WorldWideScience

Sample records for volodymyr dal lugansk

  1. DAL Algorithms and Python

    CERN Document Server

    Aydemir, Bahar

    2017-01-01

    The Trigger and Data Acquisition (TDAQ) system of the ATLAS detector at the Large Hadron Collider (LHC) at CERN is composed of a large number of distributed hardware and software components. TDAQ system consists of about 3000 computers and more than 25000 applications which, in a coordinated manner, provide the data-taking functionality of the overall system. There is a number of online services required to configure, monitor and control the ATLAS data taking. In particular, the configuration service is used to provide configuration of above components. The configuration of the ATLAS data acquisition system is stored in XML-based object database named OKS. DAL (Data Access Library) allowing to access it's information by C++, Java and Python clients in a distributed environment. Some information has quite complicated structure, so it's extraction requires writing special algorithms. Algorithms available on C++ programming language and partially reimplemented on Java programming language. The goal of the projec...

  2. dal Toompeal / Ralf R Parve

    Index Scriptorium Estoniae

    Parve, Ralf R., 1946-2008

    2002-01-01

    Järg 27. veebr., 6,27. märts, 3,17,24. aprill, 10,22,29. mai, 5,12,19,26. juuni, 18,25. september, 2,16,23,30. oktoober, 13,20,27. november lk. 5, 5,11,18. detsember lk. 5. Riigikogu istungite kajastus. Kesknädal 24. apr. vt. Ants Käärma kiri R.R. Parvele. Parlamendisaadik

  3. PERFORMANCE ET RESTRUCTURATION: LE CAS SAÏDAL ...

    African Journals Online (AJOL)

    performance de SAÏDAL suite à sa restructuration débutée en 1997. Le concept de ... millions d'actions. Du point de vue du management, SAÏDAL adopte le tableau de .... Méthodes et Pratiques de la Performance : Le Guide du Pilotage. ... performance des entreprises, Kaplan et Norton proposèrent le tableau de bord ...

  4. Algas vene kirjanduse nädal / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2008-01-01

    22. septembril algas Tartu Linnaraamatukogus vene kirjanduse nädal Inga Ivanova raamatu "Kadunud koerte saladus" esitlusega; 24. sept. toimub Igor Kotjuhi autoriõhtu; 26.-28. toimub Tartu Ülikoolis vene kirjandusele pühendatud rahvusvaheline teaduskonverents. Raamatukogust saab osta ka venekeelseid raamatuid

  5. El texto visual. Una lectura de "Cenicitas" de Dalí

    DEFF Research Database (Denmark)

    Hansen, Hans Lauge

    1999-01-01

    Dalí (Salvador), García Lorca (Federico), Pintura, Semiótica, Hermenéutica, Intertextualidad, Peirce (Charles), Ricoeur (Paul)......Dalí (Salvador), García Lorca (Federico), Pintura, Semiótica, Hermenéutica, Intertextualidad, Peirce (Charles), Ricoeur (Paul)...

  6. Mediamorfosi del romanzo popolare: dal 'feuilleton' al serial TV

    Directory of Open Access Journals (Sweden)

    Emanuela Piga

    2014-12-01

    Full Text Available Nel 1964, in Apocalittici e integrati Umberto Eco affermava che se l’errore degli apologeti della cultura di massa era di ritenere che la moltiplicazione dei prodotti dell’industria fosse di per sé buona, al contrario, “l’errore degli apocalittici-aristocratici” era di pensare che la cultura di massa fosse radicalmente cattiva proprio per la sua natura di “fatto industriale”, come se si potesse dare cultura al di fuori del condizionamento industriale. In una prospettiva che guarda all’evoluzione storica dei supporti mediali che accolgono e formano l’espressione dell’immaginazione, l’intento qui è di soffermarsi su un’analogia, da più parti riscontrata, tra le forme narrative del romanzo ottocentesco e alcune contemporanee serie televisive. Senza mirare a definire integralmente il rapporto tra le diverse sfere del letterario e del televisivo, lo scopo di questo contributo è  di riflettere sulle trasformazioni del romanzo popolare attraverso epoche e media, a partire dal romanzo ottocentesco Les Mystères de Paris (Eugène Sue e dal contemporaneo Serial TV Lost (J.J. Abrams, D. Lindelof, J. Lieber, C. Cuse.

  7. Dalí, un genio hacia la muerte

    Directory of Open Access Journals (Sweden)

    Hernando Escobar Vera

    2016-12-01

    Full Text Available Este trabajo se propone analizar tres aspectos que se destacan en Soft self-portrait with grilled bacon (1941 de Salvador Dalí (1904-1989: la máscara; la contigüidad entre lo blando y lo duro; y lo orgánico, comestible y en descomposición. Estos aspectos se inscriben en el conjunto del sistema simbólico daliniano de tensiones que manifiestan el dislocamiento (y ambivalencia entre el reconocimiento que Dalí hace de su humanidad mortal y su deseo de trascendencia e inmortalidad. Así, lo que se manifiesta como angustia en el psiquismo del artista catalán es transformado en fascinación en su obra y en su vida, en las que se registran constantes alusiones al temor a la muerte y al deseo de trascenderla. Sin embargo, en este trabajo el énfasis no se pone en el psiquismo del artista sino en las mediaciones que le permiten elaborar una estética a partir de su angustia (sublimarla y en las particularidades de dicha estética.

  8. Muusikamaailm : Heliloojafestival Stocholmis. Klaverinädal Espoos. Preemiaid ja aunimetusi. Sena Jurinac 80 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Stocholmis algas iga-aastane International Composer Festival. Espoos toimub klaverinädal. Erinevaid preemiaid ja aunimetusi, mida muusikategelased on hiljuti saanud. Kroaatia päritolu Austria sopran Sena Jurinac sai 80 aastaseks

  9. La devozione alle icone medievali riscritta dal Concilio di Trento

    Directory of Open Access Journals (Sweden)

    Anita Paolicchi

    2016-06-01

    Full Text Available Il Concilio di Trento (1545-1563 determinò nuove esigenze liturgiche, che portarono a una rapida trasformazione e a un drastico rinnovamento delle chiese sia dal punto di vista strutturale che dell’arredo. Questo articolo desidera indagare i caratteri fondamentali di un fenomeno poco conosciuto e sicuramente sottovalutato della storia dell’arte moderna legata a questi cambiamenti: la ri-funzionalizzazione delle immagini medievali e bizantine, prendendo come esempio il caso toscano. In particolare verrà evidenziato come la percezione da parte dei fedeli di queste immagini si evolva nel corso dei secoli. || The Council of Trent (1545-1563 determined new liturgical requirements and specifications which brought to a rapid transformation and a radical renovation of churches from both a structural and an ornamental perspective. This article aims at investigating the fundamental features of a rarely studied and certainly underestimated artistic phenomenon of the post-Tridentine era: the changes in the function of medieval and Byzantine images, with a focus on Tuscan examples. In particular, we will examine how the worshippers’ perception of such images evolved over the centuries.

