WorldWideScience

Sample records for volokna pri razlichnoi

  1. VEDENJSKE MOTNJE PRI OTROCIH

    OpenAIRE

    Jaušovec, Špela

    2015-01-01

    Osnovni namen magistrskega dela je prispevati k boljšemu razumevanju motenj vedenja pri otrocih in mladostnikih ter obravnavati vpliv motenj vedenja na otrokovo funkcioniranje in vedenje. O motnjah vedenja je napisanega že veliko, še več pa ostaja neraziskanega in nerazumljenega. Magistrsko delo je zasnovano teoretično. S pomočjo strokovne literature in virov tako poskuša podrobno opredeliti motnje vedenja, njihove varovalne dejavnike in dejavnike tveganja, definirati družinsko in šolsko...

  2. Presence of pRI1:

    DEFF Research Database (Denmark)

    Migura, Lourdes Garcia; Hasman, Henrik; Jensen, Lars Bogø

    2009-01-01

    This study focused on the molecular characterization of a small cryptic, mobilizable plasmid (6038 bp) sequenced from an E. faecium 9631160-1 of poultry origin. Sequence analysis of pRI1 revealed seven open reading frames. pRI1 contained an IS 100% identical to ISEfa4. This insertion element...... almost identical to the repA from the pEFNP1 and pKQ10 plasmids from E. faecium was also identified. Presence of the pRI1 replication initiation gene (rep) was analyzed in a panel of 159 E. faecium isolates of human and animal origin from different European countries, of which 60 tested positive...... for the presence of pRI1-rep. Conjugation experiments verified transfer of the pRI1 together with conjugative plasmids harboring resistance to vancomycin and streptogramin. The presence of pRI1 in enterococcal isolates geographically separated and from different origin demonstrates the ability of enterococci...

  3. STRES IN IZGOREVANJE PRI DELU

    OpenAIRE

    Prašnikar, Maja

    2016-01-01

    Danes stres in izgorevanje predstavljata eno največjih težav, s katerimi se soočajo ljudje. Med mnogimi možnimi viri stresa so začetek šolanja, nova zaposlitev, nezaupanje vase, odnosi med sodelavci in nadrejenimi, pomembna odločanja in reševanje nujnih nalog pri delu, premeščanja itd. Ne moremo se ukvarjati z nečim, česar ne razumemo, zato je poznavanje mehanizmov stresa in izgorevanja, njihovih vzrokov in posledic ključnega pomena. Le na ta način lahko bolje razumemo in obvladujemo stre...

  4. Dejavniki stresa pri učiteljih

    OpenAIRE

    Kos, Tjaša

    2012-01-01

    Osnovni namen raziskave je bil ugotoviti, ali obstaja povezava med dejavniki zdravega načina življenja in zaznano stopnjo stresa učiteljev. Poleg tega smo želeli odkriti, ali obstaja povezanost stopnje zaznanega stresa učiteljev z njihovimi sociodemografičnimi podatki, zadovoljstvom s poklicem in s prostočasnimi dejavnostmi. Diplomsko delo je sestavljeno iz teoretičnega in empiričnega dela. V teoretičnem delu smo opredelili termin stres, pri čemer smo se bolj osredotočili na stres pri učitel...

  5. DISLEKSIJA PRI POUKU SLOVENŠČINE

    OpenAIRE

    Ciglar, Adrijana

    2012-01-01

    Disleksija je izraz, ki označuje motnje branja in pisanja. V slovenskem prostoru se vedno bolj uveljavlja ter nadomešča izraz legastenija. Disleksija ne pomeni samo težav na področju branja in pisanja, temveč gre za niz simptomov, ki se pojavljajo pri približno desetih odstotkih otrok, ki so povprečno ali nadpovprečno inteligentni. Motnjam pri branju in pisanju so pridruženi pomanjkanje pozornosti, slaba jezikovna razvitost, motnje v doživljanju časa in prostora ter slabo pomnjenje zaporedij...

  6. Deinococcus radiodurans PriA is a Pseudohelicase.

    Directory of Open Access Journals (Sweden)

    Matthew E Lopper

    Full Text Available Reactivation of repaired DNA replication forks in bacteria is catalyzed by PriA helicase. This broadly-conserved bacterial enzyme can remodel the structure of DNA at a repaired DNA replication fork by unwinding small portions of duplex DNA to prepare the fork for replisome reloading. While PriA's helicase activity is not strictly required for cell viability in E. coli, the sequence motifs that confer helicase activity upon PriA are well-conserved among sequenced bacterial priA genes, suggesting that PriA's duplex DNA unwinding activity confers a selective advantage upon cells. However, these helicase sequence motifs are not well-conserved among priA genes from the Deinococcus-Thermus phylum. Here, we show that PriA from a highly radiation-resistant member of that phylum, Deinococcus radiodurans, lacks the ability to hydrolyze ATP and unwind duplex DNA, thus qualifying D. radiodurans PriA as a pseudohelicase. Despite the lack of helicase activity, D. radiodurans PriA has retained the DNA binding activity expected of a typical PriA helicase, and we present evidence for a physical interaction between D. radiodurans PriA and its cognate replicative helicase, DnaB. This suggests that PriA has retained a role in replisome reloading onto repaired DNA replication forks in D. radiodurans despite its lack of helicase activity.

  7. Deinococcus radiodurans PriA is a Pseudohelicase.

    Science.gov (United States)

    Lopper, Matthew E; Boone, Jacob; Morrow, Christopher

    2015-01-01

    Reactivation of repaired DNA replication forks in bacteria is catalyzed by PriA helicase. This broadly-conserved bacterial enzyme can remodel the structure of DNA at a repaired DNA replication fork by unwinding small portions of duplex DNA to prepare the fork for replisome reloading. While PriA's helicase activity is not strictly required for cell viability in E. coli, the sequence motifs that confer helicase activity upon PriA are well-conserved among sequenced bacterial priA genes, suggesting that PriA's duplex DNA unwinding activity confers a selective advantage upon cells. However, these helicase sequence motifs are not well-conserved among priA genes from the Deinococcus-Thermus phylum. Here, we show that PriA from a highly radiation-resistant member of that phylum, Deinococcus radiodurans, lacks the ability to hydrolyze ATP and unwind duplex DNA, thus qualifying D. radiodurans PriA as a pseudohelicase. Despite the lack of helicase activity, D. radiodurans PriA has retained the DNA binding activity expected of a typical PriA helicase, and we present evidence for a physical interaction between D. radiodurans PriA and its cognate replicative helicase, DnaB. This suggests that PriA has retained a role in replisome reloading onto repaired DNA replication forks in D. radiodurans despite its lack of helicase activity.

  8. Remotely Sensing the Photochemical Reflectance Index (PRI)

    Science.gov (United States)

    Vanderbilt, Vern

    2015-01-01

    In remote sensing, the Photochemical Reflectance Index (PRI) provides insight into physiological processes occurring inside the leaves in a stand of plants. Developed by Gamon et al., (1990 and 1992), PRI evolved from laboratory measurements of the reflectance of individual leaves (Bilger et al.,1989). Yet in a remotely sensed image, a pixel measurement may include light from both reflecting and transmitting leaves. We conducted laboratory experiments comparing values of PRI based upon polarized reflectance and transmittance measurements of water and nutrient stressed leaves. We illuminated single detached leaves using a current controlled light source (Oriel model 66881) and measured the leaf weight using an analytical balance (Mettler model AE 260) and the light reflected and transmitted by the leaf during dry down using two Analytical Spectral Devices spectroradiometers. Polarizers on the incident and reflected light beams allowed us to divide the leaf reflectance into two parts: a polarized surface reflectance and a non-polarized 'leaf interior' reflectance. Our results underscore the importance when calculating PRI of removing the leaf surface reflection, which contains no information about physiological processes ongoing in the leaf interior. The results show that the leaf physiology information is in the leaf interior reflectance, not the leaf transmittance. Applied to a plant stand, these results suggest use of polarization measurements in sun-view directions that minimize the number of sunlit transmitting leaves in the sensor field of view.

  9. Subjektivni dejavniki odpora pri spremembah poslovnih procesov

    OpenAIRE

    Krapež, Aleš

    2016-01-01

    Uvajanje sprememb v poslovne procese vzbuja pri posameznikih različne odzive. Nekateri spremembe sprejemajo (odprtost do sprememb), drugi jim nasprotujejo (odpor do sprememb). Nasprotovanje prinaša dodaten napor, podaljša čas uvajanja sprememb in povečuje stroške. Intenzivnost nasprotovanja je lahko tako izrazita, da postane uvajanje sprememb nesmiselno. Nosilci sprememb morajo poznati subjektivne dejavnike odpora do sprememb, če ga hočejo obvladovati. V ta namen smo s pomočjo statistične ana...

  10. Evtanazija in pomoč pri samomoru

    OpenAIRE

    Valentinčič, Nataša

    2017-01-01

    V disertaciji, upoštevaje odločbe ESČP, obravnavam tri modele formalne in dejanske pravne ureditve evtanazije in pomoči pri samomoru v vzorčnih državah posameznega modela pravne ureditve. Vsi trije modeli, nizozemski, švicarski in slovenski, temeljijo na treh osnovnih načelih, in sicer na načelu svetosti življenja, na načelu avtonomije in na načelu dobrodelnosti, vendar pa gre ugotoviti, da posamezna država daje določenemu načelu večji ali manjši pomen. Nizozemski model temelji na izključ...

  11. Synthesis and Biological Activity of Diastereomeric and Geometric Analogs of Calcipotriol, PRI-2202 and PRI-2205, Against Human HL-60 Leukemia and MCF-7 Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Andrzej Kutner

    2013-10-01

    Full Text Available Diastereomeric and geometric analogs of calcipotriol, PRI-2202 and PRI-2205, were synthesized as advanced intermediates from vitamin D C-22 benzothiazoyl sulfones and side-chain aldehydes using our convergent strategy. Calcitriol, calcipotriol (PRI-2201 and tacalcitol (PRI-2191 were used as the reference compounds. Among a series of tested analogs the diastereomeric analog PRI-2202 showed the strongest antiproliferative activity on the human breast cancer cell line MCF-7, whereas the geometric analog PRI-2205 was the weakest. Both analogs were less potent in antiproliferative activity against HL-60 cells compared to the reference compounds. The ability to potentiate antiproliferative effect of cisplatin or doxorubicin against HL-60 cells or that of tamoxifen against the MCF-7 cell line was observed at higher doses of PRI-2202 or PRI-2205 than those of the reference compounds. The proapoptotic activity of tamoxifen, expressed as the diminished mitochondrial membrane potential, as well as the increased phosphatidylserine expression, was partially attenuated by calcitriol, PRI-2191, PRI-2201 and PRI-2205. The treatment of the MCF-7 cells with tamoxifen alone resulted in an increase in VDR expression. Moreover, a further increase in VDR expression was observed when the analogs PRI-2201 or PRI-2205, but not PRI-2191, were used in combination with tamoxifen. This observation could partially explain the potentiation of the antiproliferative effect of tamoxifen by vitamin D analogs.

  12. Pomen in vloga učitelja pri poučevanju otrok z disleksijo pri pouku glasbe

    OpenAIRE

    Neuvirt, Tina

    2017-01-01

    Zadnja leta so učne težave učencev aktualna tematika učiteljev, stroke in staršev. Disleksija je sicer že dobro raziskana, a ker se ta nanaša zlasti na težave z besedili, je raziskav na tovrstnem področju v povezavi s poukom glasbe občutno manj. Namen tega magistrskega dela je bil raziskati in predstaviti značilnosti, ki se pojavljajo pri učencih z disleksijo pri pouku glasbe, in na osnovi tega opredeliti vlogo učiteljev pri poučevanju otrok z disleksijo pri pouku glasbe. V metodološkem d...

  13. VPLIV IZVORA NADZOROVANJA NA NEKATERE DEJAVNIKE PRI DELU REVIZORJEV

    OpenAIRE

    Voje, Melita

    2012-01-01

    Izvor nadzorovanja (angl. Locus of Control) je psihološki pojem, ki ločuje posameznike na tiste s poudarjenim notranjim izvorom nadzorovanja – internaliste, in tiste s poudarjenim zunanjim izvorom nadzorovanja – eksternaliste. Razlika med njimi je v prepričanju, da kar se jim v življenju dogaja, je pri enih posledica njihovega lastnega napora, vloženega znanja, truda, pri drugih pa posledica sreče, usode. V drugem delu naloge smo opredelili pojem izvora nadzorovanja ter način ugotavljanja...

  14. Vpliv ukvarjanja s športom pri starših na ukvarjanje s športom pri njihovih otrocih

    OpenAIRE

    Rebernak, Urška

    2015-01-01

    V diplomski nalogi Vpliv ukvarjanja s športom pri starših na ukvarjanje s športom pri njihovih otrocih smo želeli raziskati in ugotoviti vpliv staršev, ki so bili v otroštvu in so tudi še sedaj športno aktivni (tudi v prostem času), na športno aktivnost njihovih otrok. Tako smo v teoretičnem delu s pomočjo deskriptivne metode predstavili otrokove gibalne sposobnosti in športne navade v vrtcih in šolah. Nadaljevali smo z družino, kjer smo predstavili vpliv ukvarjanja s športom pri starših ter ...

  15. Finding the SurPriSe: A Case Study of a Faculty Learning Community

    Science.gov (United States)

    Michel, Roberta M.

    2014-01-01

    This article details a faculty learning community (FLC) that started in 2009 on the campus of a Midwestern University and has evolved into an interdisciplinary research, teaching and social community of practice and learning called SurPriSe. SurPriSe is an acronym that reflects the interest area of the FLC; Sur for surveillance, Pri for privacy,…

  16. Geology of Planina pri Jezeru and its environs (Slovenia

    Directory of Open Access Journals (Sweden)

    Mihael Brenčič

    2008-06-01

    Full Text Available The article describes the results of detailed geological mapping of the wider environs of Planina pri Jezeru north of Bohinj. In the literature the Upper Triassic massive and bedded limestone, Jurassic limestone, Cretaceous clastic rocks and Pleistocene sediments have been reported in this area up to now. The article supplements existing lithostratigraphic information by defining exact locations of the Pleistocene sediments at Planina pri Jezeru and Planina v Lazu, and of Jurassic rocks. In Poljane a Neptunian dyke and bioclastic limestone, while north of Mizčna glava a flat-bedded microsparitic limestone were described for the first time.Correlation to the Triglav Lakes Valley Jurassic beds indicates equivalent facieses. Allochthon Cretaceous biocalcarenite and jasper situated east of Planina pri Jezeru are also described due to their importance for further glaciological studies. The results show that the recent lake Jezero na Planini pri Jezeru is formed due to the accumulation of Pleistocene glacial-lacustrine fine-grained sediment in till,deposited on the Dachstein limestone.

  17. VPLIVI NOVEGA KAPITALSKEGA SPORAZUMA PRI KREDITIRANJU MALIH IN SREDNJIH PODJETIJ V NOVI KBM

    OpenAIRE

    Hojs, Metka

    2009-01-01

    Podjetniki, ki so prerasli fazo ustanovitve v svojem življenjskem ciklu in so v fazi razvoja in rasti podjetja, so svoje največje težave pri poslovanju strnili v dve ključni točki. Pri širitvi poslovanja kot prvo težavo navajajo pridobitev ustreznih kadrov. Zanimivo je, da je bil v raziskavi o financiranju MSP v Sloveniji leta 2002 ta problem izpostavljen kot bolj žgoč od pričakovanega, ki bi naj bil največji pri razvoju podjetja, to je financiranje. Podjetniki so težave pri dostopu do virov ...

  18. PSIHOLOŠKI VIDIKI BARV PRI IZDELAVI LOGOTIPA

    OpenAIRE

    Bauman, Anja

    2015-01-01

    Osrednja tema diplomske naloge so psihološki vidiki barv pri izdelavi logotipa. Diplomska naloga zajema tako teoretični kot tudi empirični del. V teoretičnem delu je predstavljen logotip in njegovi kriteriji uspešnosti. Prav tako pa so predstavljene tudi barve, njeni učinki ter značilnosti. Empirični del diplomske naloge pa se ukvarja z analizo obstoječih in izdelanih logotipov.

  19. Prodifferentiation Activity of Novel Vitamin D2 Analogs PRI-1916 and PRI-1917 and Their Combinations with a Plant Polyphenol in Acute Myeloid Leukemia Cells

    Directory of Open Access Journals (Sweden)

    Matan Nachliely

    2016-07-01

    Full Text Available 1α,25-dihydroxyvitamin D3 (1,25D3 is a powerful differentiation inducer for acute myeloid leukemia (AML cells. However, 1,25D3 doses required for differentiation of AML cells may cause lethal hypercalcemia in vivo. There is evidence that vitamin D2 is less toxic than vitamin D3 in animals. Here, we determined the differentiation effects of novel analogs of 1α,25-dihydroxyvitamin D2 (1,25D2, PRI-1916 and PRI-1917, in which the extended side chains of their previously reported precursors (PRI-1906 and PRI-1907, respectively underwent further 24Z (24-cis modification. Using four human AML cell lines representing different stages of myeloid maturation (KG-1a, HL60, U937, and MOLM-13, we found that the potency of PRI-1916 was slightly higher or equal to that of PRI-1906 while PRI-1917 was significantly less potent than PRI-1907. We also demonstrated that 1,25D2 was a less effective differentiation agent than 1,25D3 in these cell lines. Irrespective of their differentiation potency, all the vitamin D2 derivatives tested were less potent than 1,25D3 in transactivating the DR3-type vitamin D response elements. However, similar to 1,25D3, both 1,25D2 and its analogs could strongly cooperate with the plant polyphenol carnosic acid in inducing cell differentiation and inhibition of G1–S cell cycle transition. These results indicate that the 24Z modification has contrasting effects on the differentiation ability of PRI-1906 and PRI-1907 and that the addition of a plant polyphenol could result in a similar extent of cell differentiation induced by different vitamin D compounds. The enhanced antileukemic effects of the tested combinations may constitute the basis for the development of novel approaches for differentiation therapy of AML.

  20. PriC-mediated DNA Replication Restart Requires PriC Complex Formation with the Single-stranded DNA-binding Protein*

    Science.gov (United States)

    Wessel, Sarah R.; Marceau, Aimee H.; Massoni, Shawn C.; Zhou, Ruobo; Ha, Taekjip; Sandler, Steven J.; Keck, James L.

    2013-01-01

    Frequent collisions between cellular DNA replication complexes (replisomes) and obstacles such as damaged DNA or frozen protein complexes make DNA replication fork progression surprisingly sporadic. These collisions can lead to the ejection of replisomes prior to completion of replication, which, if left unrepaired, results in bacterial cell death. As such, bacteria have evolved DNA replication restart mechanisms that function to reload replisomes onto abandoned DNA replication forks. Here, we define a direct interaction between PriC, a key Escherichia coli DNA replication restart protein, and the single-stranded DNA-binding protein (SSB), a protein that is ubiquitously associated with DNA replication forks. PriC/SSB complex formation requires evolutionarily conserved residues from both proteins, including a pair of Arg residues from PriC and the C terminus of SSB. In vitro, disruption of the PriC/SSB interface by sequence changes in either protein blocks the first step of DNA replication restart, reloading of the replicative DnaB helicase onto an abandoned replication fork. Consistent with the critical role of PriC/SSB complex formation in DNA replication restart, PriC variants that cannot bind SSB are non-functional in vivo. Single-molecule experiments demonstrate that PriC binding to SSB alters SSB/DNA complexes, exposing single-stranded DNA and creating a platform for other proteins to bind. These data lead to a model in which PriC interaction with SSB remodels SSB/DNA structures at abandoned DNA replication forks to create a DNA structure that is competent for DnaB loading. PMID:23629733

  1. PriC-mediated DNA replication restart requires PriC complex formation with the single-stranded DNA-binding protein.

    Science.gov (United States)

    Wessel, Sarah R; Marceau, Aimee H; Massoni, Shawn C; Zhou, Ruobo; Ha, Taekjip; Sandler, Steven J; Keck, James L

    2013-06-14

    Frequent collisions between cellular DNA replication complexes (replisomes) and obstacles such as damaged DNA or frozen protein complexes make DNA replication fork progression surprisingly sporadic. These collisions can lead to the ejection of replisomes prior to completion of replication, which, if left unrepaired, results in bacterial cell death. As such, bacteria have evolved DNA replication restart mechanisms that function to reload replisomes onto abandoned DNA replication forks. Here, we define a direct interaction between PriC, a key Escherichia coli DNA replication restart protein, and the single-stranded DNA-binding protein (SSB), a protein that is ubiquitously associated with DNA replication forks. PriC/SSB complex formation requires evolutionarily conserved residues from both proteins, including a pair of Arg residues from PriC and the C terminus of SSB. In vitro, disruption of the PriC/SSB interface by sequence changes in either protein blocks the first step of DNA replication restart, reloading of the replicative DnaB helicase onto an abandoned replication fork. Consistent with the critical role of PriC/SSB complex formation in DNA replication restart, PriC variants that cannot bind SSB are non-functional in vivo. Single-molecule experiments demonstrate that PriC binding to SSB alters SSB/DNA complexes, exposing single-stranded DNA and creating a platform for other proteins to bind. These data lead to a model in which PriC interaction with SSB remodels SSB/DNA structures at abandoned DNA replication forks to create a DNA structure that is competent for DnaB loading.

  2. IZBOLJŠAVE PRI TRŽENJU IZPOSOJE VOZIL

    OpenAIRE

    Frankič, Janja

    2012-01-01

    V pričujočem diplomskem delu smo na primeru podjetja Oskar Rent d.o.o. predstavili možne izboljšave na področju trženja storitev izposoje vozil. V prvem delu naloge smo z ugotovitvami avtorjev, njihovimi mnenji in izsledki na področju preučevanja trženja, ki so potrebni za uspešno prodajanje storitev, opredelili splošne teoretske osnove. V nadaljevanju smo diplomsko delo usmerili v praktične raziskave in predloge za izboljšave ter inovacije na področju marketinga podjetja Oskar Rent d.o.o. Ra...

  3. Mikrotoponymy of the village Ugljare near Priština

    Directory of Open Access Journals (Sweden)

    Jašović Golub M.

    2010-01-01

    Full Text Available The paper makes the analysis of micro-toponyms registered in the area of the Village of Ugljari, Serbian settlement on the riversides of the Prištevka, located within the Municipality of Kosovo Polje. Based on semantics and structure, recorded micro names of the subject settlement are classified in two groups. The first group includes micro-toponyms of appellative origin, while the other group includes micro-toponyms of anthroponymic origin. Recorded names are further classified to: micro names which have developed from other toponyms, micro-toponyms of phytonomic and zoonimic origin, while the names of foreign origin and hydro-names designating running and still water in the rural area of the place (wells, swamps, rivers, creeks are sorted out in a special group. Dictionary of micro-toponyms with around a hundred and fifty micro names is the integral part of the Paper.

  4. Prednosti metode Montessori pri obravnavi oseb z demenco

    Directory of Open Access Journals (Sweden)

    Andreja Ljubič

    2017-03-01

    Full Text Available Uvod: Demenca je kronično obolenje s tendenco upadanja kognitivnih sposobnosti obolelega. Uporaba metod za obvladovanje in trening osnovnih življenjskih aktivnosti, ki omogočajo daljše obdobje samostojnega življenja pacienta z demenco, je v tujini uveljavljena z različnimi novejšimi koomplementarnimi pristopi. Ena izmed uveljavljenih metod je pristop Marie Montessori, prilagojen odraslim pacientom z demenco. V članku je predstavljena metoda montessori pri obravnavi pacienta z demenco in njeni učinki na kakovost življenja pacienta z demenco. Metode: Uporabljena je bila deskriptivna raziskovalna metodologija s pregledom domače in tuje literature. Za prikaz pregleda petih preko spleta dostopnih podatkovnih baz in odločanja o uporabnosti pregledanih virov je bila uporabljena metoda PRISMA. V končni pregled literature je bilo ključenih 19 člankov, objavljenih do maja 2016. Za obdelavo podatkov je bil uporabljen model analize konceptov. Večina zajetih raziskav je bila izvedena v Združenih državah Amerike. Rezultati: Po pregledu raziskav so bila identificirana tri tematska področja: (1 vpliv metode montessori na sodelovanje in prizadevanje, (2 vpliv metode montessori na vedenje, povezano s hranjenjem, in (3 vpliv metode montessori na širšo skupino kognitivnih sposobnosti. Diskusija in zaključek: Kljub majhnemu številu člankov, ki opisujejo uporabo metode montessori pri obravnavi pacientov z demenco, metodo lahko predstavimo kot učinkovito. Avtorji raziskav ugotavljajo, da pristop ne le omogoča ohranjanje kognitivnih sposobnosti, temveč le-te celo izboljšuje.

  5. Restart of DNA replication in Gram-positive bacteria: functional characterisation of the Bacillus subtilis PriA initiator

    Science.gov (United States)

    Polard, Patrice; Marsin, Stéphanie; McGovern, Stephen; Velten, Marion; Wigley, Dale B.; Ehrlich, S. Dusko; Bruand, Claude

    2002-01-01

    The PriA protein was identified in Escherichia coli as a factor involved in the replication of extrachromosomal elements such as bacteriophage φX174 and plasmid pBR322. Recent data show that PriA plays an important role in chromosomal replication, by promoting reassembly of the replication machinery during reinitiation of inactivated forks. A gene encoding a product 32% identical to the E.coli PriA protein has been identified in Bacillus subtilis. To characterise this protein, designated PriABs, we constructed priABs mutants. These mutants are poorly viable, filamentous and sensitive to rich medium and UV irradiation. Replication of pAMβ1-type plasmids, which is initiated through the formation of a D-loop structure, and the activity of the primosome assembly site ssiA of plasmid pAMβ1 are strongly affected in the mutants. The purified PriABs protein binds preferentially to the active strand of ssiA, even in the presence of B.subtilis SSB protein (SSBBs). PriABs also binds stably and specifically to an artificial D-loop structure in vitro. These data show that PriABs recognises two specific substrates, ssiA and D-loops, and suggest that it triggers primosome assembly on them. PriABs also displays a single-stranded DNA-dependent ATPase activity, which is reduced in the presence of SSBBs, unless the ssiA sequence is present on the ssDNA substrate. Finally, PriABs is shown to be an active helicase. Altogether, these results demonstrate a clear functional identity between PriAEc and PriABs. However, PriABs does not complement an E.coli priA null mutant strain. This host specificity may be due to the divergence between the proteins composing the E.coli and B.subtilis PriA-dependent primosomes. PMID:11917020

  6. RAČUNOVODSKE INFORMACIJE PRI UPRAVLJANJU ČLOVEŠKIH VIROV V PODJETJU X

    OpenAIRE

    Pihler, Petra

    2012-01-01

    V diplomski nalogi je predstavljeno upravljanje človeških virov in računovodske informacije o le teh. Opredelili smo informacije nasploh in računovodske informacije, ki jih potrebujemo pri odločitvah o človeških virih. Od vsakega podjetja je odvisno ali bo pri različnih nalogah upravljanja človeških virov uporabil računovodske informacije. Pri vseh nalogah upravljanja človeških virov so uporabne računovodske informacije, odvisno od velikosti in razširjenosti upravljanja človeških virov v...

  7. Sezonska nihanja vitamina D pri nosečnicah in novorojenčkih v mariborski regiji

    OpenAIRE

    Dovnik, Andraž

    2017-01-01

    Izhodišča: Vitamin D je v maščobah topen vitamin, katerega pomanjkanje v nosečnosti povezujejo z različnimi zapleti v nosečnosti in boleznimi pri novorojenčku. V mariborski regiji še ni bilo raziskave, ki bi ugotavljala koncentracijo vitamina D pri nosečnicah in novorojenčkih. Namen raziskave je bil ugotoviti povprečne koncentracije vitamina D pri nosečnicah in novorojenčkih, pogostnost pomanjkanja vitamina D, dejavnike, ki vplivajo na koncentracjo vitamina D pri nosečnicah in novorojenčkih, ...

  8. Diurnal and Directional Responses of Chlorophyll Fluorescence and the PRI in a Cornfield

    Science.gov (United States)

    Middleton, Elizabeth; Cheng, Y. B.; Corp, L.; Campbell, P.; Kustas, W.

    2010-01-01

    Determining the health and vigor of vegetation using high spectral resolution remote sensing is an important goal which has application to monitoring agriculture and ecosystem productivity and carbon exchange. Two spectral indices used to assess whether vegetation is performing near-optimally or exhibiting symptoms of environmental stress (e.g., drought or nutrient deficiency, non-optimal temperatures, etc.) are the Photochemical Reflectance Index (PRI) and solar-induced red and far-red Chlorophyll Fluorescence (Fs). Both the PRI and Fs capture the dynamics of photoprotection mechanisms within green foliage: the PRI is based on the association of the reflected radiation in the green spectrum with the xanthophyll cycle, whereas Fs measures the emitted radiation in the red and far-red spectrum. Fs was determined from retrievals in the atmospheric oxygen absorption features centered at 688 and 760 nm using a modified Fraunhofer Line Depth (FLD) method. We previously demonstrated diurnal and seasonal PRI differences for sunlit vs. shaded foliage in a conifer forest canopy, as expressed in the hotspot and darkspot of the Bidirectional Reflectance Function (BRF). In a USDA-ARS experimental field site located in Beltsville, MD, USA, measurements were acquired over a corn crop from a nadir view in 2008 with an ASD FieldSpec Pro (Analytical Spectral Devices, Inc., Boulder, CO, USA) to study the behavior of the PRI for sunlit and shaded foliage as captured in reflectance variations associated with the BRF, in a I m tall canopy in the vegetative growth stage. Those observations were compared to simulations obtained from two radiative transfer models. Measurements were then acquired to examine whether the PRI and Fs were influenced by view zenith and azimuth geometries at different times of day. Those measurements were made in 2010 with the Ocean Optics USB4000 Miniature Fiber Optic Spectrometer (Ocean Optics Inc., Dunedin, Florida, USA) at several times during the day on

  9. Spectral Similarity and PRI Variations for a Boreal Forest Stand Using Multi-angular Airborne Imagery

    Directory of Open Access Journals (Sweden)

    Vincent Markiet

    2017-09-01

    Full Text Available The photochemical reflectance index (PRI is a proxy for light use efficiency (LUE, and is used in remote sensing to measure plant stress and photosynthetic downregulation in plant canopies. It is known to depend on local light conditions within a canopy indicating non-photosynthetic quenching of incident radiation. Additionally, when measured from a distance, canopy PRI depends on shadow fraction—the fraction of shaded foliage in the instantaneous field of view of the sensor—due to observation geometry. Our aim is to quantify the extent to which sunlit fraction alone can describe variations in PRI so that it would be possible to correct for its variation and identify other possible factors affecting the PRI–sunlit fraction relationship. We used a high spatial and spectral resolution Aisa Eagle airborne imaging spectrometer above a boreal Scots pine site in Finland (Hyytiälä forest research station, 61°50′N, 24°17′E, with the sensor looking in nadir and tilted (off-nadir directions. The spectral resolution of the data was 4.6 nm, and the spatial resolution was 0.6 m. We compared the PRI for three different scatter angles ( β = 19 ° , 55 ° and 76 °, defined as the angle between sensor and solar directions at the forest stand level, and observed a small (0.006 but statistically significant (p < 0.01 difference in stand PRI. We found that stand mean PRI was not a direct function of sunlit fraction. However, for each scatter angle separately, we found a clear non-linear relationship between PRI and sunlit fraction. The relationship was systematic and had a similar shape for all of the scatter angles. As the PRI–sunlit fraction curves for the different scatter angles were shifted with respect to each other, no universal curve could be found causing the observed independence of canopy PRI from the average sunlit fraction of each view direction. We found the shifts of the curves to be related to a leaf structural effect on canopy

  10. A MAC scheme of HORNET based on PRI and node structure with variable optical buffer

    Science.gov (United States)

    Fang, Nian; Wang, Lutang; Huang, Zhaoming

    2004-04-01

    A MAC scheme of HORNET based on PRI and node structure with variable optical buffer is reported. When collision is detected in an AP, PRI of this coming packet is compared with that of the packet being transmitted, if priority of the former is low, it will be routed into a variable optical buffer to loop for the latter. If its priority is high, the buffer will be closed, and the coming packet will be transmitted undisturbedly. On the other hand, the packet being transmitted is terminated, and the transmitter sends out a jamming signal. The downstream AP recognizes the incomplete packet by the presence of the jamming signal and pulls it off the ring. The AP can reschedule the transmission of the packet for a later time. Thus it can be ensured that the packet with high PRI will be transmitted first when conflict emerges.

  11. Uporaba novih medijev pri poučevanju prostorskega oblikovanja v osnovni šoli

    OpenAIRE

    Žbona, Tilen

    2017-01-01

    V disertaciji je obravnavana uporaba novomedijskega učnega pripomočka pri reševanju likovnih nalog na področju prostorskega oblikovanja oziroma arhitekture. Novi mediji omogočajo učencu celovit vpogled v prostorsko oblikovanje in arhitekturo, saj učenec lahko ob ugotavljanju sorazmerij in odnosov med različnimi likovnimi elementi posega v časovno premico ter odnos velikosti in oblik. Namen raziskave je bil preizkusiti inovativen novomedijski sistem pri pouku likovne umetnosti v 8. razredu ...

  12. PREVERJANJE ZNANJA PRI LIKOVNI VZGOJI NA PODROČJU PROSTORSKEGA OBLIKOVANJA

    OpenAIRE

    Mihelin, Andreja

    2010-01-01

    V osnovnih šolah se znanje preverja z namenom, da lahko učitelj spremlja napredek učencev in ugotovi, ali so učenci osvojili podano učno vsebino. Ugotovimo lahko tudi, če so učni programi prilagojeni zmogljivosti učencev. Znanje se preverja pri vseh predmetih, zato likovna vzgoja ni izjema. Osredotočili smo se na področje prostorskega oblikovanja, ki je eno izmed petih področij pri predmetu likovna vzgoja. Glavni namen diplomske naloge je bil sestaviti banko testnih nalog za področje prostors...

  13. Razumevanje difuzije in osmoze pri bodočih profesorjih biologija

    OpenAIRE

    Slanc, Ana

    2017-01-01

    Difuzija in osmoza sta pomembna koncepta za razumevanje bioloških, kemijskih in fizikalnih procesov ter se pojavljata tako pri pouku v osnovni šoli, kot v vsakdanjem življenju. Z analizo učnih načrtov naravoslovnih predmetov v osnovni šoli smo ugotovili, da sta koncepta difuzije in osmoze posredno ali neposredno prisotna v učnih načrtih od prvega do devetega razreda. Ravno zato je pomembno, da bodoči učitelji dobro razumejo oba pojma, saj s tem omogočajo boljše razumevanje pri učencih. V m...

  14. Vključitev elementov joge pri predmetu šport

    OpenAIRE

    Ribič Strmečki, Urška

    2016-01-01

    V diplomskem delu z naslovom »Vključitev elementov joge pri predmetu šport« je najprej predstavljen pomen športa za zdrav razvoj otrok ter v okviru tega prikazana pomembnost pridobivanja in vzdrževanja gibljivosti. Sledi vpogled v pouk športa v osnovni šoli, pri čemer so izpostavljene aktivnosti, povezane z gibljivostjo. Predstavljena je tudi joga kot vadbena tehnika s svojimi pozitivnimi učinki na celostni razvoj posameznika. V drugem delu diplomskega dela so predstavljene predvsem možnosti ...

  15. Varovanje/zaščita podatkov pri e-poslovanju

    OpenAIRE

    Pukšič, Marko

    2012-01-01

    V magistrski nalogi smo želeli predstaviti problematiko varovanja/zaščite podatkov pri e-poslovanju v zasebnih in javnih organizacijah, ter opisati metode in mehanizme za zaščito podatkov, ki jih organizacije pri tem uporabljajo. Zanimala nas je tudi pravna ureditev e-poslovanja v Republiki Sloveniji in ali le-to organizacije izvajajo v praksi. Osnovni namen magistrskega dela je bil dokazati, da organizacije e-poslujejo, ter da za svoje poslovanje z elektronskimi podatki uporabljajo kakrš...

  16. PRAVICE IN OBVEZNOSTI BANK PRI UNOVČENJU IN IZDAJI BANČNIH GARANCIJ

    OpenAIRE

    Vesenjak, Maja

    2016-01-01

    Magistrska naloga Pravice in obveznosti bank pri izdaji in unovčenju bančne garancije obravnava posamezna vprašanja o bančnih garancijah. Obravnava predvsem vprašanja, ki so povezana z izdajateljem bančne garancije. V Sloveniji in tudi po svetu so to najpogosteje banke. Za raziskavo te teme sem se odločila, ker sem zaposlena v banki in sem se pri delu pogosto srečala s problematiko bančnih garancij. V vrsti sporov v zvezi z bančnimi garancijami sem banko zastopala pred sodiščem. V nalogi p...

  17. POMEN BARV V RAZLIČNIH KULTURAH IN NJIHOVA VLOGA PRI OBLIKOVANJU IDENTITETE MESTA

    OpenAIRE

    Ditmajer, Mihela

    2016-01-01

    V današnjem svetu je vizualna podoba zelo pomembna na vseh področjih. Barve so atribut, ki je pri vizualni podobi zelo pomemben, vendar pa se pomeni barv v različnih kulturah razlikujejo med sabo. Blagovne znamke tako tekmujemo med sabo, katera bo bolj prepoznavna in uspešna na trgu. Ta trend se je prenesel tudi na mesta in oblikovanje njihove identitete. Znamčenje mest je postalo zelo pomembno, pomembna pa je tudi uporaba barv pri znamčenju mest, saj se njihovi pomeni na različnih koncih sve...

  18. PriFi - Using a Multiple Alignment of Related Sequences to Find Primers for  Amplification of Homologs

    DEFF Research Database (Denmark)

    Fredslund, Jakob; Schauser, Leif; Madsen, Lene Heegaard

    2005-01-01

    Using a comparative approach, the web program PriFi (http://cgi-www.daimi.au.dk/cgi-chili/PriFi/main) designs pairs of primers useful for PCR amplification of genomic DNA in species where prior sequence information is not available. The program works with an alignment of DNA sequences from...

  19. Regulation of pri-microRNA BIC transcription and processing in Burkitt lymphoma

    NARCIS (Netherlands)

    Kluiver, J.; van den Berg, Anke; de Jong, Doetje; Blokzijl, T.; Harms, G.; Bouwman, E.; Jacobs, Susan; Poppema, Sibrand; Kroesen, Bart-Jan

    2007-01-01

    BIC is a primary microRNA (pri-miR-155) that can be processed to mature miR-155. In this study, we show the crucial involvement of protein kinase C (PKC) and nuclear factor-kappa B (NF-kappa B) in the regulation of BIC expression upon B-cell receptor triggering. Surprisingly, Northern blot analysis

  20. Ustvarjalni potencial pri prepoznanih nadarjenih učencih v drugem triletju osnovne šole

    OpenAIRE

    Kavčič, Manca

    2017-01-01

    Namen magistrskega dela je preizkus uporabe EPoC testa za oceno ustvarjalnega potenciala v slovenski osnovni šoli in ugotavljanje morebitnega doprinosa EPoC testa k nadaljnjemu ugotavljanju ustvarjalnega potenciala in prepoznavanju nadarjenih učencev pri vsakodnevnem delu učiteljev v slovenskem vzgojno-izobraževalnem prostoru. V teoretičnem delu je skozi spoznanja različnih avtorjev predstavljen pojem ustvarjalnosti, merjenje ustvarjalnosti, odnos med ustvarjalnostjo in nadarjenostjo in vpliv...

  1. Priča o izbjegličkoj krizi u Europi kroz objektiv kartografije

    Directory of Open Access Journals (Sweden)

    Ana Kuveždić Divjak

    2016-06-01

    multimedijsku priču o sirijskoj izbjegličkoj krizi u Europi (www.geof.unizg.hr/~akuvezdic/MultimediaCartographyCourse2016.html. Multimedijski prikaz izrađen je u ljetnom semestru u ak. god. 2015/16. kao zadatak na vježbama u sklopu kojeg su studenti trebali proizvoljno izabrati temu koju će vizualizirati u multimedijskom okruženju s ciljem istraživanja mogućnosti i sastavnih dijelova multimedijske karte.

  2. Optimizacija enodimenzionalnega razreza z uporabnim ostankom pri zaporednih naročilih

    Directory of Open Access Journals (Sweden)

    Miro Gradišar

    2014-06-01

    Full Text Available V članku je predstavljena metoda za reševanje problema enodimenzionalnega razreza z uporabnimi ostanki (1DCSPUL; angl. One-dimensional Cutting Stock Problem with Usable Leftovers, kjer se lahko ostanki trenutnega naročila uporabijo v prihodnosti, če so daljši ali enaki meji t. Krajši ostanki predstavljajo izgubo. Metoda obravnava problem določanja t. Pri nižjem t se na zalogi proizvede večje število uporabnih ostankov (UL; angl. Usable Leftovers, izguba materiala pri prihodnjih naročilih pa se posledično poveča. Predlagana metoda TOP-ECOLA je sestavljena iz dveh algoritmov; TOP in ECOLA. TOP izračuna optimalen t in optimalno število UL na zalogi. ECOLA minimizira izgubo materiala in ohranja optimalno raven UL. Metoda je preizkušena z uporabo računalniških simulacij, kjer so UL prejšnjih naročil uporabljeni v naslednjem naročilu, namesto da bi bili ustvarjeni naključno. Dobljeni rezultati kažejo, da TOP-ECOLA zmanjšuje izgubo materiala pri zaporednih naročilih in preprečuje nenadzorovano rast UL na zalogi.

  3. Photochemical Reflectance Index (PRI) as a proxy of Light Use Efficiency (LUE) and transpiration in Mediterranean crop sites

    Science.gov (United States)

    LE Dantec, V.; Chebbi, W.; Boulet, G.; Merlin, O.; Lili-Chabaane, Z.; Er Raki, S.; Ceschia, E.; Khabba, S.; Fanise, P.; Zawilski, B.; Simonneaux, V.; Jarlan, L.

    2016-12-01

    The Photochemical Reflectance Index (PRI) is based on the short term reversible xanthophyll pigment changes accompanying plant stress and therefore of the associated photosynthetic activities. Strong relationships between PRI and Light Use Efficiency (LUE) were shown at leaf and canopy scales and over a wide range of species (Garbulsky et al., 2011). But very few previous works have explored the potential link with plant water status. In this study, we have first analyzed the link between PRI and LUE at canopy scale on two different crops in terms of canopy structure and crop management: olive grove (Tunisia) and wheat grown under different water regimes (irrigated or rainfed) and climate zones (France, Morocco). We have investigated the daily and seasonal dynamics of PRI; linking its variations to meteorological factors (global radiation and sun angle effects, soil water content, relative air humidity …) and plant processes. The highest correlations were mainly observed in clear skies conditions. We have found, whatever site, linear negative relationships between PRI and LUE using data acquired in midday (i.e. in solar zenithal angle condition). Linear link between PRI and sapflow measurements was also revealed. This correlation was obtained over periods characterized by a moderate soil water deficit, i.e. by when transpiration rate was mainly control by Vapor Pressure Deficit. We will then briefly presented alternative and complementary approaches to this index, to detect different level of water stress using thermal infrared emissions.

  4. Uporaba grafološke analize pri opravljanju detektivske dejavnosti : diplomsko delo visokošolskega strokovnega študija Varnost in policijsko delo

    OpenAIRE

    Gosnik, Alenka

    2014-01-01

    V tujini se grafologija oziroma grafološka analiza pisave pojavlja kot pomoč skoraj na vseh področjih človekovega delovanja pri zaposlovanju, pri osebnostnem profiliranju, pri odločanju glede izbire poklica, pri ugotavljanju piscev strupenega peresa in tako naprej. Lahko bi dejali, da se je medtem v Sloveniji začela grafologija intenzivneje pojavljati v zadnjih letih. Podali smo nekaj predlogov, kako bi lahko bila grafološka analiza v pomoč detektivom. Eden izmed predlogov je bil, da bi lahko...

  5. Prion-like nanofibrils of small molecules (PriSM): A new frontier at the intersection of supramolecular chemistry and cell biology.

    Science.gov (United States)

    Zhou, Jie; Du, Xuewen; Xu, Bing

    2015-01-01

    Formed by non-covalent interactions and not defined at genetic level, the assemblies of small molecules in biology are complicated and less explored. A common morphology of the supramolecular assemblies of small molecules is nanofibrils, which coincidentally resembles the nanofibrils formed by proteins such as prions. So these supramolecular assemblies are termed as prion-like nanofibrils of small molecules (PriSM). Emerging evidence from several unrelated fields over the past decade implies the significance of PriSM in biology and medicine. This perspective aims to highlight some recent advances of the research on PriSM. This paper starts with description of the intriguing similarities between PriSM and prions, discusses the paradoxical features of PriSM, introduces the methods for elucidating the biological functions of PriSM, illustrates several examples of beneficial aspects of PriSM, and finishes with the promises and current challenges in the research of PriSM. We anticipate that the research of PriSM will contribute to the fundamental understanding at the intersection of supramolecular chemistry and cell biology and ultimately lead to a new paradigm of molecular (or supramolecular) therapeutics for biomedicine.

  6. The crystal structure of Neisseria gonorrhoeae PriB reveals mechanistic differences among bacterial DNA replication restart pathways

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Jinlan; George, Nicholas P.; Duckett, Katrina L.; DeBeer, Madeleine A.P.; Lopper, Matthew E. (UDRI); (UW-MED)

    2010-05-25

    Reactivation of repaired DNA replication forks is essential for complete duplication of bacterial genomes. However, not all bacteria encode homologs of the well-studied Escherichia coli DNA replication restart primosome proteins, suggesting that there might be distinct mechanistic differences among DNA replication restart pathways in diverse bacteria. Since reactivation of repaired DNA replication forks requires coordinated DNA and protein binding by DNA replication restart primosome proteins, we determined the crystal structure of Neisseria gonorrhoeae PriB at 2.7 {angstrom} resolution and investigated its ability to physically interact with DNA and PriA helicase. Comparison of the crystal structures of PriB from N. gonorrhoeae and E. coli reveals a well-conserved homodimeric structure consisting of two oligosaccharide/oligonucleotide-binding (OB) folds. In spite of their overall structural similarity, there is significant species variation in the type and distribution of surface amino acid residues. This correlates with striking differences in the affinity with which each PriB homolog binds single-stranded DNA and PriA helicase. These results provide evidence that mechanisms of DNA replication restart are not identical across diverse species and that these pathways have likely become specialized to meet the needs of individual organisms.

  7. Lajšanje bolečine pri otroku z glasbo

    OpenAIRE

    Valič, Stanka

    2017-01-01

    Uvod: Ko govorimo o bolezni in z boleznijo povezanimi čustvenimi odzivi na bolečino, so otroci ena izmed najbolj občutljivih skupin, za katere je potrebno narediti vse, da jim okrevanje ne bo pustilo travmatičnih izkušenj. Bolni otroci so pogosto izpostavljeni invazivnim medicinskim postopkom, ki lahko povzročijo bolečino, strah, stres in tesnobo. Glasba in glasbena terapija sta dve izmed mnogih nefarmakoloških oblik lajšanja teh težav pri otrocih. Namen: Namen diplomskega dela je raziskati,...

  8. Poljudna literatura kot pomoč staršem pri vzgoji otrok

    OpenAIRE

    Kurtović, Husmira

    2017-01-01

    Diplomska naloga obravnava poljudno literaturo kot pomoč staršem pri vzgoji otrok. Najprej predstavim pojmovanje otroka in otroštva skozi zgodovino, družbene spremembe, vzgojne stile v družinah. Omenim tudi avtoriteto v vzgoji, ki se različno odraža v vzgojnih stilih in je povezana z vzgojo, saj si brez nje ne moremo predstavljati vzgojnih učinkov. V nadaljevanju opredelim tudi pojem patološki narcis, nekaj pozornosti pa namenim tudi pretirani skrbi za otroka oz. paranoičnem starševstvu. Na k...

  9. Enfermedades priónicas: riesgos y medidas preventivas en Odontología

    OpenAIRE

    Dardanelli, Y.; Luque, W.

    2015-01-01

    El objetivo del presente trabajo es hacer una revisión de los últimos trabajos de investigación sobre las enfermedades priónicas para poder actualizar y transmitir información sobre las medidas de prevención y bioseguridad de estos agentes infecciosos no convencionales. Los priones son glucoproteínas situadas en las superficies celulares. Las versiones modificadas de los priones normales ocasionan enfermedades de progresión lenta, a menudo mortales del sistema nervioso central, una de las más...

  10. Explaining the variability of Photochemical Reflectance Index (PRI): deconvolution of variability related to Light Use Efficiency and Canopy attributes.