  10. La protezione del patrimonio monumentale dal rischio sismico / The protection of monuments from the seismic risk

    Directory of Open Access Journals (Sweden)

    Giovanni Urbani

    2017-06-01

    Full Text Available Il classico pubblicato nel n. 15/2017 è il testo Protezione del patrimonio monumentale dal rischio sismico  scritto da Giovanni Urbani, direttore dell'Istituto centrale del Restauro (ICR di Roma dal 1973 al 1983, come introduzione alla prima mostra organizzata in Italia sul rischio sismico nel 1983.   The classic published in the issue n. 15/2017 is the text Protezione del patrimonio monumentale dal rischio sismico written by Giovanni Urbani, director of the Central Institue of Restoration ICR in Rome from 1973 to 1983, as introduction to the first exhibition organized in Italy about the seismic risk in 1983.

  11. Ikestatud rahvaste nädal New Yorgis. New York City, 16. - 23 juuli 2006 / Juta Kurman

    Index Scriptorium Estoniae

    Kurman, Juta, 1912-2015

    2006-01-01

    1959. aastal president Eisenhoweri poolt välja kuulutatud 3. nädal juulis on Ikestatud Rahvaste Nädal, mida on tähistatud 48 korda. Sellel aastal tähistati seda jumalateenistuste, meeleavalduste, resolutsiooni vastuvõtmise ja kultuuriprogrammiga

  12. Portugali nädal toob kunsti, filme ja muusikat / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2008-01-01

    Portugali suursaatkonna, Pärnu linnavalitsuse, Pärnu kolledzhi ja restorani Café Grand koostööna algab 17.09.2008 kunstinädal Pärnus. Ürituste kalender. Toimuvad näitused, kirjandus- ja filmiõhtud ning kontserdid

  13. Tam tam in de polder: uitbreiding Afrikamuseum Berg en Dal door Rijksgebouwdienst

    NARCIS (Netherlands)

    Voorthuis, J.C.T.

    2006-01-01

    Op 27 mei dit jaar is in het glooiende boslandschap van Berg en Dal, vlak bij Nijmegen, de nieuwe uitbreiding van het Afrika Museum geopend. Het ontwerp is in vele opzichten voorbeeldig. Het stelt zich terughoudend op ten aanzien van zowel de schitterende omgeving als het doel - het tentoonstellen

  14. Salvador Dalí et le mécénat du Zodiaque

    NARCIS (Netherlands)

    Verhaar, Marijke

    2008-01-01

    When Salvador Dalí settled in Paris with the avowed aim to conquer the art world, he was unknown and virtually penniless. The great Economic Crisis which had hit Europe at that time, did nothing to improve his prospects. Yet, during his early years in the French capital, 1929-1935, he was able to

  15. Salvador Dalí's paintings to introduce Quantum Mechanics concepts in High School

    OpenAIRE

    Rúbia de Fátima Antunes Martins Fernandes; Flaviston Ferreira Pires; Thaís Cyrino de Mello Forato; José Alves da Silva

    2017-01-01

    A few papers have presented results of teaching Quantum Mechanics in High School. As a high abstraction level is demanded, it is necessary to reconsider theoretical assumptions, approaches and methodologies, in order to reduce difficulties in its insertion. This paper presents the achievements of a research, which is a didactic proposal for High School comprising discussions about Quantum Mechanics, involving elements that relate Physics and some paintings of Salvador Dalí. Embracing the rela...

  16. Passando per Milano. Kebba Suwareh, immigrato dal Gambia, e le conseguenze dell’illegalità

    Directory of Open Access Journals (Sweden)

    Alice Bellagamba

    2013-10-01

    Full Text Available Il centro d’accoglienza Naga-Har, l’abitazione del cugino, le carceri di San Vittore e di Bollate sono alcuni dei luoghi tra il 2005 e il 2007 attraversati da Kebba Suwareh - richiedente asilo originario del Gambia (un piccolo paese dell’Africa Occidentale affacciato sull’Oceano Atlantico e circondato su tre lati dal Senegal - mentre aspettava che la sua domanda d’asilo politico fosse valutata dalla commissione territoriale di Milano.

  17. БАРВОСВІТ ПОЕЗІЇ ВОЛОДИМИРА СОСЮРИ / THE EXUBERANT WORLD OF THE POETRY BY VOLODYMYR SOSIURA

    Directory of Open Access Journals (Sweden)

    Олена КУЛЬБАБСЬКА

    2017-03-01

    Full Text Available Кульбабская Елена. Мир цвета в поэзии Владимира Сосюры. В статье рассмотрена проблема функционирования эпитетов со значением цвета в современной украинской поэзии на примере художественной речи Владимира Сосюры. Установлено, что художественные образы поэтических текстов неординарного поэта насыщены широкой цветовой гаммой, которая охватывает названия цветов от архетипных (черный↔белый, основных спектральных (синий, зеленый, красный, до таких названий, как золотой, фиолетовый, оранжевый (помаранчевый. Такое большое количество цветовых наименований свидетельствует о „цветовом” восприятии поэтом мира, его ощущениях, о „цветовых” ассоциациях. Ключевые слова: поэтический текст, индивидуально-авторское восприятие действительности, цветовая гамма, художественный образ, метафора, ассоциативность, символичность, эмоциональность, стилистические функции. Kulbabska Olena. The exuberant world of the poetry by Volodymyr Sosiura. The article deals with the functioning specificity of epithet constructions bearing the meaning of color in the linguistic worldview of Volodymyr Sosiura. The author establishes the fact that the attribute as a poly-functional unit of poetical speech, being the marker of the author's style, synthesizes the

  18. The Construtive Reason and the Poetic Lacework of Maria Lúcia Dal Farra

    Directory of Open Access Journals (Sweden)

    Teresa Cabañas

    2005-01-01

    Full Text Available This article examines some aspects of the poetical production of Maria Lúcia Dal Farra, Livro de auras (1994 and Livro de possuídos (2002, trying, mainly, an approach to the constructive mechanisms that move its poetical universes. The focus of attention centers in the use that such a poetics makes of a constructive ratio, which hovers between “canto” and “decanto” to symbolize, in a feminine way of writing, the possession of an aesthetic intellect that traditional androcentric culture has reserved for the masculine.

  19. The construtive reason and the poetic lacework of Maria Lúcia Dal Farra

    Directory of Open Access Journals (Sweden)

    Teresa Cabañas

    2006-01-01

    Full Text Available This article concerns itself with the analysis of the work of São Paulo poet Maria Lúcia Dal Farra, Livro de auras (1994 e Livro de possuídos (2002,attempting, principally, an approximation of the constructive mechanisms that dynamize her poetical universe. The focus of attention is centered on the use, by this poet, of a constructive ratio which moves between the canto and the decanto to symbolize, as feminine writing, the possession an aesthetic intellect that an androcentric culture reserves for masculine use only.