    Science.gov (United States)

    Merlier, Elodie; Hmimina, Gabriel; Dufrêne, Eric; Soudani, Kamel

    2014-05-01

    The Photochemical Reflectance Index (PRI) was designed as a proxy of the state of xanthophyll cycle which is used as a response of plants to excess of light (Gamon et al., 1990; 1992). Strong relationships between PRI and LUE were shown at leaf and canopy scales and over a wide range of species (Garbulsky et al., 2011). However, its use at canopy scale was shown to be significantly hampered by effects of confounding factors such as the PRI sensitivity to leaf pigment content (Gamon et al. 2001; Nakaji et al. 2006) and to canopy structure (Hilker et al. 2008). Several approaches aimed at correcting such effects and recent works focused on the deconvolution of LUE related and LUE unrelated PRI variability (Rahimzadeh-Bajgiran et al. 2012).In this study, the PRI variability at canopy scale is investigated over two years on three species (Fagus sylvatica, Quercus robur and Pinus sylvestris) growing under two water regimes. At daily scale, PRI variability is mainly explained by radiation conditions. As already reported at leaf scale in Hmimina et al. (2014), analysis of PRI responses to incoming photosynthetically active radiation over seasonal scale allowed to separate two sources of variability : a constitutive variability mainly related to canopy structure and leaf chlorophyll content and a facultative variability mainly related to LUE and soil moisture content. These results highlight the composite nature of PRI signal measured at canopy scale and the importance of disentangling its sources of variability in order to accurately assess ecosystem light use efficiency. Gamon JA, Field CB, Bilger W, Björkman O, Fredeen AL, Peñuelas J. 1990. Remote sensing of the xanthophyll cycle and chlorophyll fluorescence in sunflower leaves and canopies. Oecologia 85, 1-7. Gamon JA, Field CB, Fredeen A AL, Thayer S. 2001. Assessing photosynthetic downregulation in sunflower stands with an optically-based model. Photosynthesis Research 67, 113-125. Gamon JA, Peñuelas J, Field CB

  11. PRiMeUM: A Model for Predicting Risk of Metastasis in Uveal Melanoma.

    Science.gov (United States)

    Vaquero-Garcia, Jorge; Lalonde, Emilie; Ewens, Kathryn G; Ebrahimzadeh, Jessica; Richard-Yutz, Jennifer; Shields, Carol L; Barrera, Alejandro; Green, Christopher J; Barash, Yoseph; Ganguly, Arupa

    2017-08-01

    To create an interactive web-based tool for the Prediction of Risk of Metastasis in Uveal Melanoma (PRiMeUM) that can provide a personalized risk estimate of developing metastases within 48 months of primary uveal melanoma (UM) treatment. The model utilizes routinely collected clinical and tumor characteristics on 1227 UM, with the option of including chromosome information when available. Using a cohort of 1227 UM cases, Cox proportional hazard modeling was used to assess significant predictors of metastasis including clinical and chromosomal characteristics. A multivariate model to predict risk of metastasis was evaluated using machine learning methods including logistic regression, decision trees, survival random forest, and survival-based regression models. Based on cross-validation results, a logistic regression classifier was developed to compute an individualized risk of metastasis based on clinical and chromosomal information. The PRiMeUM model provides prognostic information for personalized risk of metastasis in UM. The accuracy of the risk prediction ranged between 80% (using chromosomal features only), 83% using clinical features only (age, sex, tumor location, and size), and 85% (clinical and chromosomal information). Kaplan-Meier analysis showed these risk scores to be highly predictive of metastasis (P metastasis based on their individual and tumor characteristics. It will aid physicians with decisions concerning frequency of systemic surveillance and can be used as a criterion for entering clinical trials for adjuvant therapies.

  12. Recomposiciones: el PRI de la primera década del milenio

    Directory of Open Access Journals (Sweden)

    Rosa María Mirón-Lince

    2012-01-01

    Full Text Available Al priísmo del nacionalismo revolucionario, de los consensos forzados y la fundación institucional del México moderno, hoy le prosigue un partido de prácticas arraigadas al control, en el que sin el viejo referente de un jefe máximo encarnado por la figura presidencial, nuevos liderazgos han tenido que tomar la batuta. La recomposición de los flancos de orden y la obligada dispersión del poder al interior y al exterior del partido tricolor, ahora se suma indudablemente a la multiplicación de los epicentros y plataformas desde donde se ejerce el poder. De tal manera, este texto tiene el propósito de situar algunos de los cambios torales del PRI centrándose de forma particular en: 1 el tránsito institucional hacia el fortalecimiento de un marco partidista de mayor apertura y transversalidad; 2 el ascenso de los mandatarios locales como bastiones de la toma de decisiones al interior del partido; y 3 los reacomodos vinculados directamente con el uso táctico de los espacios parlamentarios.

  13. Remote sensing of plant emissions of volatile isoprenoids with PRI. Prospects for upscaling (Invited)

    Science.gov (United States)

    Penuelas, J.

    2013-12-01

    Josep Peñuelas*1,2, Giovanni Marino1,2,3,4, Joan LLusia1,2, Catherine Morfopoulos1,2,5, Gerard Farre-Armengol1,2, Shawn Kefauver, Alex Guenther6 , Francesca Rapparini7 , Roger Seco1,2,6, Marc Estiarte1,2, Mónica Mejia-Chang1,2, Romà Ogaya1,2, Jordi Sardans1,2 , Andrew Turnipseed6, Peter Harley6, Osvaldo Facini7, Rita Baraldi7, Jim Greenberg6 , Iolanda Filella1,2 1 CSIC, Global Ecology Unit CREAF-CEAB-UAB, Cerdanyola del Vallés 08193, Catalonia, Spain 2 CREAF, Cerdanyola del Vallés 08193, Catalonia, Spain 3 Dipartimento di Bioscienze e Territorio, Università degli Studi del Molise, Contrada Fonte Lappone, 86090 Pesche (IS), Italy 4 Institute for Plant Protection, National Research Council, Via Madonna del Piano 10, 50019 Sesto Fiorentino (FI), Italy 5 Division of Ecology and Evolution, Imperial College, Silwood Park, Ascot, SL5 7PY, UK 6 Atmospheric Chemistry Division, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307-3000, USA 7 Biometeorology Institute, IBIMET-CNR, Via P. Gobetti 101, Bologna, Italy Abstract Terrestrial plants re-emit around 1-2% of the carbon they fix as isoprene and monoterpenes. These emissions play major roles in the ecological relationships among living organisms and in atmospheric chemistry and climate, and yet their actual quantification at the ecosystem level in different regions is far from being resolved. Phenomenological models are used to estimate the emission rates, but the limited understanding of the function and regulation of these emissions leads to large uncertainties in such estimations. Many measurements have been made at the foliar but few at the ecosystem level, and those that do exist are limited in space and time. We here provide evidence that a simple remote sensing index, the photochemical reflectance index (PRI), which is indicative of light use efficiency (LUE), is a good indirect estimator of foliar isoprenoid emissions and therefore can be used to sense them remotely. These results open

  14. Planerski in urbanistični projekti – neavtorski pristop in vprašanje sinergije pri sodelovanju

    Directory of Open Access Journals (Sweden)

    Liljana Jankovič Grobelšek

    2005-01-01

    Full Text Available V prispevku je predstavljen pogled na neavtorski pristop pri urbanističnih in planerskih projektih. Vodja projekta vodi celotno delovno skupino, vendar so pomembni tudi koordinatorji vseh sodelujočih, medtem ko je samo avtorstvo pri prostorskem načrtovanju (v nasprotju z avtorstvom pri arhitekturnem projektiranju mnogokrat ali celo vedno povsem deljeno. Ne samo zato, ker se lahko prostorski projekti skozi postopke sprejemanja precej spremenijo, ampak tudi zato, ker je k sodelovanju pritegnjenih veliko akterjev (projektanti, naročniki in/ali investitorji itn., ki prispevajo k projektu in ga sooblikujejo. Neavtorski pristop je po izkušnjah osnova za dobro vodenje projekta, za ustvarjanje pogojev za konstruktivno sodelovanje interdisciplinarne delovne skupine in vseh preostalih sodelujočih pri projektu. Predstavljena sta dva konkretna primera. Posebno zanimiva je njuna primerjava, saj je v prvem primeru projekt zaradi dobrega sodelovanja med naročniki, investitorji in projektanti ter zaradi kooperativne zainteresirane javnosti pridobil kakovost, v drugem pa je (zaradi in tudi na škodo javnosti precej izgubil. Za tolikokrat omenjeno nujnost participacije javnosti v projektih ocenjujemo, da je je pravzaprav dovolj. Za sodelovanje javnosti v urbanističnih in planerskih projektih ni ovir, če le javnost pokaže interes. Problem je pogosto na drugi strani – kako pred eno javnostjo (npr. sosedje, neposredno prizadeti zavarovati skupni, javni interes.

  15. The Escherichia coli Clamp Loader Can Actively Pry Open the β-Sliding Clamp*

    Science.gov (United States)

    Paschall, Christopher O.; Thompson, Jennifer A.; Marzahn, Melissa R.; Chiraniya, Ankita; Hayner, Jaclyn N.; O'Donnell, Mike; Robbins, Arthur H.; McKenna, Robert; Bloom, Linda B.

    2011-01-01

    Clamp loaders load ring-shaped sliding clamps onto DNA. Once loaded onto DNA, sliding clamps bind to DNA polymerases to increase the processivity of DNA synthesis. To load clamps onto DNA, an open clamp loader-clamp complex must form. An unresolved question is whether clamp loaders capture clamps that have transiently opened or whether clamp loaders bind closed clamps and actively open clamps. A simple fluorescence-based clamp opening assay was developed to address this question and to determine how ATP binding contributes to clamp opening. A direct comparison of real time binding and opening reactions revealed that the Escherichia coli γ complex binds β first and then opens the clamp. Mutation of conserved “arginine fingers” in the γ complex that interact with bound ATP decreased clamp opening activity showing that arginine fingers make an important contribution to the ATP-induced conformational changes that allow the clamp loader to pry open the clamp. PMID:21971175

  16. Vloga samospoštovanja pri razvijanju izobraževalne poti

    Directory of Open Access Journals (Sweden)

    Petra Stepišek

    2003-12-01

    Full Text Available Avtorica v članku teoreticno opredeljuje in isce povezavo med osebnimi vzgibi na ravni samospostovanja pri razvijanju izobrazevalne poti posameznika. Izobrazevanje povzroci rekonstrukcijo posameznikove identitete, zaradi cesar je pricakovati, daje tudi dosezena stopnja izobrazbe eden izmed dejavnikov, ki vplivajo na posameznikovo samospostovanje in obratno. Prikazuje razlicne motive za razvoj izobrazevalne poti odraslih. Le-ti so razlicni: zajemajo spodbude, zelje, interese in potrebe. Ugotavlja, da so povezani z motivacijo, predstavo o sebi, svojih socialnih vlogah in z druzbenoekonomskim polozajem človeka. V članku so prikazani taka motivi za razvoj izobrazevalne poti kot tudi vzroki za njeno prekinitev, ki se med posamezniki z razlicnimi stopnjami izobrazbe mocno razlikujejo. Avtorica ugotavlja, da se razlike v samospostovanju večajo glede na razpon med stopnjami izobrazbe. Z nenehnim izobrazevanjem in ucenjem pridobiva posameznikovo samospostovanje nove razseznosti- visjo stopnjo izobrazbe kot je dosegel, širše dimenzije v zaznavanju sebe ima.

  17. Sovremennye podkhody k ispol'zovaniyu glyukokortikoidnykh i tsitotoksicheskikh preparatov pri bolezni Shegrena

    Directory of Open Access Journals (Sweden)

    V I Vasil'ev

    2008-01-01

    Materialy i metody. V issledovanie vklyucheno 412 patsientov (406 zhenshchin i 6 muzhchin s BSh, nablyudavshikhsya v Institute revmatologii v 1975 - 2007 gg. Mediana nablyudeniya - 9 (5-15 let. Sredniy vozrast bol'nykh na nachalo nablyudeniya - 44,8 goda. Mediana dlitel'nosti BSh do pervogo postupleniya - 9 let, mediana vozrasta debyuta BSh - 33 goda. Effektivnost' dlitel'noy terapii malymi dozami GKu 151 bol'nogo (mediana - 10 let, malymi dozami ATsu 147 bol'nykh (mediana - 5 let otsenena v sravnenii s rezul'tatami lecheniya 94 bol'nykh, poluchavshikh tol'ko «oftal'mologicheskie» i «stomatologicheskie» metody terapii. Rezul'taty issledovaniya. Pokazano, chto terapiya malymi dozami GK i ATs polozhitel'no vliyala na nekotorye zhelezistye i vnezhelezistye proyavleniya zabolevaniya, odnako k snizheniyu veroyatnosti razvitiya limfoproliferativnykh zabolevaniy (r=0,036 i povysheniyu vyzhivaemosti bol'nykh s BSh privodila tol'ko terapiya ATs (r=0,037. Razrabotany i predstavleny metodiki lokal'nogo ispol'zovaniya GK pri tyazhelykh oftal'mologicheskikh i stomatologicheskikh proyavleniyakh BSh. U 150 bol'nykh s BSh s tyazhelymi sistemnymi proyavleniyami predstavleny pokazaniya i protivopokazaniya dlya provedeniya pul's-terapii (PT, kombinirovannoy PT, plazmafereza, krioafereza i dvoynoy fil'tratsii plazmy v sochetanii s kombinirovannoy PT. Pokazano, chto naznachenie malykh doz GK i PT u zhenshchin s BSh s sokhranennym menstrual'nym tsiklom privodit k bolee rannemu nastupleniyu menopauzy i sposobstvuet razvitiyu glyukokortikoidnogo i postmenopauzal'nogo osteoporoza v otdalennye sroki. Otseneny naibolee znachimye pobochnye proyavleniya terapii GK i ATs pri razlichnykh variantakh terapii BSh.

  18. Sovremennye podkhody k ispol'zovaniyu glyukokortikoidnykh i tsitotoksicheskikh preparatov pri bolezni Shegrena

    Directory of Open Access Journals (Sweden)

    V I Vasil'ev

    2008-04-01

    Materialy i metody. V issledovanie vklyucheno 412 patsientov (406 zhenshchin i 6 muzhchin s BSh, nablyudavshikhsya v Institute revmatologii v 1975 - 2007 gg. Mediana nablyudeniya - 9 (5-15 let. Sredniy vozrast bol'nykh na nachalo nablyudeniya - 44,8 goda. Mediana dlitel'nosti BSh do pervogo postupleniya - 9 let, mediana vozrasta debyuta BSh - 33 goda. Effektivnost' dlitel'noy terapii malymi dozami GKu 151 bol'nogo (mediana - 10 let, malymi dozami ATsu 147 bol'nykh (mediana - 5 let otsenena v sravnenii s rezul'tatami lecheniya 94 bol'nykh, poluchavshikh tol'ko «oftal'mologicheskie» i «stomatologicheskie» metody terapii. Rezul'taty issledovaniya. Pokazano, chto terapiya malymi dozami GK i ATs polozhitel'no vliyala na nekotorye zhelezistye i vnezhelezistye proyavleniya zabolevaniya, odnako k snizheniyu veroyatnosti razvitiya limfoproliferativnykh zabolevaniy (r=0,036 i povysheniyu vyzhivaemosti bol'nykh s BSh privodila tol'ko terapiya ATs (r=0,037. Razrabotany i predstavleny metodiki lokal'nogo ispol'zovaniya GK pri tyazhelykh oftal'mologicheskikh i stomatologicheskikh proyavleniyakh BSh. U 150 bol'nykh s BSh s tyazhelymi sistemnymi proyavleniyami predstavleny pokazaniya i protivopokazaniya dlya provedeniya pul's-terapii (PT, kombinirovannoy PT, plazmafereza, krioafereza i dvoynoy fil'tratsii plazmy v sochetanii s kombinirovannoy PT. Pokazano, chto naznachenie malykh doz GK i PT u zhenshchin s BSh s sokhranennym menstrual'nym tsiklom privodit k bolee rannemu nastupleniyu menopauzy i sposobstvuet razvitiyu glyukokortikoidnogo i postmenopauzal'nogo osteoporoza v otdalennye sroki. Otseneny naibolee znachimye pobochnye proyavleniya terapii GK i ATs pri razlichnykh variantakh terapii BSh.

  19. Neki problemi pri prevođenju moderne poezije promatrani kroz teoriju konceptualne integracije

    Directory of Open Access Journals (Sweden)

    Sanja Cimer

    2011-12-01

    Full Text Available Straußeneimondaber ich finde nichts mehrnichts mehr an Buchstaben im Wortmache so ähnlichwie Luftgang ohne Seiles fällt nichts mehraber nichts ist eben auchZaungrenzeund LebenMittelstelzengangder Strauß legt seine Eier in den Himmelfast Massenproduktionkugelrunde Stundenmit Haut auf wirren ÜberzugHände greifen leerwenn nicht duaber das kann nicht –Angsttauchen mit Höhengangund die Hand als Schalewer fängt, – verliert!Mjesec od nojevog jajetaali nema ničeg višeničeg više u slovima riječičinim sličnokao hod po zraku bez konopcaništa više ne padaali i ništa jestgranica od ogradei životsredinom na štulamanoj liježe svoja jaja u nebogotovo masovna proizvodnjasati okrugli poput loptes kožom na neurednoj presvlaciruke posežu u praznoako nisi tiali to ne može –uron u strah s letom u visinei ruka poput ljusketko ulovi, – izgubi!Prevođenje poezije oduvijek se smatralo osobitom temom unutar ionako složenog područja književnog prevođenja. Budući da poezija predstavlja književni oblik u kojem su sadržaj i forma nerazdvojno povezani, jasno je zašto ona predstavlja najzahtjevniji oblik prevoditeljske aktivnosti. Problematičnu točku pri prevođenju poezije predstavlja činjenica da ona daje izrazito “zgusnutu” i kompaktnu formu te da jezik poezije uglavnom počiva na konotacijama, a ne na denotacijama. Noviji pristupi prevođenju prepoznaju da su nekadašnja protivljenja prevođenju poezije, to jest isticanja njezine neprevodivosti, zapravo bila usmjerena na nemogućnost potpunog prenošenja svih aspekata izvornog poetskog djela u ciljni jezik i njegovu kulturu i tradiciju (neprevodivost poezije isticali su, primjerice, T. S. Eliott: “[poezija je] stalni podsjetnik na sve ono što se može reći samo na jednom jeziku”, Roman Jakobson: “poezija je po definiciji neprevodiva” ili Nabokov: “pjesma ne može biti prevedena, reproducirana ni iznova oblikovana na ciljnom jeziku” (svi navedeni citati te citati

  20. PRI 3.1: Electrolyte membrane fuel cells (Co-PACEM), final report (july 2002 to june 2004); PRI 3.1: Coeurs de piles a combustible a electrolyte membrane (Co-PACEM), rapport final (juillet 2002 a juin 2004)

    Energy Technology Data Exchange (ETDEWEB)

    Lamy, C.

    2004-07-01

    The researches realized in the PRI Co-PACEM aim to improve the operating of the core of the electrolyte membrane fuel cells, at low temperature in order to minimize the high voltage of the electro-chemical reactions, to decrease the cost of the membrane, to improve the properties (conductivity, mechanical and thermal stability...) and to optimize the transport of heat and reactive. The document presents the research programs. (A.L.B.)

  1. ¿Por qué perdió el PRI en Yucatán? Las transiciones de este año en bastiones priístas, caída de una imagen distorsionada

    Directory of Open Access Journals (Sweden)

    Lic. Fernando Pacheco Bailón

    2001-01-01

    Full Text Available El pasado domingo 27 de mayo, a eso de las 5:30 de la tarde, los mexicanos nos enteramos a través de los medios de comunicación de televisión abierta y pagada de la ventaja que tenía el candidato a la gubernatura de Yucatán, a través de la coalición PAN, PRD, PVEM, PT, Patricio Patrón Laviada, con respecto al candidato del PRI, Orlando Paredes Lara. Más tarde, de aquella llamada telefónica que hiciera el presidente Vicente Fox para felicitar al candidato que aventajaba al del tricolor, al hacer referencia a las encuestas de salida llevadas a cabo por empresas como Consulta Mitovsky, Garo y otras más. Hay muchas metodologías para poder analizar procesos electorales, así como distintas formas de abordar el problema del por qué perdió el PRI en Yucatán. Para efectos de estudio se planteará las condiciones preelectorales que se dieron, el propio momento electoral del pasado 27 de mayo, así como la visión futura de PRI como organización política en tiempos transitorios.

  2. Responses of the reflectance indices PRI and NDVI to experimental warming and drought in European shrublands along a north–south climatic gradient

    DEFF Research Database (Denmark)

    Mänd, Pille; Hallik, Lea; Peñuelas, Josep

    2010-01-01

    canopy reflectance, effective green leaf area index (green LAIe) and chlorophyll fluorescence of dominant species. The treatment effects on green LAIe varied among sites. We calculated three reflectance indices: photochemical reflectance index PRI [531 nm; 570 nm], normalized difference vegetation index...... NDVI680 [780 nm; 680 nm] using red spectral region, and NDVI570 [780 nm; 570 nm] using the same green spectral region as PRI. All three reflectance indices were significantly related to green LAIe and were able to detect changes in shrubland vegetation among treatments. In general warming treatment...... in vegetation areas with low green LAIe. As both soil reflectance and LAI varied between northern and southern sites it is problematic to draw universal conclusions of climate-derived changes in all vegetation types based merely on PRI measurements. We propose that canopy level PRI measurements can be more...

  3. UČNI PRIPOMOČKI ZA SLEPE IN SLABOVIDNE UČENCE PRI POUKU ANGLEŠČINE

    OpenAIRE

    Štor, Ana

    2017-01-01

    Magistrsko delo z naslovom Učni pripomočki za slepe in slabovidne učence pri pouku angleščine je sestavljeno iz teoretičnega in praktičnega dela. V teoretičnem delu smo predstavili vid in okvaro vida, vzgojo in izobraževanje slepih in slabovidnih otrok, značilnosti slepih in slabovidnih otrok, delo s slepimi in slabovidnimi učenci v šoli in pri pouku angleščine ter razvoj tipno-kinestetičnega zaznavanja. V praktičnem delu smo uporabili kvalitativni metodološki pristop. Izdelali smo učne pripo...

  4. Impact of the Prezervative «PriMix-Forsil” on the Chemical Composition and the Nutritive Value of Wet Cereals

    Directory of Open Access Journals (Sweden)

    larisa caisin

    2016-05-01

    Full Text Available The purpose of the investigation was to study the chemical composition and the organoleptic parameters of wet cereals preserved in the biological preservative “PriMix-Forsil” (new microbiological preservative, which is a synergistic association of strains of Lactobacillus acidophilus - 2х109 CFU/g, Lactobacillus plantarium - 1х109 CFU/g,  Lactobacillus fermentum  - 5х109 CFU/g  and  Bifidobacterium bifidum - 3х109 CFU/g. The preservation of some wet cereals, namely corn, barley and wheat in different quantities of the preparation “PriMix-Forsil” has not negatively affected the physical appearance of the grain. The chemical analysis concerning the content of crude nutrients (protein, fat, cellulose and NEF showed a lower content of these substances in the preserved grain, in comparison with the control sample.

  5. Učinki manualnih postopkov na proprioceptivni priliv pri bolečini v vratu in spodnjem delu hrbta

    OpenAIRE

    Di Lenardo, Fanika

    2017-01-01

    Uvod: Bolečina v vratni hrbtenici in v spodnjem delu hrbtenice lahko oslabi delovanje proprioceptivnega sistema. Za izboljšanje proprioceptivnega priliva se poleg drugih fizioterapevtskih postopkov uporablja tudi manualne tehnike, kot so manipulacija in mobilizacija mehkih tkiv ter sklepov. Namen: Namen diplomskega dela je bil na osnovi pregleda tuje in domače literature ugotoviti učinek manualnih tehnik na povečanje proprioceptivnega priliva pri zdravih odraslih in preiskovancih z okvarami ...

  6. 3. slovenska konferenca: Ravnanje z ljudmi pri delu (Human Resource Management Velenje, 2G. in 27 oktobra 2000

    Directory of Open Access Journals (Sweden)

    Daniela Brečko

    2000-12-01

    Full Text Available Konferenca o ravnanju z ljudmi pri delu, ki ga vsako leto organizira GV Izobraževanje, je srečanje kadrovskih strokovnjakov in vodilnih ter vodstvenih delavcev, da bi združili moči, izmenjali znanje ter izkušnje in oblikovali najučinkovitejše rešitve pri ravnanju s tako občutljivim področjem, kot so zaposleni. Konferenca Ravnanje z ljudmi pri delu je letos potekala pod geslom Z ljudmi do konkurenčne prednosti. Na prvih dveh konferencah je namreč postalo jasno, da so lahko delovne organizacije uspešne le, če so uspešni zaposleni, in le toliko, kolikor bo delodajalcem uspelo izvabiti iz njih ustvatjalnih potencialov. To je nova naloga ali funkcija kadrovskih služb, ki so še do nedavnega opravljale bolj administrativne naloge v zvezi z zaposlovanjem delovne sile, danes pa so pred zahtevno nalogo, kako skrbeti za osebnostni in poklicni razvoj kadrov.

  7. Reverse transcriptase-PCR differential display analysis of meningococcal transcripts during infection of human cells: Up-regulation of priA and its role in intracellular replication

    Directory of Open Access Journals (Sweden)

    Alifano Pietro

    2008-07-01

    Full Text Available Abstract Background In vitro studies with cell line infection models are beginning to disclose the strategies that Neisseria meningitidis uses to survive and multiply inside the environment of the infected host cell. The goal of this study was to identify novel virulence determinants that are involved in this process using an in vitro infection system. Results By using reverse transcriptase-PCR differential display we have identified a set of meningococcal genes significantly up-regulated during residence of the bacteria in infected HeLa cells including genes involved in L-glutamate transport (gltT operon, citrate metabolism (gltA, disulfide bond formation (dsbC, two-partner secretion (hrpA-hrpB, capsulation (lipA, and DNA replication/repair (priA. The role of PriA, a protein that in Escherichia coli plays a central role in replication restart of collapsed or arrested DNA replication forks, has been investigated. priA inactivation resulted in a number of growth phenotypes that were fully complemented by supplying a functional copy of priA. The priA-defective mutant exhibited reduced viability during late logarithmic growth phase. This defect was more severe when it was incubated under oxygen-limiting conditions using nitrite as terminal electron acceptors in anaerobic respiration. When compared to wild type it was more sensitive to hydrogen peroxide and the nitric oxide generator sodium nitroprusside. The priA-defective strain was not affected in its ability to invade HeLa cells, but, noticeably, exhibited severely impaired intracellular replication and, at variance with wild type and complemented strains, it co-localized with lysosomal associated membrane protein 1. Conclusion In conclusion, our study i. demonstrates the efficacy of the experimental strategy that we describe for discovering novel virulence determinants of N. meningitidis and ii. provides evidence for a role of priA in preventing both oxidative and nitrosative injury, and in

  8. Modulation of DNA damage tolerance in Escherichia coli recG and ruv strains by mutations affecting PriB, the ribosome and RNA polymerase.

    Science.gov (United States)

    Mahdi, Akeel A; Briggs, Geoffrey S; Lloyd, Robert G

    2012-11-01

    RecG is a DNA translocase that helps to maintain genomic integrity. Initial studies suggested a role in promoting recombination, a possibility consistent with synergism between recG and ruv null alleles and reinforced when the protein was shown to unwind Holliday junctions. In this article we describe novel suppressors of recG and show that the pathology seen without RecG is suppressed on reducing or eliminating PriB, a component of the PriA system for replisome assembly and replication restart. Suppression is conditional, depending on additional mutations that modify ribosomal subunit S6 or one of three subunits of RNA polymerase. The latter suppress phenotypes associated with deletion of priB, enabling the deletion to suppress recG. They include alleles likely to disrupt interactions with transcription anti-terminator, NusA. Deleting priB has a different effect in ruv strains. It provokes abortive recombination and compromises DNA repair in a manner consistent with PriB being required to limit exposure of recombinogenic ssDNA. This synergism is reduced by the RNA polymerase mutations identified. Taken together, the results reveal that RecG curbs a potentially negative effect of proteins that direct replication fork assembly at sites removed from the normal origin, a facility needed to resolve conflicts between replication and transcription. © 2012 Blackwell Publishing Ltd.

  9. Results of tectonic measurements in the Lunan Stone forest, China: Rezultati tektonskih meritev v "Kamnitem gozdu" pri Lunanu, Kitajska:

    OpenAIRE

    Šebela, Stanka

    1996-01-01

    The main tectonic trending in the Lunan Stone Forest is from 315 to 330° (NW-SE), followed by a trending 45 to 60° (NE-SW) and by 285 to 300° (NW-SE). The layers of Permian limestones stike towards NW and W dipping by an angle of 5 to 20° and are slightly folded into several smaller anticlines and synclines V Kamnitem gozdu pri Lunanu so glavne smeri tektonskih razpok 315-330° (SZ-JV), sledi smer 45-60° (SV-JZ) in smer 285-300° (SZ-JV). Plasti permijskih apnencev vpadajo proti SZ in Z pod ...

  10. DOŽIVLJANJE SAMOMORA IN ZADNJEGA STIKA S PACIENTOM, KI JE UMRL ZARADI SAMOMORA, PRI MEDICINSKIH TEHNIKIH

    OpenAIRE

    Čuš, Anja

    2014-01-01

    Samomor v Sloveniji in svetu predstavlja pomemben javno-zdravstveni problem. Večina ljudi, ki so umrli zaradi samomora, je nekaj mesecev ali tednov pred smrtjo obiskalo splošnega zdravnika. Osrednja tema naše naloge je doživljanje samomora pacienta pri medicinskih tehnikih. V raziskavi smo uporabili kvalitativno metodo raziskovanja. Po načelih utemeljene teorije smo analizirali enajst intervjujev z medicinskimi sestrami, ki se spomnijo, da so tekom svoje delovne kariere imele izkušnjo samo...

  11. Visible Light Excited Catalysis and Reusability Performances of TiO2@Pr:Y2SiO5 Upconversion Materials

    Directory of Open Access Journals (Sweden)

    Yan Jiao

    2017-01-01

    Full Text Available To get high efficiency photodegradation on pollutants under visible light, Pr(III doped Y2SiO5 upconversion materials and anatase TiO2 nanofilm coated Pr:Y2SiO5 composite have been prepared by using a sol-gel method. XRD and SEM test results indicated that TiO2 nanofilm was well coated on Pr:Y2SiO5 to form TiO2@Pr:Y2SiO5 composite particles with the sizes of 0.5–1.0 μm. To avoid secondary pollution resulting from incomplete recovery of catalyst particles, TiO2@Pr:Y2SiO5 was loaded on the glass fiber filters by using a dip-coating method. It is found that the catalyst particles were embedded into the carrier firmly, even after having been reused for 6 times. The luminescence intensities of TiO2@Pr:Y2SiO5 were getting down sharply with the coating contents of TiO2 increased, which was attributed to the adsorption of the luminescence by the TiO2 film in situ. As a result, TiO2@Pr:Y2SiO5 with 4% TiO2, which presented lowest luminescence intensity, showed the highest efficiency on the photodegradation of nitrobenzene wastewater. The catalysts loaded on glass fiber filters showed excellent reusability on the photodegradation of nitrobenzene and presented a photodegradation rate of 95% at the first time and up to 75.9% even after 6 times of reusing by the treatment time of 12 h.

  12. Dysfunctional Presynaptic M2 Receptors in the Presence of Chronically High Acetylcholine Levels: Data from the PRiMA Knockout Mouse.

    Directory of Open Access Journals (Sweden)

    Franziska Mohr

    Full Text Available The muscarinic M2 receptor (M2R acts as a negative feedback regulator in central cholinergic systems. Activation of the M2 receptor limits acetylcholine (ACh release, especially when ACh levels are increased because acetylcholinesterase (AChE activity is acutely inhibited. Chronically high ACh levels in the extracellular space, however, were reported to down-regulate M2R to various degrees. In the present study, we used the PRiMA knockout mouse which develops severely reduced AChE activity postnatally to investigate ACh release, and we used microdialysis to investigate whether the function of M2R to reduce ACh release in vivo was impaired in adult PRiMA knockout mice. We first show that striatal and hippocampal ACh levels, while strongly increased, still respond to AChE inhibitors. Infusion or injection of oxotremorine, a muscarinic M2 agonist, reduced ACh levels in wild-type mice but did not significantly affect ACh levels in PRiMA knockout mice or in wild-type mice in which ACh levels were artificially increased by infusion of neostigmine. Scopolamine, a muscarinic antagonist, increased ACh levels in wild-type mice receiving neostigmine, but not in wild-type mice or in PRiMA knockout mice. These results demonstrate that M2R are dysfunctional and do not affect ACh levels in PRiMA knockout mice, likely because of down-regulation and/or loss of receptor-effector coupling. Remarkably, this loss of function does not affect cognitive functions in PRiMA knockout mice. Our results are discussed in the context of AChE inhibitor therapy as used in dementia.

  13. Diurnal and Seasonal Responses of High Frequency Chlorophyll Fluorescence and PRI Measurements to Abiotic Stress in Almonds

    Science.gov (United States)

    Bambach-Ortiz, N. E.; Paw U, K. T.

    2016-12-01

    Plants have evolved to efficiently utilize light to synthesize energy-rich carbon compounds, and at the same time, dissipate absorbed but excessive photon that would otherwise transfer excitation energy to potentially toxic reactive oxygen species (ROS). Nevertheless, even the most rapidly growing plants with the highest rates of photosynthesis only utilize about half of the light their leaves absorb during the hours of peak irradiance in sun-exposed habitats. Usually, that daily peak of irradiance coincides with high temperature and a high vapor pressure deficit, which are conditions related to plant stomata closure. Consequently, specially in water stressed environments, plants need to have mechanisms to dissipate most of absorbed photons. Plants avoid photo-oxidative damage of the photosynthetic apparatus due to the formation of ROS under excess light using different mechanisms in order to either lower the amount of ROS formation or detoxify already formed ROS. Photoinhibition is defined as a reduction in photosynthetic activity due largely to a sustained reduction in the photochemical efficiency of Photosystem II (PSII), which can be assessed by monitoring Chlorophyll a fluorescence (ChlF). Alternatively, monitoring abiotic stress effects upon photosynthetic activity and photoinhibition may be possible using high frequency spectral reflectance sensors. We aim to find the potential relationships between high frequency PRI and ChlF as indicators of photoinhibition and permanent photodamage at a seasonal scale. Preliminary results show that PRI responses are sensitive to photoinhibition, but provide a poor representation of permanent photodamage observed at a seasonal scale.

  14. Spectral characteristics of intense red luminescence in Pr:Y2O3 nanophosphor on UV excitation

    Science.gov (United States)

    Mishra, Kavita; Dwivedi, Y.; Rai, A.; Rai, S. B.

    2012-12-01

    Detailed structural and spectroscopic characterizations of Pr:Y2O3 nanophosphor have been carried out. On ultraviolet light (at 266 nm) excitation, intense red emission along with weak emissions in blue, green and infrared regions have been observed. The phenomena for the observed emission have been thoroughly explained in the present work and it was finally concluded that the direct excitation through low-lying 4f15d band of Pr3+ ions and through the conduction band of Y2O3 nanophosphor are the main channels for the observed emissions. The calculated quantum efficiency (QE) for the red emission is found to be ~80 % while the CIE coordinates are (0.65, 0.34) quite close to the standard values. These studies clearly indicate that Pr:Y2O3 nanophosphors are promising and futuristic red luminescent material for the development of various display devices and UV detectors. Time resolved spectroscopy has been further used to investigate luminescence dynamics.

  15. Morfološka analiza cepljenega mesta pri različnih načinih cepljenja oreha

    OpenAIRE

    Žižek, Ivan

    2014-01-01

    V drevesnici Žižek smo v letih 2007 in 2008 izvedli poskus cepljenja oreha sorte 'Šejnovo', pri tem pa vrednotili razlièno debelino podlag in cepièev ter razlièno dolžino le-teh (eno-nodijski, dvo-nodijski cepiè). V prvi poskus smo vkljuèili 8 razliènih obravnavanj: (1) strojno omega 1 sistem (eno oko) tanki cepiè (O1-T), (2) strojno omega 1 sistem (eno oko) debeli cepiè (O1-D), (3) strojno omega 2 sistem (dve oèesi) tanki cepiè (O2-T), (4) strojno omega 2 sistem (dve oèesi) debel...

  16. NON-GENICULATE CORALLINE ALGAE (CORALLINALES, RHODOPHYTA FROM THE LOWER OLIGOCENE OF POLJŠICA PRI PODNARTU (NORTHERN SLOVENIA

    Directory of Open Access Journals (Sweden)

    LUKA GALE

    2009-03-01

    Full Text Available Despite their increasing importance in sedimentology and palaeoecology, non-geniculate coralline algae remain virtually overlooked in Slovenia. Though these plants are present or even abundant in the Cretaceous and Cainozoic strata, they have never been studied in detail with notable exception of corallines from the Lower Oligocene beds in the area of Gornji Grad. Poljšica pri Podnartu is another locality where Lower Oligocene beds are exposed, considered as equivalent to the former. The studied profile consists of pebbly limestone, mudstone, sandstone and limestone. Limestones contain abundant non-geniculate coralline algae. Nine species from six genera of these corallines have been identified: Lithoporella melobesioides (Foslie Foslie, 1909, Neogoniolithon contii (Mastrorilli Quaranta et al., 2007, Spongites sp., Lithothamnion sp. 1, Lithothamnion sp. 2, Mesophyllum sp. 1, Mesophyllum sp. 2, Mesophyllum sp. 3 and Sporolithon sp. Some of these species are described from Slovenia for the first time. 

  17. VPLIV SPOMINSKEGA TRENINGA NA KRATKOTRAJNI IN DOLGOTRAJNI SPOMIN PRI POSAMEZNIKIH S PRIDOBLJENO MOŽGANSKO POŠKODBO

    OpenAIRE

    Ogrizek, Tjaša

    2015-01-01

    Namen te študije je bil preveriti vpliv spominskega treninga N-back na kratko- in dolgotrajne spominske sposobnosti pri udeležencih s pridobljeno možgansko poškodbo. V ta namen sta se izoblikovali dve hipotezi, in sicer (H1) kratkotrajni spomin udeležencev se bo izboljšal ter (H2) dolgotrajni spomin udeležencev se ne bo spremenil. Udeleženci v študiji so bili trije posamezniki, stari 38, 31 ter 26 let, ki imajo pridobljeno možgansko poškodbo. Metodološki pripomočki, uporabljeni v študiji, so ...

  18. Persistent organic pollutants, heavy metals and radioactivity in the urban soil of Priština City, Kosovo and Metohija.

    Science.gov (United States)

    Gulan, Ljiljana; Milenkovic, Biljana; Zeremski, Tijana; Milic, Gordana; Vuckovic, Biljana

    2017-03-01

    Polycyclic aromatic hydrocarbons (PAHs), organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs), heavy metals content and radioactivity levels were measured in 27 soil samples collected from Priština, the capital of Kosovo and Metohija. The sixteen PAHs, twelve OCPs and six PCBs congeners were determined by gas chromatography system with mass spectrometry detection. Although the use of PCBs and OCPs was prohibited decades ago residues of those compounds still existed in measurable concentrations in soils of Priština. PAHs were also present in analyzed samples but their mean concentration was significantly lower than mean concentrations of PAHs previously reported in urban areas in the world. The concentrations of heavy metals (As, Cd, Co, Cr, Cu, Mn, Ni, Pb and Zn) were determined by the EDTA extraction protocols, along with their extractable concentrations. The activity concentrations of natural radionuclides (226Ra, 232Th and 40K) were determined by gamma spectrometry method. The Shapiro-Wilk normality test found that activity concentrations of natural radionuclides were normally distributed. Radiological risk was estimated through the annual effective dose, gonadal dose equivalent, excess lifetime cancer risk, radium equivalent activity, external and internal hazard indexes. Spearman correlation coefficient was used for analysis of correlations between physicochemical properties, heavy metal contents and radionuclide activity concentrations. Strong positive correlation between 226Ra and 232Th was found, as well as among pairs of As-Cd and Co-Mn. Very strong positive correlation (0.838) at the 0.01 significance level was noted for Pb-Zn pair. Strong correlations indicate common occurrence of these elements in the nature, as well as geogenic association. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. The interaction effects of pri-let-7a-1 rs10739971 with PGC and ERCC6 gene polymorphisms in gastric cancer and atrophic gastritis.

    Directory of Open Access Journals (Sweden)

    Qian Xu

    Full Text Available BACKGROUND: The aim of this study was to investigate the interaction effects of pri-let-7a-1 rs10739971 with pepsinogen C (PGC and excision repair cross complementing group 6 (ERCC6 gene polymorphisms and its association with the risks of gastric cancer and atrophic gastritis. We hoped to identify miRNA polymorphism or a combination of several polymorphisms that could serve as biomarkers for predicting the risk of gastric cancer and its precancerous diseases. METHODS: Sequenom MassARRAY platform method was used to detect polymorphisms of pri-let-7a-1 rs10739971 G → A, PGC rs4711690 C → G, PGC rs6458238 G → A, PGC rs9471643 G → C, and ERCC6 rs1917799 in 471 gastric cancer patients, 645 atrophic gastritis patients and 717 controls. RESULTS: An interaction effect of pri-let-7a-1 rs10739971 polymorphism with ERCC6 rs1917799 polymorphism was observed for the risk of gastric cancer (P interaction = 0.026; and interaction effects of pri-let-7a-1 rs10739971 polymorphism with PGC rs6458238 polymorphism (P interaction = 0.012 and PGC rs9471643 polymorphism (P interaction = 0.039 were observed for the risk of atrophic gastritis. CONCLUSION: The combination of pri-let-7a-1 rs10739971 polymorphism and ERCC6 and PGC polymorphisms could provide a greater prediction potential than a single polymorphism on its own. Large-scale studies and molecular mechanism research are needed to confirm our findings.

  20. Pri-let-7a-1 rs10739971 polymorphism is associated with gastric cancer prognosis and might affect mature let-7a expression

    Directory of Open Access Journals (Sweden)

    Li Y

    2016-07-01

    Full Text Available Ying Li, Qian Xu, Jingwei Liu, Caiyun He, Quan Yuan, Chengzhong Xing, Yuan Yuan Tumor Etiology and Screening Department of Cancer Institute and General Surgery, the First Affiliated Hospital of China Medical University, and Key Laboratory of Cancer Etiology and Prevention (China Medical University, Liaoning Provincial Education Department, Shenyang, People’s Republic of China Abstract: The relationship between the pri-let-7a-1 rs10739971 polymorphism and gastric cancer (GC risk has been reported. However, the role of this polymorphism in the prognosis of GC remains largely elusive. Sequenom MassARRAY platform method and the polymerase chain reaction (PCR-restriction fragment length polymorphism were used to investigate pri-let-7a-1 rs10739971 G→A in 334 GC patients. Real-time PCR detected expression of mature let-7a in serum and tissue. Patients with AA or GA+AA genotypes of the pri-let-7a-1 rs10739971 polymorphism demonstrated significantly longer survival time than those with the wild GG genotype. Stratified analysis indicated that survival time was significantly longer in women with AA or GA+AA genotypes and in Borrmann type I/II patients with GA heterozygote or GA+AA genotypes. AA genotype was more frequent in the lymphatic-metastasis-negative subgroup. Serum mature let-7a expression in healthy people with the GA heterozygote and the GA+AA genotype was higher than in those with the GG genotype, and the difference remained significant in the female healthy subgroup. Pri-let-7a-1 rs10739971 polymorphism might be a biomarker for GC prognosis, especially for female and Borrmann type I/II patients. The pri-let-7a-1 rs10739971 polymorphism might affect serum mature let-7a expression, and partly explain the mechanism of the relationship between the pri-let-7a-1 rs10739971 polymorphism and GC survival. Keywords: miRNA, let-7a, polymorphism, gastric cancer, prognosis, expression

  1. Vrijednosti pri potrošnji, osobni čimbenici i namjere ponašanja u prihvaćanju mobilne kupovine

    OpenAIRE

    Assarut, Rujipun; Eiamkanchanalai, Somkiat

    2015-01-01

    Dosadašnja je literatura pokazala da je vrijednost pri potrošnji važan čimbenik u odlučivanju potrošača o prihvaćanju online kupovine. Međutim većina je studija bila usredotočena na jednu vrstu proizvoda ili usluge. Zbog toga je generalizacija rezultata ograničena. Nadalje, prethodne studije neizravnih učinaka osobnih čimbenika na prihvaćanje online kupovine naglašavale su samo utilitarne vrijednosti. Nitko nije istražio indirektne učinke kroz vrijednosti pri potrošnji koje uključuju i utilit...

  2. Cyrillic alphabet as the designation of national identity among students of University of Priština with temporary head office in Kosovska Mitrovica

    Directory of Open Access Journals (Sweden)

    Miketić Sanja D.

    2016-01-01

    Full Text Available The relationship between culture and nationality and in that sense - national identity of a particular community - is a known thing for a long time. Nationality is usually strongly connected to culture. We will only mention few of their joint characteristics: language, religion, art, customs, tradition etc. In this article special attention will be paid to one of the features of national identity - language - and we will focus on the usage of Cyrillic alphabet of our target group (students of University of Priština, with temporary head office in Kosovska Mitrovica. The study consists of two smaller researches. In the first part we explored reactions of students at University of Priština and we assumed that they will have different reactions towards Cyrillic alphabet and Latin alphabet used as stimuli-words comparing to pupils of Belgrade and Zrenjanin high schools and students of University of Belgrade, Novi Sad and Niš presented in The associative dictionary of Serbian language (Asocjativni rečnik srpskog jezika, 2005. In the second part we tried to find out if our informants prefer the usage of Cyrillic or Latin alphabet, and which one they find better in the esthetic sense. We compared attitudes of students who enroll University of Priština to attitudes of students who enroll University of Belgrade and differences between their attitudes. With both researches we wanted to see if there are formed verbal stereotypes with positive or negative connotation, and what are the attitudes on using Cyrillic alphabet among students in the age of expansion of Latin alphabet. We concluded that Cyrillic alphabet is more used and valued at University of Priština than in the rest of Republic of Serbia and the reason for that might be the stronger sense of national identity among these students.

  3. Assessing Steady-state Fluorescence and PRI from Hyperspectral Proximal Sensing as Early Indicators of Plant Stress: The Case of Ozone Exposure

    Directory of Open Access Journals (Sweden)

    Roberto Colombo

    2008-03-01

    Full Text Available High spectral resolution spectrometers were used to detect optical signals ofongoing plant stress in potted white clover canopies subjected to ozone fumigation. Thecase of ozone stress is used in this manuscript as a paradigm of oxidative stress. Steadystatefluorescence (Fs and the Photochemical Reflectance Index (PRI were investigatedas advanced hyperspectral remote sensing techniques able to sense variations in the excessenergy dissipation pathways occurring when photosynthesis declines in plants exposed to astress agent. Fs and PRI were monitored in control and ozone fumigated canopies during a21-day experiment together with the traditional Normalized Difference Vegetation Index(NDVI and physiological measurements commonly employed by physiologists to describestress development (i.e. net CO2 assimilation, active fluorimetry, chlorophyll concentrationand visible injuries. It is shown that remote detection of an ongoing stress through Fs andPRI can be achieved in an early phase, characterized by the decline of photosynthesis. Onthe contrary, NDVI was able to detect the stress only when damage occurred. These resultsopen up new possibilities for assessment of plant stress by means of hyperspectral remotesensing.

  4. A Privacy Protection User Authentication and Key Agreement Scheme Tailored for the Internet of Things Environment: PriAuth

    Directory of Open Access Journals (Sweden)

    Yuwen Chen

    2017-01-01

    Full Text Available In a wearable sensor-based deployment, sensors are placed over the patient to monitor their body health parameters. Continuous physiological information monitored by wearable sensors helps doctors have a better diagnostic and a suitable treatment. When doctors want to access the patient’s sensor data remotely via network, the patient will authenticate the identity of the doctor first, and then they will negotiate a key for further communication. Many lightweight schemes have been proposed to enable a mutual authentication and key establishment between the two parties with the help of a gateway node, but most of these schemes cannot enable identity confidentiality. Besides, the shared key is also known by the gateway, which means the patient’s sensor data could be leaked to the gateway. In PriAuth, identities are encrypted to guarantee confidentiality. Additionally, Elliptic Curve Diffie–Hellman (ECDH key exchange protocol has been adopted to ensure the secrecy of the key, avoiding the gateway access to it. Besides, only hash and XOR computations are adopted because of the computability and power constraints of the wearable sensors. The proposed scheme has been validated by BAN logic and AVISPA, and the results show the scheme has been proven as secure.