  20. E. Biasin - G. Maina - F. Zecca (eds., Il porno espanso. Dal cinema ai nuovi media

    Directory of Open Access Journals (Sweden)

    Mirko Lino

    2012-06-01

    Full Text Available I contributi di studiosi italiani e stranieri che compongono Il porno espanso hanno il merito di ricordare come la pornografia da fenomeno relegato alla semantica dell’osceno si sia emancipata a categoria da considerare «non più come un “problema sociale” (da combattere ma anche (e soprattutto come una “pratica culturale” (da comprendere». La pornografia, utilizzando la terminologia di Linda Williams, fondatrice in ambito accademico dei Porn Studies, dal “fuori scena” (ob/scenity si ricolloca “dentro la scena” (on/scenity, invadendo tutti gli scenari della cultura contemporanea.

  1. Makna Dalâl dalam al-Qur’an Perspektif Teori Dilâlat al-Alfâz

    Directory of Open Access Journals (Sweden)

    Ahmad Fawaid

    2015-09-01

    Full Text Available The interpretation methodology of Koran always has significant development. No death of interpretation, because the interpretation methodology will develop agree with throb of people civilization and language development. A matter of fact, Koran is a guidance book for man with Arabic language. For example, dalâl. Although concept of dalâl was exist at Muhammed period, but there are many distortion and wrong conclution after Muhammed, and lost of essential meaning of dalâl. Some people or some community said that dalâl is used to tought that considered wrong or deviate on right way, in other opinion they said that dalâl just for unbeliever, polytheist, immoral in law, and the others. The difference opinion is none other than different interpretation method to word of dalâl. Because of that, the writer interested to analyze dalâl with semantic method. Because the writer is conviced about semantic will give some enticement concept of dalâl.

  2. Il giorno della laurea di Giovanni Meola. Dal testo alla scena

    Directory of Open Access Journals (Sweden)

    Armando Rotondi

    2016-06-01

    Full Text Available Quando Giovanni Meola, drammaturgo e regista indipendente, mi ha chiesto di seguire la genesi de Il giorno della laurea, andato poi in scena con Cristiana Dell‟Anna ed Enrico Ottaviano dal 26 aprile al 1 maggio 2016 presso la Sala Ridotto del Teatro Stabile di Napoli-Teatro Nazionale (noto molte volte semplicemente come Teatro Mercadante, ho accettato con grande entusiasmo. E seppure io abbia avuto modo di seguire solo parzialmente le prove, ho raccolto comunque materiale prezioso per questa piccola monografia. Il lavoro critico che segue è stato anticipato da una serie di articoli giornalistici da me firmati e pubblicati su “EffettoNapoli.it” il 17, il 24 e il 30 Aprile e da un seminario dal titolo “Nuova letteratura drammatica contemporanea – Incontro con Giovani Meola, Cristiana Dell‟Anna ed Enrico Ottaviano” (28 aprile 2016, da me organizzato e che si è svolto nell'ambito dell‟insegnamento di Letteratura Italiana presso l‟Università degli Studi di Napoli “L‟Orientale”. Nell'approcciarmi alla stesura di questa breve monografia, ho utilizzato pertanto i precedenti articoli come primo schema per ampliare alcuni elementi che, in taluni casi, erano stati appena toccati per motivi propri di spazio, necessariamente limitato nel giornalismo on-line.

  3. Prevention of GABA reduction during dough fermentation using a baker's yeast dal81 mutant.

    Science.gov (United States)

    Ando, Akira; Nakamura, Toshihide

    2016-10-01

    γ-Aminobutyric acid (GABA) is consumed by yeasts during fermentation. To prevent GABA reduction in bread dough, a baker's yeast mutant AY77 deficient in GABA assimilation was characterized and utilized for wheat dough fermentation. An amber mutation in the DAL81 gene, which codes for a positive regulator of multiple nitrogen degradation pathways, was found in the AY77 strain. The qPCR analyses of genes involved in nitrogen utilization showed that transcriptional levels of the UGA1 and DUR3 genes encoding GABA transaminase and urea transporter, respectively, are severely decreased in the AY77 cells. The AY77 strain cultivated by fed-batch culture using cane molasses exhibited inferior gas production during dough fermentation compared to that of wild-type strain AY13. However, when fed with molasses containing 0.5% ammonium sulfate, the mutant strain exhibited gas production comparable to that of the AY13 strain. In contrast to the AY13 strain, which completely consumed GABA in dough within 5 h, the AY77 strain consumed no GABA under either culture condition. Dough fermentation with the dal81 mutant strain should be useful for suppression of GABA reduction in breads. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  4. Evaluation of secretome of highly efficient lignocellulolytic Penicillium sp. Dal 5 isolated from rhizosphere of conifers.

    Science.gov (United States)

    Rai, Rohit; Kaur, Baljit; Singh, Surender; Di Falco, Macros; Tsang, Adrian; Chadha, B S

    2016-09-01

    Penicillium sp. (Dal 5) isolated from rhizosphere of conifers from Dalhousie (Himachal Pradesh, India) was found to be an efficient cellulolytic strain. The culture under shake flask on CWR (cellulose, wheat bran and rice straw) medium produced appreciably higher levels of endoglucanase (35.69U/ml), β-glucosidase (4.20U/ml), cellobiohydrolase (2.86U/ml), FPase (1.2U/ml) and xylanase (115U/ml) compared to other Penicillium strains reported in literature. The mass spectroscopy analysis of Penicillium sp. Dal 5 secretome identified 108 proteins constituting an array of CAZymes including glycosyl hydrolases (GH) belonging to 24 different families, polysaccharide lyases (PL), carbohydrate esterases (CE), lytic polysaccharide mono-oxygenases (LPMO) in addition to swollenin and a variety of carbohydrate binding modules (CBM) indicating an elaborate genetic potential of this strain for hydrolysis of lignocellulosics. Further, the culture extract was evaluated for hydrolysis of alkali treated rice straw, wheat straw, bagasse and corn cob at 10% substrate loading rate. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Sensory Acceptability of Iron-Fortified Red Lentil (Lens culinaris Medik.) Dal.

    Science.gov (United States)

    Podder, Rajib; Khan, Shaan M; Tar'an, Bunyamin; Tyler, Robert T; Henry, Carol J; Jalal, Chowdhury; Shand, Phyllis J; Vandenberg, Albert