  5. Les prières et le droit. Considérations d’une sociologue Prayers and the Law. Reflections of a sociologist

    Directory of Open Access Journals (Sweden)

    Régine Azria

    2009-04-01

    Full Text Available Les points de rencontre entre prière et droit sont nombreux, y compris en France où, du fait de la Séparation, on serait fondé à considérer de telles rencontres comme illégitimes sinon impossibles, la prière se référant au religieux donc à la sphère privée et le droit à la justice donc à la sphère publique. Cet essai se propose de démontrer que dans la réalité, les cloisons entre le privé et le public sont moins étanches et les relations entre la religion et le droit plus étroites qu’il n’y paraît. Après avoir évoqué les systèmes de droit religieux (droit canon, charia, halakha produits en marge des droits nationaux, rappelé la diversité des liens juridiques entre État et religion (théocratie, monarchie de droit divin, religion d’État – avec ou sans reconnaissance de minorités religieuses tolérées –, religion de la majorité, pluralisme, Concordat, laïcité, séparation, athéisme d’État et la pluralité des niveaux et sources de normativité au sein même des systèmes religieux, l’article se concentre sur la prière et en décline les différents aspects. En effet, la prière n’est pas plus monolithique que le droit. Exercice solitaire ou pratique collective, expression spontanée ou normée de la foi, du sentiment religieux ou de l’appartenance confessionnelle, affirmation identitaire ou communautaire, la prière est diverse dans ses formes et ses contenus comme dans ses usages. Acte social ou militant, dès lors qu’elle se risque à franchir le seuil de la sphère privée du religieux, la prière rencontre la loi.Meeting points between prayers and the law are many, including in France where, because of the separation between the Church and the State, one would be entitled to consider such junctures as illegitimate if not impossible since prayer is linked to the religious and therefore the private sphere whereas law concerns justice and therefore the public sphere. The present essay

  6. Monitoring phenology of photosynthesis in temperate evergreen and mixed deciduous forests using the normalized difference vegetation index (NDVI) and the photochemical reflectance index (PRI) at leaf and canopy scales

    Science.gov (United States)

    Wong, C. Y.; Arain, M. A.; Ensminger, I.

    2016-12-01

    Evergreen conifers in boreal and temperate regions undergo strong seasonal changes in photoperiod and temperatures, which determines their phenology of high photosynthetic activity in the growing season and downregulation during the winter. Monitoring the timing of the transition between summer activity and winter downregulation in evergreens is difficult since this is a largely invisible process, unlike in deciduous trees that have a visible budding and a sequence of leaf unfolding in the spring and leaf abscission in the fall. The light-use efficiency (LUE) model estimates gross primary productivity (GPP) and may be parameterized using remotely sensed vegetation indices. Using spectral reflectance data, we derived the normalized difference vegetation index (NDVI), a measure of leaf "greenness", and the photochemical reflectance index (PRI), a proxy for chlorophyll:carotenoid ratios which is related to photosynthetic activity. To better understand the relationship between these vegetation indices and photosynthetic activity and to contrast this relationship between plant functional types, the phenology of NDVI, PRI and photosynthesis was monitored in an evergreen forest and a mixed deciduous forest at the leaf and canopy scale. Our data indicates that the LUE model can be parameterized by NDVI and PRI to track forest phenology. Differences in the sensitivity of PRI and NDVI will be discussed. These findings have implications to address the phenology of evergreen conifers by using PRI to complement NDVI in the LUE model, potentially improving model productivity estimates in northern hemisphere forests, that are dominated by conifers.

  7. Thermochemical cycles for the heat and cold long-range transport. Final report of the PRI 9.2 Cold transport. Annual report of the PR 2-8; Cycles thermochimiques pour le transport de chaleur et de froid a longue distance. Rapport final du PRI 9.2. Transport de froid. Rapport annuel du PR 2-8

    Energy Technology Data Exchange (ETDEWEB)

    Luo, L.; Tondeur, D. [Laboratoire des Sciences du Genie Chimique (LSGC), 54 - Nancy (France); Mazet, N.; Neveu, P.; Stitou, D.; Spinner, B. [Institut de Science et de Genie des Materiaux et Procedes (IMP), 66 - Perpignan (France)

    2004-07-01

    This PRI deals with the use of thermochemical processes, based on solid-gas reversible transformation, to transfer heat of cold at long-range distance (> 10 km), in order to enhance the energy efficiency. Four main aspects have been studied to confirm the process feasibility: the process identification and the operating conditions, the selection of compatible reagents, the design of an auto-thermal reactor and the gas transport impact on the global performances. (A.L.B.)

  8. Primerjava fizikalnih modelov Adblue tekočine pri SCR sistemih ter vpliv mrež različnih gostot

    OpenAIRE

    Milošič, Teo

    2013-01-01

    Diplomska naloga predstavlja primerjavo fizikalnih modelov Adblue tekočine pri SCR sistemih. AdBlue tekočina je enkrat obravnavana kot več-komponentna zmes (vodna raztopina uree – UWS), drugič kot eno-komponentna zmes (voda), primerjava pa je pokazala vpliv izbire modela na rezultate CFD simulacije. Izvedena je bila tudi primerjava računskih mrež različnih gostot in s tem predstavljen vpliv velikosti celice računske mreže na rezultate. Simulacije in analize so bile narejene s programskim pake...

  9. Vpliv zvezdniške kulture na vedenje potrošnikov pri uporabi družbenih omrežjih – analiza na primeru Slovenije

    OpenAIRE

    Baruca, Arne

    2016-01-01

    Ta študija temelji na ugotovitvah vpliva zvezdniške kulture in vedenja potrošnikov in poslednično preučuje kako spletni uporabniki gradijo svojo samo-podobo (blagovno znamko) sami. Spletni uporabnik ima dostop do tega in vidi kar zvezdniki delajo, kako so oblečeni in kakšne vrednote predstavljajo. Z uporabo in uživanjem različnih medijev se spletni uporabniki učijo vedenja zvednikov in vključujejo oz. imitirajo to vedenje pri uporabi družbenih omrežjih na spletu. Študija analizira tako veden...

  10. Socialno pedagoško delo s pomočjo konja pri otrocih in mladostnikih s čustvenimi in vedenjskimi težavami

    OpenAIRE

    Novak, Lina

    2017-01-01

    Diplomsko delo obravnava vprašanje ustreznosti terapije s pomočjo konja kot socialno pedagoške metode dela z otroki in mladostniki s čustvenimi in vedenjskimi težavami. Ta problematika je danes naraščajoč pojav med mladostniki, kar pa socialno pedagoško stroko kliče k iskanju novih, otrokom in mladostnikom prilagojenih metod dela. V tujini obravnavano metodo že več let uspešno uporabljajo kot dopolnilno in samostojno obravnavo na pedagoškem področju, pri nas pa se v te namene počasi uveljavlj...

  11. Nacionalno preverjanje znanja iz matematike pri učencih s primanjkljaji na posameznih področjih učenja

    OpenAIRE

    Kverh, Gabrijela

    2017-01-01

    Preizkusi znanja matematike Nacionalnega preverjanja znanja (NPZ), Programa mednarodne primerjave dosežkov učencev (PISA) in Mednarodne raziskave trendov znanja matematike in naravoslovja (TIMSS) postajajo za vse učence, posebno pa še za učence s posebnimi potrebami (PP) in za učence s primanjkljaji pri učenju matematike (PUM), vse zahtevnejši. NPZ kot oblika zunanjega preverjanja znanja, ki ima preverjene merske karakteristike, pokaže močne in šibke točke učenja in poučevanja, ustreznost učn...

  12. La declinación de la hegemonía del PRI en los gobiernos estatales de México, 1989-2014

    Directory of Open Access Journals (Sweden)

    Luis Carlos Rodríguez Montaño

    2017-04-01

    Full Text Available En este trabajo se indagó sobre la transición política mexicana en los gobiernos estatales, para lo que se planteó la pregunta: ¿qué tanto ha declinado la hegemonía del Partido Revolucionario Institucional en ellos? Para contestarla se revisaron tres indicadores: el partido de los gobernadores, el tamaño de la fracción del Partido Revolucionario Institucional en los congresos locales y la incidencia de los gobiernos hegemónicos priistas en los estados, de 1989 a 2014. El pluralismo político ha tenido avances sustantivos, y los regímenes de hegemonía priista se han reducido significativamente. Pero, mientras que en la mayoría de los estados hay gobiernos divididos, cinco mantienen la hegemonía priista sin alternancia, y hay 17 con dominio de otros partidos. A pesar de las limitaciones propias en los análisis sobre la evolución de la democracia, aquí se pretendió tener un punto de referencia sobre la pérdida del poder político de un partido que dominó la mayoría de los congresos locales durante gran parte del siglo XX. ______ This paper inquiries about Mexican political transition among state governments and it asks the question: how much the hegemony of the Institutional Revolutionary Party (PRI has declined among state governments? To answer this question, three indicators are revised: the party of governors, the size of PRI fraction within local congresses, and the count of hegemonic state governments during the approximate 1989-2014 period. The study finds out that political pluralism has made substantive progress and that hegemonic PRI state governments have significantly declined. There is however a broad variability; while the majority of states are divided governments, five maintain hegemonic PRI governments with no alternation, and also 17 states have governments where other party is dominant. Despite of limitations in the analysis of the evolution of democracy, it was intended here to have a reference point on the

  13. Spretnosti timskega dela in stališča do njega pri strokovnih delavcih v prvem razredu osnovne šole

    OpenAIRE

    Rožič, Melita

    2017-01-01

    Diplomsko delo obravnava timsko delo učiteljev razrednega pouka in vzgojitelje v prvem razredu osnovne šole. Pri timskem delu je pomembno, da se posameznik čuti pripadnega in enakovrednega člana v timu, razvijati mora sodelovalno kulturo in dobre medsebojne odnose, se prilagajati in uspešno komunicirati. Za uspešno in učinkovito timsko delo je pomembno poznavanje osnovne razsežnosti timskega dela, kot so spoznanja s področja komunikacije in reševanja konfliktov, značilnosti učinkovitih in neu...

  14. Congés… pour « prières » Prayers and days off

    Directory of Open Access Journals (Sweden)

    Claudine Viard

    2009-04-01

    Full Text Available Les premiers combats de la classe ouvrière se sont portés sur la demande d’une journée de repos, qui par tradition chrétienne a été fixée le dimanche en 1906. Quatre journées de congé à caractère chrétien ont en outre été retenues par le législateur. L’exercice du culte est donc concrètement garanti pour les chrétiens. Avec l’arrivée sur le territoire de la République  de populations de confessions variées, cette organisation du travail apparaît inégalitaire, voire de nature à porter atteinte à la liberté religieuse. Il a été proposé de reconnaître les jours de prières d’autres confessions. Pour l’instant, le législateur n’a pas adopté ces propositions. Mais la question reste posée. Or, la jurisprudence des tribunaux judiciaires et administratifs admet le droit de prier des fidèles des cultes minoritaires, ils peuvent prétendre à un congé lors des fêtes de leur religion dans la mesure où cela n’occasionne pas de perturbation. La consécration de cette jurisprudence souple par le législateur serait de nature à calmer le débat.At the turn of the century, the working classes fought for a day off in the week, which was granted on Sundays by the legislator in 1906. Four additional christian holidays are also legal. So the right to pray is garanteed for christians. As different populations with various faiths settled in France, this organisation has seemed to violate the principle of equality, and religious freedom. There has been a debate on the question whether some of the days of minority religions should also be observed by all the population. But so far, the legislator has not voted any of these proposals. It remains an issue. The French judge has consistently decided that the people of non christian faiths had the right to be granted a day off to pray on these special days, provided it would not cause prejudice to the organisation they work for. It might help to calm the debate if this

  15. Nova libro pri interlingvistiko

    Index Scriptorium Estoniae

    2006-01-01

    Rets rmt.: Blanke, Detlev. Interlinguistische Beiträge : zum Wesen und zur Plansprachen / herausgegeben von Sabine Fiedler. Frankfurt/Main, Berlin ; Bern ; Bruxelles ; New York ; Oxford ; Wien : Europäischer Verlag der Wissenschaften Peter Lang

  16. Chemistry and Technology of the Production of Fiber Nitron (Khimiya i Tekhnologiya Proizvodstva Volokna Nitron),

    Science.gov (United States)

    1987-07-17

    example (NH,) 2SO, and perborate of sodium . Nature of initiator has great effect on polymerization and mainly to speed of its course. So, were shown [11...into the solution. For example, it was established that polyacrylonitrile is dissolved in the concentrated aqueous solution of thiocyanate sodium or...of some salts, mainly thiocyanate sodium . With wet spinning are used water/aqueous precipitation baths or organic coagulants (glycerin, hexanetriol

  17. Zeaxanthin-independent energy quenching and alternative electron sinks cause a decoupling of the relationship between the photochemical reflectance index (PRI) and photosynthesis in an evergreen conifer during spring.

    Science.gov (United States)

    Fréchette, Emmanuelle; Wong, Christopher Y S; Junker, Laura Verena; Chang, Christine Yao-Yun; Ensminger, Ingo

    2015-12-01

    In evergreen conifers, the winter down-regulation of photosynthesis and its recovery during spring are the result of a reorganization of the chloroplast and adjustments of energy-quenching mechanisms. These phenological changes may remain undetected by remote sensing, as conifers retain green foliage during periods of photosynthetic down-regulation. The aim was to assess if the timing of the spring recovery of photosynthesis and energy-quenching characteristics are accurately monitored by the photochemical reflectance index (PRI) in the evergreen conifer Pinus strobus. The recovery of photosynthesis was studied using chlorophyll fluorescence, leaf gas exchange, leaf spectral reflectance, and photosynthetic pigment measurements. To assess if climate change might affect the recovery of photosynthesis, seedlings were exposed to cold spring conditions or warm spring conditions with elevated temperature. An early spring decoupling of the relationship between photosynthesis and PRI in both treatments was observed. This was caused by differences between the timing of the recovery of photosynthesis and the timing of carotenoid and chlorophyll pool size adjustments which are the main factors controlling PRI during spring. It was also demonstrated that zeaxanthin-independent NPQ mechanisms undetected by PRI further contributed to the early spring decoupling of the PRI-LUE relationship. An important mechanism undetected by PRI seems to involve increased electron transport around photosystem I, which was a significant energy sink during the entire spring transition, particularly in needles exposed to a combination of high light and cold temperatures. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  18. Agrobacterium rhizogenes pRi8196 T-DNA: mapping and DNA sequence of functions involved in mannopine synthesis and hairy root differentiation.

    Science.gov (United States)

    Hansen, G; Larribe, M; Vaubert, D; Tempé, J; Biermann, B J; Montoya, A L; Chilton, M D; Brevet, J

    1991-01-01

    This paper presents the map and DNA sequence analysis of pRi8196 transferred DNA (T-DNA) genes encoding root-inducing and mannopine synthesis functions. A canonical 24-base-pair border repeat as well as two "pseudoborders" are present at the functional right T-DNA border. To the left of this border are homologs of the mas1' and mas2' genes of TR pRiA4. Next to these are five open reading frames (ORFs) homologous to ORFs 10-14 of TL of pRiA4. ORFs 10-12 (rolA, rolB, and rolC) are less related to their pRiA4 homologs than are the other large ORFs analyzed here. In contrast to T-DNA genes of pRiA4, pRi8196 T-DNA ORFs 11 and 12 (rolB and rolC) are sufficient to induce hairy roots on carrot disks. Images PMID:1909028

  19. PAZ, PRI, AND PROGRESS: OCTAVIO PAZ’S POLITICAL, ECONOMIC AND LITERARY STRUGGLE TO INSPIRE REFORM IN TWENTIETH-CENTURY MEXICO

    Directory of Open Access Journals (Sweden)

    D. Gene Pace

    2003-01-01

    Full Text Available Throughout most of the twentieth century; Mexico’s political and economic policies were heavily influenced by the Partido Revolucionario Institutional (PRI. The landmark 1998 victory by Vicente Fox, the first presidential candidate in seven decades to win without the official sanction of the PRI,marked an important milestone in Mexican history; Octavio Paz, an eloquent proponent of political, economic, and social reform, sought for decades to inspire change. This paper seeks to illuminate Paz’s economic philosophy, and to demonstrate how the acclaimed writer, through courageous symbolic action coupled with an inimitable and potent pen, challenged the PRI’s hegemony in Mexico and contributed to the historic election he almost lived to celebrate (an elderly Paz died shortly before the historic 1998 election.“The Aztec ritual of 2 October [1968] in the Plaza de Tlatelolco. . . convinced me to abandon the Mexican Foreign Service.”“October 2, 1968 ended the student movement. It also ended an era in thehistory of Mexico.”

  20. Transcriptional, post-transcriptional and chromatin-associated regulation of pri-miRNAs, pre-miRNAs and moRNAs

    DEFF Research Database (Denmark)

    Nepal, Chirag; Coolen, Marion; Hadzhiev, Yavor

    2015-01-01

    MicroRNAs (miRNAs) play a major role in the post-transcriptional regulation of target genes, especially in development and differentiation. Our understanding about the transcriptional regulation of miRNA genes is limited by inadequate annotation of primary miRNA (pri-miRNA) transcripts. Here, we......-translational histone modifications (H3K4me3, H2A.Z) and RNA polymerase II (RNAPII) occupancy. We validated seven miR-9 pri-miRNAs by in situ hybridization and showed similar expression patterns as mature miR-9. In addition, processing of an alternative intronic promoter of miR-9-5 was validated by 5' RACE PCR....... Furthermore, we demonstrated that CAGE-seq also detects 3'-end processing of pre-miRNAs on Drosha cleavage site that correlates with miRNA-offset RNAs (moRNAs) production and provides a new tool for detecting Drosha processing events and predicting pre-miRNA processing by a genome-wide assay....

  1. Uspešnost zaznave bioloških in daktiloskopskih sledi s svetlobnimi viri pri preiskavi varnostno zanimivih pisanj in vpliv metode ESDA na daktiloskopske preiskave : diplomsko delo univerzitetnega študija

    OpenAIRE

    Anderlič, Maja

    2012-01-01

    Večina sledi, ki jih forenzični strokovnjaki (izvedenci) najdejo pri preiskovanju varnostno zanimivih pisanj na papirni podlagi, so običajno zelo slabo vidne ali celo nevidne s prostim očesom. Za njihovo odkritje se v prvi vrsti uporablja svetlobne vire, kot je videospektralni primerjalnik, ki se uporablja pri preiskavah ponarejenih dokumentov, in metode elektrostatskega izzivanja latentnega besedila, za katere je značilno, da so nedestruktivne narave. V nadaljevanju pa se za odkritje prstnih...

  2. PRI 2.1: Basic researches on the photovoltaic: new materials (july 2002 - july 2004). Final report of the integrated research project; PRI 2.1: Recherches de base en photovoltaique: nouveaux materiaux (Juillet 2002 - Juin 2004). Rapport final du projet de recherche integre

    Energy Technology Data Exchange (ETDEWEB)

    Marfaing, Y.

    2004-07-01

    The main material of the photovoltaic cells is the massive crystalline silicon. For a large scale development of the photovoltaic industry, it is necessary to use thin layers. Many materials are possible to reach this objective: different types of silicon (amorphous, mono-crystal, poly-crystal), poly-crystal of CIS type (CuInSe{sub 2}) and organic molecules and polymers. The last two types are innovative and need some researches. These research axis are presented in this PRI. (A.L.B.)

  3. Sociokultūrinio išvaizdos idealo priėmimo, pablogėjusios nuotaikos ir fizinio aktyvumo ryšys

    OpenAIRE

    Kaminskaitė, Monika

    2013-01-01

    Darbo tikslas: nustatyti ryšį tarp studentų sociokultūrinio išvaizdos idealo priėmimo, pablogėjusios nuotaikos ir fizinio aktyvumo. Darbo objektas: ryšys tarp išvaizdos idealo prėmimo, pablogėjusios nuotaikos ir fizinio aktyvumo. Metodai: 1. Mokslinės literatūros analizė 2. Anketinė apklausa 3. Aprašomoji statistinė duomenų analizė Darbo uždaviniai: 1. Nustatyti ir palyginti studentų vaikinų ir merginų fizinį aktyvumą 2. Nustatyti studentų kūno masės ir fizinio akty...

  4. Las élites gobernantes priístas del Estado de México: su conformación y redes 1942-2005

    Directory of Open Access Journals (Sweden)

    Claudia Abigail Morales Gómez

    2006-01-01

    Full Text Available El análisis que se realiza a lo largo de este texto tiene como objetivo explicar la conformación de las élites gubernamentales priístas en las sucesiones del ejecutivo local del Estado de México. Lo cual se pretende demostrar a través de una revisión teórica de las élites y desde la concepción del término; misma que para el caso de estudio se llevó a cabo mediante el reconocimiento de las redes de los principales actores políticos, lo que permite mostrar que sus relaciones de amistad, familiares o laborales son las que le posibilitan ascender y formar parte de las élites gubernamentales.

  5. Primerjava stališč do žuželk in znanja o žuželkah pri osnovnošolcih in bodočih učiteljih

    OpenAIRE

    Sedej, Neža

    2016-01-01

    V šolah naj bi učitelji uporabljali metodo izkustvenega učenja/poučevanja, saj je znano, da neposredne izkušnje z živimi organizmi, ki jih učenci pridobijo pri takšnem pouku pomembno pripomorejo k boljšemu razumevanju vsebine, posledično pa tudi k bolj pozitivnim stališčem do organizmov. Znanje, ki ga učenci pri takem pouku pridobijo, je trajnejše (Tomažič, 2009). V raziskavi smo se odločili preveriti, kakšna so stališča učencev in bodočih učiteljev do žuželk ter njihovo znanje o žuželkah. Ra...

  6. Comparison of the architectural and urban design workshop: in the town of Križevci pri Ljutomeru and the Jelovica architectural workshop

    Directory of Open Access Journals (Sweden)

    Tomaž Krušec

    2013-07-01

    Full Text Available The aim of the paper is to draw attention to the key advantages and potential disadvantages of the different types of architectural workshops and architectural/urban design workshops, i.e. based on an analysis and comparison of two workshops: architectural and urban design workshop in the town of Križevci pri Ljutomeru and the architectural workshop organised by the Jelovica Hiše d.o.o. company. The first workshop tried to find practical solutions to certain spatial problems of the town that the workshop addressed, while the client of the second workshop expected from the students to develop innovative solutions in using a specific building system for designing contemporary residential typologies. The differences in expectations meant that the workshops were carried out differently. In the first workshop, it was essential that the students stayed in the town that was the subject of the workshop, while in the second one, it was important that the students grasped the characteristics of the technological process and the special features of the building. To achieve this, the students made several visits to the company’s production plants and, as an end product of the workshop, the students had to produce a part of their designed structure. This was a most direct way of familiarising themselves with the way of building

  7. Agrobacterium pRi TL-DNA rolB and TR-DNA Opine Genes Transferred to the Spiny Amaranth (Amaranthus spinosus L., A Nutraceutical Crop

    Directory of Open Access Journals (Sweden)

    Ajantaa Pal

    2013-01-01

    Full Text Available In vitro rhizogenesis occurred with a characteristic pattern typical of transformed roots following explant (internode/leaf inoculation of Amaranthus spinosus L. with four different wild type Agrobacterium rhizogenes strains. The extent of rhizogenesis varied considerably with the explant type and source, and with the Agrobacterium strains employed; internodal segments performed better than leaves. Of the strains employed for cocultivation, A. rhizogenes LBA 9402 carrying pRi 1855 was the most virulent and infectious, causing hairy root induction in the maximum number of explants regardless of their type. Individual root clones (rhizoclones were maintained on Murashige and Skoog's basal medium without growth regulators. The physical presence of the rolB gene in the TL-DNA segment of the Ri plasmid of the infecting Agrobacterium in leaf tissues of plants regenerated from selected rhizoclones was confirmed by a positive PCR amplification. The ability of the genetically transformed plants to harbour and express TR-DNA specific opine synthase genes (man2 and ags was substantiated by PCR and opine assay respectively, demonstrating the production of characteristic opines. Such findings are implicated in the context of pharmaceutical exploitation of transformed root cultures of A. spinosus and also towards protecting this nutraceutically important crop, amaranth, against biotic stress challenges via transgenic manipulations.

  8. Li tter Fall i n A Pri mary an d Two Logged -over Lowland Tropical Rainfore sts in Pasirmayang, Jam bi.

    Directory of Open Access Journals (Sweden)

    UPIK ROSALI NA WAS R IN

    1999-01-01

    Full Text Available Litte r accu mulatio n in a prim ary and a log g ed-ove r lo wland dipterocarp fore st at Pa si rmayang, Ja mbi wa s measu red u sin g the litte r trap met hod . In the p rimary fore st , tra p s were placed in fou r d istinc t areas, reflectin g th e su ccess ion stages of the fo rest fr om building t o mat u ration. In the logged-over fo re st , litter p roduc tion w a s measured at two differe nt si tes, one cut in 197 9/1980 a nd t h e second i n 1 983/1984. In the prim ary fore st , ave rage litter production during the ob serv ation period wa s 925 g m"2yr '. In the lo gged -over f o r e st , ave rage l itte r production wa s 721 g m '2 yr1 for t h e sit e cut in 1979 /198 0 and 70 6 g m '2 yr1 f o r the site cut in 19 83/1 984 . Leave s com p ri sed the major con tri butor of litter wit h 67% of tota l litter produced in t h e pri m ary forest, 67% of total litter i n the 1979/ 1980 cut log g ed-o ver fore st, and 65 % of total li tter in the 1983/1984 cut logged-over fore st . The pu rp ose of the stu dy wa s to use litte r fa ll a s a measure of forest pro ductivi ty to a ssess the recovery of log g ed -over forests and , t o pro v ide a basi s for co mpariso n o f forest-de rived land practices for app ropriate fo re st manage ment stra tegies .

  9. Support Group for Parents Coping with Children with Type 1 Diabetes / Skupina Za Starše Kot Podpora Družinam Pri Soočanju Z Otrokovo Sladkorno Boleznijo Tipa 1

    Directory of Open Access Journals (Sweden)

    Pate Tanja

    2015-03-01

    Full Text Available Izhodišče. Sladkorna bolezen tipa 1 je ena izmed pogostejših kroničnih bolezni v otroštvu. Optimalno vodenje in presnovna urejenost otrokove sladkorne bolezni sta povezana z aktivno vključenostjo staršev/ skrbnikov, podporo otroku pri nadzoru nad boleznijo in funkcionalnostjo družine. Raziskava predstavlja oceno zadovoljstva staršev s programom skupine za starše in njihovo doživljanje vpliva omenjenega programa na življenje otroka in spoprijemanje z njegovo SBT1.

  10. Razvijanje organizacijskih in učnih spretnosti pri učenki z učnimi težavami, ki počasneje usvaja znanja

    OpenAIRE

    Mauko, Katja

    2017-01-01

    Učenci z učnimi težavami, ki počasneje usvajajo znanja, so učenci, ki imajo mejne in podpovprečne intelektualne sposobnosti. Pri njih je opaziti večjo splošno nezrelost in težave na področjih, kot so koncentracija, kratkotrajno in dolgotrajno pomnjenje, metakognicija, motivacija, socialna integracija, izvršilne funkcije idr. Eno izmed področij, na katerem imajo ti učenci težave, je tudi področje organizacije. Dobro razvite organizacijske spretnosti pa so zelo pomembne, saj vplivajo na številn...

  11. beta-Diiminato complexes of arsenic including the formally AsI compound [As3L3] [L = [N(C6H3Pri2-2,6)C(H)]2CPh].

    Science.gov (United States)

    Hitchcock, Peter B; Lappert, Michael F; Li, Gang; Protchenko, Andrey V

    2009-01-28

    The reaction of the potassium beta-diiminate KL (L = [[N(Ar)C(H)](2)CPh](-); Ar = C(6)H(3)Pr(i)(2)-2,6) with AsI(3) gave [AsI(2)L] (1), which upon reduction with KC(8) produced [(kappa(1)-L)(2)As-As[double bond, length as m-dash]As(kappa(2)-L)] (2), having a unique bent chain of the three arsenic atoms in the formal oxidation states +2, 0 and +1.

  12. A Simple and High-Throughput Analysis of Amatoxins and Phallotoxins in Human Plasma, Serum and Urine Using UPLC-MS/MS Combined with PRiME HLB μElution Platform

    Directory of Open Access Journals (Sweden)

    Shuo Zhang

    2016-05-01

    Full Text Available Amatoxins and phallotoxins are toxic cyclopeptides found in the genus Amanita and are among the predominant causes of fatal food poisoning in China. In the treatment of Amanita mushroom poisoning, an early and definite diagnosis is necessary for a successful outcome, which has prompted the development of protocols for the fast and confirmatory determination of amatoxins and phallotoxins in human biological fluids. For this purpose, a simple, rapid and sensitive multiresidue UPLC-MS/MS method for the simultaneous determination of α-amanitin, β-amanitin, γ-amanitin, phalloidin (PHD and phallacidin (PCD in human plasma, serum and urine was developed and validated. The diluted plasma, serum and urine samples were directly purified with a novel PRiME technique on a 96-well μElution plate platform, which allowed high-throughput sample processing and low reagent consumption. After purification, a UPLC-MS/MS analysis was performed using positive electrospray ionization (ESI+ in multiple reaction monitoring (MRM mode. This method fulfilled the requirements of a validation test, with good results for the limit of detection (LOD, lower limit of quantification (LLOQ, accuracy, intra- and inter-assay precision, recovery and matrix effects. All of the analytes were confirmed and quantified in authentic plasma, serum and urine samples obtained from cases of poisoning using this method. Using the PRiME μElution technique for quantification reduces labor and time costs and represents a suitable method for routine toxicological and clinical emergency analysis.

  13. A Simple and High-Throughput Analysis of Amatoxins and Phallotoxins in Human Plasma, Serum and Urine Using UPLC-MS/MS Combined with PRiME HLB μElution Platform.

    Science.gov (United States)

    Zhang, Shuo; Zhao, Yunfeng; Li, Haijiao; Zhou, Shuang; Chen, Dawei; Zhang, Yizhe; Yao, Qunmei; Sun, Chengye

    2016-05-04

    Amatoxins and phallotoxins are toxic cyclopeptides found in the genus Amanita and are among the predominant causes of fatal food poisoning in China. In the treatment of Amanita mushroom poisoning, an early and definite diagnosis is necessary for a successful outcome, which has prompted the development of protocols for the fast and confirmatory determination of amatoxins and phallotoxins in human biological fluids. For this purpose, a simple, rapid and sensitive multiresidue UPLC-MS/MS method for the simultaneous determination of α-amanitin, β-amanitin, γ-amanitin, phalloidin (PHD) and phallacidin (PCD) in human plasma, serum and urine was developed and validated. The diluted plasma, serum and urine samples were directly purified with a novel PRiME technique on a 96-well μElution plate platform, which allowed high-throughput sample processing and low reagent consumption. After purification, a UPLC-MS/MS analysis was performed using positive electrospray ionization (ESI+) in multiple reaction monitoring (MRM) mode. This method fulfilled the requirements of a validation test, with good results for the limit of detection (LOD), lower limit of quantification (LLOQ), accuracy, intra- and inter-assay precision, recovery and matrix effects. All of the analytes were confirmed and quantified in authentic plasma, serum and urine samples obtained from cases of poisoning using this method. Using the PRiME μElution technique for quantification reduces labor and time costs and represents a suitable method for routine toxicological and clinical emergency analysis.

  14. Evasion spirituelle autorisée : en détention, prière de réinsérer Spiritual escape: in jail, prayer for rehabilitation

    Directory of Open Access Journals (Sweden)

    Sara Liwerant

    2009-04-01

    Full Text Available Comment le droit français envisage la prière dans ses prisons républicaines ? Une lecture attentive du Code de procédure pénale révèle que l’exercice religieux en prison est reconnu au titre de la réinsertion et non comme une liberté individuelle. Entendue essentiellement comme un exercice collectif, les prières justifient des aménagements de la détention afin de répondre aux exigences du principe d’égalité et à l’horizon obligé de la réinsertion.How does the French law perceive the question of the prayer in prison? A analysis of the "penal process" reveals that the notion of rehabilitation justifies the right to exercice a religious belief and is not perceived as an individual right. The law recognises that the allowance of prayer in prison encourages rehabilitation and yet respects the principal of non-discrimination as a collective activity and not as an act of faith.

  15. Animal Representations on Ceremonial Objects Found in the Tumulus at Črnolica pri Šentjurju at the Foot of Rifnik

    Directory of Open Access Journals (Sweden)

    Iztok Vrenčur

    2013-07-01

    Full Text Available The years 1985 and 1986 saw a rescue excavation by archaeologists from the Institute for the Protection of Cultural Heritage of Slovenia, Celje Regional Office, performed on the severely damaged Iron Age tumulus in the village of Črnolica pri Šentjurju. The village lies in the close vicinity of the Rifnik hill, the site of one of the largest known hilltop settlements in Slovenia dating from the Late Bronze and Iron Ages. The excavation in Črnolica yielded a stone grave chamber of monumental dimensions, together with fragmented and decontextualised grave goods. These included a large set of quality ceramic vessels, a considerable number of bronze vessels, glass cups, fibulae, and a horse harness. Of special importance are three bronze items fabricated in Etruria, which carry the protomas of an aquatic bird, horses, and a ram. The burial dates to the Hallstatt C2 period or the second half of the 7th century BC. Aquatic birds are positioned on all four vertexes of the presentatoio, a special type of vessel presumably used for libation rituals. Comparable items have come to light in the richest graves of the Iron Age aristocracy of Etruria, Latium Vetus and Bologna, and date to the end of the 8th and the beginning of the 7th centuries BC. The aquatic bird sculptures on the presentatoio are stylised, displaying features of the Late Italic Geometric style. This motif marks various Late Bronze and Iron Age items associated with ritual activities in the greater part of Europe, connecting them with prehistoric religious beliefs. While the assumption that they refer to the sun divinisation cult is not proven, they must have signified some prehistoric aspect of the holy or numinous. The two anthropomorphic legs with an attached horse protoma found in the Črnolica tumulus were reconstructed as a part of a tripod of small dimensions, which can be classified as a member of the so-called horse tripod family, fine products of the Italic Geometric style

  16. Anxiety, Self-Esteem and Coping With Stress in Secondary School Students in Relation to Involvement in Organized Sports / Anksioznost, Samospoštovanje In Spoprijemanje S Stresom Pri Srednješolcih V Povezavi Z Vključenostjo V Organizirano Športno Aktivnost

    Directory of Open Access Journals (Sweden)

    Dolenc Petra

    2015-09-01

    Full Text Available Cilj. Namen raziskave je bil preučiti raven samospoštovanja in anksioznosti ter uporabo različnih strategij spoprijemanja s stresom pri srednješolskih mladostnikih v povezavi z vključenostjo v redno in organizirano športno vadbo.

  17. Perfil político de los diputados mexicanos federales del pan y pri de la LXI Legislatura: apuntes para un estudio cualitativo de los políticos

    Directory of Open Access Journals (Sweden)

    Mónica Montaño Reyes

    2014-01-01

    Full Text Available El descontento ante la democracia ha pro - vocado que el estudio del capital humano que dirige las instituciones representativas cobre relevancia. En este artículo se analiza el perfil político de 382 diputados federales del Partido Acción Nacional ( pan y del Partido Revolucionario Institucional ( pri de la lxi Legislatura. El análisis contem - pla sus competencias profesionales, su trayectoria y su experiencia política. Los resultados muestran datos relevantes sobre los personajes que ejercen los puestos de representación política en México; la revisión de sus competencias personales y de su trayectoria profesional lleva a concluir que la carrera política es un factor de gran importancia para el mejor funcionamiento de la democracia representativa.

  18. Zakotvená teória ako východisko pri hľadaní učiteľových stratégií k udržaniu svojej roly v triede

    Directory of Open Access Journals (Sweden)

    Csaba Igaz

    2013-10-01

    Full Text Available Článok sa zaoberá možnosťami využitia zakotvenej teórie pri kvalitatívnej analýze vyučovacích hodín s cieľom identifikovať rolu učiteľa a stratégie, ktoré umožňujú udržanie tejto roly. Takáto analýza sa môže využiť pri zavádzaní nových metód a prostriedkov do vyučovacieho procesu, kedy charakteristika rozdielov v správaní sa učiteľa počas bežnej vyučovacej hodiny a hodiny, v ktorej sa uplatňujú nové metódy nám umožní odhaliť ich slabé stránky. V príspevku sa podrobne venujeme postupu analýzy vyučovacích hodín. Na konkrétnych príkladoch vysvetlíme nielen aplikáciu otvoreného, axiálneho a selektívneho kódovania ale aj tzv. prechodnej úrovne kódovania, ktorá predstavuje nový prvok v zakotvenej teórií.

  19. Preliminary evidence for association of genetic variants in pri-miR-34b/c and abnormal miR-34c expression with attention deficit and hyperactivity disorder.

    Science.gov (United States)

    Garcia-Martínez, I; Sánchez-Mora, C; Pagerols, M; Richarte, V; Corrales, M; Fadeuilhe, C; Cormand, B; Casas, M; Ramos-Quiroga, J A; Ribasés, M

    2016-08-30

    Attention deficit and hyperactivity disorder (ADHD) is a prevalent neurodevelopmental disorder characterized by impairment to sustain attention and inability to control impulses and activity level. The etiology of ADHD is complex, with an estimated heritability of 70-80%. Under the hypothesis that alterations in the processing or target binding of microRNAs (miRNAs) may result in functional alterations predisposing to ADHD, we explored whether common polymorphisms potentially affecting miRNA-mediated regulation are involved in this psychiatric disorder. We performed a comprehensive association study focused on 134 miRNAs in 754 ADHD subjects and 766 controls and found association between the miR-34b/c locus and ADHD. Subsequently, we provided preliminary evidence for overexpression of the miR-34c-3p mature form in peripheral blood mononuclear cells of ADHD subjects. Next, we tested the effect on gene expression of single-nucleotide polymorphisms within the ADHD-associated region and found that rs4938923 in the promoter of the pri-miR-34b/c tags cis expression quantitative trait loci for both miR-34b and miR-34c and has an impact on the expression levels of 681 transcripts in trans, including genes previously associated with ADHD. This gene set was enriched for miR-34b/c binding sites, functional categories related to the central nervous system, such as axon guidance or neuron differentiation, and serotonin biosynthesis and signaling canonical pathways. Our results provide preliminary evidence for the contribution to ADHD of a functional variant in the pri-miR-34b/c promoter, possibly through dysregulation of the expression of mature forms of miR-34b and miR-34c and some target genes. These data highlight the importance of abnormal miRNA function as a potential epigenetic mechanism contributing to ADHD.

  20. Doenças priônicas: avaliação dos riscos envolvidos na utilização de produtos de origem bovina Prionic disease: evaluation of the risks involved in using products of bovine origin

    Directory of Open Access Journals (Sweden)

    Omar Lupi

    2003-02-01

    Full Text Available Os príons são proteínas que se mostram capazes de auto-replicação apesar de, para isso, alterar o metabolismo celular. São responsáveis por inúmeras doenças em animais e no ser humano (doenças priônicas, todas elas fatais. Essas moléstias apresentam enorme variabilidade quanto ao período de incubação, de alguns meses a 40 anos. Os príons acumulam-se e destroem os neurônios, provocando quadros conhecidos como encefalopatias espongiosiformes. Discute-se a apresentação clínica, epidemiológica e histórica das doenças priônicas. O foco maior de discussão recai, no entanto, na possibilidade teórica da transmissão iatrogênica dos príons por meio das formulações tópicas que utilizam ceramidas (cerebrosídeos ou placenta de origem bovina, assim como pelo risco representado por alguns procedimentos dermatológicos, como transplantes da pele e implantes de colágeno.A prion is a protein that is capable of self replication, thereby altering a cell's metabolism. It is responsible for a number of human and animal diseases (prionic diseases, all of which are always lethal. These diseases have enormous variability in their incubation periods, ranging from a few months to forty years. Prions accumulate and destroy nerve cells, causing spongiform encephalopathy. We discuss the clinical picture, epidemiology, and historical background of prionic diseases. The major focus of the discussion lies, however, on the theoretical possibility of iatrogenic transmission of prion infection due to topical formulations using ceramides (cerebrosides or placenta of bovine origin, as well as the risk represented by some dermatological procedures such as skin grafts and collagen implants.

  1. Cold distribution networks. Cold distribution by two-phase refrigerant fluid. Case of ice slurries; Reseaux de distribution de froid. Distribution de froid par fluide frigoporteur diphasique. Cas du coulis de glace stabilisee (2002 - 2004). Rapport final (1er juillet 2004). Programme energie. PRI 9.1

    Energy Technology Data Exchange (ETDEWEB)

    Lallemand, A. [Institut National des Sciences Appliquees (INSA), Centre de Thermique de Lyon (CETHIL), UMR 5008, 69 - Villeurbanne (France); Mercier, P. [CEA Grenoble, Groupement pour la Recherche sur les Echangeurs Thermiques (GRETH), 38 (France); Royon, L. [Paris-1 Univ., Lab. de Biorheologie et d' Hydrodynamique Physico-Chimique, 75 (France); Dumas, J.P. [L' Ecole Nationale Superieure en Genie des Technologies Industrielles, Lab. de Thermique Energetique et Procedes, 64 - Pau (France); Guilpart, J. [URGPAN/CEMAGRE, 33 - Bordeaux (France)

    2004-07-01

    This PRI aims to participate to the development of alternate solutions for refrigerant fluids, for the cold transport and more specially a two phase refrigerant fluid: the stabilized ice slurry. The research program presented three main axis: design, realization and characterization of stabilized ice slurry, experimental studies of transport and transfer properties, study of online measurement process of the solid content. A simulation has been realized to evaluate the energy efficiency of this refrigerant use. (A.L.B.)

  2. STRES PRI ZAPOSLENIH V ORGANIZACIJI "x"

    OpenAIRE

    Slaček, Doris

    2014-01-01

    Diplomski seminar temelji na obravnavi aktualnega problema, to je stres oziroma stres na delovnem mestu, s katerim se v sodobnem času spopada vsa družba na vseh področjih svojega življenja. Podrobneje smo se osredotočili na stres na delovnem mestu v izbrani organizaciji »x«. Stres ne prinaša negativnih posledic samo posameznikom, ampak so tega deležne tudi same organizacije, kar se kaže v dodatnih stroških organizacije ali kot izguba prihodkov. Stresorji na delovnem mestu so največkrat čas...

  3. Vernost reprodukcije boja pri digitalizaciji slikovnih podataka

    OpenAIRE

    Živković, Predrag; Vujaklija, Vanja

    2006-01-01

    This paper emphasis the importance of standardization of digitalization process, in the particular case digitalization the colorized object, when information of object color is of great impotence. Some prepositions for standardization of digitalization process of colorized objects are also explained.

  4. The Prying Eye: Ethics of Photojournalism.

    Science.gov (United States)

    Mundt, Whitney R.; Broussard, E. Joseph

    A national sample of journalists, consisting of 700 television news photographers, newspaper photographers, television news directors, newspaper editors, and journalism educators, was asked to evaluate the ethical conduct in eight situations involving alleged invasion of privacy by photography. The respondents found journalistic conduct to be…

  5. Uporaba kamere Pixy pri vodenju robota

    OpenAIRE

    TITAN, UROŠ

    2016-01-01

    V diplomskem delu smo obravnavali delovanje kamere Pixy in pokazali, kako je iz podatkov, ki nam jih posreduje, mogoče izračunati razdaljo med kamero in objektom. Za programiranje robota smo v nadaljevanju v programskem okolju Lego Mindstorms EV3 Home Edition opisali funkcijske bloke, povezane s kamero. Opisali smo tudi funkcijski blok za PID regulator in pokazali, kako izračunamo njegove parametre za reguliranje motorjev Lego. V empiričnem delu smo preizkusili praktično del...

  6. O svetih genealogijah pri Antigoni in Savitri:

    OpenAIRE

    Škof, Lenart

    2015-01-01

    This article deals with the ethical significance of unwritten laws in ancient Greek religion and in the play Antigone. The interpretation focuses on Antigone as read by Luce Irigaray. The second part of the article features a comparative study of Savitri's role in the Indian epic poem the Mahabharata, which proves that the legend of Savitri is characterized by similar cosmic relations or symbols as the religious background in Antigone. Članek se ukvarja z etičnim pomenom nenapisanih zakono...

  7. Comparison of the Method of Least Squares and the Simplex Method for Processing Geodetic Survey Results / Porovnanie Metódy Najmenších Štvorcov A Simplexovej Metódy Pri Spracovaní Výsledkov Geodetických Meran

    Directory of Open Access Journals (Sweden)

    Gašincová Silvia

    2013-09-01

    Full Text Available Predložený príspevok je venovaný použitiu simplexovej metódy pri spracovaní výsledkov geodetických meraní v porovnaní so štandardne používanou metódou najmenších štvorcov (MNŠ. Minimalizačný problém je pri simplexovej metóde zvyčajne riešený tabuľkovou formou, preskupovaním stĺpcov a riadkových operácií, ktorých cieľom je nájdenie optimálneho riešenia. V príspevku je poukázané na numericky nenáročnejšiu, stabilnejšiu a efektívnejšiu cestu riešenia problému lineárneho programovania pomocou maticových vzťahov.

  8. Analysis of the putative Cr-Cr quintuple bond in Ar'CrCrAr' (Ar' = C6H3-2,6(C6H3-2,6-Pr(i)2)2 based on the combined natural orbitals for chemical valence and extended transition state method.

    Science.gov (United States)

    Ndambuki, Sylvester; Ziegler, Tom

    2012-07-16

    The nature of the putative Cr-Cr quintuple bond in Ar'CrCrAr' (Ar' = C(6)H(3)-2,6(C(6)H(3)-2,6-Pr(i)(2))(2)) is investigated with the help of a newly developed energy and density decomposition scheme. The new approach combines the extended transition state (ETS) energy decomposition method with the natural orbitals for chemical valence (NOCV) density decomposition scheme within the same theoretical framework. The results show that in addition to the five bonding components (σ(2)π(2)π'(2)δ(2)δ'(2)) of the Cr-Cr bond, the quintuple bond is augmented by secondary Cr-C interactions involving the Cr-ipso-carbon of the flanking aryl rings. The presence of isopropyl groups (Pr(i)) is further shown to stabilize Ar'CrCrAr' by 20 kcal/mol compared to the two Ar'Cr monomers through stabilizing van der Waals dispersion interactions.

  9. El silenciamiento de la proteína priónica celular (PrPC mediante RNA de interferencia (siRNA reduce la infección por HSV-1 y HSV-2 en células SK-SY5Y

    Directory of Open Access Journals (Sweden)

    Elizabeth Ortega-Soto

    2012-01-01

    Full Text Available Las encefalopatías espongiformes transmisibles (EETs son enfermedades neurodegenerativas fatales que afectan a humanos y ciertas especies animales. La hipótesis más aceptada indica que el agente infeccioso, denotado como prion y compuesto principalmente por la Proteína Priónica Scrapie (PrPSc, corresponde a una conformación anormal de una proteína codificada por el huésped denominada Proteína Priónica Celular (PrPC, cuya función es aún desconocida; sin embargo, la expresión ubicua de PrPC así como su elevado grado de conservación entre especies, sugieren un papel importante para esta proteína. En este trabajo se detectó a la PrPC en diferentes tipos celulares incluyendo un cultivo primario de células de peces (Tilapia, Oreochromis spp.. Además, basándonos en la secuencia de la PrPC humana, se diseñó un RNA de interferencia (siRNA con el fin de silenciar el gen PRNP en células neuronales SK-SY5Y. El siRNA diseñado inhibió la expresión de PrPC a lo largo de las 96 h post-transfección y las células silenciadas fueron menos susceptibles a la infección por HSV-1 y HSV-2, en comparación con células no transfectadas con el siRNA.

  10. Report of the PRI biofuel-ethanol; Rapport du PRI biocarburant-ethanol

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    This evaluation report presents three research programs in the framework of the physiological behavior of the yeast ''Saccharomyces cerevisiae'', with high ethanol content. These studies should allowed to select an efficient yeast for the ethanol production. The first study concerns the development of an enzymatic process for the hydrolysis and the fermentation. The second study deals with the molecular and dynamical bases for the yeast metabolic engineering for the ethanol fuel production. The third research concerns the optimization of performance of microbial production processes of ethanol. (A.L.B.)