    2018-03-01

    Panelists in Saskatoon, Canada (n = 45) and Dhaka, Bangladesh (n = 98) participated in sensory evaluations of the sensory properties of both cooked and uncooked dehulled red lentil dal fortified with FeSO 4 ·7H 2 O, NaFeEDTA or FeSO 4 ·H 2 O at fortificant Fe concentrations of 800, 1,600 (both cooked and uncooked), or 2,800 ppm. Appearance, odor, and overall acceptability of cooked and uncooked samples were rated using a 9-point hedonic scale (1 = dislike extremely to 9 = like extremely). Taste and texture were rated for the cooked samples prepared as typical south Asian lentil meals. Significant differences in sensory quality were observed among all uncooked and cooked samples at both locations. Overall, scores for all sensory attributes and acceptability of uncooked lentil decreased with increasing concentration of Fe in the fortificant; however, Fe fortification (particularly with NaFeEDTA) had small effects on acceptability. Panelists from Saskatoon provided a wider range of scores than those from Bangladesh for all attributes of cooked lentil. Overall, sensory evaluation of Fe fortification using NaFeEDTA minimally affected consumer perception of color, taste, texture, odor, and overall acceptability of cooked lentil. Reliability estimates (Cronbach's alpha [CA]) indicated that consumer scores were generally consistent for all attributes of all lentil samples (mean CA > 0.80). NaFeEDTA was found to be the most suitable Fe fortificant for lentil based on consumer acceptability. Consumption of 45 to 50 g of NaFeEDTA-fortified lentil (fortificant Fe concentration of 1,600 ppm) per day meets the estimated average requirements (EARs) of Fe for humans (10.8 to 29.4 mg). Iron fortification of dehulled lentil dal may change organoleptic attributes that can influence consumer acceptability. Sensory evaluation by consumers helps to determine the effect on appearance, odor, taste, texture, and overall acceptability of fortified lentils. In this study, consumer

  6. Origine ed evoluzione dell'universo dal big-bang alle galassie

    CERN Document Server

    Gratton, Livio

    1992-01-01

    Il volume, destinato a un vasto pubblico di lettori anche non particolarmente versati in materie scientifiche, offre un panorama aggiornato e completo degli sviluppi più recenti della cosmologia, la scienza che studia l'Universo nel suo complesso. Abbandonate ormai completamente visioni mitiche e geocentriche, la moderna cosmologia ripresenta come un ambizioso e affascinante tentativo di creare un modello unitario dell'Universo e della sua evoluzione attraverso gli strumenti della fisica e dell'astronomia. In questo quadro, nato da una profonda riflessione sui concetti di spazio e di tempo sviluppatasi nei primi decenni del secolo soprattutto da parte di Einstein, e sostenuto dal prodigioso progresso della tecnologia che ha aperto nuove e rivoluzionarie possibilità di osservazione, un succedersi sempre più incalzante ed emozionante di scoperte sta rivelando un panorama inaspettatamente vario, complesso, e allo stesso tempo semplice e unitario, la cui interpretazione richiede al cosmologo rigore, fantasia e...

  7. L’adattamento in evoluzione. Percorsi teorici dal 2005 a oggi

    Directory of Open Access Journals (Sweden)

    Claudia Cao

    2012-12-01

    Full Text Available

    In questa sezione apparirà presto un articolo di aggiornamento bibliografico che  completerà il numero monografico di Between sull’adattamento con una ricognizione su quelli che ci sono sembrati i saggi più importanti sul tema apparsi negli ultimi anni.

    Senza pretendere un’impossibile completezza, stiamo prendendo in considerazione le monografie, uscite dal 2005 ad oggi a livello internazionale, che si siano occupate dell’adattamento da un punto di vista teorico, anche nello specifico di un numero limitato di codici/generi (ad es. letteratura e cinema, teatro, televisione, fumetto, videogiochi, etc..

    Chiunque volesse inviare segnalazioni su opere di rilievo può farlo all’indirizzo: g.rossini@gmal.com

  8. El mito de la vida verdadera en la «Vida secreta» de Salvador Dalí

    Directory of Open Access Journals (Sweden)

    Domingo Ródenas de Moya

    2012-12-01

    Full Text Available Este artículo se propone examinar cómo el mito de la mutatio vitae fue adoptado por Dalí como matriz narrativa de su autobiografía Vida secreta. Se sitúa el libro en el género del autorretrato que cultivó el pintor desde su juventud y en la tradición de las “vidas” ejemplares. La necesidad de reinventarse ante la sociedad norteamericana condujo a Dalí a identificar la cultura europea, en especial el arte de vanguardia, con la decadencia y la corrupción, en tanto él construía para sí mismo una coraza protectora con la firma de “salvador” del arte clásico. El crecimiento de esa coraza (o personaje público está narrado como el resultado de una revelación que da paso a una vida auténtica. En el relato de ese proceso, Gala aparece como el agente epifánico que cura al artista enfermo y redime al Dalí hombre. Vida secreta constituye una muestra excelente de autobiografía estetizada y supeditada a un objetivo: la configuración de una máscara pública que fuera a la vez marca registrada y coraza protectora. This paper aims to analyze how the myth of the mutatio vitae was adopted by Dalí as a narrative pattern in his autobiography Vida secreta. The book belongs to the genre of the self-portrait that he cultivated since his youth and it can also be considered part of the tradition of the “exemplary lives”. The need to reinvent himself in the eyes of American society brought Dalí to identify European culture, especially the art of avant-garde, with decadence and corruption, while he created for himself a protective cuirass, as the “salvador” of classical art. How he created this mask (or public figure is narrated as the result of a revelation which gives way to an authentic life. In the story of that process, Gala appears as the epiphanic agent who heals the sick artist and redeems Dalí, the man. Vida secreta is an excellent example of an aestheticised autobiography, subordinated to an object: setting a public mask

  9. Geochemical Peculiarities of Galena and Sphalerite from Polymetallic Deposits of the Dal'negorskii Ore Region (Primorsky Krai, Russia)

    Science.gov (United States)

    Rogulina, L. I.; Moiseenko, V. G.; Ponomarchuk, V. A.

    2018-04-01

    New data on the composition of the major minerals from the skarn and vein polymetallic deposits of the Dal'negorskii ore region are reported. Analysis of galena and sphalerite was carried out by the X-ray fluorescent energy-dispersive method of synchrotron radiation for the first time. It is shown that the minor elements in major minerals of different deposits are typomorphic. Among these elements are Fe, Cu, Ni, Cd, Ag, Sn, and Sb, as well as In in sphalerite and Te in galena. The high concentrations of Ag, Cu, Te, Cd, and In in the extracted minerals indicate the complex character of mineralization. The compositional patterns of ore minerals characterize the sequence of mineral formation from the skarn to vein ores, and the sequence of deposits from the mesothermal to epithermal conditions. This provides geochemical evidence for the stage model of the formation of mineralization in the Dal'negorskii ore region.

  10. 19.-25. IX toimub Rüütelkonna hoones Kumu pärlite nädal...

    Index Scriptorium Estoniae

    2005-01-01

    23. IX kõneleb Anu Allikvee teemal "Eestlane baltisaksa kunstnike vaatepiiris"; 24. IX tutvustab Mai Levin Eugen Dückeri maale, 25. IX Ene Lamp Konrad Mäge. Vt. ka lk. 24 Tähtede nädal 26. IX-2. X - kohtumisõhtutel esinevad Marika ja Heinz Valk, Jüri Kuuskemaa, Sirje Helme, Pekka Vapaavuori, Inge Teder, Rain Lõhmus

  11. Lezioni dal grande terremoto e dallo tsunami del marzo 2011 in Giappone orientale

    Directory of Open Access Journals (Sweden)

    Shunji Murai

    2012-04-01

    Full Text Available Questo rapporto riassume ciò che abbiamo imparato dal disastro del Gran Terremoto e Maremoto nell’Est del Giappone  che avvenne l’11 marzo 2011 su una vasta area. Include le descrizioni delle perdite dovute al disastro, le lezioni dai disastri passati e presenti, un focus su ciò che è stato fatto correttamente e cosa è andato storto, l'incidente nucleare della Centrale Nucleare di Fukushima  (NPS, Nuclear Power Station e le opinioni dell’autore. Lessons from the Disaster of East Japan Great Earthquake and Tsunami 311 The report summarizes what we have learnt from the disaster of  the  East  Japan  Great  Earthquake  and  Tsunami  which  oc-curred on March 11, 2011 over a wide area of East Japan. It includes descriptions of the losses due to the disaster, lessons from  the  past  and  present  disasters  with  focus  on  what  was done  correctly  and  what  went  wrong,  the  accident  at  Fuku-shima Nuclear Power Station (NPS and my views.

  12. Daily Life elevations in the poetry of Maria Lúcia Dal Farra: three poems in perspective

    Directory of Open Access Journals (Sweden)

    Kalina Naro Guimarães

    2017-03-01

    Full Text Available This paper discusses the lyrics of one of the great names of the contemporary Brazilian poetry, Maria Lúcia Dal Farra, based on the analysis of three poems - Manhã, Culinária and Sustância -, included in Livro de auras (1994, the first literary work published by the author. The objective was to investigate how, in these poems, the daily life is problematized, as a generalizing and repetitive space, characterized by the immediacy and lack of reflection, in favor of a poetry that places this daily life aspect in the female universe and, with an intense meditative tone, reconnects the lost human ties, weaving a mythical time. This encounter dramatizes a poetic attitude that, plunging into experiences considered trivial, makes current the space taken by the affective memory and filled with a sense of belonging and perpetuates it. After the attempt to theoretically comprehend the daily life (Kujawski, 1991; Heller, 1992; Maffesoli, 1998, followed by the poems’ literary analysis, the conclusion reached is that the path that starts at the present day and reaches the essential meaning revelation configures important formal and perspective traits in the figuration of this lyric’s universe.

  13. Lezioni dal grande terremoto e dallo tsunami del marzo 2011 in Giappone orientale

    Directory of Open Access Journals (Sweden)

    Shunji Murai

    2012-04-01

    Full Text Available Questo rapporto riassume ciò che abbiamo imparato dal disastro del Gran Terremoto e Maremoto nell’Est del Giappone  che avvenne l’11 marzo 2011 su una vasta area. Include le descrizioni delle perdite dovute al disastro, le lezioni dai disastri passati e presenti, un focus su ciò che è stato fatto correttamente e cosa è andato storto, l'incidente nucleare della Centrale Nucleare di Fukushima  (NPS, Nuclear Power Station e le opinioni dell’autore.Lessons from the Disaster of East Japan Great Earthquake and Tsunami 311The report summarizes what we have learnt from the disaster of  the  East  Japan  Great  Earthquake  and  Tsunami  which  oc-curred on March 11, 2011 over a wide area of East Japan. It includes descriptions of the losses due to the disaster, lessons from  the  past  and  present  disasters  with  focus  on  what  was done  correctly  and  what  went  wrong,  the  accident  at  Fuku-shima Nuclear Power Station (NPS and my views.

  14. WiFiabe: un’esperienza di storytelling dal territorio al web 2.0

    Directory of Open Access Journals (Sweden)

    Marco Carnesecchi

    2013-03-01

    Full Text Available L’impatto iniziale di WiRoni sulla popolazione di Monteroni d’Arbia (Siena è stato limitato alla fruizione dei contenuti caricati dal team di design, in particolare le storie per i bambini. Mancavano infatti brani audio prodotti dalla comunità locale. In realtà, però, la competenza tecnica necessaria a trasmettere i contenuti nel parco e in rete è minima (upload da CMS wordpress e anche le tecnologie per registrare e arricchire l’audio con effetti sonori sono alla portata di tutti, se opportunamente guidati da esperti. Da queste osservazioni è nato il progetto WiFiabe. Nel corso dell’anno scolastico 2010/2011 20 bambini tra 6 e 13 anni, coordinati da un’educatrice durante l’attività di doposcuola del Comune, hanno lavorato in gruppi e creato storie di fantasia. In seguito, alcuni studenti dell’Università di Siena, con l’aiuto di un musicista per la parte degli effetti sonori, hanno assistito i ragazzi nel diventare autori digitali e apprendere in prima persona come trasformare le loro storie in contenuti audio. In questo modo i partecipanti hanno interagito con il web non in quanto fruitori ma come autori, e messo in moto un processo per rendere WiRoni uno strumento per dare voce alle varie anime della comunità.

  15. Salvador Dalí's paintings to introduce Quantum Mechanics concepts in High School

    Directory of Open Access Journals (Sweden)

    Rúbia de Fátima Antunes Martins Fernandes

    2017-08-01

    Full Text Available A few papers have presented results of teaching Quantum Mechanics in High School. As a high abstraction level is demanded, it is necessary to reconsider theoretical assumptions, approaches and methodologies, in order to reduce difficulties in its insertion. This paper presents the achievements of a research, which is a didactic proposal for High School comprising discussions about Quantum Mechanics, involving elements that relate Physics and some paintings of Salvador Dalí. Embracing the relations between Physics and Art allows us to approach and express the relations between scientific education and culture with alternative ways to enrich the knowledge meaning, also aiming to provide students with a broader view about the scientific knowledge construction in an intelligent dialogue with the world.  To do so, the proposal presents an operative methodology, approaching science as a historical and social knowledge to teach quantum mechanics, and it aims to make the student able to hypothesize, conceptualize, situate scientific explanations in time, in short, operate according to the provided tools. Working with the ways in which Physics, introduced as a cultural component, influences the interpretations of macro and microscopic phenomena and contributes to the understanding of Modern Physics, part of twentieth-century Physics. Therefore, adding cultural elements to Physics world seems to be increasingly necessary, as it seems to resignify it by rehumanizing its knowledge. In addition, using the historical context seems to give us a greater extensiveness to knowledge, since it also starts being part of a broader culture, beyond its scientific meaning.

  16. Empātijas atšķirības improvizācijas teātru, amatierteātru un koru dalībniekiem

    OpenAIRE

    Nikolajeva, Inga

    2012-01-01

    Pētījuma mērķis ir noskaidrot empātijas atšķirības starp improvizācijas teātru, amatierteātru un koru dalībniekiem. Izlasi veido 106 respondenti, no tiem 41 improvizācijas teātru dalībnieks, 34 amatierteātru dalībnieki un 31 koru dalībnieks kā kontroles grupa – respondenti, kuriem tā ir brīvā laika aktivitāte ārpus darba. Dalībnieki ir 14 vīrieši un 92 sievietes vecumā no 18 līdz 30 gadiem, dalībnieku pieredzes ilgums aktiermākslā ir no 1 līdz 15 gadiem. Pētījumā tiek izmantota Saimona Barona...