  11. Metodologija postavljanja diferencijalnih jednačina pri istraživanju dinamičkih parametara konstrukcije lansirne rampe na vozilu točkašu / Methodology make of differential equations at investigation of dynamic parameters of constructions of launcher on vehicle

    Directory of Open Access Journals (Sweden)

    Vlado P. Đurković

    2007-07-01

    Full Text Available U radu se određuju optimalni parametri konstrukcije lansirne rampe: položaj tačke vešanja hidrocilindra na rampi, dužina i materijal rampe, koeficijent viskoznog trenja ulja u hidrocilindru, koeficijent krutosti lansirne rampe i hidrocilindra, poprečni presek rampe, itd. Radi toga postavlja se mehanički model sa tri stepena slobode kretanja i odgovarajući model u vidu sistema od tri nelinearne diferencijalne jednačine drugog reda. Numeričkom analizom dobijenog matematičkog modela (primenom programskog jezika Compaq Visual Fortran, Version 6.5 dolazi se do optimalnosti pojedinih parametara. Dobijeni rezultati, predstavljeni u grafičkoj formi, mogu da budu veoma korisni projektantima raketnih lansera, kako stabilnih, tako i mobilnih, pri razvoju novih konstrukcija i modifikaciji postojećih. / This paper determines optimal construction parametrics of a missile launcher place of hydro-cylinder on launcher, length and material of ramp of launcher coefficient of the viscosity of friction oil in hydro-cylinder, coefficient of stiffness of launcher and hydro-cylinder, cross-section of launcher etc. In this purpose appointment mechanical model with three degrees of freedom motion and analogous model of system of three nonlinear differential equation second order. Numerical analysis obtained mathematical model (programming with language Compaq Visual Fortran, Version 6.5 coming to optimal parameters. Obtained results that are presented in graphical shapes can be very useful for designing stable and mobile missile launchers, both for development of new constructions and modification of existing structures.

  12. ODLOČITVENI MODEL ZA POMOČ PRI IZBIRI ERP SISTEMA

    OpenAIRE

    Golob, Miha

    2009-01-01

    Pogosto se v organizacijah pojavi problem, kateri ERP (Enterprise Resource Planning) sistem izbrati za implementacijo. Na rast in uspešnost podjetij v veliki meri vpliva optimizacija poslovnih procesov. Sodobni ERP sistemi omogočajo podjetjem celovito informacijsko podporo, od dela s kadri, pregleda nad celotnim poslovanjem podjetja, do načrtovanja proizvodnje. Podjetja se običajno odločijo za takšne ERP sisteme, ki pokrijejo večino poslovnih funkcij in procesov v podjetju in so na voljo po z...

  13. Kalman Filter Predictor and Initialization Algorithm for PRI Tracking

    National Research Council Canada - National Science Library

    Hock, Melinda

    1998-01-01

    .... The algorithm uses a Kalman filter for prediction combined with a preprocessing routine to determine the period of the stagger sequence and to construct an uncorrupted data set for Kalman filter initialization...

  14. DISKRIMINACIJA PRI ZAPOSLOVANJU IN DELU NA PODLAGI SPOLNE USMERJENOSTI

    OpenAIRE

    Markovič, Polona

    2012-01-01

    Ustavno zagotovljena pravica do enakosti, brez kakršnegakoli razlikovanja na podlagi osebnih okoliščin, predstavlja eno izmed temeljnih človekovih pravic. Za zagotavljanje enakega obravnavanja posameznikov in različnih skupin oseb na vseh področjih družbenega življenja je neizogibno potrebna natančna zakonska opredelitev varstva pred diskriminacijo. Prepoved diskriminacije je pravno regulirana v določilih mnogih dokumentov, sprejetih na mednarodni in nacionalni ravni. Diskriminacijo lahko naj...

  15. Fyzioterapia pri paréze nervus facialis

    OpenAIRE

    DANANAJOVÁ, Lucia

    2011-01-01

    The subject of this bachelor?s thesis is physiotherapy for peripheral paralysis of a facial nerve (nervus facialis), specifically Bell?s palsy. This is a paralysis of the mimetic muscles affecting an entire half of a face. It is typified by a rapid onset, usually on waking in the morning, and normally follows a predictable course. The most notable objective symptom is a marked facial asymmetry together with a complete change in the facial expression. For most patients prognosis is good, many ...

  16. Okeanos Explorer (EX1607): CAPSTONE Wake Island PRI MNM (Mapping)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Operations will include 24 hour/day mapping operations using the ship’s deep water mapping systems (Kongsberg EM302 multibeam sonar, EK60 split-beam fisheries...

  17. ODKRIVANJE GOVORNO-JEZIKOVNIH MOTENJ PRI 5-LETNIKIH

    OpenAIRE

    Brec, Barbara

    2016-01-01

    Govorno-jezikovnih težav je v zadnjih nekaj letih vse več, kljub temu pa jih danes logopedi hitreje odkrijejo in odpravijo. Na kvaliteto logopedske obravnave vplivajo predvsem višji nivo znanja, večje število raziskav in odkritij, novi merski instrumenti, diagnostična sredstva ter poznavanje dejavnikov, ki vplivajo na govor. Prav tako se govorne in jezikovne težave hitreje odpravijo, če gre za zgodnje odkritje, ko je otrok še majhen. Preventiva oziroma sistematični pregledi so zato izredno po...

  18. Presoja vplivov na zasebnost pri razvoju pametnih tehnologij

    OpenAIRE

    ZAVRL, TOMAŽ

    2016-01-01

    Informacijski sistemi, nas pogosto nezavedno spremljajo na vsakem koraku. Kolikokrat se, ob pogledu na video kamero nad pločnikom, zamislimo in vprašamo, čemu je ta kamera namenjena? Kam se prenaša slika? Kdo sedi za ekranom in spremlja dogajanje? Je slika shranjena? Ali obstaja mehanizem, ki prepozna obraz in ugotavlja, kdo in kdaj hodi po pločniku? S takimi in podobnimi vprašanji, bi se v sodobnem času moral ukvarjati vsakdo. Še posebno se morajo z njimi ukvarjati razvijalci informacijsk...

  19. PRiFi Networking for Tracking-Resistant Mobile Computing

    Science.gov (United States)

    2017-11-01

    of an organization to access the Internet anonymously while they are on- site, via privacy-preserving WiFi networking, or off-site, via privacy...client messages based on the history of all messages they have received so far. As a result, any equivocation attempt makes the communication...model, threat models, and goals of the protocol. Our system model comprises a set of n clients (or users) who want to access the Internet anonymously

  20. Do PRI ao sistema plural na transição mexicana From PRI's hegemony to a plural system in the mexican transition

    Directory of Open Access Journals (Sweden)

    Nelson Rojas de Carvalho

    1997-08-01

    Full Text Available Os resultados das eleições mexicanas de 6 de julho deste ano devem ser compreendidos à luz das políticas de ajuste e de reforma do Estado implementadas por De La Madrid e Salinas de Gortari. A reforma do Estado minou o partido de Estado: a perestroika mexicana acabou por produzir sua glasnostThe outcome of this year's Mexican elections must be understood from the perspective of the structural reform policies put into practice by presidents De La Madri and Salinas de Gortari. The reform of the State undermined the state party: the Mexican perestroika produced its own glasnost.

  1. Organizacija inžinjerijskih radova pri rušenju deonice puta / Organization of engineering works during demolition of a road section / Организация инженерных работ по демонтажу участков дорог

    Directory of Open Access Journals (Sweden)

    Nenad V. Kovačević

    2016-01-01

    Full Text Available Prilikom upotrebe minsko-eksplozivnih sredstava za rušenje elemenata, materijala i objekata jako je bitna organizacija izvođenja radova prilikom pripreme i u toku izvođenja samog rušenja. Za izvođenje ovih radova u Vojsci Srbije postoje specijalizovane i namenske jedinice. Radi se o jedinicama jedne od specijalnosti u okviru roda inžinjerije, pionirske specijalnosti, koje egzistiraju u okviru inžinjerijskih bataljona, odnosno brigada KoV. Organizacija inžinjerijskih radova zapravo predstavlja iznalaženje najcelishodnijeg rešenja u pogledu upotrebe pokretnih stvari, ali i naprezanja ljudstva, pri rušenju konkretnog objekta – deonice puta. Pri tome veliki problem predstavlja literatura, a posebno norme za izvođenje radova, jer izuzev nekoliko skripti za internu upotrebu, sve se svodi na literaturu iz sedamdesetih ili početak osamdesetih godina prošlog veka. Posebno je razrađena primena mera zaštite prilikom upotrebe eksploziva. / When using explosive ordnance for the demolition of elements, materials and facilities, organization is very important in the preparation of works as well as during demolition itself. In the Army of Serbia, for this kind of works, there are specialized expert units within Land Forces engineering battalions or brigades. The organization of the engineering work given in the article is a purposeful solution, regarding the use of movable property and stress imposed on people as well, when performing demolition of a concrete structure - road section. Lack of literature is a big drawback, especially lack of norms for demolition works. Except for some unofficial lectures for internal use, most of the literature dates back to the seventies or early eighties. A special emphasis in this paper is given to the application of protective measures in the use of explosives. / В процессе применения минно-взрывных средств для сноса элементов, материалов

  2. JPRS Report Science & Technology USSR: Chemistry

    Science.gov (United States)

    1991-09-26

    Grebennikov ; KHIMICHESKIYE VOLOKNA, No 6, Nov-Dec 90] 14 Polymer Composite Materials Reinforced With Aramid Fabric (N.M. Grad, V.N. Pershikov, et al...Fridman, S. F. Grebennikov ] UDC 677.529.661.183 [Abstract] Carbon-fiber adsorbents with 6- to 12- um-diameter elementary fibers, variable and homoge

  3. ODNOS ADMINISTRATIVNEGA OSEBJA NA VISOKOŠOLSKIH ZAVODIH V SLOVENIJI DO VEČOPRAVILNOSTI PRI DELU

    OpenAIRE

    ROBIDA, MATEJA

    2017-01-01

    Večopravilnost je človekova zmožnost, da opravlja več nalog hkrati oz. v kratkem časovnem obdobju. Večopravilnost lahko povzroči neučinkovito porabo časa zaradi preklapljanja med nalogami, s tem pa očitno povzroča več napak zaradi nezadostne pozornosti. Tuje študije so pokazale, da se človek težje osredotoči na več kot eno nalogo naenkrat. Negativne posledice, ki spremljajo preklapljanje, so stres, izguba motivacije za dokončanje prvotne naloge, pojavljanje napak, duševna utrujenost, pojav...

  4. Trudovye resursy poslevoennoj Litvy i ih ispol'zovanie pri vosstanovlenii Klajpedy

    Directory of Open Access Journals (Sweden)

    Kretinin G. V.

    2014-05-01

    Full Text Available This article focuses on the issues of post-WWII economic restoration effort in the Soviet Lithuania. German occupation of the republic caused significant damage to its industry and agriculture. Pre-war Lithuania was an agrarian state aspiring to embark on an industrial-agrarian path of development. After the war, this aspiration did not only persist, but was intensified. To reach this objective, however, Lithuania required qualified workforce. Before the war, hardly any attention was paid to the training of workers for industrial-scale production and construction. Then, a considerable decrease in population during the war aggravated the already substantial labour shortage. The attempts of the republic’s leadership to solve the problems of labour shortage through organised labour migration and labour mobilisation yielded no significant results. The appeals to the Centre with the request to send a substantial number of specialists and workers to Lithuania were heard, but a state ravaged by war did not have sufficient human resources. One of the solution was the use of labour of German prisoners of war. A network of prisoner-of-war camps was established in Lithuania. In a matter of two to three years, PWs completed a significant amount of work aimed at the rebuilding of important infrastructural objects. The case of Klaipeda is used to demonstrate the opportunities of the region and Centre in organising workforce in the Lithuanian SSR. The study uses the data obtained by modern historiography and documents kept in the Lithuanian State Central Archive.

  5. Ca-Pri a Cellular Automata Phenomenological Research Investigation: Simulation Results

    Science.gov (United States)

    Iannone, G.; Troisi, A.

    2013-05-01

    Following the introduction of a phenomenological cellular automata (CA) model capable to reproduce city growth and urban sprawl, we develop a toy model simulation considering a realistic framework. The main characteristic of our approach is an evolution algorithm based on inhabitants preferences. The control of grown cells is obtained by means of suitable functions which depend on the initial condition of the simulation. New born urban settlements are achieved by means of a logistic evolution of the urban pattern while urban sprawl is controlled by means of the population evolution function. In order to compare model results with a realistic urban framework we have considered, as the area of study, the island of Capri (Italy) in the Mediterranean Sea. Two different phases of the urban evolution on the island have been taken into account: a new born initial growth as induced by geographic suitability and the simulation of urban spread after 1943 induced by the population evolution after this date.

  6. VLOGA IZOBRAŽEVANJA PRI IZPOSTAVLJENOSTI ŠKODLJIVIM VIROM SEVANJA NA DELOVNEM MESTU

    OpenAIRE

    Zabukovec, Jasmina

    2016-01-01

    Kakovost in varnost predstavljata sestavni in pomemben del našega vsakdanjega dela. Zaradi razvoja medicinske tehnologije in s tem tudi novih postopkov dela se moramo vseživljenjsko izobraževati. Poraja pa se vprašanje, kako smo usposobljeni na področju lastne varnosti in izpostavljenosti škodljivim vplivom na delovnem mestu. V teoretičnem delu diplomske naloge so opisani škodljivi vplivi na delovnem mestu: ionizirajoče sevanje, sevanje na brahiradioterapiji, anestezijski plini, elektrokir...

  7. Odnos med telesno samopodobo in tveganjem za razvoj motenj hranjenja pri mladostnikih

    OpenAIRE

    Omerza, Ana

    2017-01-01

    Adolescenca je kritično življenjsko obdobje, v katerem posameznik oblikuje svojo osebnost in se prvič sooči z odraslostjo, katere nekateri mladostniki še niso pripravljeni sprejeti, zato lahko pride do različnih težav. Posamezniki so takrat najbolj obremenjeni z zunanjim okoljem, ki jih obdaja – od vrstnikov, katerih mnenje se jim zdi zelo pomembno, pa vse do medijev, ki izpostavljajo ideal vitkosti, ki naj bi bil v družbi potreben, da bi bil uspešen. To lahko škoduje razvoju njihove (telesne...

  8. Optimizatsiya i intensifikatsiya insulinoterapii pri sakharnom diabete 2 tipa (klinicheskie rekomendatsii

    Directory of Open Access Journals (Sweden)

    I I Dedov

    2010-12-01

    Full Text Available По данным Государственного регистра больных сахарным диабетом, на 1 января 2009 года в России сахарный диабет (СД выявлен более чем у 3 миллионов человек, из них 2,7 миллиона приходится на 2 тип. Последние 15-20 лет интерес к выбору оптимальной терапии на всех этапах развития СД 2 типа возрастает. Это связано с одной стороны с появлением новых научных данных, а с другой стороны со всё увеличивающимися возможностями фармакологического воздействия у этой категории больных. В настоящее время специалисты выделяют 9 групп таблетированных и инъекционных препаратов. Эти данные представлены в одном из самых важных опубликованных за последнее время международных документов – совместном консенсусе Американской Диабетической Ассоциации (ADA и Европейской Ассоциации по исследованию диабета (EASD, а также в недавно опубликованном Консенсусе Американской Ассоциации Клинических Эндокринологов (AACE/ Американской Коллегии Эндокринологов (ACE. В этом обзорном документе специально оговаривается сравнение различных препаратов в виде следующего заявления: «В настоящее время недостаточно данных, чтобы поддержать рекомендацию по какому-то конкретному классу сахароснижающих препаратов или их комбинации в отношении влияния на предупреждение осложнений. Поэтому, справедливо судить и сравнивать сахароснижающие агенты, так же, как и их сочетание, в первую очередь по их способности снижать и поддерживать уровень HbA1c, а также по их безопасности, специфическим побочным эффектам, переносимости, удобстве в применении». Далее в документе подчеркивается особая роль инсулина в лечении СД, обосновывая это следующим: • инсулин является самым мощным сахароснижающим препаратом; • своевременное начало инсулинотерапии обеспечивает оптимальный контроль гликемии и, соответственно, улучшает прогноз СД 2 типа, замедляя развитие в организме необратимых изменений; • доказано влияние интенсивной инсулинотерапии на предупреждение развития сосудистых осложнений при диабете; • по мере прогрессирования диабета заболеванием труднее управлять; в этом плане инсулин даёт дополнительные преимущества, поскольку его действие не зависит от остаточной секреторной активности бета-клеток. В настоящих рекомендациях будут затронуты все этапы инсулинотерапии СД 2 типа: начало, оптимизация и интенсификация.

  9. Obrazovanie Vzroslykh pri Probleme Dosuga (Adult Education and the Problem of Leisure)

    Science.gov (United States)

    Darinskii, Anatolii V.

    1969-01-01

    Adult education in the Soviet Union must find flexible new methods, preferably including tourism or other elements of recreation, to raise adults' cultural standards and intellectualize their free time while helping them improve their work qualifications and professional skills. (Author/LY)

  10. E-BANČNIŠTVO ZA SAMOSTOJNE PODJETNIKE PRI NOVI KBM

    OpenAIRE

    Mlaker, Jasmina

    2010-01-01

    Razvoj e-poslovanja sovpada z razvojem računalniških omrežij, interneta in združevanja informacijske tehnologije. Področje na katerega je e-poslovanje imelo še posebej velik vpliv je področje bančništva. Banke so že od nekdaj polne transakcij, ki zahtevajo veliko mero natančnosti, le-to pa je moč doseči z ustrezno tehnologijo. Tako so le-te že zelo zgodaj v svoje poslovanje uvedle računalnike. Na podlagi uvedbe tovrstne tehnologije v bančništvo se je postopoma razvilo e-bančništvo. Pojem e-ba...

  11. Gledišta o kvaliteti pri upravljanju građevinskim projektom

    OpenAIRE

    Rutešić, Snežana; Praščević, Živojin; Đuranović, Petar

    2005-01-01

    Daju se osnovne napomene o kvaliteti i sustavima upravljanja kvalitetom. Ukratko su prikazani povijest, koncept i zahtjevi norma niza ISO 9000:2000. Analizirani su zahtjevi investitora s obzirom na kvalitetu građevine i proces njezine izgradnje te zahtjevi usmjereni na upravljanje projektima. Ispunjavanje tih zahtjeva osnovna je pretpostavka kvalitete projekta. Opisana je norma ISO 10006:2003 koja preporučuje uspješno obavljanje procesa usmjerenih prema upravljanju projektom.

  12. MEHANSKO IN KEMIČNO REDČENJE JABLANE (Malus domestica Borkh.) PRI SORTI 'PINOVA'

    OpenAIRE

    Kadivnik, Tamara

    2013-01-01

    Leta 2011 smo v Sadjarskem centru Maribor izvedli poskus redčenja cvetov in plodičev jablane. Za primerjavo smo vzeli standardno kemično redčenje in različne kombinacije mehanskega in kemičnega redčenja. Poskus je bil izveden na sorti 'Pinova', cepljeni na podlago M9. Nasad, v katerem smo opravili poskus, ima namakalni in oroševalni sistem ter protitočno mrežo. Namen poskusa je bil primerjati učinkovitost mehanskega redčenja s strojem Tree Darwin in standardnega kemičnega redčenja ter uspešno...

  13. EFFEKTIVNOST' VNUTRISUSTAVNOGO VVEDENIYa GENTAMITsINA PRI PODAGRIChESKOM ARTRITE

    Directory of Open Access Journals (Sweden)

    A. V. Orlov-Morozov

    2000-01-01

    Full Text Available Aim: То determine the efficacy of intraarticular injections of Gentamycin in gout arthtiris a randomized double blind, placebo-controlled trial was carried out. Material and methods: 27 patients answering the criteria of the definite gout diagnosis were randomly recruited from rheumatological clinic. The patients received an intraarticular injection of either 4- mg of Gentamycin in 4 ml of sterile 0.25% procaine or 5 ml of the vehicle alone. Results: It was found that weekly intraarticular injections of Gentamycin performed better than the inert vehicle alone over a 2-week period and were conjirmed during 4 week period of crossing-over. Conclusion: The possible mechanisms of Gentamycin activity are discussed. It is concluded, that intraarticular administration of Gentamicin offers signijicant benejit over placebo. The serious side effects were not obsen’ed. Therefore, the technique could be applied in the routine treatment of gout.

  14. Pomoč pri dojenju otročnici v poporodni depresiji

    OpenAIRE

    Peček, Doroteja

    2013-01-01

    V poporodnem obdobju je za žensko čas spreminjanja telesa in hormonskega ter psihičnega stanja v ravnovesje kot je bilo pred nosečnostjo in porodom. Ob tem se lahko pojavijo težave in zapleti, ki od otročnice zahtevajo novo znanje in spretnosti vsakdana. Potrebno se je prilagajati na urnik, ki si ga postavi otrok. Prav tako pa to prinese spremembe v družinsko življenje in življenje med otročnico in njenim partnerjem. Pogosto se lahko zato pojavijo motnje razpoloženja, med njimi tudi poporodna...

  15. Sensor4PRI: a sensor platform for the protection of railway infrastructures.

    Science.gov (United States)

    Cañete, Eduardo; Chen, Jaime; Díaz, Manuel; Llopis, Luis; Rubio, Bartolomé

    2015-02-27

    Wireless Sensor Networks constitute pervasive and distributed computing systems and are potentially one of the most important technologies of this century. They have been specifically identified as a good candidate to become an integral part of the protection of critical infrastructures. In this paper we focus on railway infrastructure protection and we present the details of a sensor platform designed to be integrated into a slab track system in order to carry out both installation and maintenance monitoring activities. In the installation phase, the platform helps operators to install the slab tracks in the right position. In the maintenance phase, the platform collects information about the structural health and behavior of the infrastructure when a train travels along it and relays the readings to a base station. The base station uses trains as data mules to upload the information to the internet. The use of a train as a data mule is especially suitable for collecting information from remote or inaccessible places which do not have a direct connection to the internet and require less network infrastructure. The overall aim of the system is to deploy a permanent economically viable monitoring system to improve the safety of railway infrastructures.

  16. Sensor4PRI: A Sensor Platform for the Protection of Railway Infrastructures

    Directory of Open Access Journals (Sweden)

    Eduardo Cañete

    2015-02-01

    Full Text Available Wireless Sensor Networks constitute pervasive and distributed computing systems and are potentially one of the most important technologies of this century. They have been specifically identified as a good candidate to become an integral part of the protection of critical infrastructures. In this paper we focus on railway infrastructure protection and we present the details of a sensor platform designed to be integrated into a slab track system in order to carry out both installation and maintenance monitoring activities. In the installation phase, the platform helps operators to install the slab tracks in the right position. In the maintenance phase, the platform collects information about the structural health and behavior of the infrastructure when a train travels along it and relays the readings to a base station. The base station uses trains as data mules to upload the information to the internet. The use of a train as a data mule is especially suitable for collecting information from remote or inaccessible places which do not have a direct connection to the internet and require less network infrastructure. The overall aim of the system is to deploy a permanent economically viable monitoring system to improve the safety of railway infrastructures.

  17. Legislativní problematika zpracování pryžového odpadu

    OpenAIRE

    Harant, Petr

    2011-01-01

    This diploma thesis deals with the issue of rubber waste legislative focusing on waste tyres. The aim of the thesis is a thorough analysis of current legislative including newly prepared alterations with emphasis on specific lingering problems. A project of secondary material recycling, which has been created in current legal conditions, will be introduced. The project is assessed in terms of project managment methodology and the thesis concludes by suggesting an ideal project managment appro...

  18. Novi pristopi pri proučevanju prsti v pokrajini = New approaches in Slovenian soil geography

    Directory of Open Access Journals (Sweden)

    Blaž Repe

    2006-01-01

    Full Text Available In Slovenia, soil research of a given landscape is often neglected in physical geography studies. Despite the fact of an equivalent position of soil geography within the science system of Slovene geography. Reasons can be found in time consuming fi eld research, expensive laboratory analysis and soil data and also the lack of its own methodology. The drawbacks could be partially replaced by different approaches of research and especially to establish links with other physical elements of the environment. The use of easily accessible digital and cartographic data, basic field techniques, in combination with simple GIS tools and quantitative methods overcomes many of the financial or time constraints.

  19. Sensor4PRI: a sensor platform for the protection of railway infrastructures

    National Research Council Canada - National Science Library

    Cañete, Eduardo; Chen, Jaime; Díaz, Manuel; Llopis, Luis; Rubio, Bartolomé

    2015-01-01

    .... In this paper we focus on railway infrastructure protection and we present the details of a sensor platform designed to be integrated into a slab track system in order to carry out both installation...

  20. P.A. Mbenzi and D.N. Iithete. English-Oshindonga Dictionary for Pri-

    African Journals Online (AJOL)

    1. Introduction. I cannot over-emphasize the critical importance of this book. ... the dictionary does make a valuable contribution to the language learning aids available to primary school learners and teachers in Namibia. Since English is the only .... learner might realise that knowledge of word class makes his/her dictionary.

  1. Hyperfine structure investigations of Pr-I lines in the region 4200-4450 A

    Energy Technology Data Exchange (ETDEWEB)

    Siddiqui, Imran; Khan, Shamim; Tanweer Iqbal, Syed; Windholz, Laurentius [Institute of Experimental Physics, Graz University of Technology, Petersgasse 16, A 8010 Graz (Austria)

    2012-07-01

    Praseodymium I spectral lines were investigated using laser induced fluorescence spectroscopy in a hollow cathode discharge lamp. The investigations led to the discovery of new Pr I energy levels of even and odd parity. A high resolution Fourier transform (FT) spectrum was used to extract promising excitation wavelengths. In the FT spectrum the investigated line 4375.53 A shows up as a narrow peak hfs with a weak SNR. Nevertheless, the line was excited and fluorescence signals were observed on 6 lines (4163 A, 4816 A, 5091 A, 5164 A, 5209 A, 5233 A). The hfs of the line was recorded by scanning the laser frequency and was fitted to obtain angular momentum J and hf constant A of the combining levels. We got J{sub up}=5/2, A{sub up}=1028.30 MHz, J{sub lo}=7/2 and A{sub lo}=861.46 MHz (the subscripts refer to upper and lower level). Assuming an unknown upper level, a known lower level was searched among the known levels having sufficient values of J and A. The level 7617.440 cm{sup -1}, even parity, J{sub lo}=7/2 and A{sub lo}=868 MHz fulfils these requirements. Using the center of gravity wave number of the line 4375.53 A and the energy of the lower level, the unknown upper level was calculated to have 30465.424 cm{sup -1}, odd parity, J{sub up}=5/2 and A{sub up}=1033(6) MHz.

  2. Presoja notranjih kontrol pri obračunu davka na dodano vrednost na primeru "Podjetja x"

    OpenAIRE

    Majcen, Borut

    2016-01-01

    Poslovanje podjetja si je ob odsotnosti notranjih kontrol nemogoče predstavljati. Podjetja so podvržena raznim tveganjem, še posebej v današnjih razmerah globalnega poslovanja, ko se podjetja soočajo z vedno novimi izzivi, kar prinaša tudi nova tveganja. Najučinkovitejši ukrep za obvladovanje tveganj predstavlja vzpostavitev sistema notranjih kontrol. Obvladovanje tveganj pa ne poteka samo na ravni podjetja kot celote, ampak je prisotno na vseh področjih delovanja podjetja, torej tudi na p...

  3. School Internal Investigations of Employees, Open Records Laws, and the Prying Press.

    Science.gov (United States)

    Remington, Lee R.

    2002-01-01

    Discusses history and purpose of state open-records laws. Surveys how parties make open-records requests, various causes of action, and sanctions for noncompliance. Examines how open-records requests related to district investigations can implicate the Family Education Rights and Privacy Act. Attempts to find appropriate balance between public's…

  4. Prison Inmate Information System: The Case of Yola Central Pri1son ...

    African Journals Online (AJOL)

    The development in technology has brought about using computer system to solve practical problems in various fields of work. This advancement leads to automation of system processes. This paper studied the manual processing of Prisoners Information in Yola Prison of Adamawa state, with a view to developing an ...

  5. RELACIJE TELESNIH IZMER, SESTAVE TELESA IN ŽIVLJENJSKEGA SLOGA PRI ŠTUDETNIH

    OpenAIRE

    Žohar, Anja

    2015-01-01

    Namen raziskave je bil ugotoviti, ali obstaja povezanost življenjskega sloga študentk z njihovimi telesnimi izmerami ter sestavo telesa. V raziskavi je sodelovalo 161 študentk Pedagoške fakultete v Mariboru, smer razredni pouk, starih 19 in 20 let. Podatke o življenjskem slogu posameznih študentk smo pridobili z anketnima vprašalnikoma »Ovrednotenje življenjskega sloga« in »Gibalna dejavnost mladih«. Telesne izmere so bile izmerjene z uporabo standardiziranega antropometričnega instrumentarij...

  6. Primerjava različnih metod izolacije DNA pri bezgu (Sambucus spp.)

    OpenAIRE

    Leopold, Eva

    2011-01-01

    Cilj študije je bil ugotoviti, katere izolacije DNA so kvalitativno, časovno in stroškovno najbolj smotrne za uporabo. V raziskave smo vključili štiri različne metode izolacije DNA, in sicer klasično CTAB metodo ter tri metode izolacije s kompleti: Wizard Genomic DNA Purification Kit (Promega), Total DNA Purification Kit (Invitrogen) in avtomatsko metodo izolacije z napravo QIAcube (Qiagen) in kompletom DNeasy plant Mini Kit (Qiagen). Vzorce bezga (Sambucus spp.) smo v letih 2010 in 2011 izol...

  7. Analiza vpliva ekspozicijskih pogojev na kakovost slik pri računalniški radiografiji

    OpenAIRE

    Vodopivec, Lea; Žakelj, Tadeja

    2017-01-01

    Uvod: Kvaliteta rentgenske slike temelji na dobrem prikazu struktur in je posledica dobre kontrastne in prostorske ločljivosti. Z računalniško obdelavo lahko sliki dodamo večjo diagnostično uporabnost in boljšo kakovost. Namen: Zanimalo nas je, kako ekspozicijski pogoji in obdelava slik vplivajo na njihovo kakovost ter ali so slike z višjim razmerjem signal-šum bolj kakovostne od tistih z nižjim. Metode dela: Pregledali smo literaturo in pridobili rentgenske slike prsnih in trebušnih organov ...

  8. Tehnološke izboljšave pri izdelavi zavorne zagozde za avtomatski menjalnik

    OpenAIRE

    Figek, Tadej

    2015-01-01

    Diplomsko delo obravnava tehnološke izboljšave mehanske obdelave z odrezovanjem na velikoserijskem artiklu zavorne zagozde. Uvodoma smo predstavili osnove CAD/CAM sistema in CNC-obdelovalne stroje, na katerih bomo izvedli obdelavo. Nadalje smo opisali karakteristike obdelovanca in potek proizvodnega procesa. Sledi predstavitev strojev in orodij, ki smo jih uporabili za izdelavo in kontrolo končnega izdelka. Temeljito smo razdelali posamezne delovne operacije in uporabljena orodja. Rezultat an...

  9. FLAVOUR: Friendly Location-aware conference Assistant with priVacy Observant architectURe

    NARCIS (Netherlands)

    Kavitha Muthukrishnan, K.; Meratnia, Nirvana; Lijding, M.E.M.

    Context-aware applications are emerging on the daily basis and location information proves to be one of the key components to develop context-aware applications upon. This stems from the fact that location information enables and facilitates reasoning about what users are doing (user’s behavioural

  10. ZNAČAJ KRITERIJA PRI PROSUDBI UGROŽENOSTI POSLOVANJA GOTOVIM NOVCEM I VRIJEDNOSTIMA

    OpenAIRE

    Palačić, Darko

    2007-01-01

    SAŽETAK: Temelj za primjenu potrebnih mjera zaštite od razbojstava i provala u novčarskim institucijama je prosudba ugroženosti. Prosudba ugroženosti koristi se za izgradnju i upravljanje cijelim sustavom sigurnosti poslovanja gotovim novcem i vrijednostima u novčarskim institucijama. Odabir svih potrebnih kriterija prosudbe ugroženosti i određivanje njihovog značaja osnovni su uvjeti za primjenu učinkovite metodologije prosudbe ugroženosti za određivanje optimalnih mjera zaštite. U članku su...

  11. The Politics of Parental Involvement: How Opportunity Hoarding and Prying Shape Educational Opportunity

    Science.gov (United States)

    Lyken-Segosebe, Dawn; Hinz, Serena E.

    2015-01-01

    As more state legislatures join the debate on school-choice and parent-trigger legislation, their discussions draw attention to an evolving landscape outside school walls where parental action shapes educational opportunity. Parents wield their political, social, economic, and cultural capital to secure the best educational outcomes for their…

  12. Advancing sustainable development in Canada : policy issues and research needs[PRI Project, Sustainable Development

    Energy Technology Data Exchange (ETDEWEB)

    Eliadis, P. [Government of Canada Privy Council Office, Ottawa, ON (Canada). Policy Research Initiative; Creech, H.; Glanville, B.; Barg, S.; Cosbey, A.; Roy, M.; Swanson, D.A.; Venema, H.D.; Von Moltke, K. [International Inst. for Sustainable Development, Winnipeg, MB (Canada); Slayen, S. (ed.)

    2003-11-01

    This paper defined 7 policy-relevant issues that advance sustainable development in Canada. These were; (1) urban redesign, (2) freshwater management, (3) eco-region sustainability, (4) impacts of globalization on sustainable development in Canada, (5) designing signals and incentives that promote sustainable behaviour among citizens, (6) reducing the ecological burden of unsustainable lifestyles, and (7) international engagement in sustainable development. The authors questioned why these issues have not made greater progress, given that they have been on national and international agendas since 1972. They also questioned why it is so difficult to integrate environmental and economic signals. Finally, they examined whether enough ecological and political space can be provided to developing countries to achieve sustainable development while enhancing the standard of living in Canada and not threatening critical global systems. 173 refs.

  13. Primjena umjetnih neuronskih mreža pri identificiranju i vođenju procesa

    Directory of Open Access Journals (Sweden)

    Jerbić, I.

    2006-11-01

    Full Text Available During the development of intelligent systems inspired by biological neural system, in the last two decades the researchers from various scientific fields have created neural networks for solving a series of problems from pattern recognition, prediction, diagnostic, software sensor, modelling and identification, control and optimization. In this paper a review of neural network application in the field of chemical engineering with emphasis on identification and process control is given.The neural networks have been proven usefull in the applications which include complex chemical and biochemical reactions. In such a processes use of standard methods of process modelling and control structure are frequently not suitable. The ability of neural network to model dynamics of nonlinear process makes them an important tool for implementation in model-based control. Due to intensively theory development and many practical applications, there are numerous neural network structures and algorithms.In this paper neural networks are categorized under three major control schemes: model-base predictive control, inverse model-based control, and adaptive control. The major applications are summarized. It reveals prospect of using neural networks in process identification and control.The future of neural network application lies not only in their explicite use, but in cross connecting to other advanted technnologies as well. Fusion of neural networks and fuzzy logic in the form of neural-fuzzy network is one of the possibilites. Other important field is hibrid modelling and identification methods which supplement simplified mechanistic models. Software sensors and their application, especially in controlling of bioprocesses, present a very promising field.

  14. Prison Inmate Information System: The Case of Yola Central Pri son ...

    African Journals Online (AJOL)

    PROF. OLIVER OSUAGWA

    the manual processing of Prisoners Information in Yola Prison of Adamawa state, with a view to developing an “Automated Prison ... the current system, the prison inmate information system is more secure, flexible, provides more user feedback, reduces the workload, ..... 4. Testing and quality assurance. 5. Maintenance ...

  15. VIDEOIGRE KOT DIDAKTIČNI PRIPOMOČEK PRI POUKU SLOVENSKEGA JEZIKA IN KNJIŽEVNOSTI

    OpenAIRE

    Čeh, Aleš

    2016-01-01

    Videoigre so trenutno najpomembnejši medij v zabavni industriji 21. stoletja. Njihova pot je bila tlakovana s številni težavami in neprilikami, zlasti v splošni družbeni recepciji, saj jih je strokovna in splošna javnost dolgo časa (in jih ponekod še) obravnavala kot nekoristne, občasno celo škodljive. Slednje seveda ni absolutno res, ni pa tudi popolnoma ovrgljivo. Videoigre so prav tako kot drugi mediji izjemno širok pojem, med njimi najdemo tako estetsko izjemno dovršene umetniške naslove,...

  16. VRIJEDNOST KARBOKSITERAPIJE PRI LIJEČENJU KRONIČNE RANE POTKOLJENICE

    OpenAIRE

    KOVAČEVIĆ, JADRANKA; SINOŽIĆ, TAMARA

    2015-01-01

    Karboksiterapija je potporna metoda liječenja kroničnih rana koja se provodi kutanim ili subkutanim ubrizgavanjem medicinskog ugljičnog dioksida (Co2). osnovni princip djelovanja ubrizganog plina Co2 je korekcija tkivne hipoksije temeljem Bohrovog efekta. Djelujući na endotelne faktore rasta potiče neoangiogenezu te stimuliraju ibroblaste na sintezu kolagena što sve zajedno dovodi do boljeg zacjeljivanja rana. Brojna su područja primjene karboksiterapije: od liječenja kroničnih rana, bolesti ...

  17. Sodelovanje družbe pri ustvarjanju prostorske ureditve in njena povezanost s strukturo vsakodnevne krajine

    Directory of Open Access Journals (Sweden)

    Beata J. Gawryszewska

    2008-01-01

    Full Text Available Bivanjski prostor oblikujejo naravni procesi, značilni za posamezen kraj, javni prostori v njem in enačenje prebivalcev s krajem. Proces enačenja s krajem spodbuja nastanek sistema zasebnih, družbenih in javnih zelenih površin. Pojavlja se na formalni, funkcionalni in simbolni ravni zaznave mestnega prostora. Zelene površine so lahko zasebna cvetlična korita pod oknom ali gredice pod blokom, skupne zelenice, javne zelene površine, parki in drevoredi ... Vse te zelene površine so za skupnost zelo pomembne. Krajevnim skupnostim omogočajo, da se enačijo s krajino svojega stanovanjskega naselja in z monumentalno krajino, v kateri so ob njihovem naselju zrasla nova stanovanjska naselja. Enačenje s krajem v tem smislu zvišuje standard naselja in simbolizira monumentalno pokrajino. To pa spodbuja njeno prenovo. Primer take strukture so varšavsko stanovanjsko naselje, ki sta ga projektirala Poljaka B. in S. Brukalski, delavnice, v katerih so sodelovali srednješolci, in projekt »Varšavska kraljevska promenada«. To so tudi instrumenti, ki oblikujejo družbeno potrebo po objektih za rekreativne in kulturne dejavnosti, po objektih, ki simbolizirajo metropolitanski značaj mesta.

  18. PRI: transport and distribution networks of the electric power. Research program 2002/2003 (one year); PRI: Reseaux de transport de et de distribution de l'energie electrique. Programme de recherche 2002 / 2003 (1 an)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    This program proposes two actions. The first one deals with the energy transfers in networks. The study presents the control of networks in the new context of the deregulation which will imply a massive insertion of a decentralized production and the research of new tools of networks simulation using the new analysis methods by order reduction and fractals. The second one is devoted to the high voltage electronic and the energy transfer. (A.L.B.)

  19. Organization of engineering works in deploying a bridge crossing point made of class 20 pontoon material / Организация инженерных работ при устройстве понтонного моста класса 20 на месте перехода / Organizacija inžinjerijskih radova pri uspostavljanju mosnog mesta prelaska od pontonskog materijala klase 20

    Directory of Open Access Journals (Sweden)

    Nenad V. Kovačević

    2017-10-01

    -мостового батальона, являющегося частью Речной флотилии (объединение - бригада. Описанная в данной статье организация инженерных работ представляет собой целесообразную разработку всех процессов, задействованных в области переправы через водные преграды, в том числе распределение нагрузки на понтеров при устройстве понтонномостовых переправ, грузоподъемностью 20 тонн. Одной из насущных проблем, с которой сталкиваются военные инженеры при оформлении основной документации по устройству ПМП, является отсутствие современной литературы (существующая литература относится к 70-80-ым годам прошлого века, таким образом, разработчики вынуждены опираться исключительно на практический опыт как в оформлении проектной документации, так и в самом процессе производства работ. / Prilikom upotrebe pontonskog materijala za uspostavljanje mosnog i/ili neke druge vrste prelaska preko vodene prepreke (skelskog, desantnog, vrlo je važna organizacija izvođenja radova prilikom pripreme, u toku uspostavljanja, ali i pri dezangažovanju jedinica i pontonskog materijala za uspostavu i održavanje mesta prelaska. Za izvođenje ovih radova u Vojsci Srbije postoje specijalizovane ( namenske jedinice. To su jedinice jedne od specijalnosti u okviru roda inžinjerije , pontonirske specijalnosti, koje egzistiraju u okviru pontonirskih bataljona, odnosno u okviru Re

  20. Limited access to HIV prevention in French prisons (ANRS PRI2DE: implications for public health and drug policy

    Directory of Open Access Journals (Sweden)

    Blanche Jerôme

    2011-05-01

    Full Text Available Abstract Background Overpopulation, poor hygiene and disease prevention conditions in prisons are major structural determinants of increased infectious risk within prison settings but evidence-based national and WHO guidelines provide clear indications on how to reduce this risk. We sought to estimate the level of infectious risk by measuring how French prisons adhere to national and WHO guidelines. Methods A nationwide survey targeting the heads of medical (all French prisons and psychiatric (26 French prisons units was conducted using a postal questionnaire and a phone interview mainly focusing on access to prevention interventions, i.e. bleach, opioid substitution treatment (OST, HBV vaccination and post-exposure prophylaxis (PEP for French prisoners. Two scores were built reflecting adherence to national and WHO international guidelines, ranging from 0 (no adherence to 10 (maximum adherence and 0 to 9 respectively. Results A majority (N = 113 (66% of the 171 prisons answered the questionnaires, representing 74% coverage (46,786 prisoners of the French prison population: 108 were medical units and 12 were psychiatric units. Inmate access to prevention was poor. The median[IQR] score measuring adherence to national guidelines was quite low (4.5[2.5; 5.5] but adherence to WHO guidelines was even lower 2.5[1.5; 3.5]; PEP was absent despite reported risky practices. Unsuitable OST delivery practices were frequently observed. Conclusions A wide gap exists between HIV prevention policies and their application in prisons. Similar assessments in other countries may be needed to guide a global policy reform in prison settings. Adequate funding together with innovative interventions able to remove structural and ideological barriers to HIV prevention are now needed to motivate those in charge of prison health, to improve their working environment and to relieve French prisoners from their currently debilitating conditions.

  1. Metodyka PRI9CE 2 w zarządzaniu realizacją projektów

    OpenAIRE

    Wodecka-Hyjek, Angelika

    2010-01-01

    Prince 2 is a structured method for achieving effective project management that has been evolved in the UK and is currently widely used in both government and private sector at the world. At the beginning the key characteristics of evolution of PRINCE2 have been presented. In the main part of the article the has been produced of structure and main components of the PRINCE2 approach. The final part of the paper is focused on benefits and threats of the methodology ut...

  2. Ayer, Hoy y Mañana, La Teoría del Prión.

    Directory of Open Access Journals (Sweden)

    Gabriel Toro González

    2004-03-01

    Full Text Available

    (Reproducido con autorización de Acta Neurológica Colombiana Vol. 18 No. 4, 2002.

    Introducción

    La creencia mejor respaldada actualmente nos indica que existe un grupo de enfermedades causadas por anormalidades en el procesamiento de las proteínas. En la década 1950-1960 D. Carleton Gajdusek y Vincent Zigas comenzaron a estudiar en Nueva Guinea una enfermedad fatal del sistema nervioso que se conoce con el nombre de Kuru que estaba diezmando a la tribu Fore, comunidad de unos 12.000 nativos (Figura 1. Gajdusek y Zigas observaron que el Kuru no correspondía a ningún modelo genético conocido y con la colaboración del antropólogo R. Glasse pensaron que el canibalismo ritual practicado por los Fore podría ser la causa de la transmisión de esta enfermedad, lo cual resultó cierto porque el Kuru prácticamente desapareció tras tres décadas de abolidos estos hábitos.

    Desde el primer momento se notó que el Kuru tenía características comunes con el Scrapie y que había semejanza entre estas dos entidades y la enfermedad de Creutzfeldt-Jakob (ECJ, una demencia de progresión rápida, no limitada geográficamente, descrita a principios del siglo XX, las tres aparentemente causadas por infecciones virales lentas con largos períodos de incubación medibles en años y un avance irreversible de los síntomas.

    Este pensamiento, por supuesto, se apoyaba en la afirmación formulada en 1939 por Mc Farlane Burnet de un posible mecanismo de acción lenta o temperada, inicialmente ejemplificada en los virus Herpes y en la propuesta que unos 15 años más tarde hiciera el veterinario islandés B. Sigurdsson de llamar Enfermedades Virales Lentas a las entidades que exhibieran tal comportamiento. Philip Duffy y colaboradores en la Universidad de Columbia, en 1974 comunican la primera observación de transmisión de la demencia de Creutzfeldt –Jakob de humano a humano a través de un injerto de córnea y a esta se sumaron otras posibilidades de transmitir el agente causal, entre ellas electrodos contaminados, hormona de crecimiento, transplante de duramadre. Pese a esta demostración de transmisibilidad la teoría viral desde el comienzo encontró fuerte oposición; lo cual no impidió que la comunidad científica comprendiera el alcance de esta ejemplarizante investigación y concediera por ella a DC Gajdusek el Premio Nobel de Medicina en 1976.

    El punto de partida de este monumental trabajo fue entregado a la comunidad científica desde 1981 en el libro cuya carátula vemos en la Figura 2. En 1970 J.S. Griffith y R. Latarget plantean que estos agentes infecciosos carentes de ácidos nucléicos en vez de estructura viral podrían tener naturaleza esencialmente protéica..

  3. Samodejne misli, študijski uspeh, učinkovitost in zadovoljstvo pri univerzitetnih študentih

    Directory of Open Access Journals (Sweden)

    Ivanka Živčić-Bećirević

    2001-03-01

    Full Text Available Student Automatic Thoughts Questionnaire for assessment of University students' typical automatic thoughts during studying and taking an exam has been developed. The scale resulted with 5 interpretable subscales: negative expectations and discouragement regarding exam; negative attitude toward the subject; fear of disappointing parents; lack of motivation; and positive (encouraging automatic thoughts. Successful and efficient students, as well as students who are satisfied with their achievements, have more positive, and less negative automatic thoughts focused on failure, parents' disappointment and motivation. Automatic thoughts better differentiate students by their satisfaction, than by their success and efficiency. Negative automatic thoughts related to fear of disappointing parents are the best predictor while negative automatic thoughts related to negative attitude toward the subject are the worst predictor of students' satisfaction, success and efficiency.

  4. ANALIZA DINAMIČNIH FIZIOLOŠKIH ODZIVOV PRI NEINVAZIVNEM MERJENJU KRVNEGA TLAKA S PROTITLAČNO METODO PENAZ

    OpenAIRE

    Zrim, Grega

    2015-01-01

    Bolezni obtočil so glavni vzrok smrti v razvitih delih sveta. Obtočila so pod nadzorom avtonomnega živčevja, zato se preko monitoringa srca zagotovi pogled v avtonomno živčevje. Zgodnja preventivna intervencija s presejalnimi testi pomeni pravočasno zdravljenje in znižanje umrljivosti. Raziskovali smo, ali je mogoče z medicinsko opremo, ki je primarno namenjena neprekinjenemu monitoringu v bolnišničnem okolju, izvajati hitre dinamične provokacijske teste, ki bi nam služili kot presejalni test...

  5. Priedų bei skirtingų gamybos technologijų įtaka kepinių kokybei

    OpenAIRE

    Duobienė, Lina

    2015-01-01

    Goal of the research: to analyse quality parameters of different types of bread, produced with or without improvers, also to evaluate intensity of microbiological spoilage of bread during storage. Results and findings: Different bread technologies have influence on bread quality parameters and in all cases bread improvers have positive influence on bread quality: „Lietuviškas ragaišis“ (Lithuanian whole wheat bread) using improvers the higher specific volume (21.27%) and porosity (9.02%...

  6. Limited access to HIV prevention in French prisons (ANRS PRI2DE): implications for public health and drug policy.

    Science.gov (United States)

    Michel, Laurent; Jauffret-Roustide, Marie; Blanche, Jerôme; Maguet, Olivier; Calderon, Christine; Cohen, Julien; Carrieri, Patrizia M

    2011-05-27

    Overpopulation, poor hygiene and disease prevention conditions in prisons are major structural determinants of increased infectious risk within prison settings but evidence-based national and WHO guidelines provide clear indications on how to reduce this risk. We sought to estimate the level of infectious risk by measuring how French prisons adhere to national and WHO guidelines. A nationwide survey targeting the heads of medical (all French prisons) and psychiatric (26 French prisons) units was conducted using a postal questionnaire and a phone interview mainly focusing on access to prevention interventions, i.e. bleach, opioid substitution treatment (OST), HBV vaccination and post-exposure prophylaxis (PEP) for French prisoners. Two scores were built reflecting adherence to national and WHO international guidelines, ranging from 0 (no adherence) to 10 (maximum adherence) and 0 to 9 respectively. A majority (N=113 (66%)) of the 171 prisons answered the questionnaires, representing 74% coverage (46,786 prisoners) of the French prison population: 108 were medical units and 12 were psychiatric units. Inmate access to prevention was poor. The median[IQR] score measuring adherence to national guidelines was quite low (4.5[2.5; 5.5]) but adherence to WHO guidelines was even lower 2.5[1.5; 3.5]; PEP was absent despite reported risky practices. Unsuitable OST delivery practices were frequently observed. A wide gap exists between HIV prevention policies and their application in prisons. Similar assessments in other countries may be needed to guide a global policy reform in prison settings. Adequate funding together with innovative interventions able to remove structural and ideological barriers to HIV prevention are now needed to motivate those in charge of prison health, to improve their working environment and to relieve French prisoners from their currently debilitating conditions.

  7. Viga on öelda, et me ei vaja PRi / Roger Hayes, Alasdair Sutherland ; interv. Tiiu Värbu

    Index Scriptorium Estoniae

    Hayes, Roger

    2001-01-01

    Eesti Suhtekorraldajate Liidu 5. aastapäeva seminaril osalevad Rahvusvahelise Kommunikatsiooni Instituudi direktor R. Hayes ja maailma ühe juhtiva suhtekorraldusfirma Manning, Selvage & Lee asepresident A. Sutherland

  8. Diurnal Patterns of Photosynthesis, Chlorophyll Fluorescence, and PRI to Evaluate Water Stress in the Invasive Species, Elaeagnus umbellata Thunb

    Science.gov (United States)

    2010-01-01

    was induced by withholding watering from treatment plants for 8 days (at which point all plants had wilted and stomata had closed) followed by a...2). There was a significant interaction between month and time of day (F = 6.16, P \\ 0.0001). Stomata opened earlier in the day during June, with...umbellata plants. By day 8, all drought- treated plants showed signs of stress as evidenced by extremely wilted leaves and essentially closed stomata

  9. Gamma spectroscopy of the sea floor during exploration for mineral deposits. Gammametriya morskogo dna pri poiskakh poleznykh iskopaemykh

    Energy Technology Data Exchange (ETDEWEB)

    Shatsov, A.N.

    1977-01-01

    An examination is made of the basic aspects of studying natural gamma field during geological studies of the sea floor. A discussion is made of problems in making marine scintillation radiometers for continuous (by profiles) and discrete (by stations) measurements of natural gamma radiation on the surface layer of contemporary marine sediments and rock of the sea floor in the course of their natural stratification. The importance of gamma spectroscopy of shallow water shelf zones of the Caspian, Asov, Baltic, Black, and Japan Seas for studying the geological bottom structure and its raw-mineral base was demonstrated. A brief description is given of geophysical methods with which gamma spectroscopy of the sea floor might be combined. Data from native and foreign investigations are used to indicate the prospective use of spectrometry of natural as well as induced and capture gamma radiation for studying iron-manganese and phosphorite concretions, sea floor depressions that have been filled in with highly mineralized brine and sludge. 122 references, 41 figures, 33 tables.

  10. A Multimethod Assessment of Juvenile Psychopathy: Comparing the Predictive Utility of the PCL:YV, YPI, and NEO PRI

    Science.gov (United States)

    Cauffman, Elizabeth; Kimonis, Eva R.; Dmitrieva, Julia; Monahan, Kathryn C.

    2009-01-01

    The current study compares 3 distinct approaches for measuring juvenile psychopathy and their utility for predicting short- and long-term recidivism among a sample of 1,170 serious male juvenile offenders. The assessment approaches compared a clinical interview method (the Psychopathy Checklist: Youth Version [PCL:YV]; Forth, Kosson, & Hare,…

  11. Vloga finančnih omejitev pri poslovanju na tujih trgih = The Role of Financial Constraints on Foreign Markets

    Directory of Open Access Journals (Sweden)

    Crt Kostevc

    2006-12-01

    Full Text Available The Role of Financial Constraints on Foreign MarketsAbstract: Recent research on the role of foreign activities and their impact on firm characteristics has, with few exceptions, confirmed the existence of persistently large differences between exporters and non-exporters in terms of size, investments, innovative activity etc. In spite of the mounting evidence on the advantages of exporters over firms focused solely on their domestic markets, the source of these differences is yet to be explained. The present contribution attempts to analyze the role of financial constraints as one of the factors determining which firms will export and which will not. Through a survey of the existing literature, the role of financial constraints that limit foreign market access to only a subset of the firms, will be revealed. It is shown that financial constraints – even when other factors are explicitly considered (such as firm size, productivity, capital intensity, . . . – to a large extent determine the firms that will be able to enter into foreign markets, and also mean that financially constrained firms end up exporting less frequently and in smaller quantities than could otherwise be expected.

  12. Prying into the intimate secrets of animal lives; software beyond hardware for comprehensive annotation in 'Daily Diary' tags.

    Science.gov (United States)

    Walker, James S; Jones, Mark W; Laramee, Robert S; Holton, Mark D; Shepard, Emily Lc; Williams, Hannah J; Scantlebury, D Michael; Marks, Nikki J; Magowan, Elizabeth A; Maguire, Iain E; Bidder, Owen R; Di Virgilio, Agustina; Wilson, Rory P

    2015-01-01

    Smart tags attached to freely-roaming animals recording multiple parameters at infra-second rates are becoming commonplace, and are transforming our understanding of the way wild animals behave. Interpretation of such data is complex and currently limits the ability of biologists to realise the value of their recorded information. This work presents Framework4, an all-encompassing software suite which operates on smart sensor data to determine the 4 key elements considered pivotal for movement analysis from such tags (Endangered Species Res 4: 123-37, 2008). These are; animal trajectory, behaviour, energy expenditure and quantification of the environment in which the animal moves. The program transforms smart sensor data into dead-reckoned movements, template-matched behaviours, dynamic body acceleration-derived energetics and position-linked environmental data before outputting it all into a single file. Biologists are thus left with a single data set where animal actions and environmental conditions can be linked across time and space. Framework4 is a user-friendly software that assists biologists in elucidating 4 key aspects of wild animal ecology using data derived from tags with multiple sensors recording at high rates. Its use should enhance the ability of biologists to derive meaningful data rapidly from complex data.

  13. 7 CFR 14.6 - Criteria for determining the pri- mary purpose of payments with respect to potential exclusion...

    Science.gov (United States)

    2010-01-01

    ... Secretary of Agriculture DETERMINING THE PRIMARY PURPOSE OF CERTAIN PAYMENTS FOR FEDERAL TAX PURPOSES § 14.6...— (i) Improving efficiency in use; (ii) Reducing loss and waste; (iii) Increasing the recycling or... efficiency of water use, or increasing the recycling or reuse of water. (2) Payments shall be considered to...

  14. Izbrani kazalci obremenjenosti okolja pri študijah ranljivosti okolja = Selected environmental pollution indicators in environmental vulnerability studies

    Directory of Open Access Journals (Sweden)

    Dejan Cigale

    2002-01-01

    Full Text Available One of the components of the environmentalvulnerability studies is also the evaluation of the pollution of theenvironment. In the article, the analysis of the selected indicators of theachieved degree of the total and integral pollution is presented. In theframework of the environmental vulnerability studies on the spatial levelof landscape-ecological types for this purpose the following indicatorswere selected: population density, density of working places, trafficintensity and percentage of forests.

  15. PROJECTION OF PENETRATION OF THE BROKER IN HOME BRAZILIAN CAPITAL MARKET THROUGH LINEAR, GOMPERTZ AND FISHER – PRY MODELS

    Directory of Open Access Journals (Sweden)

    Carlos Kawamoto

    2010-09-01

    Full Text Available This paper aims to discuss the theories of internationalization and competitiveness, the positioning of a Brazilian company from agribusiness industry, exporting meat and food that has become a major global player in this industry JBS - Friboi. This company has been internationalized very fast in recent years and become a global leader in beef production, the second to the production of chicken meat and third largest producer of pork in the U.S. (JBS, 2010. The case is emblematic of JBS when analyzed under the concept of Porter's diamond applied to Brazil. This company gained scale and competitiveness with the access to natural resources of prodution (condition factor, but now it is necessary for maintenance its leading position, it requires a strategy grounded in innovation beyond just scale and operational excellence.

  16. UPORABA EKSPERIMENTALNEGA NAČRTA PRI RAZBARVANJU ODPADNIH TEKSTILNIH VOD Z NAPREDNIM OKSIDACIJSKIM H2O2/UV POSTOPKOM

    OpenAIRE

    Gornik, Nina

    2010-01-01

    Voda kot ključni sestavni del okolja predstavlja življenjski prostor velikemu številu živali in rastlin. Prav tako je tudi sestavni del vsakega živega bitja, kateremu omogoča normalno delovanje. V odpadni vodi so prisotne snovi, ki lahko ogrožajo naravno ravnotežje, zato jih je potrebno iz nje odstraniti. Eden večjih onesnaževalcev vode je tekstilna industrija, saj so tekstilne odpadne vode trenutno najkompleksnejše med vsemi odpadnimi vodami, saj poleg barvil vsebujejo še različne dodatke, k...

  17. The Effect o f Twelve - Week Recreation Act i v ities on the Anxiety Level of Female Pri soners

    Directory of Open Access Journals (Sweden)

    Zekiye B AŞARAN

    2015-07-01

    Full Text Available T h e a i m o f t h e s t u d y w a s to examine the effect of twelve - weeks recreation activities on the trait anxiety level of female prisoners in the prisons. The sampling of this study consists of 45 female prisoners who are in the Open Prison in Kandira, 22 of whom are in the experimental group and 23 of whom are in the control group. Different activities, such as music, dance, meditatio n, sportive activities, movies and videos, fun and entertainment activities and competitions, were performed one and half hours a day and two days a week. This lasted for twelve weeks. The data were collected by pre - tests and post - tests that were given bo th at the beginning and at the end of this program. Personal information form and Spielberger anxiety inventory were used as the data collecting tool. The reliability coefficient (Cronbach Alpha was calculated as ,873. The data were analysed with SPSS Win dows 18 programme. Descriptive statistics and Wilcoxon test were conducted. A si gnificant statistical correlation was determined between the prisoners’ pre - tests and post - tests scores in the experimental group (p <0.05. A s c o n c l u s i o n , a positive impact on trait anxiety levels of prisoners w a s f o u n d a f t e r 12 weeks o f recreational activities.

  18. PRI-CAT: a web-tool for the analysis, storage and visualization of plant ChIP-seq experiments.

    NARCIS (Netherlands)

    Muino, J.M.; Hoogstraat, M.; Ham, van R.C.H.J.; Dijk, van A.D.J.

    2011-01-01

    Although several tools for the analysis of ChIP-seq data have been published recently, there is a growing demand, in particular in the plant research community, for computational resources with which such data can be processed, analyzed, stored, visualized and integrated within a single,

  19. Primena programskog paketa MATLAB pri simulaciji rada sistema za prenos snage / MATLAB software application for power transmission simulation

    Directory of Open Access Journals (Sweden)

    Milan Krsmanović

    2008-01-01

    Full Text Available Rad se odnosi na veoma savremenu problematiku primene programskog paketa MATLAB za simulaciju rada sklopova transmisije motornih vozila. Osnovni cilj je doprinos razvoju procesa projektovanja sklopova transmisije za motorna vozila putem integracije različitih metoda i postupaka, kojima se mogu obuhvatiti faktori koji određuju proces prenosa i transformacije parametara snage (obrtnog momenta i ugaone brzine. Posebna pažnja posvećena je simulaciji rada glavne frikcione spojnice u slučaju polaska vozila iz mesta. U okviru toga detaljno je prikazan način formiranja simulacionog modela frikcione spojnice sa prikazom razvijenog matematičkog modela kao osnove za formiranje simulacionog modela. / This paper refers to modern problems in using the MATLAB program package for the simulation of motor vehicle transmission functions. The main goal is to contribute to the development of the process of motor vehicle transmission design by combining different methods and procedures comprising factors which determine the transmission process and the power parameters transformations (torque and angle velocity. The paper particularly focuses on the simulation of the main friction clutch during vehicle starting. The process of the simulation model design and the elaborate mathematical models which form its basis are described in detail.

  20. DINAMIKA SPREMEMB PARAMETROV ZRELOSTI IN KAKOVOSTI V ČASU ZORENJA PRI SLIVAH SORT ´STANLEY´ IN ´HANITA´

    OpenAIRE

    Košir, Sonja

    2012-01-01

    V letu 2008 smo v Sadjarskem centru Maribor – Gačnik spremljali nekatere parametre zrelosti in kakovosti sliv (Prunus domestica L.) sort ´Hanita´ in ´Stanley´v času zorenja. Namen poskusa je bil ugotoviti optimalni čas obiranja v naših pedoklimatskih razmerah ter povezavo med obarvanostjo plodov (parametri L* a* in b*) in posameznimi parametri zrelosti (trdoto mesa plodov, vsebnostjo skupnih titracijskih kislin, topno suho snov in razmerje med topno suho snovjo in titracijskimi kislinami). Re...

  1. Lokalizacija istočnikov električeskoj i fokusov gemodinamičeskoj aktivnosti mozga pri voobraženii dviženij

    Czech Academy of Sciences Publication Activity Database

    Frolov, A. A.; Húsek, Dušan; Mokienko, O.; Bobrov, P.; Chernikova, L.; Konovalov, R.

    2014-01-01

    Roč. 40, č. 3 (2014), s. 45-56 ISSN 0131-1646 Grant - others:GA MŠk(CZ) ED1.1.00/02.0070; GA MŠk(CZ) EE.2.3.20.0073 Program:ED Institutional support: RVO:67985807 Keywords : brain computer interface * independent component analysis * EEG pattern classification * motor imagery * inverse EEG problem Subject RIV: IN - Informatics, Computer Science

  2. Prinos i sadržaj biogenih elemenata u plodu rajčice pri različitim koncentracijama NaCl-a u hranjivoj otopini

    OpenAIRE

    Erhatić, Renata; Toth, Nina; Benko, Božidar; Permin-Volf, Tomislava; Stojnović, Miomir; Babić, Ivana

    2013-01-01

    Kakvoću svježih plodova rajčice, osobito sadržaj minerala moguće je poboljšati povećanjem EC-vrijednosti, odnosno koncentracije NaCl-a u hranivoj otopini bez značajnijeg smanjenja prinosa. Istraživanje je provedeno tijekom 2004. i 2005. godine na sorti Belle, u hidroponima na pločama kamene vune s ciljem utvrđivanja utjecaja povećane koncentracije NaCl-a u hranivoj otopini na prinos rajčice i sadržaj biogenih elemenata u plodu. Pokus je postavljen po metodi slučajnog bloknog rasporeda u če...

  3. Regulyaciya deyatel'nosti serdechno-sosudistoj sistemy pri normotenzivnoj reakcii na fizicheskuyu nagruzku=REGULATION OF ACTIVITIES OF CARDIOVASCULAR SYSTEM IN RESPONSE TO NORMOTENSIVE EXERTION

    OpenAIRE

    Romanchuk,A.P.

    2015-01-01

    With use of method of spiroarterycardiorhythmografy 167 persons with normothensiv type of reaction to physical activity are surveyed. Was used the test with adjustable breath for studying of mechanisms of regulation. It is by results established, that at persons with normothensiv type of reaction in reply to the test is marked the tendency to moderate increase HR, acceleration depolarysation of warm ventricles, to shortening QRS and QT, to displacement ST above an isoline, and also to slight ...

  4. Elektrofiziologičeskaja aktivnost mozga pri upravlenii interfejsom mozg kompjuter, osnovannym na voobraženii dviženij

    Czech Academy of Sciences Publication Activity Database

    Frolov, A. A.; Aziatskaya, G.A.; Bobrov, P.D.; Luykmanov, R. Kh.; Húsek, Dušan; Snášel, V.

    2017-01-01

    Roč. 43, č. 5 (2017), s. 17-28 ISSN 0131-1646 Institutional support: RVO:67985807 Keywords : brain- computer interface, electroencephalogram, motor imagery, EEG rhythm synchronization and desynchronization, Independent Component Analysis, neurorehabilitaiton. Subject RIV: IN - Informatics, Computer Science

  5. Organochlorines and trace elements in avian pry of peregrine falcons in Colorado: Ten years after: First year interim report of a two year study

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Bird species considered potential prey for peregrine falcons were collected at 10 sites in Colorado for analysis of organochlorine (OC) compounds and trace elements...

  6. Uplatnenie princípov a nástrojov business intelligence pri riadení nemocničného zariadenia

    OpenAIRE

    Hocko, Martin

    2012-01-01

    Diploma thesis deals with the application of principles and tools of business intelligence in the management and control process of the hospital facilities. In term of the definition of problem areas in the management and control process of the hospital is proposed concept of streamlining the current state, which consists of the methodological unification of the main control and managing areas, in the implementation of consolidated data structure (data warehouse) and reporting tool above the ...

  7. Cuál fue el resultado obtenido por el candidato del PRI en el 4º distrito de Yucatán, durante el proceso electoral 2000

    Directory of Open Access Journals (Sweden)

    Lic. Fernando Pacheco Bailón

    2001-01-01

    Full Text Available El autor trata de analizar la eficacia electoral aplicando los conceptos expuestos en escritos referentes al origen del pensamiento político, con la finalidad de lograr un avance significativo en cuanto a este proyecto de investigación. No es la intención en este trabajo dar conclusiones debido a que en forma tal, todavía no se aplica la metodología política necesaria para hacerlo.

  8. Borelijski limfocitom pri otrocih v Sloveniji - demografske, klinične in laboratorijske značilnosti: Borrelial lymphocytoma in children in Slovenia - demographic, clinical and laboratory characteristics:

    OpenAIRE

    Arnež, Maja; Vuković, Klavdija; Žnidaršič, Marta

    2010-01-01

    Backgrounds. Lyme borreliosis is a disease which affects many organ systems. It is transmitted by ticks and caused by the bacteria Borrelia burgdorferi sensu lato. Borreliallymphocytoma is a dinical sign of early localized Lyme borreliosis in children. Methods. The dinical study was retrospective. It induded 45 patients who were treated at the Department of Infectious Diseases,University Medical Centre, Ljubljana, Slovenia, from 1 January 2001 to 31 December 2007. The diagnosis ofborreliallym...

  9. FACEBOOK IN PARTNERSKI ODNOSI: Vloga uporabe Facebooka in stilov navezanosti v partnerskih odnosih pri izražanju in doživljanju ljubosumja na Facebooku

    OpenAIRE

    Fermišek, Neja

    2017-01-01

    Popularnost Facebooka je v zadnjih nekaj letih izrazito narastla, vendar kljub temu njegov vpliv na partnerske odnose še zmeraj ostaja relativno neraziskan. Magistrsko delo ugotavlja, kako je uporaba Facebooka povezana z ljubosumjem in nadzorom partnerja na Facebooku ter z zadovoljstvom v samem partnerskem odnosu. Ker pa je romantična ljubezen proces navezanosti, se nam je prav tako zdelo pomembno, da v empiričnem delu raziščemo povezavo med različnimi stili navezanosti in ljubosumjem na Face...

  10. National audit of the quality of pain relief provided in emergency departments in Aotearoa, New Zealand: The PRiZED 1 Study.

    Science.gov (United States)

    2017-04-01

    Pain is a common feature of ED presentations and the timely provision of adequate analgesia is important for patient care. However, there is currently no New Zealand data with respect to this indicator of care quality. The present study aimed to provide a baseline for the quality of care with respect to the provision of timely and adequate analgesia in New Zealand EDs. The present study is a secondary analysis of data initially collected for the Shorter Stays in Emergency Department Study, using a retrospective chart review of 1685 randomly selected ED presentations (2006-2012) from 26 New Zealand public hospital EDs. Of the 1685 charts randomly selected, 1547 (91%) were reviewed from 21 EDs. There were 866 ED presentations with painful conditions, of whom 132 (15%) did not have pain recorded, 205 (24%) did not receive pain relief and 19 (2%) did not have time of analgesia documented leaving 510 (59%) for the analysis of time to analgesia. Four hundred and fifty-seven (53%) did not have pain well documented sufficiently to assess adequacy, leaving 277 (32%) for the analysis of adequacy of analgesia. The median (interquartile range) time to analgesia was 62 (30-134) min and the provision of adequate analgesia was 141/277 (51%, 95% CI: 45-57%); however, there was some variation between hospitals for both outcomes. Although these outcomes are on a par with other countries, this baseline audit has shown both poor documentation and variation in the provision of timely and adequate pain relief in New Zealand EDs, with room for improvement with respect to this quality indicator. © 2017 Australasian College for Emergency Medicine and Australasian Society for Emergency Medicine.

  11. Razvoj komunikacijskih in vodstvenih kompetenc pri vodjih tehnične stroke = The Development of Communication and Leading Competences among the Leaders of Technical Expertise

    Directory of Open Access Journals (Sweden)

    Mojca Jermanis

    2012-01-01

    Full Text Available A leader holds an important role in the communication process.His/her way of passing information and of communication continuouslyinfluences the employees as it streams their behaviour and buildsmutual trust. The purpose of this article is to show the development ofcommunication and leading competences for mid-level leaders. Furthermore,the article defines specific competences and their importancefor the efficient management of staff. 152 mid-level leaders workingfor an automotive company – a worldwide automotive supplier –were involved in the research. They completed the education programmefor mid-level leaders. Descriptive statistical techniques and factoranalysis were used for data processing.

  12. Medosebni odnosi in vsebina dela kot dejavnika stresa pri srednjem managementu = Interpersonal Relationships and Work Content as Stress Factors among Middle Management

    Directory of Open Access Journals (Sweden)

    Polona Kožuh

    2011-06-01

    Full Text Available In the modern society, where importance is placed on progress, newtechnologies and economic trends, there is a lack of awareness of thesignificance of good interpersonal relations and organizational culturewithin a company. They both contribute to the better functioningof employees as well as the entire organization. The purpose of thisstudy was to determine any possible differences between the stressorslinked to the relationships within an organization and those linked tothe work of middle management. The study included 58 middle managersworking in commercial activity in the Ljubljana region. The resultshave indicated that the amount of stressors related to the relationships,and stressors related to the managers’ work, that affect themiddle managers participating in the survey is on average the same.The results have therefore shown no statistically significant differencebetween the two forms of the studied stress factors.

  13. Correlations between maternal, breast milk, and infant vitamin B12 concentrations among mother-infant dyads in Vancouver, Canada and Pry Veng, Cambodia: an exploratory analysis

    Science.gov (United States)

    Vitamin B12 plays an essential role in fetal and infant development. In regions where animal source food consumption is low and perinatal supplementation is uncommon, infants are at risk of vitamin B12 deficiency. In this secondary analysis, we measured total vitamin B12 concentrations in maternal a...

  14. Napoved razvoja hiperbilirubinemije pri donošenih novorojenčkih z neinvazivnimi metodami: Prediction of hyperbilirubinemia by noninvasive methods in full-term newborns:

    OpenAIRE

    Bratanič, Borut; Pavlin, Tatjana; Gradecki, Mirjam; Furlan, Danijela; Žalec, Lidija; Oštir Mevželj, Darinka

    2013-01-01

    Introduction: The noninvasive screening methods for bilirubin determination were studied prospectively in a group of full-term healthy newborns with the aim of early prediction of pathological neonatal hyperbilirubinemia. Laboratory determination of bilirubin (Jendrassik- Grof (JG)) was compared to the noninvasive transcutaneous bilirubin (TcBIL) together with the determination of bilirubin in cord blood. Methods: The study group consisted of 284 full-term healthy consecutively born infants i...

  15. Pričakovanja študentov glede na razlike v kakovosti storitev visokošolskih zavodov = Student Expectations of Higher Education Institution Services

    Directory of Open Access Journals (Sweden)

    Marijana Sikošek

    2011-09-01

    Full Text Available New challenges witnessed also in Slovenian higher education requirea different approach towards understanding students and their expectations,as higher education becomes increasingly market-oriented.Since research on assessing student expectations is still rare, we havedecided to establish the expectations of students regarding their studiesat the University of Primorska. With the help of factor analysis, wehave determined that these expectations are related to the followingsix factors: relationship between teaching staff and students, faculty’sreputation, faculty’s environment, employment chances, academic excellence,and staff competence and expertise. Cluster analysis has revealeda difference between the expectations of students of professionalstudy programmes and students of academic study programmes.

  16. Responses of the reflectance indices PRI and NDVI to experimental warming and drought in European shrublands along a north-south climatic gradient

    NARCIS (Netherlands)

    Mänd, P.; Hallik, L.; Peñuelas, J.; Nilson, T.; Duce, P.; Emmett, B.A.; Beier, C.; Estiarte, M.; Garadnai, J.; Kalapos, T.; Schmidt, I.K.; Kovács-Láng, E.; Prieto, P.; Tietema, A.; Westerveld, J.W.; Kull, O.

    2010-01-01

    The aim of this study was to evaluate the use of ground-based canopy reflectance measurements to detect changes in physiology and structure of vegetation in response to experimental warming and drought treatment at six European shrublands located along a North-South climatic gradient. We measured

  17. Etiologija in klinična slika duševne manjrazvitosti pri otrocih: Etiology and clinical features of mental retardation in children:

    OpenAIRE

    Bon, Jurij

    1998-01-01

    Children with mental retardation constitute a group with special medical needs. There are several hundrede known etiological (mostly biomedical) factors, that can influence the development of a child's brain. We experience the changes in their prevalence rates, mainly because of improvements in health care. There is more than one etiological factor present in more than half of mentally retarded children. We are recognizing the role of psychosocial factors in development of borderline and mild...

  18. Portable infrared camera as a tool in topoclimatic research = Prenosna infrardeča kamera kot pripomoček pri topoklimatskem raziskovanju

    Directory of Open Access Journals (Sweden)

    Miroslav Vysoudil

    2009-01-01

    Full Text Available The paper presents some possibilities of application of a portable infrared camera fortopoclimatic researches, especially for establishing the differences in temperatures of theso-called active surface layer. Demonstrated is the dependence of surface temperature onsurface characteristics, such as land use, morphological features and the time of the day. Theresults can be useful for establishing topoclimatic units with similar temperature regimes.

  19. Pomen Centra šolskih in obšolskih dejavnosti (CŠOD pri pouku in terenskem delu geografije = Geography in Slovenian Field Study Centres

    Directory of Open Access Journals (Sweden)

    Špela Odar

    1998-01-01

    Full Text Available The paper represents a program written for a "week in nature" for students of 5th, 6th and 7th primary school classes. Primary stress is given to the geographic themes, field work and theory, which are presented in a weekly course in one of 13 field studies centres in Slovenia.

  20. Možnosti zdravljenja klimakteričnih težav pri bolnicah z rakom dojk: Treatment possibilities of menopausal symptoms in breast cancer patients:

    OpenAIRE

    Arko, Darja

    2009-01-01

    Background. Breast cancer is the most common cancer in women. Menopausal symptoms, which can highly reduce quality of life in women of all ages, are frequent side-effects of systemic treatment of early breast cancer whether treated by hormonal or cytotoxic therapy. Methods. The article presents literature review of the causes, assessment and management of menopausal syptoms in breast cancer patients. Results. There are a number of non-hormonal drugs effective in treating vasomotor symptoms, a...

  1. Določanje ciljev fizioterapevtske obravnave pri bolnikih z multiplo sklerozo: Goal setting in physiotherapy for patients with multiple sclerosis:

    OpenAIRE

    Krizmanič, Tatjana

    2014-01-01

    Multiple sclerosis (MS) is a chronic autoimmune inflammatory demyelinating disease of the central nervous system with an unknown aetiology, which is the most common cause of neurological disability in young adults. The disease course is unpredictable and has an influence on all aspects of life. Due to the variability of clinical signs and symptoms in multiple sclerosis a full and accurate assessment is essential to determine the primary problems resulting from the disease pathology. The main ...

  2. Safety techniques during operation and maintenance of electrical equipment in geological development sites. Tekhnika bezopasnosti pri ekspluatatsii i remonte elektroustanovok na geologorazvedochnykh rabotaka

    Energy Technology Data Exchange (ETDEWEB)

    Ksenofontov, A.P.; Chirkin, R.T.

    1976-01-01

    An examination is made of problems in electrical safety and the prevention of electrical accidents in geological-survey operations. A description is given of technical and organizational protective measures against electric shock injuries in geological-survey electrical machinery. Recommendations are given for the safe operation, installation and repair of electrical equipment under specific geological survey conditions. The book is intended for electricians, mechanics, power specialists, safety engineers, geological engineers of survey expenditions, parties, trusts, as well as design-resesarch organizations. 13 references, 18 figures, 8 tables.

  3. Vloga svetovalnega delavca pri prepoznavanju motenj hranjenja in preventivnem delovanju: The school counsellor's role in recognizing eating disorders and implementing preventive measures:

    OpenAIRE

    Berčnik, Sanja

    2012-01-01

    The present article discusses eating disorders. Eating disorders are defined as a serious health threat due to an abnormal relation to food which has become a way of coping with stress. They are also often linked to personality disorders. We have focused mainly on the three most common types of eating disorder – anorexia, bulimia, and compulsive (binge) eating – their recognizable features, the causes that lead to eating disorders, and on preventive measures practiced in ...

  4. Razlike med spoloma pri nekaterih simptomih stresa ter intenzivnost doživljanja stresnih simptomov = Gender Differences in Some Stress Symptoms and Intensity of Experiencing Stress Symptoms

    Directory of Open Access Journals (Sweden)

    Maja Meško

    2010-06-01

    Full Text Available The aim of this study was to identify the symptoms of stress and to establishgender differences in stress symptoms. We tried to find out ifthere are gender differences in the stress level at work, if there aregender differences in terms of stress symptoms frequency, and if thereare gender differences in terms of the intensity of experiencing stresssymptoms. In this study 85 randomly selected managers from Slovenecompanies participated. The results of the study have shown that thereare gender differences in terms of all the above mentioned factors,namely a statistically higher level of stress in women. In terms of stresssymptoms occurrence there are gender differences in some stress symptomsas well as in the intensity of experiencing stress symptoms.

  5. McKenzijeva metoda pri obravnavi bolečine v križu: McKenzie method at treatment of low back pain:

    OpenAIRE

    Bulc, Mateja; Divjak, Mojca

    2008-01-01

    Introduction: The McKenzie method has been known for some time and is an established physiotherapeutic approach for patients with lower back pain. Backpain is a widespread problem, appearing even in young people, and it frequently progresses to chronic stages. Therefore, above all, the aim was to establish whether the McKenzie method is effective in decreasing the intensityof, or even eliminating back pain, as well as what possibilities it offers for quality physiotherapeutic treatment. Metho...

  6. Správanie spotrebitel'a pri nákupe mliečnych produktov v maloobchodnom reťazci Tesco

    OpenAIRE

    Moravčíková, Mária

    2015-01-01

    Consumer behavior buying milk product in string of retail Tesco. Bachelor thesis. Brno: Mendel University, 2015. The bachelor thesis is focused on in store comunication, consumer´s behaviour during shopping for milk and milk products in a Tesco shop. It is based on factors, which influence the consumers during purchasing, such as price, packaging and sales promotion. Furthermore it is dealing with visual merchandising and its influence on behaviour of consumers. Personal questionnaire, which...

  7. Development peculiarities of software systems for automatic control of mine atmosphere. Osobenosti pri izgrazhdane na softuerni sistemi za avtomatiziran kontrol za rudnichnata atmosfera

    Energy Technology Data Exchange (ETDEWEB)

    Arsenyan, E.; Vlaseva, E. (Vissh Minno-Geolozhki Institut, Sofia (Bulgaria))

    1988-01-01

    Analyzes ventilation systems of underground coal mines and computerized systems for their control. The following features of mine ventilation systems are discussed: number and distribution of workings, dynamic and nonstationary character of air flow, influence of extraction and haulage processes, accidents and emergency situations (e.g. fires). Elements of a computerized system for mine ventilation control are evaluated: types of sensors measuring content of methane, carbon monoxide, carbon dioxide, oxygen, air flow velocity, air temperature, a central station for data processing, computerized evaluation of data on mine atmosphere. Examples of the computerized control systems for ventilation control and detecting spontaneous coal combustion used in the Babino coal mine in Bulgaria are discussed. 6 refs.

  8. PRI 8.1: CARNOT. Analysis and research community of the new orientations of the thermodynamics. Activity report june 2002/ june 2004; PRI 8.1: CARNOT. Communaute d'Analyse et de Recherche des Nouvelles Orientations de la Thermodynamique. Rapport d'activite juin 2002/ juin 2004

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    This progress report takes stock on the CARNOT project. This project aims to standardize the different approaches or identify the application fields of each thermodynamical methodology. The cycles analysis and more generally thermodynamical machines (design, energy efficiency, new energy utilization concepts). The environmental impact is also an important topic of the project. (A.L.B.)

  9. Synthesis, structure and reductive dechlorination of the C-centred phosphorus(III) beta-diketiminate PCl(Ph)L [L = C[C(Me)NC6H3Pri2(-2),6][C(Me)NHC6H3Pri2(-2),6

    Science.gov (United States)

    Hitchcock, Peter B; Lappert, Michael F; Nycz, Jacek E

    2003-05-21

    Treatment of the beta-diketimine HL with successively LiBun and PCl2Ph gave the first C-centered monodentate beta-diketiminate PCl(Ph)L 1; with C8K 1 underwent reductive dechlorination yielding 2, a novel N-PIII-PIII-C=C heterocycle.

  10. Pri svete vetra : Tjomnõi tunnel; Kogda-to na jarmarke; Daljoki, zabõtõi...; 'Hriplõi...'; Grustnaja pessenka; Bõla bõ metla...; Kannel; 'Pri svete vetra...'; Odnazhdõ; 'Kipariss...'; 'Na starom kostrisht'e...'; 'Vot spjashtshaja ja...'; 'Ser�

    Index Scriptorium Estoniae

    Vaarandi, Debora, 1916-2007

    1996-01-01

    Orig.: Tume tunnel; Vana laadalugu; Kauge unustatud; "See on..."; Kurb lauluke; Luuata; Kandlemängija; "Tuule valgel..."; Üks; "Küpress..."; "Magan tormis mis mujal..."; "Ööliblikaid halle ja maokaid..."; "naised on need..."; "Krestomaatsed luuletused..."; Sisevaade

  11. La crisis de la seguridad pública y los resultados electorales en el retorno del PRI a Nuevo León. Un análisis retrospectivo

    Directory of Open Access Journals (Sweden)

    Laura Nelly Medellín Mendoza

    2016-01-01

    Full Text Available En este artículo se revisa la problemática reciente de la seguridad en la agenda pública de Nuevo León. Se destaca el efecto en los resultados electorales para el partido gobernante, tanto en elecciones intermedias como en la sucesión por la gubernatura. En ese sentido, el periodo de gobierno de 2003 a 2009 tuvo que enfrentar los altos índices delictivos con promulgación de leyes y políticas públicas, para marcar una reestructuración institucional en esta área. Se encontró evidencia de que el partido gobernante perdió espacios en los comicios intermedios en un contexto de gran inseguridad, pero esto no repercutió en la sucesión por la gubernatura, aunque los índices de homicidios por narcotráfico y la percepción de inseguridad ciudadana fueron altos hasta el término de la administración.

  12. Type 1 Diabetes in the Young: Organization of two National Centers in Israel and Slovenia / Sladkorna Bolezen Tipa 1 Pri Otrocih in Mladostnikih: Organizacija Dela V Dveh Nacionalnih Centrih V Izraelu in Sloveniji

    Directory of Open Access Journals (Sweden)

    Bratina Nataša

    2015-03-01

    Full Text Available Sladkorna bolezen tipa 1 je kronično avtoimuno obolenje, ki najpogosteje prizadene mlade ljudi. Incidenca bolezni zadnjih 50 let narašča po vsem svetu, v povprečju je letni porast incidence ocenjen na 4 %, ob tem pa starost bolnikov ob času diagnoze pada. Raziskave kažejo, da je dobra presnovna urejenost bolnikov s sladkorno boleznijo zelo pomembna, saj je s tem mogoče odložiti pozne zaplete bolezni ter izboljšati kvaliteto življenja bolnikov in njihovih družin. Neprekinjena edukacija bolnikov skupaj z možnostmi moderne tehnologije lahko prispeva k izboljšanju njihove presnovne urejenosti. Presnovno urejenost spremljamo z določanjem glikoziliranega hemoglobina (HbA1c ter s številom težkih hipoglikemij in ketoacidoz na populacijo pacientov v določenem časovnem obdobju. V prispevku sta opisana dva nacionalna referenčna centra za obravnavo otrok, mladostnikov in mladih odraslih s sladkorno boleznijo v Izraelu in Sloveniji.

  13. KAKVOĆA TRUPOVA BROJLERSKIH PILIĆA COBB 500 I HUBBARD CLASSIC PRI HRANIDBI KRMNIM SMJESAMA S NIŽOM I VIŠOM RAZINOM BJELANČEVINA I ENERGIJE

    OpenAIRE

    Nikolova, Nedeljka; Pavlovski, Zlatica; Milošević, Niko; Perić, Lidija

    2008-01-01

    Ocjenjivanje kakvoće brojlerskih trupova sprovedeno je na ukupno 240 pilića dva genotipa Cobb 500 i Hubbard Classic tovljenih do 49 dana. Korištene su dvije različite energetsko-proteinske krmne smjese, a cilj istraživanja je bio utvrditi utjecaj genotipa, spola i hranidbe na kakvoću brojlerskih trupova (masa trupa, randman, mase i udjeli osnovnih dijelova trupa), njihove varijance i interakcija. Utvrđen je statistički značajan (P0,05). Kod ocjenjivanja randmana statistički značajan (P...

  14. Remedies to Fraud in Documentary Letters of Credit: A Comparative Perspective / Opravné Opatrenia Pri Podvodoch S Dokumentárnymi Akreditívami: Komparatívna Perspektíva

    Directory of Open Access Journals (Sweden)

    Alavi Hamed

    2016-06-01

    Full Text Available Article 4 of the Unified Customs and Practices of Documentary Letters of Credit establishes the notion of autonomy principle by separating credit from underlying contract between account party and beneficiary. Article 5 by recognizing the autonomy principle confirms that effectuate the payment under credit, banks only deal with documents and not with goods. As a result, while documentary letters of credit are meant to facilitate the process of international trade, their sole dependency on compliance of presented documents to bank by beneficiary to actualize the payment will increase the risk of fraud and forgery in the course of their operation. Interestingly, UCP (currently UCP600 takes a silent status regarding the problem of fraud in international LC operation and leaves the ground open for national laws to provide remedies to affected parties by fraudulent beneficiary. National Laws have different approaches to the problem of fraud in general and fraud in international LC operation in particular which makes the access of affected parties to possible remedies complicated and difficult. Current paper tries to find answer to the questions of (i what available remedies are provided to affected parties in international LC fraud by different legal systems? (ii And what are conditions for benefiting from such remedies under different legal systems? In achieving its objective, paper will be divided in two main parts to study remedies provided by intentional legal frameworks as well as the ones offered by national laws. Part one will study the position of UCP and UNCITRAL Convention on Independent Guarantees and Standby Letters of Credit (UNCITRAL Convention and remedies, which they provide to LC fraud in international trade. Part two in contrary will study available remedies to LC fraud and condition for access them under English and American legal system.

  15. A Simple and High-Throughput Analysis of Amatoxins and Phallotoxins in Human Plasma, Serum and Urine Using UPLC-MS/MS Combined with PRiME HLB ?Elution Platform

    OpenAIRE

    Shuo Zhang; Yunfeng Zhao; Haijiao Li; Shuang Zhou; Dawei Chen; Yizhe Zhang; Qunmei Yao; Chengye Sun

    2016-01-01

    Amatoxins and phallotoxins are toxic cyclopeptides found in the genus Amanita and are among the predominant causes of fatal food poisoning in China. In the treatment of Amanita mushroom poisoning, an early and definite diagnosis is necessary for a successful outcome, which has prompted the development of protocols for the fast and confirmatory determination of amatoxins and phallotoxins in human biological fluids. For this purpose, a simple, rapid and sensitive multiresidue UPLC-MS/MS method ...

  16. Primerjava običajnih in faktorskih modelov pri statističnem strojnem prevajanju iz angleščine v slovenščino z orodjem Moses

    Directory of Open Access Journals (Sweden)

    Sašo Kuntarič

    2017-05-01

    Full Text Available Machine translation is a field in computational linguistics that explores the use of software to translate text from one language to another. Factored statistical translation is an extension of statistical machine translation, where linguistic annotation is added on the word level. Words are turned into vectors in an attempt to improve translation quality. We describe the use of the open-source Moses system for factored statistical machine translation from English to Slovenian. We created several factored and non-factored language and translation models from a text corpus, containing IT-related texts. We translated two different IT-related documents. The first one was marketing-orientated with a complex structure, while the second one was technical with a simpler structure. We used two methods to compare the generated translations with two independent human translations and a translation, created by the Google Translate service. The first comparison method was the BLEU metrics and the second one were evaluations of human reviewers. The latter method expressed a subjective score, which is still very important in the machine translation field. Even though the results can’t be compared directly due to different metrics, the movement of the grades is well correlated for both texts. The only bigger difference can be seen while implementing factored models for translating the second text. In the conclusion we analysed the inter-evaluator coherence and the obtained results. We discovered that our models are more suitable for technical texts, and that factored models improve the translation of complex texts more.

  17. Neupoštevanje nevarnih in strupenih snovi pri nedavnem množičnem vrednotenju nepremičnin: Accounting for the presence of hazardous and toxic substances in the assessment of property values:

    OpenAIRE

    Drev, Darko; Panjan, Jože; Peček, Mitja

    2013-01-01

    Reductions in assessed value of buildings, equipment and land due to the presence of hazardous and toxic substances are an obligation defined by the International Valuation Standards (8th edition, 2007). Prudent valuation should be conducted in concordance with applicable legislation, fundamental principles of valuation, and international valuation standards - taking into account the presence of hazardous and toxic substances. In Slovenia, however, this aspect of international valuation norms...

  18. Drugi pored mene. Antologija priča i eseja pisaca Jugoistočne Evrope (anthologie éditée par Ričard Švarc

    Directory of Open Access Journals (Sweden)

    Pieter Troch

    2009-02-01

    Full Text Available L’anthologie Drugi pored mene… (L’Autre à côté de moi. Anthologie de nouvelles et d’essais d’écrivains de l’Europe du sud-est comprend vingt et une nouvelles et essais écrits par des auteurs contemporains serbes (David Albahari, Vladimir Arsenijević, László Végel, Charles Simic, Biljana Srbljanović, Dragan Velikić, kosovars (Beqë Cufaj, croates (Slavenka Drakulić, Bora Ćosić, Miljenko Jergović, Irena Vrkljan, bulgares (Dimitré Dinev, Vladimir Zarev, bosniaques (Aleksandar Hemon, Saša Sta...

  19. MEDPREPARATY, PRIMENIMYYe PRI OSTROM OTRAVLENII UGARNYM GAZOM V SHAKHTAKH. ZAMENITELI PLAZMY KROVI. GOLUBAYA KROV' [MEDICATIONS WHICH CAN BE USED IN CASE OF CARBON MONOXIDE ACUTE POISONING IN THE MINES. BLOOD PLASMA SUBSTITUTES. BLUE BLOOD

    Directory of Open Access Journals (Sweden)

    Khromov A.V.

    2017-09-01

    Full Text Available Fires in the operational underground mine openings, as a rule, are catastrophic and lead to numerous victims. Due to the transfer of combustion products by the ventilation stream of the mine ventilation, they can be spread over long distances from the fire site and mortally injure miners along the course of the air stream. Essential assistance to miners in such emergency situations is provided by means of individual protection of miners, which are breathing apparatus of various types - so-called self-rescuers. There are cases anyway when they cannot protect from poisonous combustion products action. Then in the arsenal of mine rescuers there must be medical preparations capable of restoring the respiratory functions of the miners the fire victims. The purpose of this article is to familiarize mining specialists and VGSCh workers with the current state of medical preparations for carbon monoxide effect neutralization.

  20. Naravovarstveno vrednotenje Radenskega polja pri Grosupljem na podlagi inventarizacije favne dnevnih metuljev (Lepidoptera: Rhopalocera): Nature conservation value of Radensko polje near Grosuplje based on the inventory of butterflies (Lepidoptera: Rhopalocera):

    OpenAIRE

    Verovnik, Rudi; Rebeušek, Franc

    2001-01-01

    Radensko polje is one of the largest areas of extensively used wet meadows in central Slovenia. In 2000, we surveyed the nature conservation value of this area based on distribution of the butterfly fauna. The presence of strong populations of Maculinea ažcon, Euphydryas aurinia and Pyrgus armoricanus pointed out a very high conservation value of the surveyed area. Equally important is the presence of locally distributed and highly threatened Carcharodus flocciferus in the northern part of th...

  1. Segmentácia trhu pri použití marketingových dát ako súčasť marketingovej stratégie

    OpenAIRE

    Nagyová-Tkáčová, Monika

    2013-01-01

    The thesis deals mainly with market segmentation which is very important part of marketing strategy. The theoretical part consists of general knowledge of marketing, a Customer relationship management (CRM), market segmentation and database marketing. A case study consists of the implementation of the theoretical knowledge into the practical part. The aims of the thesis are: an introduction to the issue of market segmentation, an importance of market segmentation in creating marketing strateg...

  2. Metodika rasčeta potěr' napora pri gidrotransportě sguščennych pul'p chvostov obogaščenija rud

    Czech Academy of Sciences Publication Activity Database

    Aleksandrov, V.I.; Vlasák, Pavel

    2015-01-01

    Roč. 216, č. 18067 (2015), s. 37-43. ISBN 978-5-94211-749-8. ISSN 0135-3500 Institutional support: RVO:67985874 Keywords : pressure losses * concentration * slurry * rheological parameters Subject RIV: BK - Fluid Dynamics

  3. Verjetnost in statistika igralništva

    OpenAIRE

    Petek, Bojan

    2014-01-01

    V diplomskem delu so predstavljene različne igre pri katerih obstaja matematično ozadje. Razdeljene so v tri skupine: loterijske igre, igre s kockami in kartami ter igre znanja. Pri vsaki igri so predstavljena pravila, različne strategije igranja in matematična podlaga, ki nam pri igranju lahko pomaga. Pri igrah so uporabljeni tudi primeri z izračuni,ki pomagajo razumeti koncept igre.

  4. Behavior and sensitivity of an optimal tree diameter growth model under data uncertainty

    Science.gov (United States)

    Don C. Bragg

    2005-01-01

    Using loblolly pine, shortleaf pine, white oak, and northern red oak as examples, this paper considers the behavior of potential relative increment (PRI) models of optimal tree diameter growth under data uncertainity. Recommendations on intial sample size and the PRI iteractive curve fitting process are provided. Combining different state inventories prior to PRI model...

  5. Treatment of rectal war wounds

    NARCIS (Netherlands)

    O.J.F. van Waes (Oscar); J.A. Halm (Jens); J. Vermeulen (J.); McAlister, V.C. (V. C.)

    2014-01-01

    textabstractTreatment strategies for penetrating rectal injuries (PRI) in civilian settings are still not uniformly agreed, in part since high-energy transfer PRI, such as is frequently seen in military settings, are not taken into account. Here, we describe three cases of PRI, treated in a deployed

  6. The place of Political Risk Insurance in the political risk management strategy of multinational corporations

    Directory of Open Access Journals (Sweden)

    Violeta Iftinchi

    2016-06-01

    Full Text Available Confronted with a variety of political risks that affect their international activities, multinational corporations (MNCs can use Political Risk Insurance (PRI as a method to mitigate some of those risks. The aim of this article is to present the main characteristics of the PRI policies and participants, to highlight its benefits and to put forward three limitations that prevent MNCs in using PRI in their political risk management strategy (fluctuating capacity on the market, high premium rates and small compensation value. The recent trend in incorporating corporate social responsibility requirements as a pre-condition for providing PRI can contribute to lowering PRI premium rates.