  17. La narrazione dell’azione sociale: spunti dal Trattato di Vilfredo Pareto

    Directory of Open Access Journals (Sweden)

    Ilaria Riccioni

    2017-08-01

    Full Text Available La rilettura dei classici porta con sé sempre una duplice operazione: da una parte un ritorno a riflessioni, ritmi, storicità che spesso sembrano già superate; dall’altra la riscoperta delle origini di fenomeni contemporanei da punti di vista che ne delineano le interconnessioni profonde, non più visibili allo stato di avanzamento in cui le osserviamo oggi. Tale maggiore chiarezza è forse dovuta al fatto che ogni fenomeno nella sua fase aurorale è più chiaramente identificabile rispetto alle sue fasi successive, dove le caratteristiche primarie tendono a stemperarsi nelle cifre dominanti della contemporaneità, perdendosi nelle pratiche quotidiane che ne celano la provenienza. Se la sociologia è un processo di conoscenza della realtà dei fenomeni, il punto centrale della scienza sociale va distinto tra quelle scienze che schematizzano il reale in equazioni formali funzionali e funzionanti, il sistema economico, normativo, e le scienze sociali che si occupano della realtà e della sua complessità, che in quanto scienze si devono occupare non tanto di ciò che la realtà deve essere, bensì di ciò che la realtà è, di come si pone e di come manifesta i movimenti desideranti e profondi del vivere collettivo oltre il sistema che ne gestisce il funzionamento. Il punto che Pareto sembra scorgere, con estrema lucidità, è la necessità di ribaltare l’importanza della logica economica nell’organizzazione sociale da scienza che detta la realtà a scienza che propone uno schema di gestione di essa: da essa si cerca di dettare la realtà, ma l’economia, dal greco moderno Oikòs, Oikòsgeneia (casa e generazione, il termine utilizzato per definire l’unità famigliare non è di fatto “la realtà”, sembra dirci Pareto in più digressioni, bensì l’arte e la scienza della gestione di unità familiari e produttive. La realtà rimane in ombra e non può che essere “avvicinata” da una scienza che ne registri, ed eventualmente

  18. Nuevas hipótesis sobre La miel es más dulce que la sangre de Dalí

    Directory of Open Access Journals (Sweden)

    Moure Pazos, Iván

    2012-06-01

    Full Text Available On 10 February 2011, the Gala-Salvador Dalí Foundation acquired at Christie’s the preparatory study for Dalí’s Honey is Sweeter than Blood (1926, currently in an unknown location. Iconographically, it is a complex painting and crucial in the development of the Catalan artist’s work. This article offers an updated view of the painting, based on recent discoveries that point to the Count of Lautréamont –pseudonym of Isidore Ducasse– as a possible inspirational element and protagonist of the work.El 10 de febrero de 2011, la Fundación Gala-Salvador Dalí adquiría en Christie’s el estudio para La miel es más dulce que la sangre (1926 de Dalí –actualmente desaparecido–. Se trata de una obra iconográficamente compleja, así como crucial en la trayectoria del pintor catalán. El presente artículo pretende ofrecer una visión actualizada del cuadro, en base a los últimos descubrimientos que apuntan al Conde de Lautréamont –pseudónimo de Isidore Ducasse– como posible elemento inspirador y protagonista en la obra.

  19. Its surreal: zinc-oxide degradation and misperceptions in Salvador Dalí’s Couple with Clouds in their Heads, 1936

    NARCIS (Netherlands)

    Keune, K.; Boevé-Jones, G.; Burnstock, A.; de Keijzer, M.; Krueger, J.; Learner, T.; de Tagle, A.; Heydenreich, G.

    2014-01-01

    The painting Couple with Clouds in their Heads by Salvador Dalí (1936) from the Museum Boijmans van Beuningen in Rotterdam was seriously disfigured by ring formations on the edges of the painting and a matt, white-looking semi-transparent material on the surface. Paint samples, taken from affected

  20. 40 CFR 721.6900 - Polymer of bisphenol A di-glyc-i-dal ether, substituted al-kenes, and but-a-diene.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymer of bisphenol A di-glyc-i-dal... SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.6900 Polymer of bisphenol A di-glyc-i... subject to reporting. (1) The chemical substances identified generically as polymer of bisphenol A...

  1. La religione nell’ordinamento algerino tra previsioni costituzionali e normativa ordinaria in materia di esercizio dei culti diversi dal musulmano

    Directory of Open Access Journals (Sweden)

    Maria Cristina Ivaldi

    2012-11-01

    SOMMARIO: 1. Rilievi introduttivi – 2. Il trattamento riservato alla religione nelle costituzioni algerine postcoloniali – 3. La disciplina in materia di esercizio dei culti diversi dal musulmano varata nel 2006 – 4. I decreti di esecuzione della normativa de qua – 5. Tendenze evolutive:

  2. Measuring the Performance of Attention Networks with the Dalhousie Computerized Attention Battery (DalCAB): Methodology and Reliability in Healthy Adults.

    Science.gov (United States)

    Jones, Stephanie A H; Butler, Beverly C; Kintzel, Franziska; Johnson, Anne; Klein, Raymond M; Eskes, Gail A

    2016-01-01

    Attention is an important, multifaceted cognitive domain that has been linked to three distinct, yet interacting, networks: alerting, orienting, and executive control. The measurement of attention and deficits of attention within these networks is critical to the assessment of many neurological and psychiatric conditions in both research and clinical settings. The Dalhousie Computerized Attention Battery (DalCAB) was created to assess attentional functions related to the three attention networks using a range of tasks including: simple reaction time, go/no-go, choice reaction time, dual task, flanker, item and location working memory, and visual search. The current study provides preliminary normative data, test-retest reliability (intraclass correlations) and practice effects in DalCAB performance 24-h after baseline for healthy young adults (n = 96, 18-31 years). Performance on the DalCAB tasks demonstrated Good to Very Good test-retest reliability for mean reaction time, while accuracy and difference measures (e.g., switch costs, interference effects, and working memory load effects) were most reliable for tasks that require more extensive cognitive processing (e.g., choice reaction time, flanker, dual task, and conjunction search). Practice effects were common and pronounced at the 24-h interval. In addition, performance related to specific within-task parameters of the DalCAB sub-tests provides preliminary support for future formal assessment of the convergent validity of our interpretation of the DalCAB as a potential clinical and research assessment tool for measuring aspects of attention related to the alerting, orienting, and executive control networks.

  3. Measuring the performance of attention networks with the Dalhousie Computerized Attention Battery (DalCAB: Methodology and reliability in healthy adults

    Directory of Open Access Journals (Sweden)

    Stephanie Anne Holland Jones

    2016-06-01

    Full Text Available Attention is an important, multifaceted cognitive domain that has been linked to three distinct, yet interacting, networks: alerting, orienting, and executive control. The measurement of attention and deficits of attention within these networks is critical to the assessment of many neurological and psychiatric conditions in both research and clinical settings. The Dalhousie Computerized Attention Battery (DalCAB was created to assess attentional functions related to the three attention networks using a range of tasks including: simple reaction time, go/no-go, choice reaction time, dual task, flanker, item and location working memory and visual search. The current study provides preliminary normative data, test-retest reliability (intraclass correlations and practice effects in DalCAB performance 24-hours after baseline for healthy young adults (n = 96, 18-31 years. Performance on the DalCAB tasks demonstrated Good to Excellent test-retest reliability for mean reaction time, while accuracy and difference measures (e.g., switch costs, interference effects and working memory load effects were most reliable for tasks that require more extensive cognitive processing (e.g., choice reaction time, flanker, dual task, and conjunction search. Practice effects were common and pronounced at the 24-hour interval. In addition, performance related to specific within-task parameters of the DalCAB sub-tests provides preliminary support for future formal assessment of the convergent validity of our interpretation of the DalCAB as a potential clinical and research assessment tool for measuring aspects of attention related to the alerting, orienting and executive control networks.Keywords: computerized assessment; attention; orienting; alerting; executive function

  4. La segnalazione dei danni provocati dal terremoto attraverso modalità innovative: Web 2.0 e crowdsourcing

    Directory of Open Access Journals (Sweden)

    Alessandro Prunesti

    2013-03-01

    Full Text Available La sequenza sismica verificatasi in Emilia Romagna, Lombardia e Veneto a partire dal Maggio 2012, culminata con ledue tragiche scosse del 20 e 29 maggio, ha provocato 27 morti, 350 feriti e 16.000 senzatetto. Sono stati finora valutatidanni per 13,2 miliardi di Euro. Abstract A seismic sequence occurred in Emilia Romagna, Lombardia and Veneto regions since May 2012. The culminating events were two tragic mainshocks on May 20th and May 29th, resulting in 27 dead, 350 injuried and over 16,000 homeless. As of this writing, a total damage of 13.2 billion euros was assessed. Unfortunately, catastrophic consequences of earthquakes are not uncommon in Italy. The 2012 seismic sequence was one among the first cases in which social network and communication technologies were used to convey information about tragedy and to support rescue operations as well as self-organization of affected communities.

  5. Preservation status and priorities for in situ monitoring of the weapon sacrifice in Illerup Ådal, Denmark

    DEFF Research Database (Denmark)

    Tjellden, Anna Katarina Ejgreen; Kristiansen, Søren Munch; Botfeldt, Knud B.

    2012-01-01

    Excavations of the southern part of a very rich sacrificial bog in Illerup Ådal, Denmark between 1950 and 1985 recovered approximately 15,000 Iron Age artefacts. At the time, 60% of the area was left unexcavated and thousands of objects are now preserved in situ, but the present preservation status...... has not been investigated for approximately 25 years. Extensive in situ monitoring was carried out for one year in order to present a prioritized plan for further monitoring of the unexcavated areas, producing documentation of groundwater table variations, water quality and vegetation in the area....... Results show that the remaining artefacts in general are well preserved in the waterlogged and anaerobic environment. However, in the north-eastern part of the bog, the groundwater table is too low even in a year when net precipitation and hydrological conditions were near normal. Here, slow, continuous...

  6. Preservation status and priorities for in situ monitoring of the weapon sacrifice in Illerup Ådal, Denmark

    DEFF Research Database (Denmark)

    Tjelldén, A.K.E.; Kristiansen, S.M.; Botfeldt, Knud Bo

    2012-01-01

    Excavations of the southern part of a very rich sacrificial bog in Illerup Ådal, Denmark between 1950 and 1985 recovered approximately 15,000 Iron Age artefacts. At the time, 60 per cent of the area was left unexcavated and thousands of objects are now preserved in situ, but the present preservation...... status has not been investigated for approximately twenty-five years. Extensive in situ monitoring was carried out for one year in order to present a prioritized plan for further monitoring of the unexcavated areas, producing documentation of groundwater table variations, water quality and vegetation...... in the area. Results show that the remaining artefacts are generally well preserved in a waterlogged and anaerobic environment. However, in the north-eastern part of the bog, the groundwater table is too low even in a year when net precipitation and hydrological conditions were near normal. In the centre...

  7. Calculation of Co2 emissions from the italian energy system; Calcolo delle emissioni di CO2 dal settore energetico italiano. 1990-2000. Metodo di riferimento IPCC

    Energy Technology Data Exchange (ETDEWEB)

    Contaldi, M. [Agenzia Nazionale per la Protezione dell' Ambiente, Rome (Italy); La Motta, S. [ENEA, Funzione Centrale Studi, Centro Ricerche Casaccia, Rome (Italy)

    2001-07-01

    The calculation of Co2 emissions from the Italian energy system is the object of this work. The inventory method used is the Reference Approach from the Intergovernmental Panel for Climate Change (IPCC, 1996 revised Guidelines for National Greenhouse Gas Inventories) and the energy consumption data are taken from the Italian Energy Balance edited by the Ministry of Industry. The years analysed are those from 1990 to 2000. [Italian] Lo scopo di questo lavoro e' quello di contabilizzare le emissioni di CO2 provenienti dal settore energetico per fonte di utilizzo dell'energia, a partire direttamente dal Bilancio Energetico Nazionale (Bilancio Energetico Nazionale, BEN, a cura del Ministero Industria, Commercio ed Artigianato) ed applicando all'Italia la metodologia di riferimento per il calcolo delle emissioni della CO2 elaborata dall'Intergovernmental Panel for Climate Change (IPCC, 1996 revised Guidelines for National Greenhouse Gas Inventories). Gli anni presi in considerazione in queto lavoro sono quelli dal 1990 al 2000.

  8. Insect emergence in relation to floods in wet meadows and swamps in the River Dalälven floodplain.

    Science.gov (United States)

    Vinnersten, T Z Persson; Östman, Ö; Schäfer, M L; Lundström, J O

    2014-08-01

    Annual variation in flood frequency and hydroperiod during the vegetation season has ecological impacts on the floodplain biota. Although many insect groups may have a lower emergence during a flood event, it is poorly known how annual emergence of insects in temporary wetlands is related to the variation in hydrology. Between May and September, we studied the weekly emergence of 18 insect taxa over six consecutive years, 2002-2007, in six temporary flooded wetlands (four wet meadows and two forest swamps) in the River Dalälven floodplains, Central Sweden. We used emergence traps to collect emerging insects from terrestrial and aquatic parts of wet meadows and swamp forests. In all wetlands, the insect fauna was numerically dominated by the orders Diptera, Hymenoptera, Coleoptera and Homoptera. On a weekly basis, 9 out of the 18 insect taxa had lower emergence in weeks with flood than in weeks with no flood, whereas no taxon had a higher emergence in weeks with flood. Over the seasons, we related insect emergence to seasonal flood frequency and length of hydroperiod. The emergence of most studied taxa decreased with increasing hydroperiod, which suggests that emergence after floods do not compensate for the reduced emergence during floods. Only Culicidae and the aquatic Chironomidae sub-families Tanypodinae and Chironominae showed an increase in emergence with increasing hydroperiod, whereas Staphylinidae peaked at intermediate hydroperiod. We conclude that a hydroperiod covering up to 40% of the vegetation season has a significant negative effect on the emergence of most taxa and that only a few taxa occurring in the temporary wetlands are actually favoured by a flood regime with recurrent and unpredictable floods.