  7. DOLOČANJE VLAGE V TALINAH S SLADKORNIMI ANALOGI Z UPORABO "NIR" TEHNOLOGIJE

    OpenAIRE

    Slana, Borut

    2011-01-01

    V diplomskem delu opisujemo eksperimentalni postopek določanja vlage v talinah s sladkornimi analogi z uporabo »NIR« tehnologije. V prvi fazi raziskav smo pri predhodno določenih optimalnih procesnih pogojih izdelali taline sladkornih analogov pri različnih tlakih. V drugi fazi raziskovalnega dela smo pri optimalnih laboratorijskih pogojih pri talinah, izdelanih pri različnih tlakih, določevali vsebnost vlage z NIR tehnologijo in Karl-Fischer-jevo metodo, katera je bila uporabljena kot r...

  8. Program Energy of the CNRS. Topic 10 combustion and capture of CO{sub 2}. PRI 10.1. Capture by adsorption of the CO{sub 2} in thermal power plants gas and their injection in petroleum wells. Final report period 2002-2004; Programme energie du CNRS. Theme 10 combustion et capture du CO2. PRI 10.1. Capture par adsorption du CO2 dans des gaz de centrales thermiques et leur injection en puits de petrole. Rapport final periode 2002-2004

    Energy Technology Data Exchange (ETDEWEB)

    Tondeur, D

    2005-07-01

    In the framework of the global warming resulting of the greenhouse gases emission increase, the carbon dioxide capture and storage in deep underground cavities of old petroleum and gas deposits, are studied. This report presents the researches realized by the CNRS (France) in the domain: technology and knowledge assessment concerning the carbon dioxide capture and storage, active coals for the CO{sub 2} capture, methodology of thermo-economical optimization of the combined cycle, global simulation of an IGCC (Integrated gasification combined cycle) with CO{sub 2} capture and integration in the process scheme, petroleum recovery-aided by CO{sub 2} injection, storage in geological deposits. (A.L.B.)

  9. Arterijska hipertenzija in DASH dieta

    OpenAIRE

    Vidović, Duška

    2017-01-01

    Uvod: Arterijska hipertenzija je pri nas in v razvitem svetu poglavitni vzrok obolevnosti in umrljivosti, zato predstavlja velik javno-zdravstveni problem. Namen: Namen diplomskega dela je na teoretični ravni predstaviti arterijsko hipertenzijo, dejavnike tveganja za nastanek arterijske hipertenzije in zdravljenje s poudarkom na predstavitvi DASH diete, ki je oblika pravilnega prehranjevanja pri obolenju oseb z visokim krvnim tlakom. Diplomsko delo želi predstaviti vlogo medicinske sestre pri...

  10. Forjando a revolução: a cultura política priista (1946-1988)

    OpenAIRE

    Pagotto, Aline Maria de Carvalho [UNESP

    2015-01-01

    This research analyzes the PRI political culture back in 1946 till 1988. The term PRI refers to the Institutional Revolutionary Party (PRI) from Mexico, which won the political and cultural scene of the country during the mentioned time. However, it did not emerge in 1946, as can be concluded. It opened in 1929 as a alternative to the chaotic post-revolution period, obtaining the following name: National Revolutionary Party (PNR 1929-1938). The opening of PNR obeyed the firmament of Maximato ...

  11. Primary microRNA processing is functionally coupled to RNAP II transcription in vitro

    OpenAIRE

    Yin, Shanye; Yu, Yong; Reed, Robin

    2015-01-01

    Previous studies in vivo reported that processing of primary microRNA (pri-miRNA) is coupled to transcription by RNA polymerase II (RNAP II) and can occur co-transcriptionally. Here we have established a robust in vivo system in which pri-miRNA is transcribed by RNAP II and processed to pre-miRNA in HeLa cell nuclear extracts. We show that both the kinetics and efficiency of pri-miRNA processing are dramatically enhanced in this system compared to that of the corresponding naked pri-miRNA. Mo...

  12. Design of Effective Primary MicroRNA Mimics With Different Basal Stem Conformations

    Directory of Open Access Journals (Sweden)

    Fiona T van den Berg

    2016-01-01

    Full Text Available Primary microRNA (pri-miRNA mimics are important mediators of effective gene silencing and are well suited for sustained therapeutic applications. Pri-miRNA mimics are processed in the endogenous miRNA biogenesis pathway, where elements of the secondary RNA structure are crucial for efficient miRNA production. Cleavage of the pri-miRNA to a precursor miRNA (pre-miRNA by Drosha-DGCR8 typically occurs adjacent to a basal stem of ≃11 bp. However, a number of pri-miRNA structures are expected to contain slightly shorter or longer basal stems, which may be further disrupted in predicted folding of the expressed pri-miRNA sequence. We investigated the function and processing of natural and exogenous RNA guides from pri-miRNAs with various basal stems (9–13 bp, where a canonical hairpin was predicted to be well or poorly maintained in predicted structures of the expressed sequence. We have shown that RNA guides can be effectively derived from pri-miRNAs with various basal stem conformations, while predicted guide region stability can explain the function of pri-miRNA mimics, in agreement with previously proposed design principles. This study provides insight for the design of effective mimics based on naturally occurring pri-miRNAs and has identified several novel scaffolds suitable for use in gene silencing applications.

  13. Evaluación de la calidad de la educación en las escuelas priMarías de la ciudad de Guayaquil en los sectores municipales que constituyen ciudadelas y asentamientos de la vía a Daule y la vía a salinas

    OpenAIRE

    Saglimbeni, Evelyn; Zurita Herrera, Gaudencio

    2009-01-01

    Esta investigación se llevó a cabo entre los meses de septiembre y octubre del año 2006, cuya Población Objetivo son las escuelas primarias que se encuentran en los sectores municipales que constituyen ciudadelas o asentamientos de la vía a Daule y la vía a Salinas, y se la estudia a través de la opinión de sus directivos y el saber de sus estudiantes del séptimo año de educación básica. El propósito de la misma es evaluar la calidad de la educación en las escuelas primarias, analizando la op...

  14. Suchozemská malakofauna malokarpatských potočných jelšín a priľahlých porastov Terrestrial molluscan assemblages in alder alluvial forests and adjacent forests in the Small Carpathians (SW Slovakia

    Directory of Open Access Journals (Sweden)

    Juraj Čačaný

    2012-01-01

    Full Text Available A total of 56 species of land snails and 9 freshwater species were recorded at 22 alluvial forest sites (14 alder sites, 8 beech or hornbeam sites in the Small Carpathian Mts. (SW Slovakia during the researches in 2008–2009. Fifty two species were recorded in alder carrs and 32 species in adjacent forests. Woodland species sensu stricto (17 species, 32.7% and euryecious species (10 species, 19.2% predominated in alder forests. Dominant ecological groups in beech and hornbeam forests were woodland species sensu stricto (14 species, 43.8% and woodland eurytopic species (6 species, 18.8%. There were 28 species (433 individuals at the highest species richness site (Lozorno, alder carr. Generally, the species richness was higher in alder forests in comparison to beech or hornbeam forests. As expected, there was a higher number of species at the carbonate sites than non-carbonate sites. The following species were recorded in the Small Carpathian Mts. for the first time: Deroceras rodnae s. lat. Grossu et Lupu, 1965, Deroceras turcicum (Simroth, 1894 and freshwater snail Gyraulus rossmaessleri (Auerswald, 1852.

  15. 'ja hotela skazat eti pustõje slova, govorit, kak oskolki...'; 'oni tantsevali, oni smejalis, u nih bõli bussõ na sheje...'; 'vse mastera, vse kuznetsõ kontshajut rabotu pri utrennem...'; 'u hipohondrika bolit golova, u nego klaustrofobija...' /

    Index Scriptorium Estoniae

    Oidekivi, Kirsti

    1997-01-01

    Orig.: "tahtsin öelda neid tühiseid sõnu, rääkida, kuidas luutükid nahka..."; "nad tantsisid ja naersid, ja helmed olid kaelas..."; "kõik meistrid ja sepistajad lõpetavad töö hommiku- või mõnes muus..."; "hüpohondrikul valutab pea, sest tal on klaustrofoobia..."

  16. Ruspoli Stéphane, Le message de Hallâj l’Expatrié. Recueil du Dîwân, Hymnes et prières, Sentences prophétiques et philosophiques, Paris, Cerf, coll. Patrimoines – Islam, 2005, 422 p.

    Directory of Open Access Journals (Sweden)

    Denis Gril

    2007-11-01

    Full Text Available Stéphane Ruspoli, auteur de nombreuses traductions de textes soufis entreprend dans ce recueil de rendre accessible à un large public la plus grande partie de l’œuvre d’al-Hallâj. Il vient de publier, en complément à ce travail, la réédition et la traduction des ™awâsîn (al-Paris, Al-Bouraq 2006, mettant ainsi à la disposition du lecteur francophone la quasi-totalité des “vestiges“ intellectuels et spirituels laissés par le martyr de Bagdad. En effet Massignon n’avait pas cherché à réunir da...

  17. GenBank blastx search result: AK110320 [KOME

    Lifescience Database Archive (English)

    Full Text Available rotein p30), a zinc finger protein pseudogene, the 5' end of a variant of the MAGED1 gene for melanoma antigen, family D, 1 and two CpG islands, complete sequence.|PRI PRI 3e-99 +2 ...

  18. GenBank blastx search result: AK107236 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK107236 002-125-E12 BC011034.1 Homo sapiens butyrobetaine (gamma), 2-oxoglutarate ...dioxygenase (gamma-butyrobetaine hydroxylase) 1, mRNA (cDNA clone MGC:13676 IMAGE:4042355), complete cds.|PRI PRI 9e-31 +2 ...

  19. GenBank blastx search result: AK062023 [KOME

    Lifescience Database Archive (English)

    Full Text Available similar to human tumor rejection antigen (gp96) 1 (TRA1), mRNA, RefSeq: NM_003299.1.|PRI PRI 1e-131 +3 ... ...AK062023 001-043-G02 AB169724.1 Macaca fascicularis brain cDNA, clone: QflA-11385,

  20. GenBank blastx search result: AK059704 [KOME

    Lifescience Database Archive (English)

    Full Text Available similar to human tumor rejection antigen (gp96) 1 (TRA1), mRNA, RefSeq: NM_003299.1.|PRI PRI 2e-19 +1 ... ...AK059704 001-032-D05 AB169724.1 Macaca fascicularis brain cDNA, clone: QflA-11385,

  1. GenBank blastx search result: AK061896 [KOME

    Lifescience Database Archive (English)

    Full Text Available similar to human tumor rejection antigen (gp96) 1 (TRA1), mRNA, RefSeq: NM_003299.1.|PRI PRI 1e-172 +2 ... ...AK061896 001-041-G11 AB169724.1 Macaca fascicularis brain cDNA, clone: QflA-11385,

  2. SPARK-UP; Seaweed Production And Refining of Kelp, Ulva and Palmaria

    NARCIS (Netherlands)

    Wald, J.; Visser, de W.; Brandenburg, W.A.; Jongschaap, R.E.E.; Werf, van der A.K.; Deelman, Berth-Jan; Helmendach-Nieuwenhuize, Carola

    2016-01-01

    In het SPARK-UP project, waarin de partners Arkema, PRI-WUR en North Seaweed samenwerkten aan de ontwikkeling van toepassing van zeewier in de biobased economy, is de afgelopen jaren veel werk verzet. In een bassin op het terrein van Arkema, heeft PRI een teeltsysteem opgezet en in gebruik genomen,

  3. Deconvolution of pigment and physiologically related photochemical reflectance index variability at the canopy scale over an entire growing season.

    Science.gov (United States)

    Hmimina, G; Merlier, E; Dufrêne, E; Soudani, K

    2015-08-01

    The sensitivity of the photochemical reflectance index (PRI) to leaf pigmentation and its impacts on its potential as a proxy for light-use efficiency (LUE) have recently been shown to be problematic at the leaf scale. Most leaf-to-leaf and seasonal variability can be explained by such a confounding effect. This study relies on the analysis of PRI light curves that were generated at the canopy scale under natural conditions to derive a precise deconvolution of pigment-related and physiologically related variability in the PRI. These sources of variability were explained by measured or estimated physiologically relevant variables, such as soil water content, that can be used as indicators of water availability and canopy chlorophyll content. The PRI mainly reflected the variability in the pigment content of the canopy. However, the corrected PRI, which was obtained by subtracting the pigment-related seasonal variability from the PRI measurement, was highly correlated with the upscaled LUE measurements. Moreover, the sensitivity of the PRI to the leaf pigment content may mask the PRI versus LUE relationship or result in an artificial relationship that reflects the relationship of chlorophyll versus LUE, depending on the species phenology. © 2015 John Wiley & Sons Ltd.

  4. GenBank blastx search result: AK061903 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061903 001-041-H07 AB209558.1 Homo sapiens mRNA for splicing factor, arginine/serine-rich 1 (splicing... factor 2, alternate splicing factor) variant protein.|PRI PRI 6e-47 +1 ...

  5. GenBank blastx search result: AK104857 [KOME

    Lifescience Database Archive (English)

    Full Text Available ene for chromosome 20 open reading frame 136, the 5' end of the C20orf14 gene for chromosome 20 open reading frame 14 and twelve CpG islands, complete sequence.|PRI PRI 3e-12 +2 ...

  6. GenBank blastx search result: AK060610 [KOME

    Lifescience Database Archive (English)

    Full Text Available ene for chromosome 20 open reading frame 136, the 5' end of the C20orf14 gene for chromosome 20 open reading frame 14 and twelve CpG islands, complete sequence.|PRI PRI 5e-11 +2 ...

  7. GenBank blastx search result: AK064411 [KOME

    Lifescience Database Archive (English)

    Full Text Available ene for chromosome 20 open reading frame 136, the 5' end of the C20orf14 gene for chromosome 20 open reading frame 14 and twelve CpG islands, complete sequence.|PRI PRI 1e-55 +3 ...

  8. GenBank blastx search result: AK060287 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060287 001-006-C09 BC009235.2 Homo sapiens hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme... A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit, mRNA (cDNA clone MGC:1728 IMAGE:2966432), complete cds.|PRI PRI 5e-15 +1 ...

  9. GenBank blastx search result: AK061665 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061665 001-036-F01 BC009235.2 Homo sapiens hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme... A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit, mRNA (cDNA clone MGC:1728 IMAGE:2966432), complete cds.|PRI PRI 8e-31 +3 ...

  10. GenBank blastx search result: AK061948 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061948 001-042-E07 BC011977.1 Homo sapiens acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coen...zyme A thiolase), mRNA (cDNA clone MGC:9371 IMAGE:3860150), complete cds.|PRI PRI 1e-104 +3 ...

  11. GenBank blastx search result: AK059654 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059654 001-031-C10 BC011977.1 Homo sapiens acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coen...zyme A thiolase), mRNA (cDNA clone MGC:9371 IMAGE:3860150), complete cds.|PRI PRI 2e-53 +1 ...

  12. GenBank blastx search result: AK062168 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062168 001-046-B11 BC009235.2 Homo sapiens hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme... A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit, mRNA (cDNA clone MGC:1728 IMAGE:2966432), complete cds.|PRI PRI 3e-29 +2 ...

  13. GenBank blastx search result: AK105069 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105069 001-045-C01 AB169286.1 Macaca fascicularis testis cDNA, clone: QtsA-18648, similar to human mortali...ty factor 4 like 2 (MORF4L2), mRNA, RefSeq: NM_012286.1.|PRI PRI 3e-20 +3 ...

  14. GenBank blastx search result: AK107489 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK107489 002-129-C12 CR457345.1 Homo sapiens full open reading frame cDNA clone RZP...Do834B0510D for gene C14orf137, chromosome 14 open reading frame 137; complete cds, incl. stopcodon.|PRI PRI 1e-14 +1 ...

  15. GenBank blastx search result: AK105716 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105716 001-201-F04 CR457266.1 Homo sapiens full open reading frame cDNA clone RZP...Do834C046D for gene C20orf31, chromosome 20 open reading frame 31; complete cds, incl. stopcodon.|PRI PRI 1e-90 +1 ...

  16. GenBank blastx search result: AK060852 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060852 001-034-E10 CR457266.1 Homo sapiens full open reading frame cDNA clone RZP...Do834C046D for gene C20orf31, chromosome 20 open reading frame 31; complete cds, incl. stopcodon.|PRI PRI 3e-33 +3 ...

  17. GenBank blastx search result: AK059388 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059388 001-026-H03 CR457345.1 Homo sapiens full open reading frame cDNA clone RZP...Do834B0510D for gene C14orf137, chromosome 14 open reading frame 137; complete cds, incl. stopcodon.|PRI PRI 1e-28 +3 ...

  18. GenBank blastx search result: AK063713 [KOME

    Lifescience Database Archive (English)

    Full Text Available rotein p30), a zinc finger protein pseudogene, the 5' end of a variant of the MAGED1 gene for melanoma antigen, family D, 1 and two CpG islands, complete sequence.|PRI PRI 1e-122 +2 ...

  19. GenBank blastx search result: AK060824 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060824 001-034-B04 U75295.1 Human fatty aldehyde dehydrogenase (ALDH10) gene, alternative...ly spliced exon 9', and complete cds for alternatively spliced product.|PRI PRI 3e-91 +1 ...

  20. GenBank blastx search result: AK104746 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104746 001-038-E07 U75295.1 Human fatty aldehyde dehydrogenase (ALDH10) gene, alternative...ly spliced exon 9', and complete cds for alternatively spliced product.|PRI PRI 1e-102 +2 ...

  1. GenBank blastx search result: AK060250 [KOME

    Lifescience Database Archive (English)

    Full Text Available similar to human NIMA (never in mitosis gene a)- related kinase 9 (NEK9),mRNA, RefSeq: NM_033116.3.|PRI PRI 1e-14 +2 ... ...AK060250 001-004-B02 AB168824.1 Macaca fascicularis testis cDNA, clone: QtsA-15092,

  2. GenBank blastx search result: AK060204 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060204 001-001-H12 AB168629.1 Macaca fascicularis testis cDNA clone: QtsA-13651, ...similar to human NIMA (never in mitosis gene a)-related kinase 2 (NEK2),mRNA, RefSeq: NM_002497.1.|PRI PRI 8e-12 +3 ...

  3. GenBank blastx search result: AK060750 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060750 001-032-G02 AB168702.1 Macaca fascicularis testis cDNA clone: QtsA-14263, ...similar to human NIMA (never in mitosis gene a)-related kinase 2 (NEK2),mRNA, RefSeq: NM_002497.1.|PRI PRI 2e-12 +2 ...

  4. GenBank blastx search result: AK060204 [KOME

    Lifescience Database Archive (English)

    Full Text Available similar to human NIMA (never in mitosis gene a)- related kinase 9 (NEK9),mRNA, RefSeq: NM_033116.3.|PRI PRI 2e-13 +3 ... ...AK060204 001-001-H12 AB168824.1 Macaca fascicularis testis cDNA, clone: QtsA-15092,

  5. GenBank blastx search result: AK060204 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060204 001-001-H12 AB168702.1 Macaca fascicularis testis cDNA clone: QtsA-14263, ...similar to human NIMA (never in mitosis gene a)-related kinase 2 (NEK2),mRNA, RefSeq: NM_002497.1.|PRI PRI 8e-12 +3 ...

  6. GenBank blastx search result: AK059494 [KOME

    Lifescience Database Archive (English)

    Full Text Available for 60kDa splicing factor 3a subunit 3, the FHL3 gene for four and a half LIM domains 3 and the gene for comparative gene identifica...tion transcript 94 (CGI-94), complete sequence.|PRI PRI 2e-37 +2 ...

  7. GenBank blastx search result: AK063915 [KOME

    Lifescience Database Archive (English)

    Full Text Available some 10 Contains a novel gene, the HPS1 gene for Hermansky-Pudlak syndrome 1, the 3' end of the HPSE2 gene for heparanase 2 and a CpG island, complete sequence.|PRI PRI 1e-139 +3 ...

  8. GenBank blastx search result: AK107538 [KOME

    Lifescience Database Archive (English)

    Full Text Available some 10 Contains a novel gene, the HPS1 gene for Hermansky-Pudlak syndrome 1, the 3' end of the HPSE2 gene for heparanase 2 and a CpG island, complete sequence.|PRI PRI 5e-21 +2 ...

  9. GenBank blastx search result: AK060767 [KOME

    Lifescience Database Archive (English)

    Full Text Available some 10 Contains a novel gene, the HPS1 gene for Hermansky-Pudlak syndrome 1, the 3' end of the HPSE2 gene for heparanase 2 and a CpG island, complete sequence.|PRI PRI 3e-25 +2 ...

  10. GenBank blastx search result: AK058642 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058642 001-018-E05 AF023268.1 Homo sapiens clk2 kinase (CLK2), propin1, cote1, glucocerebro...sidase (GBA), and metaxin genes, complete cds; metaxin pseudogene and glucocerebrosidase pseudogene; and thrombospondin3 (THBS3) gene, partial cds.|PRI PRI 2e-18 +3 ...

  11. GenBank blastx search result: AK059494 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059494 001-028-H05 AB179082.1 Macaca fascicularis testis cDNA clone: QtsA-12630, similar to human oculocer...ebrorenal syndrome of Lowe (OCRL), transcriptvariant a, mRNA, RefSeq: NM_000276.3.|PRI PRI 7e-40 +2 ...

  12. GenBank blastx search result: AK104229 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104229 006-307-D03 AF023268.1 Homo sapiens clk2 kinase (CLK2), propin1, cote1, glucocerebro...sidase (GBA), and metaxin genes, complete cds; metaxin pseudogene and glucocerebrosidase pseudogene; and thrombospondin3 (THBS3) gene, partial cds.|PRI PRI 3e-41 +3 ...

  13. GenBank blastx search result: AK061708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061708 001-037-F11 AF023268.1 Homo sapiens clk2 kinase (CLK2), propin1, cote1, glucocerebro...sidase (GBA), and metaxin genes, complete cds; metaxin pseudogene and glucocerebrosidase pseudogene; and thrombospondin3 (THBS3) gene, partial cds.|PRI PRI 1e-41 +3 ...

  14. GenBank blastx search result: AK106998 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK106998 002-120-B12 AB179082.1 Macaca fascicularis testis cDNA clone: QtsA-12630, similar to human oculocer...ebrorenal syndrome of Lowe (OCRL), transcriptvariant a, mRNA, RefSeq: NM_000276.3.|PRI PRI 1e-29 +3 ...

  15. GenBank blastx search result: AK104725 [KOME

    Lifescience Database Archive (English)

    Full Text Available osome 9p12-13.3 Contains the 3' end of a novel gene (FLJ22611), a novel gene, the GRHPR gene for glyoxylate ...reductase/hydroxypyruvate reductase, a novel gene (KIAA0354), a novel pseuodgene and a CpG island, complete sequence.|PRI PRI 3e-19 +1 ...

  16. GenBank blastx search result: AK064003 [KOME

    Lifescience Database Archive (English)

    Full Text Available some 1 Contains the 5' end of the gene for a novel protein (LOC255104), the gene for a novel protein (FLJ20225), a novel... gene and the 5' end of the gene for a novel protein (KIAA0459), complete sequence.|PRI PRI 6e-22 +2 ...

  17. GenBank blastx search result: AK104788 [KOME

    Lifescience Database Archive (English)

    Full Text Available osome 9p12-13.3 Contains the 3' end of a novel gene (FLJ22611), a novel gene, the GRHPR gene for glyoxylate ...reductase/hydroxypyruvate reductase, a novel gene (KIAA0354), a novel pseuodgene and a CpG island, complete sequence.|PRI PRI 1e-22 +2 ...

  18. GenBank blastn search result: AK058686 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058686 001-019-A10 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 6e-46 Plus Minus ...

  19. GenBank blastx search result: AK061605 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061605 001-030-C05 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 7e-27 +1 ...

  20. GenBank blastn search result: AK058913 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058913 001-009-A01 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 3e-12 Plus Minus ...

  1. GenBank blastn search result: AK058436 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058436 001-015-F07 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 2e-51 Plus Minus ...

  2. GenBank blastn search result: AK059159 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059159 001-023-D03 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 3e-19 Plus Plus ...

  3. GenBank blastn search result: AK059019 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059019 001-021-B02 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 5e-47 Plus Minus ...

  4. GenBank blastn search result: AK058741 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058741 001-019-G08 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 2e-55 Plus Minus ...

  5. GenBank blastn search result: AK119240 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119240 001-120-A04 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 6e-50 Plus Minus ...

  6. GenBank blastx search result: AK058540 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058540 001-017-B06 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 5e-27 +1 ...

  7. GenBank blastx search result: AK059228 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059228 001-024-D11 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 8e-27 +3 ...

  8. GenBank blastn search result: AK059098 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059098 001-022-C07 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 2e-43 Plus Minus ...

  9. GenBank blastx search result: AK058227 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058227 001-010-H11 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 1e-16 +2 ...

  10. GenBank blastn search result: AK105816 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105816 001-203-C11 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 1e-47 Plus Minus ...

  11. GenBank blastx search result: AK058913 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058913 001-009-A01 U91328.1 Human hereditary haemochromatosis region, histone 2A-like protein gene, heredi...tary haemochromatosis (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds.|PRI PRI 1e-27 +1 ...

  12. GenBank blastx search result: AK062053 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062053 001-044-B12 AB168326.1 Macaca fascicularis testis cDNA clone: QtsA-11239, similar to human serologi...cally defined breast cancer antigen 84(SDBCAG84), transcript variant 2, mRNA, RefSeq: NM_015966.2.|PRI PRI 8e-15 +3 ...

  13. GenBank blastx search result: AK111941 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111941 001-021-E10 AB169016.1 Macaca fascicularis testis cDNA, clone: QtsA-16612, similar to human serolog...ically defined colon cancer antigen 10(SDCCAG10), mRNA, RefSeq: NM_005869.1.|PRI PRI 9e-31 +2 ...

  14. GenBank blastx search result: AK111941 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111941 001-021-E10 AB168438.1 Macaca fascicularis testis cDNA clone: QtsA-12191, similar to human serologi...cally defined colon cancer antigen 10(SDCCAG10), mRNA, RefSeq: NM_005869.1.|PRI PRI 9e-31 +2 ...

  15. GenBank blastx search result: AK105601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105601 001-200-A06 AB168326.1 Macaca fascicularis testis cDNA clone: QtsA-11239, similar to human serologi...cally defined breast cancer antigen 84(SDBCAG84), transcript variant 2, mRNA, RefSeq: NM_015966.2.|PRI PRI 1e-92 +2 ...

  16. GenBank blastx search result: AK059138 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059138 001-022-H09 AB168326.1 Macaca fascicularis testis cDNA clone: QtsA-11239, similar to human serologi...cally defined breast cancer antigen 84(SDBCAG84), transcript variant 2, mRNA, RefSeq: NM_015966.2.|PRI PRI 2e-18 +2 ...

  17. GenBank blastx search result: AK063763 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063763 001-121-B02 AB168326.1 Macaca fascicularis testis cDNA clone: QtsA-11239, similar to human serologi...cally defined breast cancer antigen 84(SDBCAG84), transcript variant 2, mRNA, RefSeq: NM_015966.2.|PRI PRI 3e-88 +3 ...

  18. GenBank blastx search result: AK104987 [KOME

    Lifescience Database Archive (English)

    Full Text Available ene for regulator of G-protein signalling like 2, the 5' end of the RGSL1 gene fo...r regulator of G-protein signalling like 1 and a CpG island, complete sequence.|PRI PRI 1e-111 +1 ...

  19. GenBank blastx search result: AK058580 [KOME

    Lifescience Database Archive (English)

    Full Text Available highly similar to DNA-DIRECTED RNA POLYMERASE I 135 KD POLYPEPTIDE (EC 2.7.7.6).|PRI PRI 1e-75 +1 ... ...AK058580 001-017-F06 AK022890.1 Homo sapiens cDNA FLJ12828 fis, clone NT2RP2002993,

  20. GenBank blastx search result: AK058580 [KOME

    Lifescience Database Archive (English)

    Full Text Available highly similar to DNA-DIRECTED RNA POLYMERASE I 135 KD POLYPEPTIDE (EC 2.7.7.6).|PRI PRI 1e-74 +1 ... ...AK058580 001-017-F06 AK022533.1 Homo sapiens cDNA FLJ12471 fis, clone NT2RM1000894,

  1. GenBank blastx search result: AK062146 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062146 001-045-G12 AB063318.1 Homo sapiens MoDP-2, MoDP-3 mRNA for acute morphine... dependence related protein 2, acute morphine dependence related peptide 3, complete cds.|PRI PRI 2e-80 +1 ...

  2. GenBank blastx search result: AK059413 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059413 001-027-D02 AB063318.1 Homo sapiens MoDP-2, MoDP-3 mRNA for acute morphine... dependence related protein 2, acute morphine dependence related peptide 3, complete cds.|PRI PRI 9e-12 +1 ...

  3. GenBank blastx search result: AK059663 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059663 001-031-E04 AB063318.1 Homo sapiens MoDP-2, MoDP-3 mRNA for acute morphine... dependence related protein 2, acute morphine dependence related peptide 3, complete cds.|PRI PRI 7e-29 +3 ...

  4. Neuronal activity rapidly induces transcription of the CREB-regulated microRNA-132, in vivo

    DEFF Research Database (Denmark)

    Nudelman, Aaron Samuel; DiRocco, Derek P; Lambert, Talley J

    2010-01-01

    , olfactory bulb, and striatum by contextual fear conditioning, odor-exposure, and cocaine-injection, respectively, also increased pri-miR-132. Induction kinetics of pri-miR-132 were monitored and found to parallel those of immediate early genes, peaking at 45 min and returning to basal levels within 2 h...

  5. Improved plant nitrogen nutrition contributes to higher water use efficiency in tomatoes under alternate partial root-zone irrigation

    DEFF Research Database (Denmark)

    Wang, Yaosheng; Liu, Fulai; Andersen, Mathias Neumann

    2010-01-01

    carbon isotope composition (δ13C), indicating that the improvement of WUE might have been a result of long-term optimisation of stomatal control over gas exchange. The constantly higher xylem sap ABA concentration in PRI compared with DI plants was seemingly responsible for the greater control over......Comparative effects of partial root-zone irrigation (PRI) and deficit irrigation (DI) on stomatal conductance (gs), nitrogen accumulation and distribution in tomato (Lycopersicon esculentum L.) plants were investigated in a split-root pot experiment. Results showed that both PRI and DI saved 25...... nutrition and distribution in the canopy may indicate that PRI plants have a greater photosynthetic capacity than DI plants; this is confirmed by the observed positive linear relationship between specific leaf N content and δ13C. It is concluded that PRI improves N nutrition and optimises N distribution...

  6. The Effect of Analogues of 1α,25-Dihydroxyvitamin D2 on the Regrowth and Gene Expression of Human Colon Cancer Cells Refractory to 5-Fluorouracil

    Directory of Open Access Journals (Sweden)

    Jacek Neska

    2016-06-01

    Full Text Available This study aimed to evaluate the capacity of hypocalcemic analogues of 1α,25-dihydroxyvitamin D2 (1,25D2 and 1α,25-dihydroxyvitamin D3 (1,25D3 to inhibit regrowth and regulate the stemness-related gene expression in colon cancer cells undergoing renewal after exposure to 5-fluorouracil (5-FU. All of the tested analogues of 1,25D2 equally potently decreased the clonogenicity and the proliferative activity of HT-29 cells which survived the exposure to 5-FU, but differently regulated gene expression of these cells during their renewal. 1,25D2 and analogues (PRI-1907 and PRI-1917, as well as 1,25D3 and analogue PRI-2191, decreased the relative expression level of several stemness-related genes, such as NANOG, OCT3/4, PROM1, SOX2, ALDHA1, CXCR4, in HT-29/5-FU cells during their renewal, in comparison to untreated HT-29/5-FU cells. The other 1,25D2 analogues (PRI-1906 and PRI-1916 were not capable of downregulating the expression of these stemness-related genes as the analogues PRI-1907 and PRI-1917 did. All of the tested vitamin D analogues upregulated CDH1, the gene encoding E-cadherin associated with epithelial phenotype. Out of the series of analogues studied, side-chain branched analogues of 1,25D2 (PRI-1907, PRI-1917 and the analogue of 1,25D3 (PRI-2191 might be used to target cancer cells with stem-like phenotypes that survive conventional chemotherapy.

  7. Preoperative low-dose steroid can prevent respiratory insufficiency after thymectomy in generalized myasthenia gravis.

    Science.gov (United States)

    Kataoka, Hiroshi; Kiriyama, Takao; Kawaguchi, Takeshi; Sawa, Nobuhiro; Sugie, Kazuma; Horikawa, Hirosei; Tojo, Takashi; Ueno, Satoshi

    2014-01-01

    Postoperative respiratory insufficiency (PRI) in myasthenia gravis (MG) often occurs within several days after thymectomy and remains problematic. In limited studies reporting that preoperative steroids prevented PRI in patients with MG, high doses of steroids were used and detailed information on the use of steroids is limited. Because high-dose steroids significantly increase the risk of adverse effects, we studied 37 patients with generalized MG to investigate whether low-dose steroids might prevent PRI. The low-dose steroids were started orally, and the dose was gradually increased to the maximum level (30 mg/day). Immediately before thymectomy, patients received the maximum dose of oral steroids daily. PRI was defined as the development of restrictive dysfunction requiring mechanical ventilation within 3 days after thymectomy and total postoperative mechanical ventilation support time of >24 h. The rate of PRI in the low-dose steroid use group was significantly lower than that in the no-steroid use group. The postoperative stay in the intensive care unit was shorter in the steroid use group. Extended thymectomy is a well-accepted surgical treatment for selected patients with MG. However, PRI remains problematic. Our results suggest that not only preoperative high-dose steroid treatment, but also low-dose steroid treatment can prevent PRI. © 2014 S. Karger AG, Basel.

  8. Microprocessor Recruitment to Elongating RNA Polymerase II Is Required for Differential Expression of MicroRNAs

    Directory of Open Access Journals (Sweden)

    Victoria A. Church

    2017-09-01

    Full Text Available The cellular abundance of mature microRNAs (miRNAs is dictated by the efficiency of nuclear processing of primary miRNA transcripts (pri-miRNAs into pre-miRNA intermediates. The Microprocessor complex of Drosha and DGCR8 carries this out, but it has been unclear what controls Microprocessor’s differential processing of various pri-miRNAs. Here, we show that Drosophila DGCR8 (Pasha directly associates with the C-terminal domain of the RNA polymerase II elongation complex when it is phosphorylated by the Cdk9 kinase (pTEFb. When association is blocked by loss of Cdk9 activity, a global change in pri-miRNA processing is detected. Processing of pri-miRNAs with a UGU sequence motif in their apical junction domain increases, while processing of pri-miRNAs lacking this motif decreases. Therefore, phosphorylation of RNA polymerase II recruits Microprocessor for co-transcriptional processing of non-UGU pri-miRNAs that would otherwise be poorly processed. In contrast, UGU-positive pri-miRNAs are robustly processed by Microprocessor independent of RNA polymerase association.

  9. Primary microRNA processing is functionally coupled to RNAP II transcription in vitro.

    Science.gov (United States)

    Yin, Shanye; Yu, Yong; Reed, Robin

    2015-07-07

    Previous studies in vivo reported that processing of primary microRNA (pri-miRNA) is coupled to transcription by RNA polymerase II (RNAP II) and can occur co-transcriptionally. Here we have established a robust in vivo system in which pri-miRNA is transcribed by RNAP II and processed to pre-miRNA in HeLa cell nuclear extracts. We show that both the kinetics and efficiency of pri-miRNA processing are dramatically enhanced in this system compared to that of the corresponding naked pri-miRNA. Moreover, this enhancement is general as it occurs with multiple pri-miRNAs. We also show that nascent pri-miRNA is efficiently processed before it is released from the DNA template. Together, our work directly demonstrates that transcription and pri-miRNA processing are functionally coupled and establishes the first in vivo model systems for this functional coupling and for co-transcriptional processing.

  10. Physiology of the seasonal relationship between the photochemical reflectance index and photosynthetic light use efficiency.

    Science.gov (United States)

    Porcar-Castell, Albert; Garcia-Plazaola, José Ignacio; Nichol, Caroline J; Kolari, Pasi; Olascoaga, Beñat; Kuusinen, Nea; Fernández-Marín, Beatriz; Pulkkinen, Minna; Juurola, Eija; Nikinmaa, Eero

    2012-10-01

    The photochemical reflectance index (PRI) is regarded as a promising proxy to track the dynamics of photosynthetic light use efficiency (LUE) via remote sensing. The implementation of this approach requires the relationship between PRI and LUE to scale not only in space but also in time. The short-term relationship between PRI and LUE is well known and is based on the regulative process of non-photochemical quenching (NPQ), but at the seasonal timescale the mechanisms behind the relationship remain unclear. We examined to what extent sustained forms of NPQ, photoinhibition of reaction centres, seasonal changes in leaf pigment concentrations, or adjustments in the capacity of alternative energy sinks affect the seasonal relationship between PRI and LUE during the year in needles of boreal Scots pine. PRI and NPQ were highly correlated during most of the year but decoupled in early spring when the foliage was deeply downregulated. This phenomenon was attributed to differences in the physiological mechanisms controlling the seasonal dynamics of PRI and NPQ. Seasonal adjustments in the pool size of the xanthophyll cycle pigments, on a chlorophyll basis, controlled the dynamics of PRI, whereas the xanthophyll de-epoxidation status and other xanthophyll-independent mechanisms controlled the dynamics of NPQ at the seasonal timescale. We conclude that the PRI leads to an underestimation of NPQ, and consequently overestimation of LUE, under conditions of severe stress in overwintering Scots pine, and most likely also in species experiencing severe drought. This severe stress-induced decoupling may challenge the implementation of the PRI approach.

  11. Vloga uniforme in zunanja podoba medicinske sestre v psihiatrični bolnišnici

    OpenAIRE

    Lukša, Maša

    2017-01-01

    Uvod: Pacienti z duševno motnjo imajo spremenjeno mišljenje, čustvovanje in vedenje. Pri njih sta slog oblačenja in zunanji videz medicinskih sester med pomembnejšimi dejavniki ustvarjanja prvega vtisa. Z uniformo upoštevamo protokol za preprečevanje in obvladovanje okužb in identifikacijsko podobo pri posamezniku. Civilna obleka naj bi prispevala k boljšemu zdravljenju pacientov z duševno motnjo. Vendar mora medicinska sestra paziti pri izbiri civilne obleke za na delovno mesto. Namen: Namen...

  12. Določanje strelne razdalje : diplomsko delo visokošolskega strokovnega študija Varstvoslovje

    OpenAIRE

    Žlof, Nataša

    2013-01-01

    Pri strelu s strelnim orožjem se skupaj s kroglo izstreli del nezgorelih in izgorelih smodniških delcev, ki so zelo pomembni za določanje strelne razdalje in kvalifikacije kaznivega dejanja. Količina in sestava teh delcev sta odvisni predvsem od vrste orožja, vrste streliva, kvalitete streliva in stanja cevi orožja. Domet teh delcev je odvisen od njihove mase, hitrosti ter orožja. Pri kratkocevnem orožju je to do 100 cm, pri dolgocevnem orožju pa do 180 cm. Lokacija in porazdelitev smodniš...

  13. Posebnosti prestajanja kazni zapora za ženske

    OpenAIRE

    Samida, Sandra

    2017-01-01

    Zavodi za prestajanje kazni zapora so bili in so še vedno izoblikovani predvsem po vzoru moških. Glede na to, da se v zadnjih letih število žensk v zaporih drastično dviga, to predstavlja pereč problem pri obsojenih ženskah. S tem so ženske prikrajšane, morda celo zapostavljene, pri njihovih specifičnih posebnostih in potrebah, ki jim pri prestajanju kazni predstavljajo ključno vlogo. Izpostavljenih je osem posebnosti, ki v največji meri vplivajo na obsojene in jih zaradi tega postavljajo ...

  14. Tehnološki razvoj vrenja u hladnjaku s pomoću zamrznutih sirovina

    OpenAIRE

    Gialleli, Angelika-Ioanna; Ganatsios, Vassilios; Terpou, Antonia; Kanellaki, Maria; Bekatorou, Argyro; Koutinas, Athanasios A.; Dimitrellou, Dimitra

    2017-01-01

    U radu je prikazan razvoj novog tipa piva za tržiste, koje se dobiva vrenjem pri niskoj temperaturi u hladnjaku s pomoću imobiliziranog kvasca. Zamrznuta sladovina te stanice soja kvasca Saccharomyces cerevisiae AXAZ-1, koji je otporan na smrzavanje, imobilizirane su na cijevnom modulu i zasebno upotrijebljene za vrenje pri niskim temperaturama (2, 5 i 7 °C). Ispitan je pozitivan učinak cijevnog modula na vrenje pri niskim temperaturama, te je utvrđeno da smrznute imobilizirane stanice kvasca...

  15. Annotation of mammalian primary microRNAs

    Directory of Open Access Journals (Sweden)

    Enright Anton J

    2008-11-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are important regulators of gene expression and have been implicated in development, differentiation and pathogenesis. Hundreds of miRNAs have been discovered in mammalian genomes. Approximately 50% of mammalian miRNAs are expressed from introns of protein-coding genes; the primary transcript (pri-miRNA is therefore assumed to be the host transcript. However, very little is known about the structure of pri-miRNAs expressed from intergenic regions. Here we annotate transcript boundaries of miRNAs in human, mouse and rat genomes using various transcription features. The 5' end of the pri-miRNA is predicted from transcription start sites, CpG islands and 5' CAGE tags mapped in the upstream flanking region surrounding the precursor miRNA (pre-miRNA. The 3' end of the pri-miRNA is predicted based on the mapping of polyA signals, and supported by cDNA/EST and ditags data. The predicted pri-miRNAs are also analyzed for promoter and insulator-associated regulatory regions. Results We define sets of conserved and non-conserved human, mouse and rat pre-miRNAs using bidirectional BLAST and synteny analysis. Transcription features in their flanking regions are used to demarcate the 5' and 3' boundaries of the pri-miRNAs. The lengths and boundaries of primary transcripts are highly conserved between orthologous miRNAs. A significant fraction of pri-miRNAs have lengths between 1 and 10 kb, with very few introns. We annotate a total of 59 pri-miRNA structures, which include 82 pre-miRNAs. 36 pri-miRNAs are conserved in all 3 species. In total, 18 of the confidently annotated transcripts express more than one pre-miRNA. The upstream regions of 54% of the predicted pri-miRNAs are found to be associated with promoter and insulator regulatory sequences. Conclusion Little is known about the primary transcripts of intergenic miRNAs. Using comparative data, we are able to identify the boundaries of a significant proportion of

  16. Kako so indijske števke osvojile svet?

    OpenAIRE

    Miklavžina, Nina

    2015-01-01

    V diplomskem delu so obravnavani različni številski sistemi s poudarkom na zgodovini in vpeljavi indijsko-arabskega številskega sistema in indijskih števkah. Pri vsakem obravnavanem številskem sistemu je predstavljen njegov izvor, razvoj, pomembni posamezniki in drugi prispevki. Pri indijsko-arabskem številskem sistemu smo poleg tega predstavili tudi pomembne mejnike pri uveljavitvi le tega. V praktičnem delu smo predstavili tudi algoritme za pretvorbe iz desetiškega številskega sistema v šte...

  17. Konstruiranje preme električnega avtomobila

    OpenAIRE

    Zevnik, Aleš

    2013-01-01

    Cilj magistrskega dela je konstruiranje preme električnega avtomobila, ki bo še vzdržala obremenitve pri danih pogojih obratovanja. Najprej je bila določena osnovna geometrija elementa, kjer je bilo potrebno upoštevati geometrijo celotnega vzmetenja. Na osnovi določene geometrije preme je bil izdelan 3D model, pri čemer je bila upoštevana tudi montaža v sklop vzmetenja. Nato so bili določeni obremenitveni primeri pri obratovanju vozila, na osnovi katerih so bile po analitičnem postopku izraču...

  18. AUTOBIOGRAFIJE DJECE - RATNIH PROGNANIKA KAO ETNOGRAFIJA ODRASTANJA

    OpenAIRE

    Prica, Ines; Povrzanović, Maja

    1995-01-01

    Članak uvodi u interpretaciju životnih priča djece ratnih prognanika kroz probleme interdisciplinarnog proučavanja autobiografija, naročito teorijskog pregovaranja o problemu statusa zbilje u tekstovima koji nose značaj svjedočenja. Mogućnost etnografskog viđenja ovih dokumenata ovdje se razlaže kao prepoznavanje pripovijednih/kulturnih modela prognaničkog foklora koji sadrže napor kulturne prerade i uklapanja neposrednih iskustava rata u prostor između povijesne priče i priče o ž...

  19. Avtomatizacija merjenja in umerjanja sevalnih termometrov

    OpenAIRE

    ŠTUPICA, ROBERT

    2016-01-01

    Industrijski napredek od nas zahteva vse večjo natančnost pri izdelavi izdelkov, zato moramo paziti na kvaliteto samega procesa izdelovanja, kateri pa je odvisen od različnih parametrov. V ta namen potrebujemo vse boljše in boljše merilnike, s katerimi nadzorujemo parametre, ki nastajajo pri procesu izdelave. V veliko primerih je najpomembnejši parameter pri izdelavi izdelkov prav temperatura. V ta namen so v podjetju Heitronics razvili pirometre, s katerimi lahko brezkontaktno odčitavamo tem...

  20. Recepcijska zmožnost mladega bralca – razvijanje recepcijske zmožnosti zaznavanja, doživljanja in vrednotenja književne osebe

    OpenAIRE

    Jerčič Pšeničnik, Simona

    2016-01-01

    V zadnjem desetletju smo priča spreminjanju bralnih navad otrok in mladostnikov. Opazen je premik od tradicionalnega branja knjig za zabavo do novih bralnih priložnosti, ki jih ponujajo internet in drugi multimedijski sistemi. Računalniki in druge naprave, ki sočasno prikazujejo besedilo, slike, filme in zvoke, so že splošno rabljena orodja, ki lahko pomagajo pri razvijanju otrokovih bralnih zmožnosti. Vsekakor pa ima pri tem pomembno vlogo učitelj, ki bi moral biti usposobljen za pogovor o l...

  1. UGOTAVLJANJE GENSKIH PREDIKTORJEV S POMOČJO INTELIGENTNIH SISTEMOV

    OpenAIRE

    Rednjak, Nejc

    2015-01-01

    Pri strojnem učenju (angl. Machine Learning) gre za pridobivanje znanja na podlagi izkušenj. Ne gre za učenje na pamet, ampak za iskanje pravil v učnih podatkih. Najbolj znane metode strojnega učenja so odločitvena drevesa (DT), metoda podpornih vektorjev (SVM) in nevronske mreže (NN). Metode strojnega učenja so nam v pomoč pri ugotavljanju genskih prediktorjev. Algoritmi strojnega učenja imajo prav tako pomembno vlogo pri diagnosticiranju rakavih obolenj. V magistrskem delu smo opisali najbo...

  2. Primeri uporabe zunanjih avtomatskih defibrilatorjev (AED) na javnih krajih s strani očividcev

    OpenAIRE

    Kristan, Matjaž

    2012-01-01

    V diplomskem delu smo raziskali uporabo avtomatskih defibrilatorjev (AED) na javnih krajih s strani očividcev. Raziskava je temeljila na deskriptivni metodi. Ugotavljamo, da so očividci v 20 primerih uporabili AED, pri tem je AED v šestih primerih priporočal in tudi sprožil električni sunek. Vzpostavili smo kontakt s šestimi očividci, ki so ga uporabili in opisali njihove izkušnje z uporabo AED-ja. Ugotavljamo, da intervjuvanci niso imeli težav pri vklopu aparata, niso imeli težav pri prilepl...

  3. Comparative effects of partial root-zone irrigation and deficit irrigation on phosphorus uptake in tomato plants

    DEFF Research Database (Denmark)

    Wang, Yaosheng; Liu, Fulai; Jensen, Christian Richardt

    2012-01-01

    The comparative effects of partial root-zone irrigation (PRI) and deficit irrigation (DI) on phosphorus (P) uptake in tomato (Lycopersicon esculentum Mill.) plants were investigated in a split-root pot experiment. The results showed that PRI treatment improved water-use efficiency (WUE) compared...... mineral N fertilisation, while similar physiological and agronomic P-use efficiencies were found between the two irrigation treatments with organic N fertilisation. PRI-induced drying and wetting processes might have influenced the bio-availability of soil P, as the concentrations of bio-available P...

  4. Een bloemstrook als leverancier van natuurlijke vijanden: Met luzerne minder groene perzikluis op ijsbergsla

    NARCIS (Netherlands)

    Schelling, G.C.; Belder, den E.

    2002-01-01

    PRI onderzocht het effect van stroken bloeiende luzerne tussen vollegronds ijsbergsla op het voorkomen van natuurlijke vijanden van bladluizen. In de luzernestroken bleken vele predatoren en parasieten van bladluizen voor te komen (zweefvliegen; sluipwespen; loopkevers; roofwantsen); met name de

  5. Students' perceptions of a multimedia computer-aided instruction ...

    African Journals Online (AJOL)

    IDS (aspirin!, ibuprofen·). Prescribed. Pri'3Cri~d pharmaceutical pl'ysical methods methods. Nonspecific low back. Nonspecific low. Sciatica symptoms and/or back symptoms sciatica. Other .:'-1SAIDsI. Manipulation (in place of medication.

  6. "Hacer o no hacer" (To do or not to do). Mexican Foreign Policy and UN Peacekeeping Operations in the 21st Century

    National Research Council Canada - National Science Library

    Encinas-Valenzuela, Jesus E

    2006-01-01

    On December 1, 2000 a new administration took over the presidency of Mexico. This event was much anticipated because the new president, Vicente Fox, belonged to a different party than the PRI, the established official party...

  7. EX1607 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX1607: CAPSTONE Wake Island PRI MNM...

  8. Alternate partial root-zone irrigation improves fertilizer-N use efficiency in tomatoes

    DEFF Research Database (Denmark)

    Wang, Yaosheng; Liu, Fulai; Jensen, Lars Stoumann

    2013-01-01

    N fertilizer treatment (OrgN). Compared with DI, the rhizosphere and bulk soil mineral N content in the soil were significantly lowered in the PRI treatment, indicating the enhanced root N uptake efficiency. It is suggested that PRI-enhanced soil water dynamics may have increased soil nitrate mass....../diffusive flow to the root surfaces and root N uptake efficiency in the wetting soil and stimulated soil N mineralization and plant N demand, contributing to the improved fertilizer-N use efficiency in the PRI relative to the DI treatment.......The objective of this study was to investigate the comparative effects of alternative partial root-zone irrigation (PRI) and deficit irrigation (DI) on fertilizer-N use efficiency in tomato plants under mineral N and organic N fertilizations. The plants were grown in split-root pots in a climate...

  9. Tatiana Detlofson: "Mandariinide" film on nagu väike kalliskivi üüratus meres / intervjueerinud Annela Laaneots

    Index Scriptorium Estoniae

    Detlofson, Tatiana

    2016-01-01

    Intervjuu Oscari nominatsiooni jõudnud Eesti filmi "Mandariinid" PR-tegija Tatiana Detlofsoniga filmi PR-i eduteguritest. Filmi meeskond pälvis Aasta Suhtekorraldaja 2015 tiitli professionaalse ja tulemusliku PR-töö eest

  10. Parent's Take Home Guide to GERD (Gastroesophogeal Reflux Disease)

    Science.gov (United States)

    ... to help reduce spitting up: 3.Persistent Food Refusal •Poor growth or failure to thrive Avoid overfeeding • ... are severe or persistent then your pri mary care provider may consider treatment with a medication or ...

  11. Uudised : Balleti võlumaailm. Agent M sai maha uue plaadi, singli ja videoga

    Index Scriptorium Estoniae

    2007-01-01

    Rahvusooper Estonia, eesotsas Mai Murdmaa, Tatjana Järvi ja Lemme Järviga, korraldab põhikoolinoortele balletti tutvustavaid etendusi. Alternatiivrokki viljeleva ansambli Agent M heliplaadist "Spionaazh" ja videost laulule "Queen of the World" (www.agentm.pri.ee)

  12. Disease: H00945 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available cranial hemorrhages. In plasma, FXIII circulates as a pr...y of the bleeding tendency varies from benign symptoms like excessive bruising to life threatening bleeding emergencies such as intra

  13. Detection of circulating tumor cells by nested RT-PCR targeting ...

    African Journals Online (AJOL)

    Salwa H. Teama

    important factor affecting the prognosis of patients with pri- mary carcinomas [2]. ..... breast, colon cancer, melanoma, neuroblastoma, prostate can- cer, and .... The best- defined problem in RT-PCR assays is carry-over contamina- tion.

  14. Protein (Cyanobacteria): 497241418 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_009555656.1 NZ_CM001633 1117:7258 ... 1150:42633 1301283:62759 44887:855 ... 864702:518 ... replication resta...rt DNA helicase PriA Oscillatoriales cyanobacterium JSC-12 MQSQSSNQQFPCPNCGGRLEFNPK

  15. Protein (Cyanobacteria): 497242540 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_009556762.1 NZ_CM001633 1117:536 ... 1150:41177 1301283:61141 44887:3036 ... 864702...:1912 ... replication restart DNA helicase PriA Oscillatoriales cyanobacterium JSC-12 MNTVTKINIYCPNCGSPAERHTLTKEKLIRTQCHHCDYLMITCSQTGKVIEAYAPGYSIQSL

  16. Protein (Cyanobacteria): 493562294 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 9:2500 ... replication restart DNA helicase PriA Leptolyngbya sp. PCC 7375 MEPTTSVNQYKCPGCKADMAFDPNLGQLQCPYCG... WP_006515698.1 NZ_JH993796 1117:7258 ... 1150:44343 1301283:64659 ... 47251:2393 10212

  17. Aanpak kniptorren werkt beter dan bestrijding ritnaalden

    NARCIS (Netherlands)

    Griepink, F.C.; Ester, A.; Rozen, van K.

    2004-01-01

    Ritnaalden, de larven van kniptorren, veroorzaken schade in bol-, knol- en graangewassen. Als alternatief voor grondontsmetting ter bestrijding van de ritnaalden, ontwikkelden PRI en PPO een methode van geleide bestrijding waarmee de kniptorren worden aangepakt. Met sexferomonen in trechtervallen

  18. Glomerular filtration rate in patients with gout and factors influencing the rate

    Directory of Open Access Journals (Sweden)

    F M Kudaeva

    2007-09-01

    Zaklyuchenie. Sushchestvuet zavisimost' mezhdu sostoyaniem azotovydelitel'noy funktsii pochek i vozrastom bol'nykh, dlitel'nost'yu i IT podagry. Nalichie AG, IBS, KhSN dostoverno ukhudshaet azotovydelitel'nuyu funktsiyu pochek pri podagre.

  19. A Comparative Analysis of Corporate Academies in the Slovenian Economy

    Directory of Open Access Journals (Sweden)

    Metod Šuligoj

    2014-08-01

    Full Text Available V članku avtorja najprej predstavita teoretični okvir in koncept korporativne akademije, pri čemer pojasnita tudi funkcijo in načine merjenja uspešnosti korporativnih akademij. S primerjalno analizo sedmih korporativnih akademij iz Slovenije in ene iz tujine ugotavljata, da zaradi splošne krize večina zmanjšuje število zaposlenih in število ur izobraževanja ter krči letna vlaganja v izobraževanje. Pri analiziranih podjetjih sta še ugotavljala, na katere načine merijo uspešnost svojih akademij, pri čemer sta kompleksnejše pristope zasledila le pri tujem podjetju. Velika večina analiziranih podjetij ocenjuje vzpostavitev korporativne akademije kot popolnoma upravičeno, saj dosega poslovne cilje podjetja, kar kaže, da je v podjetjih zaznana kultura znanja.

  20. GenBank blastx search result: AK243064 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243064 J100015K17 AF034374.1 AF034374 Homo sapiens molybdenum cofactor biosynthesis protein A and molybden...um cofactor biosynthesis protein C mRNA, complete cds. PRI 1e-75 1 ...

  1. Across cultures (Nada Šabec in Limon David

    Directory of Open Access Journals (Sweden)

    Marija Sonja Pezdirc

    2001-12-01

    Full Text Available Pred kratkim je pri Založbi Obzorja iz Maribora izšla knjiga Across Cultures s podnaslovom Slovene-British-American Intercultural Communication (Slovensko-britansko-ameriško sporazumevanje avtorjev dr. Nade Šabec, anglistke in strokovnjakinje za sociolingvistiko, in mag. Davida Limona, Angleža, vendar dobrega poznavalca slovenskega jezika in Slovenije. Knjiga je prvi tovrstni priročnik pri nas, namenjen spoznavanju družbenih in kulturnih razlik in odpravljanju težav pri medkulturnem sporazumevanju med govorci slovenskega ter angleškega jezika in uporaben za vsakega, ki ima (ali pričakuje, da bo imel osebne in pisne stike z angleško govorečimi.

  2. GenBank blastx search result: AK241698 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241698 J065196B09 U75295.1 HSALDHX10 Human fatty aldehyde dehydrogenase (ALDH10) gene, alternative...ly spliced exon 9', and complete cds for alternatively spliced product. PRI 4e-77 1 ...

  3. GenBank blastx search result: AK242828 [KOME

    Lifescience Database Archive (English)

    Full Text Available dependent regulator of chromatin (subfamily a, member 1), the 5' end of the OCRL gene for oculocerebrorenal syndrome of Lowe and two CpG islands, complete sequence. PRI 3e-51 1 ...

  4. GenBank blastx search result: AK241408 [KOME

    Lifescience Database Archive (English)

    Full Text Available dependent regulator of chromatin (subfamily a, member 1), the 5' end of the OCRL gene for oculocerebrorenal syndrome of Lowe and two CpG islands, complete sequence. PRI 1e-21 1 ...

  5. GenBank blastx search result: AK241821 [KOME

    Lifescience Database Archive (English)

    Full Text Available dependent regulator of chromatin (subfamily a, member 1), the 5' end of the OCRL gene for oculocerebrorenal syndrome of Lowe and two CpG islands, complete sequence. PRI 5e-41 1 ...

  6. Experiment list: SRX476927 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  7. Experiment list: SRX099052 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  8. Experiment list: SRX476930 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  9. Experiment list: SRX663240 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  10. Experiment list: SRX476928 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  11. Experiment list: SRX244149 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  12. Experiment list: SRX105185 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  13. Experiment list: SRX476917 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  14. Experiment list: SRX753311 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  15. Experiment list: SRX323568 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  16. Experiment list: SRX514836 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  17. Experiment list: SRX971581 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  18. Experiment list: SRX099054 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  19. Experiment list: SRX476918 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  20. Experiment list: SRX476929 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  1. Experiment list: SRX244150 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available =Epidermal cells which synthesize keratin and undergo characteristic changes as they move upward from the basal layers... of the keratinocytes forming the epidermal layers are basal cell, spinous or pri

  2. Experiment list: SRX031444 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available lysis of H3K27me3 in human fetal heart cells MOLECULE=genomic DNA || DISEASE=None || BIOMATERIAL..._PROVIDER=University of Washington, Congenital Defects Lab. Ian Glass || BIOMATERIAL_TYPE=Pri

  3. Commercialising public research new trends and strategies

    CERN Document Server

    Organisation for Economic Co-operation and Development. Paris

    2013-01-01

    This report describes recent trends in government and institutional level policies to enhance the transfer and exploitation of public research. It also benchmarks a set of countries, universities and public research institutions (PRI) based on both traditional and new indicators.

  4. Adapting risk management and computational intelligence network optimization techniques to improve traffic throughput and tail risk analysis.

    Science.gov (United States)

    2014-04-01

    Risk management techniques are used to analyze fluctuations in uncontrollable variables and keep those fluctuations from impeding : the core function of a system or business. Examples of this are making sure that volatility in copper and aluminum pri...

  5. Media formulation influences chemical effects on neuronal growth and morphology

    Science.gov (United States)

    Abstract Screening for developmental neurotoxicity (DNT) using in vitro, cell-based test systems has been proposed as an efficient and cost-effective alternative to performing in vivo DNT studies. One of the pri...

  6. Solution Method of Multi-Product Two-Stage Logistics Problem with Constraints of Delivery Course

    Science.gov (United States)

    Ataka, Shinichiro; Gen, Mitsuo

    The logistics network design is one of the important phase of Supply Chain Management (SCM) and it is the problem that should be optimized for long-term promotion of efficiency of the whole supply chain. Usually a plant produces different type of products. Even if it is a factory of the same company, delivery is different by a kind of a produced product. The restrictions which this model has are deeply concerned with TP in the real world. In this paper, we consider the logistics network design problems with multi-products and constraints for delivery course. To solve the problem, we used a hybrid priority-based Genetic Algorithm (h-priGA), and we tried the comparison experiment with priority-based Genetic Algorithm (priGA)and h-priGA, we show it about the effectiveness of h-priGA.

  7. Hoe houden we de bladluis in toom?

    NARCIS (Netherlands)

    Schelling, G.C.; Belder, den E.

    2002-01-01

    PRI onderzocht het effect van een meter brede strips luzerne op de aantallen bladluizen en hun natuurlijke vijanden in ijsbergsla. Alle belangrijke bladluissoorten op ijsbergsla en de belangrijkste bladluispredatoren werden geteld gedurende drie plantingen in het groeiseizoen. Behalve voor groene

  8. Photoperiod and temperature constraints on the relationship between the photochemical reflectance index and the light use efficiency of photosynthesis in Pinus strobus.

    Science.gov (United States)

    Fréchette, Emmanuelle; Chang, Christine Yao-Yun; Ensminger, Ingo

    2016-03-01

    The photochemical reflectance index (PRI) is a proxy for the activity of the photoprotective xanthophyll cycle and photosynthetic light use efficiency (LUE) in plants. Evergreen conifers downregulate photosynthesis in autumn in response to low temperature and shorter photoperiod, and the dynamic xanthophyll cycle-mediated non-photochemical quenching (NPQ) is replaced by sustained NPQ. We hypothesized that this shift in xanthophyll cycle-dependent energy partitioning during the autumn is the cause for variations in the PRI-LUE relationship. In order to test our hypothesis, we characterized energy partitioning and pigment composition during a simulated summer-autumn transition in a conifer and assessed the effects of temperature and photoperiod on the PRI-LUE relationship. We measured gas exchange, chlorophyll fluorescence and leaf reflectance during the photosynthetic downregulation in Pinus strobus L. seedlings exposed to low temperature/short photoperiod or elevated temperature/short photoperiod conditions. Shifts in energy partitioning during simulated autumn were observed when the pools of chlorophylls decreased and pools of photoprotective carotenoids increased. On a seasonal timescale, PRI was controlled by carotenoid pool sizes rather than xanthophyll cycle dynamics. Photochemical reflectance index variation under cold autumn conditions mainly reflected long-term pigment pool adjustments associated with sustained NPQ, which impaired the PRI-LUE relationship. Exposure to warm autumn conditions prevented the induction of sustained NPQ but still impaired the PRI-LUE relationship. We therefore conclude that alternative zeaxanthin-independent NPQ mechanisms, which remain undetected by the PRI, are present under both cold and warm autumn conditions, contributing to the discrepancy in the PRI-LUE relationship during autumn. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. The Drug war: Diplomatic and Security Implications for Mexico and the United States

    Science.gov (United States)

    2011-06-10

    Federal Security (DFS), the Agencia Federal de Investigacion (AFI), or local/state police agencies. The Colombian armed forces did match their Mexican...2012 highlights economic and social improvements and public safety. Furthermore the PRI seeks to improve law enforcement, the judicial system, and...identified by the PRI platform is the hindrance of Mexico’s economic and social development by the DTOs. From the PRI’s perspective the justice and

  10. Seasonal patterns of reflectance indices, carotenoid pigments and photosynthesis of evergreen chaparral species.

    Science.gov (United States)

    Stylinski, C; Gamon, J; Oechel, W

    2002-05-01

    This study examined the ability of the Photochemical Reflectance Index (PRI) to track seasonal variations in carotenoid pigments and photosynthetic activity of mature evergreen chaparral shrubs. Our results confirm that PRI scales with photosystem two (PSII) photochemical efficiency across species and seasons, as demonstrated by PRI's strong correlation with de-epoxidized (photoprotective) xanthophyll cycle pigment levels (normalized to chlorophyll) and with the chlorophyll fluorescence index, ΔF/Fm'. PRI and carotenoid pigment levels (de-epoxidized xanthophyll cycle pigments normalized to chlorophyll or total carotenoid pigments normalized to chlorophyll) were correlated with seasonal fluctuations in midday net CO2 uptake of top-canopy leaves. By contrast, chlorophyll levels (as measured by the Chlorophyll Index) were not as strongly linked to photosynthetic activity, particularly when all species were considered together. Likewise, the Normalized Difference Vegetation Index (NDVI, an index of canopy greenness) did not correlate with net CO2 uptake. Canopy NDVI also did not correlate with canopy PRI, demonstrating that these indices were largely independent over the temporal and spatial scales of this study. Together, these patterns provide evidence for coordinated regulation of carotenoid pigments, PSII electron transport, and carboxylation across seasons and indicate that physiological adjustments are more important than structural ones in modifying CO2-fixation capacity during periods of photosynthetic down-regulation for these evergreen species. The strong correlation between PRI of whole canopies and PRI of top-canopy leaves suggests that the canopy can be treated as a "big leaf" in terms of this reflectance index and that PRI can be used in "scalable" models. This along with the links between carotenoid pigments, PSII photochemical efficiency and carboxylation across species and seasons supports the use of optical assays of pigment levels and PSII activity

  11. Oscillation of a rigid rod in the special relativity

    CERN Document Server

    Paiva, F M

    2012-01-01

    In the special relativity, a rigid rod slides upon itself, with one extremity oscillating harmonically. We discovered restrictions in the amplitude of the motion and in the length of the rod, essential to eliminate unphysical solutions. ------- Cxe la speciala relativeco, rigida stango movigxas sur si mem, kun unu fino oscilante harmonie. Ni malkovris limigajn kondicxojn pri la amplitudo de movado kaj pri la longo de stango, necesegaj por elimini ne-fizikajn solvojn.

  12. U.S.-Mexico Border: America’s Unlocked Backdoor

    Science.gov (United States)

    2013-03-01

    is a troubling statistic considering Customs and Border Patrol, a division of the Department of Homeland Security, grew tremendously since 2000. “In...Mexico. The election marked a return of the PRI after losing to the National Action Party in 2000. 7 The population of Mexico elected the PRI...initiative which has demonstrated less than expected results is the Merida Initiative. In 2007, the Merida Initiative was a U.S., Mexico and Central

  13. ZADOVOLJSTVO STANOVALCEV S KOMUNIKACIJO NEGOVALNEGA TIMA

    OpenAIRE

    Meško, Maja

    2010-01-01

    Pomen komunikacije je v osebnem, prav tako tudi v poklicnem življenju, vedno bolj v ospredju. Poklic medicinske sestre zaradi usmerjenosti k delu z ljudmi zahteva znanje in obvladovanje komunikacije. Skozi proces komunikacije medicinska sestra razvija svojo osebnost, odkriva pričakovanja starostnikov do nje in njena pričakovanja v odnosu do starejših. V diplomskem delu je predstavljen pomen zadovoljstva stanovalcev s komunikacijo negovalnega tima. Z raziskavo smo želeli opredeliti vrste komun...

  14. ORGANIZIRAN PRISTOP VODENJA GRADBENIH PROJEKTOV V PODJETJU BAUER BERNARD S.P.

    OpenAIRE

    Bauer, Kristina

    2009-01-01

    Ta diplomska naloga podaja osnove upravljanja in vodenja posameznih projektov ter podjetja kot celote. Gradbena podjetja so zaradi narave dela projektno usmerjena in se pri svojem delu srečujejo s problemi multiprojektnega poslovanja. Pri tem gre za problem obvladovanja vseh projektov, ki se v podjetju pojavljajo. Kot organizacijska rešitev teh problemov se v projektnem managementu pojavlja projektna pisarna, ki omogoča celovit pregled in obvladovanje projektov, tako eksternih komercialnih pr...

  15. Dicty_cDB: Contig-U15569-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CL680661 ) PRI012a_A08_2 - PRI012a.BR (747) Mixed stage fosm... 46 5.2 1 ( ES544202 ) Kr_K09_02D13_attB1_seq K09 Euphau...sia superba cDNA... 46 5.2 1 ( ES543556 ) Kr_K06_02P24_attB1_seq K06 Euphau

  16. Ekološki terorizem : magistrsko delo

    OpenAIRE

    Domjanič, Mario

    2013-01-01

    Skozi analizo strokovne literature in intervjujev, opravljenih s slovenskimi strokovnjaki s področja ekologije, okoljske kriminalitete in terorizma, skušamo v magistrski nalogi predstaviti problematiko pojma ekološki terorizem, v nadaljevanju eko terorizem. Podobno kot pri pojmu terorizem se tudi pri eko terorizmu soočimo z velikim številom definicij, ki eko terorizem opredeljujejo v treh oblikah, in sicer kot izraba okolja za teroriziranje, kot teroriziranje okolja ter kot taktiko radikalnih...

  17. Jak3, STAT3, and STAT5 inhibit expression of miR-22, a novel tumor suppressor microRNA, in cutaneous T-Cell lymphoma

    DEFF Research Database (Denmark)

    Sibbesen, Nina A; Kopp, Katharina L; Litvinov, Ivan V

    2015-01-01

    the promoter of the miR-22 host gene, and (iii) inhibition of Jak3, STAT3, and STAT5 triggers increased expression of pri-miR-22 and miR-22. Curcumin, a nutrient with anti-Jak3 activity and histone deacetylase inhibitors (HDACi) also trigger increased expression of pri-miR-22 and miR-22. Transfection...

  18. Prototipna rešitev za vodenje IT projektov

    OpenAIRE

    Jeraj, Simon

    2018-01-01

    Magistrsko delo obravnava razvoj prototipa spletne aplikacije za vodenje projektov. Prototip temelji na programskem jeziku Python. Pri izdelavi prototipa sta bili uporabljeni ogrodji Django in Vue.js. Aplikacija agregira podatke in je namenjena vodjem projektov. Nudi pomoč pri sledenju projektom in upravljanju z njimi. Njena glavna naloga je združevanje in prikaz vseh relevantnih informacij o projektih. Prikazuje vse aktivnosti, ki so povezane s projekti. Nudi tudi prikaz statističnih po...

  19. Dokazi o učinkovitosti ortopedskih čevljev in vložkov: Evidence on effectiveness of orthopaedic shoes and insoles:

    OpenAIRE

    Burger, Helena

    2011-01-01

    The article reviews the literature about effectiveness of insoles or foot orthoses and orthopaedic shoes for paediatric pes planus, juvenile idiopathic arthritis, pes cavus, plantar fasciitis, hallux valgus, diabetic foot, fractures of foot and ankle and rheumatoid arthritis. Prispevek je pregled objavljene literature o učinkovitosti ortopedskih vložkov in čevljev pri otrocih s ploskim stopalom, idiopatičnim juvenilnim artitisom ter pri ljudeh z obokanim stopalom, plantarnim fasciitisom, v...

  20. Combining Sun-Induced Chlorophyll Fluorescence and Photochemical Reflectance Index Improves Diurnal Modeling of Gross Primary Productivity

    Directory of Open Access Journals (Sweden)

    Anke Schickling

    2016-07-01

    Full Text Available Sun-induced chlorophyll fluorescence (F is a novel remote sensing parameter providing an estimate of actual photosynthetic rates. A combination of this new observable and Monteith’s light use efficiency (LUE concept was suggested for an advanced modeling of gross primary productivity (GPP. In this demonstration study, we evaluate the potential of both F and the more commonly used photochemical reflectance index (PRI to approximate the LUE term in Monteith’s equation and eventually improve the forward modeling of GPP diurnals. Both F and the PRI were derived from ground and airborne based spectrometer measurements over two different crops. We demonstrate that approximating dynamic changes of LUE using F and PRI significantly improves the forward modeling of GPP diurnals. Especially in sugar beet, a changing photosynthetic efficiency during the day was traceable with F and incorporating F in the forward modeling significantly improved the estimation of GPP. Airborne data were projected to produce F and PRI maps for winter wheat and sugar beet fields over the course of one day. We detected a significant variability of both, F and the PRI within one field and particularly between fields. The variability of F and PRI was higher in sugar beet, which also showed a physiological down-regulation of leaf photosynthesis. Our results underline the potential of F to serve as a superior indicator for the actual efficiency of the photosynthetic machinery, which is linked to physiological responses of vegetation.

  1. The prevalence and course of osteoporosis in patients with cardiovascular diseases

    Directory of Open Access Journals (Sweden)

    A L Vertkin

    2008-01-01

    Rezul'taty issledovaniya. Atravmaticheskiy perelom sheyki bedra u muzhchin otmechalsya v srednem na 7,1 goda ran'she, chem u zhenshchin. Gospital'naya letal'nost' pri perelome sheyki bedra - 6,8%; eshche okolo 25% bol'nykh umirayut v techenie goda. U bol'shinstva patsientov imelas' kardi-ovaskulyarnaya patologiya, po povodu kotoroy oni nablyudalis' u terapevta, pri etom OP ili faktory ego riska do pereloma ni v odnom sluchae ne byli diagnostirovany. Faktory riska OP pri kardiovaskulyarnoy patologii vstrechalis' v 86,6% sluchaev, u patsientov bez takovoy - v 81,4%. Nizkaya MPK vyyavlena u 65,2% bol'nykh s serdechno-sosudistymi zabolevaniyami i sostavlyala pri IBS -1,9 SD, pri AG-1,6 SD, a u patsientov bez kardiovaskulyarnoy patologii etot pokazatel' dostigal -0,9 SD. Pri nekontroliruemoy AG, gipertrofii levogo zheludochka s narusheniem ego sokratimosti poterya MPK bolee vyrazhennaya. Otmecheny prirost MPK i znachitel'noe klinicheskoe uluchshenie sostoyaniya u patsientov s kardiovaskulyarnoy patologiey i OP na fone terapii kal'tsitoninom lososya i preparatami kal'tsiya v sochetanii s vitaminom Ds. Zaklyuchenie. Privedennye dannye rasshiryayut nashi predstavleniya o svyazi kardiovaskulyarnoy patologii so snizheniem MPK. Vysokaya obrashchaemost' patsientov s sosudistoy patologiey k kardiologam, terapevtam, nevrologam trebuet sozdaniya usloviy dlya uluchsheniya diagnostiki OP.

  2. Unified Field Theory and Principle of Representation Invariance

    CERN Document Server

    Ma, Tian

    2012-01-01

    This is part of a research program to establish a unified field model for interactions in nature. The aim of this article is to postulate a new principle of representation invariance (PRI), to provide a needed mathematical foundation for PRI, and to use PRI to refine the unified field equations of four interactions. Intuitively, PRI amounts to saying that all SU(N) gauge theories should be invariant under transformations of different representations of SU(N). With PRI, we are able to substantially reduce the number of to-be-determined parameters in the unified model to two SU(2) and SU(3) constant vectors $\\{\\alpha^1_\\mu \\}$ and $\\{\\alpha^2_k\\}$, containing 11 parameters, which represent the portions distributed to the gauge potentials by the weak and strong charges. Furthermore, both PRI and PID can be directly applied to individual interactions, leading to a unified theory for dark matter and dark energy, and theories on strong and weak interaction potentials. As a direct application of the strong interacti...

  3. Monitoring water stress and fruit quality in an orange orchard under regulated deficit irrigation using narrow-band structural and physiological remote sensing indices

    Science.gov (United States)

    Stagakis, S.; González-Dugo, V.; Cid, P.; Guillén-Climent, M. L.; Zarco-Tejada, P. J.

    2012-07-01

    This paper deals with the monitoring of water status and the assessment of the effect of stress on citrus fruit quality using structural and physiological remote sensing indices. Four flights were conducted over a citrus orchard in 2009 using an unmanned aerial vehicle (UAV) carrying a multispectral camera with six narrow spectral bands in the visible and near infrared. Physiological indices such as the Photochemical Reflectance Index (PRI570), a new structurally robust PRI formulation that uses the 515 nm as the reference band (PRI515), and a chlorophyll ratio (R700/R670) were compared against the Normalized Difference Vegetation Index (NDVI), Renormalized Difference Vegetation Index (RDVI) and Modified Triangular Vegetation Index (MTVI) canopy structural indices for their performance in tracking water status and the effects of sustained water stress on fruit quality at harvest. The irrigation setup in the commercial orchard was compared against a treatment scheduled to satisfy full requirements (based on estimated crop evapotranspiration) using two regulated deficit irrigation (RDI) strategies. The water status of the trees throughout the experiment was monitored with frequent field measurements of stem water potential (Ψx), while titratable acidity (TA) and total soluble solids (TSS) were measured at harvest on selected trees from each irrigation treatment. The high spatial resolution of the multispectral imagery (30 cm pixel size) enabled identification of pure tree crown components, extracting the tree reflectance from shaded, sunlit and aggregated pixels. The physiological and structural indices were then calculated from each tree at the following levels: (i) pure sunlit tree crown, (ii) entire crown, aggregating the within-crown shadows, and (iii) simulating a lower resolution pixel, including tree crown, sunlit and shaded soil pixels. The resulting analysis demonstrated that both PRI formulations were able to track water status, except when water stress

  4. Utilizing national patient-register data to control for comorbidity in prognostic studies

    Directory of Open Access Journals (Sweden)

    Nilssen Y

    2014-10-01

    Full Text Available Yngvar Nilssen,1 Trond-Eirik Strand,1 Robert Wiik,2 Inger Johanne Bakken,3 Xue Qin Yu,4,5 Dianne L O'Connell,4–7 Bjørn Møller1 1Department of Registration, Cancer Registry of Norway, Oslo, 2Norwegian Patient Register Department, Norwegian Directorate of Health, Trondheim, 3Norwegian Institute of Public Health, Oslo, Norway; 4Cancer Research Division, Cancer Council NSW, 5School of Public Health, University of Sydney, 6School of Public Health and Community Medicine, University of New South Wales, Sydney, 7School of Medicine and Public Health, University of Newcastle, Newcastle, NSW, Australia Objective: To construct an updated comorbidity index (Patient Register Index [PRI] using national data collections from Norway and compare its predictive ability of 1-year mortality with the Charlson Comorbidity Index (CCI. Materials and methods: Data regarding over 1.11 million patients registered in the Norwegian Patient Register in 2010 and 2011 were used to construct the PRI. The PRI was evaluated by comparing its model fit and discrimination with the CCI. Results: Compared with the CCI, the PRI weights decreased for six, increased for four, and were unchanged for seven diseases. When the PRI was added to the model including age and sex, the age effects were reduced by up to 38% for patients older than 50 years. All measures of model fit improved for the PRI model. Conclusion: Adjustment for comorbidity is especially important for patients 50 years of age or older, and its effect on 1-year mortality is almost comparable to the age effect. The PRI is based on more recent data than the CCI, and is more representative of the general population due to its construction. Keywords: comorbidity, National Patient Register, Charlson Comorbidity Index, predictive ability, patient-register index, prognostic value

  5. Comparison of a new ELISA-based with the flow cytometric assay for vasodilator-associated stimulated phosphoprotein phosphorylation to assess P2Y12 -inhibition after ticagrelor intake.

    Science.gov (United States)

    Hobl, Eva-Luise; Jilma, Bernd; Derhaschnig, Ulla; Schoergenhofer, Christian; Schwameis, Michael; Jilma-Stohlawetz, Petra

    2015-01-01

    Ticagrelor is a P2Y12 receptor antagonist, with superior effects but also ensuing enhanced bleeding risk as compared to clopidogrel. Determination of platelet inhibition may be useful to confirm efficient platelet inhibition on an individual patient level and to identify patients at risk for bleeding. The vasodilator-associated stimulated phosphoprotein (VASP) phosphorylation assay specifically measures platelet P2Y12 inhibition, but has so far required individual sample processing. A new ELISA-based VASP assay has been developed, which allows batch analysis after initial platelet activation. Because of the reversible binding of ticagrelor it is unclear if the ELISA and flow cytometric assays provide comparable results; several washing steps of the ELISA may potentially result in false low results through dilution. We hypothesized that the conventional and new methods may be comparable when ticagrelor is used. We pair-wise compared the platelet reactivity index (PRI) between assays in a prospective clinical trial. Six healthy volunteers received a single 180 mg loading dose of ticagrelor. PRI-values of the two methods correlated well (r = 0.97, P Ticagrelor rapidly decreased PRI values on average after 50 min, but nadir levels 2-6 h after ticagrelor intake were 15% higher when PRI% was measured with the flow cytometric method. Bland-Altman analysis showed that the flow cytometric assay measured markedly higher PRI levels than the new ELISA-based technique (mean difference 13%). The new ELISA-based VASP assay offers an alternative to the currently used flow cytometric method, but measures lower PRI levels, particularly when PRI falls below 20% after ticagrelor intake. © 2013 Clinical Cytometry Society.

  6. Prihodnja osvetlitev in nočna podoba mest: študija primera

    Directory of Open Access Journals (Sweden)

    Simon Rankel

    2014-06-01

    Full Text Available Prihodnja osvetlitev na podlagi polprevodniških virov svetlobe bo spremenila nočno podobo mest. Možnosti njihove umestitve in uporabe v urbanem prostoru so številne. V članku zato proučujemo, ali bi njihova prihodnja uporaba v splošni zunanji razsvetljavi pozitivno vplivala na človekovo sprejemanje tako osvetljenega urbanega prostora. Na podlagi inovativne uporabe omenjenih virov svetlobe smo izoblikovali dva različna koncepta osvetlitve. Prvi koncept temelji na ploskovni osvetlitvi, drugi pa na detajlnem prikazu arhitekturno–urbanih elementov. Predlogi za osvetlitev so bili narejeni na petih različnih lokacijah mesta. Poleg izpolnjevanja funkcionalnih potreb upoštevajo tudi urbanistični in arhitekturni vidik osvetljevanja. Z ocenami afektivne kakovosti slikovnih prikazov smo predstavili in proučevali temeljna afektivna stanja anketiranih. Ugotovitve kažejo, da so se anketiranci pri večini predlogov strinjali pri ocenah spremenljivk »prijetnost« in »pozornost. Statistika pokaže med konceptoma značilne razlike pri ocenah obeh spremenljivk. Pri neposredni primerjavi obeh konceptov smo ugotovili, da je naklonjenost anketirancev do določenega osvetlitvenega koncepta odvisna tudi od mestne lokacije. S člankom želimo poudariti pomen nočne podobe mesta pri razvoju prihodnjih strategij osvetlitve, ki temeljijo na polprevodniških virih svetlobe.

  7. Remotely-sensed detection of effects of extreme droughts on gross primary production.

    Science.gov (United States)

    Vicca, Sara; Balzarolo, Manuela; Filella, Iolanda; Granier, André; Herbst, Mathias; Knohl, Alexander; Longdoz, Bernard; Mund, Martina; Nagy, Zoltan; Pintér, Krisztina; Rambal, Serge; Verbesselt, Jan; Verger, Aleixandre; Zeileis, Achim; Zhang, Chao; Peñuelas, Josep

    2016-06-15

    Severe droughts strongly impact photosynthesis (GPP), and satellite imagery has yet to demonstrate its ability to detect drought effects. Especially changes in vegetation functioning when vegetation state remains unaltered (no browning or defoliation) pose a challenge to satellite-derived indicators. We evaluated the performance of different satellite indicators to detect strong drought effects on GPP in a beech forest in France (Hesse), where vegetation state remained largely unaffected while GPP decreased substantially. We compared the results with three additional sites: a Mediterranean holm oak forest (Puéchabon), a temperate beech forest (Hainich), and a semi-arid grassland (Bugacpuszta). In Hesse, a three-year reduction in GPP following drought was detected only by the Enhanced Vegetation Index (EVI). The Photochemical Reflectance Index (PRI) also detected this drought effect, but only after normalization for absorbed light. In Puéchabon normalized PRI outperformed the other indicators, while the short-term drought effect in Hainich was not detected by any tested indicator. In contrast, most indicators, but not PRI, captured the drought effects in Bugacpuszta. Hence, PRI improved detection of drought effects on GPP in forests and we propose that PRI normalized for absorbed light is considered in future algorithms to estimate GPP from space.

  8. Evaluation of benefit to educational material for photoprotection in those with cutaneous lupus erythematosus.

    Science.gov (United States)

    Kaushik, Anshika; Laumann, Anne; Nwe, Steven; Kwasny, Mary J; West, Dennis P; Kundu, Roopal V

    2015-04-01

    Photosensitivity (PS) in cutaneous lupus erythematosus (CLE) contributes to decreased quality of life (QoL). We aimed to assess baseline knowledge about sun protection in persons with CLE and identify knowledge differences by race. Additionally, we aimed to determine the impact of a verbal educational intervention on photoprotection and CLE. 31 adults with CLE were recruited from an academic-based dermatology clinic and completed a 17-item questionnaire about CLE and sun protection at three time points: pre- intervention (PR-I), post-intervention (PO-I), and 3-month phone follow up (3MF). An educational intervention using American Academy of Dermatology CLE and sun protection education materials was delivered between PR-I and PO-I. 31 subjects participated at PR-I and PO-I, and 25 subjects (81%) at 3MF. Baseline CLE-related PS and photoprotection knowledge differed significantly by race, with non-Caucasians demonstrating less knowledge (P= 0.049). Knowledge about sun exposure being linked to lupus increased from 81% to 97% (P=0.25) between PR-I and PO-I. At PR-I, 19% agreed that smoking was linked to lupus compared to 90% PO-I (Peducational intervention successfully improved immediate lupus-related PS and sun exposure knowledge, but knowledge was not retained long-term. It appears educational materials must be improved.

  9. Field Theory of Fundamental Interactions

    Science.gov (United States)

    Wang, Shouhong; Ma, Tian

    2017-01-01

    First, we present two basic principles, the principle of interaction dynamics (PID) and the principle of representation invariance (PRI). Intuitively, PID takes the variation of the action under energy-momentum conservation constraint. We show that the PID is the requirement of the presence of dark matter and dark energy, the Higgs field and the quark confinement. PRI requires that the SU(N) gauge theory be independent of representations of SU(N). It is clear that PRI is the logic requirement of any gauge theory. With PRI, we demonstrate that the coupling constants for the strong and the weak interactions are the main sources of these two interactions, reminiscent of the electric charge. Second, we emphasize that symmetry principles-the principle of general relativity and the principle of Lorentz invariance and gauge invariance-together with the simplicity of laws of nature, dictate the actions for the four fundamental interactions. Finally, we show that the PID and the PRI, together with the symmetry principles give rise to a unified field model for the fundamental interactions, which is consistent with current experimental observations and offers some new physical predictions. The research is supported in part by the National Science Foundation (NSF) grant DMS-1515024, and by the Office of Naval Research (ONR) grant N00014-15-1-2662.

  10. The Menu of Features that Define Primary MicroRNAs and Enable De Novo Design of MicroRNA Genes.

    Science.gov (United States)

    Fang, Wenwen; Bartel, David P

    2015-10-01

    MicroRNAs (miRNAs) are small regulatory RNAs processed from stem-loop regions of primary transcripts (pri-miRNAs), with the choice of stem loops for initial processing largely determining what becomes a miRNA. To identify sequence and structural features influencing this choice, we determined cleavage efficiencies of >50,000 variants of three human pri-miRNAs, focusing on the regions intractable to previous high-throughput analyses. Our analyses revealed a mismatched motif in the basal stem region, a preference for maintaining or improving base pairing throughout the remainder of the stem, and a narrow stem-length preference of 35 ± 1 base pairs. Incorporating these features with previously identified features, including three primary-sequence motifs, yielded a unifying model defining mammalian pri-miRNAs in which motifs help orient processing and increase efficiency, with the presence of more motifs compensating for structural defects. This model enables generation of artificial pri-miRNAs, designed de novo, without reference to any natural sequence yet processed more efficiently than natural pri-miRNAs. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. A Poroelastic Approach for Quantifying Gel Network Properties

    Science.gov (United States)

    Chan, Edwin; Nadermann, Nichole; Feldman, Katie; Davis, Eric

    The unique chemical and structural properties of polymer gels has led to the application of these materials in various membrane-based technologies where selective transport is critical to device performance. Characterizing the chemical and structural properties of a gel is critical to understanding its transport behavior. yet quantifying these properties is nontrivial as it typically requires multiple measurement techniques. In this talk, we demonstrate poroelastic relaxation indentation (PRI) as a single measurement tool to characterize the swelling, mechanical and transport properties of model poly(ethylene glycol)-based hydrogel systems. By applying the appropriate thermodynamic polymer network model and the linear theory of poroelasticity, we are able to use the results from PRI to extract the thermodynamic parameters, elastic modulus, water permeability and mesh size of these gels. We validate these results with small angle neutron scattering to illustrate the applicability of the PRI measurement technique for studying these membrane-like materials.

  12. Towards an understanding of miRNA regulation

    DEFF Research Database (Denmark)

    Jensen, Trine Ilsø

    miRNAs are well-known regulators of gene expression. They function post-transcriptionally by binding to complementary sites within the 3´UTR of target mRNAs, which mediates translational repression and destabilization. However, miRNA expression itself is also subjected to regulation. Here, we...... report a new method to investigate and potentially characterize the pri-miRNA transcript. Overexpression of a transdominant Drosha mutant, which is unable to cleave its substrate, enables stabilization of the pri-miRNA transcript. Drosha mutant immunoprecipitation from the nuclear compartment...... is performed followed by high-throughput sequencing (nuclear Drosha Mt2 RIPseq). This method allows for the detection of global pri-miRNA signature and also provides a method to potentially identify new Drosha substrates. Furthermore, data on the identification of a novel endogenous circular RNA sponge (ciRS-7...

  13. POUČEVANJE BESEDIŠČA ZA ODRASLE

    OpenAIRE

    Antonijević, Jasmina

    2013-01-01

    Namen diplomske naloge je osvetliti različne vidike vloge besedišča pri poučevanju angleškega jezika za odrasle. Za ponazoritev nekaterih načel v praksi sta v diplomski nalogi predstavljeni dve študiji primerov odraslih učencev, ki se učijo angleškega jezika v jezikovni šoli. Dolgo časa so slovnico videli kot glavno nalogo pri poučevanju tujega jezika. Obvladovanje slovničnih struktur je bil glavni cilj pri učenju tujega jezika. Ravno nasprotno je imelo poučevanje in učenje besedišča relat...

  14. Stališča razrednih učiteljev do športa v povezavi s kakovostjo izvajanja športno-vzgojnega procesa

    OpenAIRE

    Jančič, Nina

    2016-01-01

    Učitelji imajo pri svojem delu eno pomembnejših vlog pri oblikovanju življenjskega stila učencev, ki jih poučujejo. Zavedati se moramo, da je učenje z zgledom še kako pomembno, saj je prav v zgodnjem otrokovem obdobju mogoče najučinkoviteje vplivati na njegov celostni razvoj. Gibanje, šport in vse, kar je povezano z njim, bi moralo imeti pomembno mesto v našem življenju – tako pri otrocih kot odraslih. Zdrav življenjski slog omogoča krepitev in ohranjanje zdravja, zato mora tudi učitelj najti...

  15. Blessings in disguise: biological benefits of prion-like mechanisms.

    Science.gov (United States)

    Newby, Gregory A; Lindquist, Susan

    2013-06-01

    Prions and amyloids are often associated with disease, but related mechanisms provide beneficial functions in nature. Prion-like mechanisms (PriLiMs) are found from bacteria to humans, where they alter the biological and physical properties of prion-like proteins. We have proposed that prions can serve as heritable bet-hedging devices for diversifying microbial phenotypes. Other, more dynamic proteinaceous complexes may be governed by similar self-templating conformational switches. Additional PriLiMs continue to be identified and many share features of self-templating protein structure (including amyloids) and dependence on chaperone proteins. Here, we discuss several PriLiMs and their functions, intending to spur discussion and collaboration on the subject of beneficial prion-like behaviors. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. Nutritional responses to soil drying and rewetting cycles under partial root-zone drying irrigation

    DEFF Research Database (Denmark)

    Wang, Yaosheng; Jensen, Christian Richardt; Liu, Fulai

    2017-01-01

    and their bioavailability. Partial root-zone drying irrigation (PRI) irrigates half of the soil zone, while the other half is allowed to dry, and the two halves is alternately irrigated. PRI outweighs conventional deficit irrigation in further improving water use efficiency (WUE) by enhancing the root-to-shoot chemical...... signaling that regulates stomatal aperture. PRI induced soil DRW cycles and more soil water dynamics in the root zone enhance soil nutrient mineralization process and thus increase the bioavailability of soil nutrients, resulting in improved nitrogen (N) and phosphorus (P) uptake, in which soil microbial......Abstract Repeated soil drying and rewetting (DRW) cycles occur in rainfed and irrigated agriculture. The intensity and frequency of DRW cycles regulate both microbial physiology and soil physical processes, hereby affecting the mineralization and immobilization of soil nutrients...

  17. The viability of the Parenting Representations Interview for assessing and measuring change in parents of adolescents.

    Science.gov (United States)

    Scharf, Miri; Mayseless, Ofra; Kivenson-Baron, Inbal

    2015-01-01

    Parents' representations include parents' views of their adolescent, of their own parenting and of the parent-adolescent relationship. Two longitudinal studies of parents and their adolescent sons and daughters support the validity of scales coding mothers in the Parenting Representations Interview-Adolescence (PRI-A). The studies, conducted in Israel during the transition from home to military service, demonstrated that three dimensions derived from the PRI-A: positive representations of adolescents, negative emotionality and inadequate boundaries were associated with adolescents' AAI variables, relatedness-autonomy behaviors with mothers, and with other indicators, such as adolescents' wellbeing, romantic intimacy and individuation. Examining parenting representations could help practitioners pinpoint targets for intervention and evaluate the changes that families go through during psychotherapy, as well as the therapeutic process and its outcomes. The findings support the viability of the PRI for use in attachment based interventions for adolescents.

  18. Simulacija razvoja v prostoru zaradi vpliva graditve avtoceste

    Directory of Open Access Journals (Sweden)

    Damjana Bačnar

    2002-01-01

    Full Text Available Planerski postopek za načrtovanje avtocest vsebuje vrednotenje variant z namenom izbire najugodnejše. V postopku se uporabljajo določena merila, med katere spada tudi vrednotenja vpliva na regionalni in urbani razvoj. Kljub zastavljenim merilom pa izbrane variante največkrat niso usklajene z razvojnimi cilji mest in širših območij – regij, na katere AC vpliva. Članek predstavlja možnost uporabe modelov vpliva AC na razvoj poselitve pri napovedovanju posledic po izgradnji. Modeli temeljijo na poznavanju vplivov že zgrajenih AC, navedeni so primeri iz analize vpliva AC-priključkov na razvoj poselitve. Prostorski modeli so koristno orodje pri napovedovanju sprememb v prostoru oziroma pri simuliranju posledic vpliva projekta na prostor ali njegove posamezne elemente.

  19. Developmental adaptation of central nervous system to extremely high acetylcholine levels.

    Directory of Open Access Journals (Sweden)

    Vladimir Farar

    Full Text Available Acetylcholinesterase (AChE is a key enzyme in termination of fast cholinergic transmission. In brain, acetylcholine (ACh is produced by cholinergic neurons and released in extracellular space where it is cleaved by AChE anchored by protein PRiMA. Recently, we showed that the lack of AChE in brain of PRiMA knock-out (KO mouse increased ACh levels 200-300 times. The PRiMA KO mice adapt nearly completely by the reduction of muscarinic receptor (MR density. Here we investigated changes in MR density, AChE, butyrylcholinesterase (BChE activity in brain in order to determine developmental period responsible for such adaptation. Brains were studied at embryonal day 18.5 and postnatal days (pd 0, 9, 30, 120, and 425. We found that the AChE activity in PRiMA KO mice remained very low at all studied ages while in wild type (WT mice it gradually increased till pd120. BChE activity in WT mice gradually decreased until pd9 and then increased by pd120, it continually decreased in KO mice till pd30 and remained unchanged thereafter. MR number increased in WT mice till pd120 and then became stable. Similarly, MR increased in PRiMA KO mice till pd30 and then remained stable, but the maximal level reached is approximately 50% of WT mice. Therefore, we provide the evidence that adaptive changes in MR happen up to pd30. This is new phenomenon that could contribute to the explanation of survival and nearly unchanged phenotype of PRiMA KO mice.

  20. Poslovni potenciali CRM rešitev v oblaku na primeru Microsoft Dynamics CRM in Salesforce

    OpenAIRE

    Blagojević, Tina

    2015-01-01

    Umetnost prodaje se je v zadnjem desetletju drastično spremenila. Da bi uspeli v poslovnem svetu, potrebujemo veliko več kot le talent. Čas preprostih odnosov med kupci in prodajalci je že zdavnaj minil, saj živimo v času, ko si želijo kupci vse več kontrole o tem, kako je izdelek oblikovan, oglaševan in kako se prodaja. Pri tem se svoje moči še kako dobro zavedajo. Današnji CRM je usmerjen v pomoč podjetjem pri usmerjanju pozornosti na kupce z zagotavljanjem vpogleda v kupce ob hkratnem razu...

  1. PROCESIRANJE POLIMEROV Z UPORABO SUPERKRITIČNIH FLUIDOV

    OpenAIRE

    Aionicesei, Elena

    2009-01-01

    Tradicionalne metode za procesiranje polimerov uporabljajo nevarna hlapna organska topila in kloro-floro-ogljikovodike. Zaradi povečanih izpustov nevarnih topil se pojavlja potreba po uporabi čistejših metod za procesiranje polimerov. Eno možnost predstavlja superkritični ogljikov dioksid (scCO2) kot mehčalo pri procesiranju polimerov. Velika uporabnost superkritičnih fluidov se kaže pri procesiranju polimerov za potrebe biomedicinskih pripomočkov (kot so mikrodelci, mikrokapsule, pene, me...

  2. Učni potni list

    Directory of Open Access Journals (Sweden)

    Ana Krajnc

    1996-12-01

    Full Text Available Decembra 1994 je bila v Rimu velika mednarodna konferenca o permanentnem ali vse življenje trajajočem izobraževanju. Široki strokovni javnosti sta bila takrat prvič predstavljena tudi dva nova pojma: osebni učni načrt in učni potni list. Pri priči sta se prijela v teoriji in praksi - očitno sta bila oba predloga odsev potreb.

  3. PRAVNA PODLAGA ZA ORGANIZACIJO DELA V POLICIJI

    OpenAIRE

    Volavšek, Boštjan

    2012-01-01

    Živimo v sodobnem in razvitem svetu, ki od nas zahteva, da se pri svojih dejanjih in nalogah odločamo hitro, da smo fleksibilni in da rešujemo posamezne ali skupne naloge skladno z družbenimi usmeritvami, moralnimi načeli in zakonom. Trajnostni razvoj družbe nas usmerja v priprave na spremembe, v sprejemanje in razumevanje razvoja človeštva in nam daje možnosti za nove paradigme. Čas, prostor in informacija so temeljni elementi, ki človeku dajejo prednost pri izvajanju logističnih procesov. Č...

  4. The Scattering of Partially Coherent Electromagnetic Beam Illumination from Statistically Rough Surfaces

    Science.gov (United States)

    2014-06-19

    intH , satisfy Maxwell’s equations, such that [19] ( )2 20 0 int int intj n k nk η= − × − + ⋅E F A∇ ∇∇ (3) , sct sctE H ( ),n h( )0 0,n h ,inc...incE H V ,sec secJ M ,pri priJ M 0 0 ext ext ¹ ¹ E H 0 0 int int ¹ ¹ E H n̂ S 7 and ( )2 20 0 int int intj n k nk η= × − + ⋅H A F∇ ∇∇ , (4) where intA

  5. Nosotros los proles, vosotros los ricos... #Yo Soy 132 : Un acercamiento a la percepción que tienen jóvenes miembros y simpatizantes del movimiento #Yo Soy 132 sobre la participación política y la democracia en México

    OpenAIRE

    Colín Olivares, Citlali Guadalupe

    2012-01-01

    Setenta y un años de administración priísta consolidada por medio de acciones fraudulentas y doce años de mal gobierno panista produjeron en los ciudadanos (sobre todo los jóvenes) una actitud de descrédito y apatía hacia su democracia. Con las elecciones de 2012, donde se apuntaba al candidato del PRI como potencial ganador; surge el movimiento estudiantil #Yo Soy 132 tomando fuerza en la escena política, logrando sumar a otros sectores; y que ante la escasez de espacios de participación ciu...

  6. Le modèle MIRABEL : un guide pour aider à questionner les Problématiques de Recherche d'Informations

    OpenAIRE

    Goria, Stéphane; Geffroy, Philippe

    2004-01-01

    International audience; Les actions d'Intelligence Economique ou de documentation ont souvent pour origine des actions de recherche d'informations. Celles-ci prennent leur essor par l'intermédiaire d'une expression humaine de Problématique de Recherche d'Informations (une PRI dans ce texte). Or, pour bien répondre à une PRI, il faut pouvoir bien la comprendre, c'est-à-dire qu'il faut déjà arriver à l'identifier clairement par rapport à l'environnement décisionnel qui l'a engendrée, les acteur...

  7. Latin America Report No. 2672.

    Science.gov (United States)

    1983-04-28

    Prieto. Ciudad Juarez is also endangered. It is the largest and most populous munici- pality in the state, and here the PAN is a serious threat, with...Jose Posada Pompa, a prestigious PAN member, seen as. a challenge to any PRI candidate. In Ciudad Camargo, imports and the dishonesty of CTM mayor...the towns of Tijuana and Mexicali. In Puebla the PRI admits that "if a good candidate is not chosen, we may lose the capital. The blue and white is

  8. ZAPOSLOVANJE V LEKARNIŠTVU - PRIMER LEKARNE AJDOVŠČINA

    OpenAIRE

    Furlan, Miha

    2010-01-01

    Diplomska naloga vsebuje predstavitev zaposlovanja novih delavcev v lekarništvu, med zaposlenimi v tej dejavnosti, pa je celovito opisan farmacevtski poklic in njegov položaj na trgu dela. Pri tem smo orisali organizacijo (Lekarna Ajdovščina), zgodovino lekarništva, položaj javnih zavodov in javnih uslužbencev, sistemizacijo dela, pripravništvo, študij, obravnavali pa smo tudi probleme, težave in nevarnosti, s katerimi se srečujejo pri svojem delu. Za opravljanje poklica lekarniški farmacevt ...

  9. Patološke osebnostne poteze odraslih oseb z depresivnimi značilnostmi

    OpenAIRE

    Marko, Deborah

    2017-01-01

    Depresija je duševna motnja, katere povod lahko razumemo v kombinaciji posameznikove osebnostne ranljivosti in stresnega življenjskega dogodka. Če osebnost razumemo kot celoto posameznikovih lastnosti in potez, ki se gibljejo na kontinuumu od povprečno do nadpovprečno izraženih, bi pri slednjih lahko govorili o osebnostnih motnjah. Pri tem motnje osebnosti razumemo kot skrajno poudarjene osebnostne poteze določenega tipa, ki vodijo v osebne težave ali oškodovanost na socialnem, zaposlitvenem ...

  10. Chlorhexidine does not increase immediate bond strength of etch-and-rinse adhesive to caries-affected dentin of primary and permanent teeth

    OpenAIRE

    Lenzi, Tathiane Larissa; Tedesco, Tamara Kerber; Soares, Fabio Zovico Maxnuck; Loguercio, Alessandro Dourado; Rocha, Rachel de Oliveira

    2012-01-01

    The aim of this study was to evaluate the effect of 2% chlorhexidine digluconate (CHX) on immediate bond strength of etch-and-rinse adhesive to sound (SD) and caries-affected (CAD) primary dentin compared with permanent dentin. Flat dentin surfaces from 20 primary molars (Pri) and 20 permanent molars (Perm) were assigned to 8 experimental groups (n=5) according to tooth type (Pri or Perm), dentin condition (SD or CAD - pH-cycling for 14 days) and treatment (control - C or 60 s application of ...

  11. Nadgradnja informacijskega sistema za vodenje projektov v IT podjetjih

    OpenAIRE

    Košir, Janez

    2010-01-01

    Pri prenovi procesov lahko informacijska tehnologija odigra zelo pomembno vlogo. Res pa je, da lahko nepravilna uporaba informacijske tehnologije pripelje do rešitev, ki so delne, ki ne upoštevajo celote in dajejo v splošnem zelo slabe rezultate. Pravi pristop pri reševanju težav je tako dvostopenjski. Na prvi stopnji je treba opredeliti potrebne značilnosti poslovnega procesa, ki poteka v organizaciji, in ga temeljito prenoviti. Na drugi stopnji pa je treba prenovljenemu poslovnemu procesu z...

  12. PRIMERJAVA FINANČNE KRIZE 1929 S FINANČNO KRIZO 2007

    OpenAIRE

    Krulić, Goran

    2012-01-01

    Na prvi pogled sta si krizi 1929 in 2007 precej podobni. Obe sta se pričeli na finančnih trgih, obe v ZDA, v mesecih in dnevih pred krizo je v obeh primerih prišlo do dogodkov, ki so vsaj moralno sporni. Površen opazovalec bi lahko celo trdil, da se iz primera velike gospodarske krize finančni svet ni ničesar naučil. A vendar ob natančnejšem opazovanju opazimo razlike – tako v naravi krize kot v ukrepanju pristojnih institucij. Če je v veliki gospodarski krizi mehanizem po katerem se je ...

  13. Transferencias de recursos y partidos políticos. Estudio de los municipios mexicanos.

    Directory of Open Access Journals (Sweden)

    Silverio Tamez Garza

    2013-01-01

    Full Text Available In this paper we analyze how much influence the political party with the largest nationwide (Partido Revolucionario Institucional: PRI in the Congress, specifically the House of Representatives, in the distribution of the Funds of Branch 23: Paving Fund and Sports Spaces for Municipalities, for the year 2010 which is when this fund was created and for the year 2011. The results of our analysis were that there is a positive impact in the influence of the political party with the largest presence in the Chamber of Deputies in the allocation of resources to those municipalities that are governed by mayors from the PRI.

  14. DNEVNO TRGOVANJE NA MEDNARODNEM VALUTNEM TRGU S TEHNIČNO ANALIZO

    OpenAIRE

    Stojković, Mile

    2016-01-01

    Z diplomsko nalogo smo raziskali možnosti za uporabo tehnične analize pri dnevnem trgovanju na mednarodnem valutnem trgu, saj se veliko forex trgovcev srečuje s težavami, kje in kako trgovati, predvsem na začetku svoje trgovalne kariere. Namen raziskave je ugotoviti, ali smo lahko uspešni pri kratkoročnem oziroma dnevnem trgovanju na forex trgu. Predstavili smo nekatere trgovalne strategije, ki temeljijo na tehnični analizi, njihove prednosti in slabosti. Poskušali smo ugotoviti, ali nam tehn...

  15. Etični kodeks specialnih in rehabilitacijskih pedagogov in dileme v šoli

    OpenAIRE

    Vulić, Nadja

    2017-01-01

    Specialni in rehabilitacijski pedagogi v osnovni šoli se pri svojem delu dnevno vključujejo v različne odnose z ostalimi udeleženci vzgojno-izobraževalnega procesa, tako z učenci kot tudi z ostalimi učitelji in strokovnimi delavci šole, vodstvom, starši in strokovnjaki iz zunanjih institucij, zato je zelo pomembno, da pri svojem delu ohranjajo profesionalno in etično držo. V teoretičnem delu na osnovi literature spoznamo nekaj več o etiki in morali, profesionalnem delovanju, etičnih dil...

  16. STIL VODENJA V OSNOVNI ŠOLI X

    OpenAIRE

    Jovanovič, Davor

    2016-01-01

    Uspešno vodenje je tema, ki se ji je tako v preteklosti kot tudi danes namenjalo veliko pozornosti. Pri tem so se oblikovale številne teorije vodenja, ki so nastajale tudi kot nekakšen pripomoček tistim, ki so zasedali vodstvene položaje. Kakšen naj bi bil dober vodja, katere stile vodenja in kdaj naj bi jih uporabljal pri svojem delu, so vprašanja, zelo aktualna tudi v današnjem času. Načeloma velja, da je dober vodja tisti, ki svoje zaposlene posluša, sprejema njihove predloge, z njimi sode...

  17. Variabilnost prirastka na različnih višinah v deblu pinije in alepskega bora

    OpenAIRE

    Novak, Klemen

    2014-01-01

    Raziskali smo anomalije v rasti branik pinije (Pinus pinea L.) in alepskega bora (Pinus halepensis Mill.) iz kraja Guardamar del Segura v JV Španiji. Iz 6 dreves (po 3 za vsako vrsto bora) smo odvzeli kolute na različnih višinah v deblu, jih gladko obdelali, ter na vsakem analizirali ter datirali branike vzdolž 8-ih različnih radijev. Za analizo smo uporabili programa TSAP in ARSTAN. Nesklenjenih branik je bilo več kot popolnoma izpadlih. Izpad je bil večji pri alepskem boru kot pri piniji. K...

  18. Obravnava učencev s primanjkljaji na področju učenja aritmetike v tretjem triletju osnovne šole

    OpenAIRE

    Mlakar, Blanka

    2017-01-01

    Rezultati raziskave TIMSS 2011 za Slovenijo ter vsakoletno nacionalno preverjanje znanja v OŠ pokažejo na najnižje matematične dosežke pri učencih v Pomurski regiji. Rezultati nacionalnega preverjanja znanja izpostavijo še dve pomembni dejstvi, in sicer da rezultati močno korelirajo s socialno-ekonomskimi dejavniki družine ter da učenci s posebnimi potrebami po učnih dosežkih pri matematiki pomembno zaostajajo za vrstniki. Slovenski osnovnošolski učitelji zaznavajo, da imajo učenci veliko tež...

  19. Konj kot sredstvo socialnopedagoške pomoči družini

    OpenAIRE

    Bojc, Karin

    2017-01-01

    Magistrsko delo predstavlja literaturo in raziskave na temo socialnopedagoškega dela s posamezniki, skupinami in z družinami ob podpori konj in ob uporabi video gradiva. Opisuje, na kakšne načine nam podpora konja lahko pomaga v procesu skupnega ugotavljanja problematike družine in na kakšne načine v procesu pomoči. Predstavlja uporabo video gradiva v socialnopedagoškem procesu kot tudi prednosti uporabe video gradiva v raziskovalne namene in kot pomoč strokovnjaku pri delu ter pri zavzemanju...

  20. FENOMEN OBSMRTNE IZKUŠNJE

    OpenAIRE

    Potočin, Anita

    2012-01-01

    Teoretično izhodišče. S fenomenom obsmrtne izkušnje označujemo posebne izkušnje spremenjenega stanja zavesti, ki se pojavijo ob bližajoči se telesni smrti. Namen diplomske naloge. Raziskali smo fenomen obsmrtne izkušnje in njegove značilnosti tako pri odraslih kot pri otrocih. Predstavljeni so primeri obsmrtnih doživetij po svetu in v Sloveniji. Namen je bil tudi poiskati teorije in lestvice, ki merijo omenjen fenomen. Raziskovalna metodologija. Uporabljen je bil sistematični pregled l...

  1. EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on Dietary Reference Values for protein

    DEFF Research Database (Denmark)

    Tetens, Inge

    This opinion of the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) deals with the setting of Dietary Reference Values (DRVs) for protein. The Panel concludes that a Population Reference Intake (PRI) can be derived from nitrogen balance studies. Several health outcomes possibly...... for growth and maintenance. For pregnancy, an intake of 1, 9 and 28 g/d in the first, second and third trimesters, respectively, is proposed in addition to the PRI for non-pregnant women. For lactation, a protein intake of 19 g/d during the first six months, and of 13 g/d after six months, is proposed...

  2. MAGNETOTERAPIJA DEGENERATIVNIH BOLESTI KOLJENSKOG ZGLOBA

    OpenAIRE

    JAJIĆ, Ivo; DUBRAVICA, Maja; Jajić, Zrinka

    1988-01-01

    U istraživanju učinka impulsne magnetoterapije uključena su bila 32 bolesnika sa sigurnim kliničkim i rendgenološkim znakovima artroze koljenskog zgloba. Za ocjenjivanje učinka terapije praćeni su subjektivni parametri (bol na palpaciju, bol pri izvođenju pasivnog pokreta, bol pri ustajanju iz kreveta, noćna bol) bodovani od O do 3, jutarnja zakočenost u minutama i objektivni parametri (opseg koljena preko sredine patele u cm, opseg pokreta u stupnjevima, udaljenost između v...

  3. Postopek izbire generatorskega odklopnika

    OpenAIRE

    VINTAR, PRIMOŽ

    2016-01-01

    V pričujočem delu je predstavljen postopek izbire generatorskega odklopnika na osnovi kratkostične analize. Opisani postopek je nato ovrednoten na primeru realnega sistema Nuklearne elektrarne Krško (NEK). Postopek določitve nazivnih parametrov predvideva izračun kratkostičnih tokov ob pojavu kratkega stika na transformatorski, kakor tudi na generatorski strani generatorskega odklopnika. Pri tem so izračuni narejeni po postopku ročnega izračuna, in ovrednoteni z rezultati analize, opravlj...

  4. Rudarjenje bitcoinov s podatkovno pretočnim računalnikom Maxeler

    OpenAIRE

    MEDEN, ROK

    2017-01-01

    Bitcoin je prva decentralizirana kriptografska valuta, ki omogoča neposredno trgovanje med entitetami po vsem svetu. Nakazila se izvedejo preko spleta s t. i. digitalnimi kovanci - bitcoini, ki se sproti ustvarjajo in izdajajo pri procesu rudarjenja bitcoinov. Rudarji s prilagojeno računalniško rudarsko opremo tekmujejo pri potrjevanju nakazil in širjenju javne knjige nakazil (t. i. verige blokov) z namenom prejetja nagrade v bitcoinih in na ta način varujejo omrežje Bitcoin. Ker je rudarjenj...

  5. Utilizing In Situ Directional Hyperspectral Measurements to Validate Bio-Indicator Simulations for a Corn Crop Canopy

    Science.gov (United States)

    Cheng, Yen-Ben; Middleton, Elizabeth M.; Huemmrich, Karl F.; Zhang, Qingyuan; Campbell, Petya K. E.; Corp, Lawrence A.; Russ, Andrew L.; Kustas, William P.

    2010-01-01

    Two radiative transfer canopy models, SAIL and the two-layer Markov-Chain Canopy Reflectance Model (MCRM), were coupled with in situ leaf optical properties to simulate canopy-level spectral band ratio vegetation indices with the focus on the photochemical reflectance index in a cornfield. In situ hyperspectral measurements were made at both leaf and canopy levels. Leaf optical properties were obtained from both sunlit and shaded leaves. Canopy reflectance was acquired for eight different relative azimuth angles (psi) at three different view zenith angles (Theta (sub v)), and later used to validate model outputs. Field observations of photochemical reflectance index (PRI) for sunlit leaves exhibited lower values than shaded leaves, indicating higher light stress. Canopy PRI expressed obvious sensitivity to viewing geometry, as a function of both Theta (sub v) and psi . Overall, simulations from MCRM exhibited better agreements with in situ values than SAIL. When using only sunlit leaves as input, the MCRM-simulated PRI values showed satisfactory correlation and RMSE, as compared to in situ values. However, the performance of the MCRM model was significantly improved after defining a lower canopy layer comprised of shaded leaves beneath the upper sunlit leaf layer. Four other widely used band ratio vegetation indices were also studied and compared with the PRI results. MCRM simulations were able to generate satisfactory simulations for these other four indices when using only sunlit leaves as input; but unlike PRI, adding shaded leaves did not improve the performance of MCRM. These results support the hypothesis that the PRI is sensitive to physiological dynamics while the others detect static factors related to canopy structure. Sensitivity analysis was performed on MCRM in order to better understand the effects of structure related parameters on the PRI simulations. Leaf area index (LAI) showed the most significant impact on MCRM-simulated PRI among the parameters

  6. RAZVOJ SPLETNIH REŠITEV NA OSNOVI OGRODJA YII

    OpenAIRE

    Žagar, Matej

    2014-01-01

    V diplomskem delu je predstavljeno PHP-ogrodje Yii, njegove prednosti, slabosti in uporaba pri razvoju spletnih rešitev. Raziskali smo izbrano ogrodje in razložili, zakaj sta na splošno vpeljava in uporaba ogrodja za razvoj spletnih aplikacij smiselni in kako izboljšata učinkovitost razvoja. Pri raziskovanju smo uporabili strokovno literaturo, izdelali nekaj primerov funkcionalnosti aplikacije z uporabo ogrodja in brez njegove uporabe ter naredili študijo primera brezplačne in odprtokodne apl...

  7. INDIJSKA KRAJINA (fauvizem in simultani kontrast)

    OpenAIRE

    Kovač, Kim

    2010-01-01

    Diplomsko delo z naslovom in podnaslovom »Indijska krajina (fauvizem in simultani kontrast)« je sestavljeno iz teoretičnega in praktičnega dela, pri čemer je praktični del vsebinsko vezan na teoretični del diplomske naloge. Slikanje Indijske krajine meni osebno predstavlja spomin na Indijo. Pomembno vlogo pri nastajanju del je imela barva. Po načinu izražanja so se močne in čiste barve približale obdobju fauvizma in simultanemu kontrastu. Namen diplomske naloge je bilo raziskati obdobje fauvi...

  8. VLOGA VODENJA V MANAGEMENTU

    OpenAIRE

    Semenič, Peter

    2013-01-01

    Vodenje v ožjem pomenu besede pričnem obravnavati z teorijami vodenja na temelju osebnostnih lastnosti vodij. Slednja teorija je doživela svoje vrhunce na začetku obravnave področja vodenja. Pri tej teoriji o vodenju je osrednji element obravnave osebnost človeka. Poznejše obravnave, ki spadajo v to skupino teorij o vodenj pa se osredotočajo predvsem na relacijo med čustveno inteligenco in uspešnim vodenjem. Čustvena inteligenca pomeni, do katere mere vodja obvladuje svoja čustva, slednje pa ...

  9. PREVAJANJE SLOVENSKO-NEMŠKIH JEDILNIH LISTOV V KOROŠKIH RESTAVRACIJAH

    OpenAIRE

    Hudrap, Ina

    2016-01-01

    Prevajanje je zahteven in zapleten proces, ki od prevajalca zahteva translatološke kompetence, popolno posvečenost in predanost delu, ne glede na to, s katerim strokovnim področjem se ukvarja pri svojem delu. Za prevajanje ni potrebno samo znanje izhodiščnega in ciljnega jezika, ampak tudi odlično poznavanje kulturno specifičnega okolja, v katerega prevaja določeno besedilo, kakor tudi ustrezne terminologije, v katerega prevaja določeno besedilo. Pri kulinariki gre za področje, ki je splošno ...

  10. Vzpostavitev prostorskega podatkovnega skladišča na primeru občine Bovec za potres 2004

    OpenAIRE

    Šušteršič, Katja

    2015-01-01

    Poznavanje zmožnosti prostorskih podatkov vodi do uspešnega poslovanja organizacij. Pri naravnih nesrečah, kot je potres, je potreba po hitrem in učinkovitem medsebojnem delovanju različnih deležnikov. Po potresih leta 1998 in 2004 je v Občini Bovec prihajalo do neusklajenosti med cenilci, kar je povzročilo dodatno delo pri obdelavi podatkov. Podpora rešitvi v takšnih primerih je uvedba usklajenega podatkovnega skladišča. Izvedbo polnjenja podatkovnega skladišča omogoča postopek ETL (angl. ex...

  11. Analiza sistema zemljiške administracije na Norveškem

    OpenAIRE

    Žužel, Helena

    2017-01-01

    V diplomski nalogi je predstavljen sistem zemljiške administracije na Norveškem. Podanih je nekaj osnovnih podatkov o Norveški ter zgodovinsko ozadje zemljiškega katastra. Sledi opis organizacije in kompetenc geodetske uprave. Pri tem je poudarek tudi na vlogi občin in zasebnih geodetih pri vzdrževanju sistema zemljiške administracije. Občine in zasebni geodeti so namreč pomembni izvajalci geodetskih storitev tako v mestih kot na podeželju. Zaključni del naloge predstavlja delovanje njihov...

  12. The Photochemical Reflectance Index from Directional Cornfield Reflectances: Observations and Simulations

    Science.gov (United States)

    Cheng, Yen-Ben; Middleton, Elizabeth M.; Zhang, Qingyuan; Corp, Lawrence A.; Dandois, Jonathan; Kustas, William P.

    2012-01-01

    The two-layer Markov chain Analytical Canopy Reflectance Model (ACRM) was linked with in situ hyperspectral leaf optical properties to simulate the Photochemical Reflectance Index (PRI) for a corn crop canopy at three different growth stages. This is an extended study after a successful demonstration of PRI simulations for a cornfield previously conducted at an early vegetative growth stage. Consistent with previous in situ studies, sunlit leaves exhibited lower PRI values than shaded leaves. Since sunlit (shaded) foliage dominates the canopy in the reflectance hotspot (coldspot), the canopy PRI derived from field hyperspectral observations displayed sensitivity to both view zenith angle and relative azimuth angle at all growth stages. Consequently, sunlit and shaded canopy sectors were most differentiated when viewed along the azimuth matching the solar principal plane. These directional PRI responses associated with sunlit/shaded foliage were successfully reproduced by the ACRM. As before, the simulated PRI values from the current study were closer to in situ values when both sunlit and shaded leaves were utilized as model input data in a two-layer mode, instead of a one-layer mode with sunlit leaves only. Model performance as judged by correlation between in situ and simulated values was strongest for the mature corn crop (r = 0.87, RMSE = 0.0048), followed by the early vegetative stage (r = 0.78; RMSE = 0.0051) and the early senescent stage (r = 0.65; RMSE = 0.0104). Since the benefit of including shaded leaves in the scheme varied across different growth stages, a further analysis was conducted to investigate how variable fractions of sunlit/shaded leaves affect the canopy PRI values expected for a cornfield, with implications for 20 remote sensing monitoring options. Simulations of the sunlit to shaded canopy ratio near 50/50 +/- 10 (e.g., 60/40) matching field observations at all growth stages were examined. Our results suggest in the importance of the

  13. Zavzetost zaposlenih in poslovna odličnost

    OpenAIRE

    Mekiš, Alenka

    2016-01-01

    Z magistrskim delom smo želeli osvetliti pomembnost zaposlenih v modelu poslovne odličnosti EFQM glede na dejstvo, da slovenska podjetja v povprečju zaostajajo za evropskimi po merilih EFQM. Pri tem pa je največja razlika prav pri merilu zaposlenih, kar nakazuje potrebo po tem, da podjetja naredijo določene spremembe v načinu vodenja in upravljanja človeških virov. Osredotočili smo se na zavzetost zaposlenih, ki je po vseh raziskavah povezana z učinkovitostjo zaposlenih in dolgoročno uspe...

  14. ZAZNAVANJE DIZAJNA MOBILNIH NAPRAV Z VIDIKA ODJEMALCA

    OpenAIRE

    Korošak, Sara

    2016-01-01

    V današnjem času se morajo podjetja, ki želijo konkurirati na trgu, prilagajati potrebam in željam vse bolj zahtevnih odjemalcev. Kar pomeni, da morajo oblikovati izdelke tako, da bodo zadovoljili odjemalčeve potrebe, saj bodo v nasprotnem primeru odjemalci odšli h konkurenci. Pri nakupu mobilne naprave lahko igra dizajn izdelka pomembno vlogo. Pri tem ne mislimo samo na to, da se odjemalec odloči za nakup zaradi videza mobilne naprave, ampak tudi, kakšne funkcionalne koristi mu izdelek n...

  15. Epidemiologija HIV/AIDS-a u Hrvatskoj i rad centara za besplatno i anonimno savjetovanje i testiranje na HIV

    OpenAIRE

    Nemeth Blažić, Tatjana; PAVLIĆ, JASMINA

    2013-01-01

    Članak prikazuje epidemiološku situaciju u Hrvatskoj od početka praćenja HIV/AIDS-a do danas. U radu se prikazuje i rad centara za besplatno i anonimno savjetovanje i testiranje na HIV (HIV savjetovališta) koji od 2003. djeluju pri Hrvatskom zavodu za javno zdravstvo (HZJZ) u Zagrebu, županijskim zavodima za javno zdravstvo u Puli, Rijeci, Splitu, Zadru, Osijeku, Slavonskom Brodu, Dubrovniku i Korčuli, te pri Zatvorskoj bolnici i Klinici za infektivne bolesti “Dr. Fran Mihaljević” u Zagrebu. ...

  16. Radioisotopes and Life Processes (Rev.)

    Energy Technology Data Exchange (ETDEWEB)

    Kisieleski, Walter E. [Argonne National Laboratory; Baserga, Renato [Fels Research Institute

    1967-01-01

    This booklet gives an account, in chemical terms, of the materials from which living matter is made and some of the chemical reactions that underlie the manifestations and the maintenance of life. DNA, RNA and proteins are described. How radioactive isotopes can be used to pry into the innermost secrets of these substances are shown.

  17. Molecular analysis of genetic diversity in elite II synthetic hexaploid ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-07-20

    Jul 20, 2009 ... Quiros, 1993; Stiles et al., 1993; Liu et al., 1994). Out of these tested ten RAPD primers, only five pri- mers gave polymorphism with these genotypes where- as other five did not amplify any genotype. Out of the five primers that gave polymorphism, OPG-2 amplified. 7 genotypes out of 15. All of the genotypes ...

  18. Domain Modeling: NP_077014.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_077014.2 chr16 Crystal structure of uncharacterized protein CMQ451C from the pri...mitive red alga Cyanidioschyzon merolae p3bzba_ chr16/NP_077014.2/NP_077014.2_apo_155-401.pdb swppa 0 ...

  19. Tirer des connaissances de la recherche locale et les utiliser aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    gs

    à porter ces observations à l'attention de praticiens, d'universitaires et de responsables des politiques pertinents. Pour obtenir de plus amples renseignements sur cette initiative de recherche, prière de consulter la note conceptuelle ci-jointe. Financée conjointement par la CCNY, un organisme subventionnaire privé des ...

  20. Free Amino Acid Profiles from 'Pinot Noir' Grapes are Influenced by Vine N-status and Sample Preparation Method

    Science.gov (United States)

    This study examined the impact of extraction method on ammonia, free amino acids, and YAN (yeast assimilable nitrogen) concentrations in 'Pinot noir' berries obtained from a vine nutrition study (altered supply of N, P, or K). Berries were either juiced or exhaustively extracted as whole berries pri...

  1. Safety Testing of Seed and Vaccines for Dengue Viruses in Mice, Guinea Pigs, Rabbits and Bacterial and Mycoplasma Culture Media

    Science.gov (United States)

    1990-12-20

    Dr. Yen Eckols)- Tha. o-peri ccnt aJ Virus Vaccine Produccion L~bora -cr-- Suite 15𔃺 (Flow; Laboratories, Inc.) Program Resour~ces, Inc.- (PRI...manner similac to that described ab -ove for the crude virus fluid except that immnrune serum *das not included. In addition, an apopit nubro.n inocul-aLt

  2. Russia’s Contribution as a Partner in the War on Terrorism

    Science.gov (United States)

    2014-07-01

    Nr 35-F3), “On Coun- tering Terrorism,” signed by President Putin on March 6, 2006, after it was ratified by both chambers of the Russian...the event directly, or conducting a bloody and spectacular attack in Russia which would overshadow the games. For Moscow, this is the pri- mary

  3. Worldwide Phylogeography of Wild Boar Reveals Multiple Centers of Pig Domestication

    DEFF Research Database (Denmark)

    Larson, Greger; Dobney, Keith; Albarella, Umberto

    2005-01-01

    Mitochondrial DNA (mtDNA) sequences from 686 wild and domestic pig specimens place the origin of wild boar in island Southeast Asia (ISEA), where they dispersed across Eurasia. Previous morphological and genetic evidence suggested pig domestication took place in a limited number of locations (pri...

  4. Case report

    African Journals Online (AJOL)

    abp

    examen psychiatrique relève un semi-mutisme, un contact laborieux, une stéréotypie gestuelle faite de bouchage d׳oreilles avec ses mains et d׳élévation des mains en signe de prière et d׳exorcisme, une psychomotricité accrue.

  5. Hybrid Experimental-Numerical Stress Analysis.

    Science.gov (United States)

    1983-04-01

    A. 1. and Riley# W. F., Introduction to Pho hanics, Pren- tics -Hall, Englewood Cliffs# 1965P pp. 185-186. 8. Rao, G. V., "Experimental-numerical...Naw1 o a. CA *924 Loe Amnl*&. Ca 10024 Profesor T. V. Cosng Or. IF. Sm#Amv Or. M. P. gtesProfeesr Ulert pried University of Agree on"ser si pmlo

  6. Bioassessment Tools for Stony Corals: Field Testing of Monitoring Protocols in the US Virgin Islands (St. Croix)

    Science.gov (United States)

    Survey protocols for assessing coral reef condition were field tested at 61 reef stations in St. Croix, US Virgin Islands (USVI) during 2006. Three observations for stony corals were recorded: species, size, and percent live tissue. Stony corals were selected because they are pri...

  7. Implications of the PRI´S Firsth Presidential Primary. A view fron Ciudad Juárez

    Directory of Open Access Journals (Sweden)

    Steven Barraca

    2001-01-01

    Full Text Available Este artículo investiga las percepciones de los votantes en la primera elección del PRI para elegir candidato a la presidencia, llevada a cabo el 7 de noviembre de 1999. Una encuesta de salida realizada el día de la elección en Ciudad Juárez, Chihuahua, indica que la mayoría de los votantes percibían las elecciones bien organizadas, transparentes y honestas, aunque estas percepciones variaron significativamente de acuerdo a las simpatías hacia el candidato y al partido. Los resultados de la encuesta de salida sugieren que el PRI se beneficiaría con la elección al reforzar el apoyo electoral de su base y entre los votantes independientes. Esta situación era crucial para el PRI en Chihuahua dada la competitividad y el fluido ambiente bipartidista en el estado. A nivel nacional, al ayudar a solidificar su base, la elección fue un factor que posiblemente contribuyó a que el PRI obtuviera pluralidad en el Senado y en la Cámara de Diputados en las elecciones de julio del 2000.

  8. Ali vse obstaja zato, da bi pristalo v knjigi? Mallarmé in njegova dediščina

    Directory of Open Access Journals (Sweden)

    Nadežda Čačinovič

    2010-12-01

    Full Text Available Prispevek je pregled sodobnih branj in izpeljav Mallarméjeve znamenite izjave; obravnava vrsto avtorjev, od Borgesa in E. R. Curtiusa do sodobnih francoskih filozofov, in se pri tem ukvarja tudi z usodo »analogne« knjige v digitalni dobi.

  9. Assessing and Evaluating Department of Defense Efforts to Inform, Influence, and Persuade: Handbook for Practitioners

    Science.gov (United States)

    2015-01-01

    in which the focal audience would interact with the program “in the wild” or under generalizable circumstances.5 Likewise, field experiments taking...determining how members of a target audience create meaning in their lives through storytelling ; it is not a pri- mary method of data collection. It

  10. A prospective longitudinal study to estimate the prevalence of ...

    African Journals Online (AJOL)

    Sally S. Zahra

    2016-05-13

    May 13, 2016 ... Subjects and methods: This was a prospective–longitudinal study done on 180 children with pri- mary mono ... of overweight and obesity is not higher in children with nocturnal enuresis as compared to the over- all prevalence in .... and short term memory and a composite score is derived from the area ...

  11. Appelluis vlucht voor stank : olie en feromoon als bestrijdingsmiddel

    NARCIS (Netherlands)

    Tol, van R.W.H.M.; Helsen, H.H.M.

    2004-01-01

    Stand van zaken bij het onderzoek van PPO Randwijk en PRI naar de werkzaamheid van plantaardige oliën en feromonen voor de bestrijding van de roze appelluis in appel. De werking is gebaseerd op geurstoffen die het paringsgedrag van mannelijke en vrouwelijke bladluizen beïnvloeden

  12. Factors that Affect the Physical Science Career Interest of Female Students: Testing Five Common Hypotheses

    Science.gov (United States)

    Hazari, Zahra; Potvin, Geoff; Lock, Robynne M.; Lung, Florin; Sonnert, Gerhard; Sadler, Philip M.

    2013-01-01

    There are many hypotheses regarding factors that may encourage female students to pursue careers in the physical sciences. Using multivariate matching methods on national data drawn from the Persistence Research in Science and Engineering (PRiSE) project ("n" = 7505), we test the following five commonly held beliefs regarding what…

  13. MicroRNA-126 and epidermal growth factor-like domain 7-an angiogenic couple of importance in metastatic colorectal cancer. Results from the Nordic ACT trial

    DEFF Research Database (Denmark)

    Hansen, T F; Christensen, René dePont; Andersen, R F

    2013-01-01

    from a randomised phase III study were included. The primary microRNA-126 (pri-miRNA-126) A24G single-nucleotide polymorphism and the mature miRNA-126 were analysed by PCR using genomic DNA (full blood) and formalin-fixed paraffin-embedded tissue sections, respectively. The epidermal growth factor...

  14. Urban Interaction and Affective Experience

    DEFF Research Database (Denmark)

    Fritsch, Jonas; Brynskov, Martin

    2008-01-01

    in favor of three points in that direction: First we argue that interaction – and the definition of interaction – is central to unfold the potential of digital urban media, from big, shared screens and media facades to small pri-vate, networked mobile and embedded platforms. Then we argue that an affective...

  15. Gone but Not Forgotten

    Science.gov (United States)

    Monastersky, Richard

    2006-01-01

    Neanderthals, those long-lost cousins of modern humans, will not remain lost for long, at least from the prying eyes of geneticists. Two teams of scientists announced that for the first time they had analyzed DNA from the nuclei of cells preserved in 37,000-year-old Neanderthal fossils. That, they say, lays the groundwork for determining the…

  16. Kas met geïntegreerde omzetting van warmtestraling naar elektrische energie

    NARCIS (Netherlands)

    Sonneveld, P.J.; Swinkels, G.L.A.M.; Bot, G.P.A.

    2007-01-01

    PRI is een nieuwe ontwikkeling gestart in een tweede generatie energieleverende kassen. Doel van dit project is een technologie te ontwikkelen die het warmtedeel van de zonne-energie omzet in hoogwaardige elektrische en thermische energie. De warmtestraling wordt gereflecteerd met een speciale NIR

  17. Detection of three porcine vesicular viruses using multiplex real-time primer-probe energy transfer

    DEFF Research Database (Denmark)

    Rasmussen, Thomas Bruun; Uttenthal, Åse; Aguero, M.

    2006-01-01

    Rapid identification of the etiologic agent in infected animals is important for the control of an outbreak of vesicular disease in livestock. We have in the present study developed a multiplex real-time reverse transcription-PCR, based on primer-probe energy transfer (PriProET), for simultaneous...

  18. Inferring radar mode changes from elementary pulse features using Fuzzy ARTMAP classification

    CSIR Research Space (South Africa)

    Potgieter, PF

    2007-11-01

    Full Text Available A method for radar mode inference using Fuzzy ARTMAP classification is presented. In this method elementary radar parameters, Pulse Width (PW) and Pulse Repetition Interval (PRI) originating from a radar operating in a certain mode is input to a...

  19. Ringtest to evaluate four methods of resistance testing in fodder radish against Meloidogyne chitwoodi

    NARCIS (Netherlands)

    Visser, J.H.M.; Berg, van den W.; Korthals, G.W.

    2009-01-01

    To measure levels of resistance in fodder radish cultivars a reliable, objective and cost effective testing method is required. In 2006 German and Dutch plant breeder’s organizations (Bundesverband Deutscher Pflanzenzüchter; BDP and Plantum), a number of research institutes (PRI, PPO (WUR) and JKI)

  20. Effect Bacillus thuringiensis gekwantificeerd

    NARCIS (Netherlands)

    Elderson, J.; Belder, den E.

    2001-01-01

    PRI onderzocht in veldproeven de effecten van het biologische middel Dipel WP voor de bestrijding van rupsen (koolmot e.a.) in de biologische spruitkoolteelt. Na behandeling loopt het aantal koolmotten fors terug; de opbrengst van de behandelde en onbehandelde velden was gelijk, maar de kwaliteit

  1. Beyond the Narrative Mode in the Composition Classroom: Embracing a Return to the Personal Essay

    Science.gov (United States)

    Haugen, Hayley Mitchell

    2013-01-01

    Knoblauch and Brannon might suggest I pry loose the grip that ancient rhetorical tradition has on my modern classroom, but I'm not convinced I can so easily abandon the ancient rhetoricians. Learning to embrace the different, more creative, and less frequently acknowledged elements of this tradition may be the way for me to go instead. The ancient…

  2. Relationship between Palmar Dermatoglyphic Pattern and ...

    African Journals Online (AJOL)

    The palmprints and fingerprints of 320 3rd and 4th year students of Ghana Senior High School, Koforidua were analyzed according to the number of Primary crease, Intersections of pri-mary crease and Complete transverse Crease (PIC) model of classification and FBI system of fin-gerprint classification respectively.

  3. Dissecting the interactions of SERRATE with RNA and DICER-LIKE 1 in Arabidopsis microRNA precursor processing

    KAUST Repository

    Iwata, Yuji

    2013-08-05

    Efficient and precise microRNA (miRNA) biogenesis in Arabidopsis is mediated by the RNaseIII-family enzyme DICER-LIKE 1 (DCL1), double-stranded RNA-binding protein HYPONASTIC LEAVES 1 and the zinc-finger (ZnF) domain-containing protein SERRATE (SE). In the present study, we examined primary miRNA precursor (pri-miRNA) processing by highly purified recombinant DCL1 and SE proteins and found that SE is integral to pri-miRNA processing by DCL1. SE stimulates DCL1 cleavage of the pri-miRNA in an ionic strength-dependent manner. SE uses its N-terminal domain to bind to RNA and requires both N-terminal and ZnF domains to bind to DCL1. However, when DCL1 is bound to RNA, the interaction with the ZnF domain of SE becomes indispensible and stimulates the activity of DCL1 without requiring SE binding to RNA. Our results suggest that the interactions among SE, DCL1 and RNA are a potential point for regulating pri-miRNA processing. 2013 The Author(s) 2013.

  4. NJP VOLUME 42 NO 1

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-08-09

    Aug 9, 2014 ... Abstract: Background: Autism is a chronic neuro-developmental disorder and teachers of pupils with autism require a basic under- standing of the disorder. Objective: To determine the awareness of autism amongst pri- mary school teachers and to find out pupils with symptoms of Au- tism Spectrum ...

  5. Bacterie remt phytophthora

    NARCIS (Netherlands)

    Knuivers, M.; Overbeek, van L.S.

    2009-01-01

    Bacteriën kunnen aardappelplanten weerbaarder maken tegen phytophthora. Uit kas-experimenten van Plant Research International (PRI) blijkt dat de aanwezigheid van de bacteriePseudomonas putida(isolaat P9) in twee late aardappelrassen leidt tot een vertraging met 45 procent van het ziekteverloop na

  6. Varroabestrijding en Amitraz

    NARCIS (Netherlands)

    Steen, van der J.J.M.

    2010-01-01

    Dat de varraomijt bestreden moet worden is voor iedere imker duidelijk. Niet bestrijden leidt tot zwakke volken en wintersterfte. Onderzoeken van PRI Bijen@wur en vele buitenlandse onderzoeksinstellingen komen, als het gaat over wintersterfte, altijd hetzelfde uit: de varroamijt is oorzaak nummer

  7. Introduction of transposon Tn901 into a plasmid of Anacystis nidulans: preparation for cloning in cyanobacteria

    NARCIS (Netherlands)

    van den Hondel, C. A.; Verbeek, S.; van der Ende, A.; Weisbeek, P. J.; Borrias, W. E.; van Arkel, G. A.

    1980-01-01

    We have used the TEM beta-lactamase transposon Tn901, located on Escherichia coli plasmid pRI46, to introduce in vivo a genetic marker into plasmid pUH24, present in the cyanobacterial strain Anacystis nidulans R-2. Restriction enzyme analysis and heteroduplex studies of the 8.3 x 10(6)-dalton

  8. The Nature of Coherent Radio Emission from Pulsars

    Indian Academy of Sciences (India)

    72

    As the primary particles move away from the gap region where E.B = 0, they continue to create high energy photons, which further create pairs and this cas- cade leads to the generation of of a cloud of secondary electron-positron plasma which has a significantly lower. Lorentz factor with mean value of γs. If there are np pri-.

  9. A política internacional da CGTP e da CUT: Etapas, temas e desafios

    Directory of Open Access Journals (Sweden)

    Hermes Augusto Costa

    2012-10-01

    Full Text Available Apesar de existir enquanto política no seio das organizações sindicais nacionais, a política de relações internacionais (PRI configura-se, todavia, como “parente pobre” do sindicalismo nacional. Depois de enunciar brevemente, na primeira parte, alguns dos obstáculos actuais à construção de uma PRI, este texto debruça-se, na segunda parte, sobre o espaço que as duas principais centrais sindicais de Portugal e do Brasil (a CGTP e a CUT, respectivamente vêm conferindo à PRI. Partindo do trabalho de investigação realizado nos últimos 5 anos junto daquelas organizações sindicais, propõe-se uma distribuição das fases da PRI da CGTP e da CUT, sintetizando-se, na terceira parte, algumas semelhanças e diferenças entre ambas a esse respeito.

  10. Zwartvruchtrot gedijt prima op dood perenblad : Infectie aan de bron bestrijden

    NARCIS (Netherlands)

    Jong, de P.F.; Köhl, J.

    2010-01-01

    PPO en PRI vonden de belangrijkste substraten waar zwartvruchtrot op overleeft. Vooral afgevallen bladeren, afgevallen peren en dood onkruid zijn de boosdoeners. De ziekte treedt op als er in het begin van het seizoen voldoende ziekteverwekker op deze substraten aanwezig is. Door het verwijderen van

  11. A System to Derive Optimal Tree Diameter Increment Models from the Eastwide Forest Inventory Data Base (EFIDB)

    Science.gov (United States)

    Don C. Bragg

    2002-01-01

    This article is an introduction to the computer software used by the Potential Relative Increment (PRI) approach to optimal tree diameter growth modeling. These DOS programs extract qualified tree and plot data from the Eastwide Forest Inventory Data Base (EFIDB), calculate relative tree increment, sort for the highest relative increments by diameter class, and...

  12. Long-Range Military Implications of Petroleum Availability for Navy Planning Study

    Science.gov (United States)

    1981-11-01

    Energy Fact Book. Unclassified, May 1979 (37] Root, David H., and Attanasi, Emil D., "World Petroleum Avail- ability," paper presented to 37th Annual...expected to nold down pri.e3. Although this view is in contrast with recent experience with oil, it reflects to a degree the situation encountered a fev

  13. History and Current Research in the USDA-ARS Cotton Breeding Program at Stoneville, MS

    Science.gov (United States)

    It has been more than 50 years since the USDA-ARS cotton breeding program was initiated at Stoneville, MS in the middle of last century. The mission of this program was established to promote profits for cotton growers and improve cotton production in the U.S. In early times, earliness was a top pri...

  14. Video displays, work, and vision

    National Research Council Canada - National Science Library

    National Research Council Staff

    1983-01-01

    ... Sciences and Education National Research Council NATIONAL ACADEMY PRESS Washington, D.C. 1983 Copyrightthe cannot be not from book, paper however, version for formatting, original authoritative the typesetting-specific the as from created publication files XML from other this and of recomposed styles, version heading pri...

  15. The expression and function of microRNAs in vertebrate embryonic development

    NARCIS (Netherlands)

    Kloosterman, W.P.

    2007-01-01

    MicroRNAs regulate gene expression at the posttranscriptional level by binding to the 3'UTR of mRNAs. These small RNA molecules (~22 bases in length) are processed from long primary transcripts (pri-miRNA). In animals, microRNAs bind with imperfect complementarity to their target mRNA. This leads to

  16. Preciscavanje otpadnih voda u postupcima prerade i flegmatizacije eksploziva

    OpenAIRE

    Anđelković-Lukić Mirjana

    2002-01-01

    U radu su prikazani tehnološki postupci prerade (flegmatizacije) eksploziva pri kojima dolazi do zagađenja okoline otpadnim vodama. Prikazani su neki od načina prerade otpadnih voda pre nego što se ispuste u javne vodotokove.

  17. GenBank blastx search result: AK289049 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289049 J090092N07 BC111969.1 BC111969 Homo sapiens coagulation factor VIII, procoagulant component (hemoph...ilia A), transcript variant 2, mRNA (cDNA clone IMAGE:8327437), complete cds. PRI 0.0 0 ...

  18. GenBank blastx search result: AK289049 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289049 J090092N07 BC022513.1 BC022513 Homo sapiens coagulation factor VIII, procoagulant component (hemoph...ilia A), mRNA (cDNA clone IMAGE:4815208), complete cds. PRI 0.0 0 ...

  19. GenBank blastx search result: AK289049 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289049 J090092N07 BC098389.1 BC098389 Homo sapiens coagulation factor VIII, procoagulant component (hemoph...ilia A), mRNA (cDNA clone IMAGE:5284386), complete cds. PRI 0.0 0 ...

  20. GenBank blastx search result: AK289049 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289049 J090092N07 BC111967.1 BC111967 Homo sapiens coagulation factor VIII, procoagulant component (hemoph...ilia A), transcript variant 2, mRNA (cDNA clone IMAGE:8327435), complete cds. PRI 0.0 0 ...