  9. Aspetti deontologici e giuridici della Responsabilità professionale del chirurgo in Italia. Evoluzione storica a partire dal '900.

    Science.gov (United States)

    Picardi, Nicola

    2018-01-01

    È pleonastico ricordare che ogni individuo raziocinante delle essere responsabile delle sue azioni: deve agire con la coscienza degli scopi che si propone evitando possibili conseguenze negative dei suoi atti. In ambito medico questo tipo di responsabilità è codificata con le norme della "deontologia". Per secoli l'arte terapeutica è stata praticata da individui dotati di una particolare vocazione ed una particolare cultura acquisita da Maestri dell'arte ancor prima che dalla propria esperienza, con nozioni di erboristeria e di elementari conoscenze anatomiche e di fisiologia, circondati da un'aura sacerdotale e da un rispetto derivante dal timore e dall'ammirazione per il coraggio e auspicabilmente dai successi, e facendo riferimento nell'occidente mediterraneo alle regole operative fissate nel Giuramento di Ippocrate, di significato tra il sacro ed il deontologico. Lo sviluppo delle tecniche anestesiologiche a partire dalla seconda metà dell'800 ha determinato l'ampliamento delle iniziative chirurgiche di tipo elettivo, a fianco con gli storici interventi in emergenza per la cura di lesioni traumatiche, ancor prima delle acquisizioni riguardanti le infezioni. Con l'espansione del campo di azione della chirurgia, le possibili complicanze ed i possibili insuccessi hanno fatto da contrappeso ai sentimenti di rispetto e di fiducia nei confronti dei chirurghi, giungendo a far assimilare in tali casi la loro opera quale causa all'origine di danni, provocati rientrando quindi nella categoria dei reati sottoposti alla Legge penale. Così, al termine deontologico di "responsabilità" valido per ogni iniziativa ed ogni professione, per i medici è venuto ad associarsi la qualifica di "professionale", con un significato di presunta colpevolezza. Da una parte le regole deontologiche si sono ampliate, ed hanno coinvolto direttamente il paziente nella fase decisionale delle terapie chirurgiche, formalizzate programmaticamente in moderni codici deontologici ed

  10. Geographical information system for radon gas from soil measurement; Il sistema informativo territoriale per la valutazione del potenziale di esalazione di radon dal suolo

    Energy Technology Data Exchange (ETDEWEB)

    Orlando, P.; Amici, M.; Altieri, A.; Massari, P.; Miccadei, E.; Onofri, A.; Orlando, C.; Paolelli, C.; Paron, P.; Perticaroli, P.; Piacentini, T.; Silvestri, C. [Milan Univ. Sacro Cuore, Milan (Italy). Servizio Centralizzato Radioisotopi; Belli, M.; Marchetti, A.; Petrocchi, A.; Rosamilia, S.; Serva, L.; Singh, G.; Tommasino, L. [Agenzia Nazionale per la Protezione dell' Ambiente, Rome (Italy); Minach, L.; Verdi, L. [Agenzia Provinciale per la Protezione dell' Ambiente, Bolzano (Italy); Bertolo, A.; Trotti, F. [Agenzia Regionale per la Protezione dell' Ambiente, Regione Veneto (Italy)

    2000-07-01

    The working program foresees the realization of an geographical information system for the check in field of the geological parameters and determination of uranium and radium contents in various type of rocks. It is here also pointed out a measuring method for radon concentration in soil. [Italian] In questo documento viene presentato il lavoro svolto fino ad oggi: dalla definizione dei parametri geologici ritenuti piu' significativi per la presenza di radon nel suolo e dalle misure in campo e in laboratorio, fino alla realizzazione del Sistema Informativo Territoriale (SIT) per la gestione dei suddetti parametri. Nel primo capitolo sono descritte le caratteristiche del radon, dal punto di vista chimico-fisico e geologico, per introdurre i criteri adottati nella scelta dei paramentri geologici e del loro peso per la valutazione del PERS (Potenziale di Esalazione Radon dal Suolo). Il secondo capitolo descrive il progetto in generale, mentre i successivi capitoli descrivono piu' in dettaglio la parte informatica e quella delle indagini sperimentali.

  11. Müzik Eğitimi Anabilim Dalı Öğrencilerinin Zaman Yönetimi Becerileri/The Time Management Skills of Music Education Students

    OpenAIRE

    Babacan, Yrd.Doç.Dr.Ezgi; Küçükosmanoğlu, Dr.Hayrettin Onur

    2015-01-01

    ÖZETBu araştırmanın amacı müzik eğitimi anabilim dalı öğrencilerinin zaman yönetimi becerilerini belirlemek ve bu becerilerin cinsiyet, yaş, sınıf ve bireysel çalgılarına göre değişkenlik gösterip göstermediğini saptamaktır. Araştırmada ilişkisel tarama modeli kullanılmıştır. Araştırmanın örneklemini 2014–2015 eğitim-öğretim yılında Necmettin Erbakan Üniversitesi A.K.E.F. Müzik Eğimi Anabilim Dalı'nda öğrenimine devam eden 128 öğrenci oluşturmaktadır. Verilerin toplanmasında Britton ve T...

  12. Dal caos... alla coscienza

    CERN Document Server

    Prattico, Franco

    1989-01-01

    Attraverso i domini della fisica, della genetica e della biologia, fino alle neuroscienze, alla ricerca dei percorsi che hanno portato alla nascita del cervello umano : frutto di una singolare serie casuale o di una necessità inscritta nelle leggi del Cosmo?

  13. dal pildis

    Index Scriptorium Estoniae

    2004-01-01

    Kabala laulupäevast 31. juulil. Juuli lõpul osales üle Lõuna-Järvamaa veerandsada 1.-10. klassi õpilast käsitöö ja muusikalaagris "Käsa-Musa" Õisu lasteaias, kus õpiti laule Tea Saare juhendamisel

  14. Muusikamaailm : Sibeliuse nädal Järvenpääl. Enescu festival Bukarestis. Ukraina tagastab käsikirjad. Nello Santi 70. Gina Cigna lahkus kõrges eas / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Järvenpääl toimus Sibeliuse nädal. Bukarestis toimus George Enescu festival. Ukraina valitsuse otsusega tagastatakse Berliini Gesangsakademie'le nende fondides olnud hulk käsikirjalis Nimekas itaalia ooperidirigent Nello Santi sai 70. Itaalia päritolu prantsuse ooperilaulja Gina Cigna suri 101 aastasena

  15. L' influenza nella regione Lazio dal 1999 al 2003: casi di sindrome influenzale, ricoveri ospedalieri per malattie respiratorie e coperture vaccinali

    Directory of Open Access Journals (Sweden)

    A. Pasquarella

    2003-05-01

    Full Text Available

    Obiettivi: 1 Descrivere l’andamento dei ricoveri ospedalieri per patologie respiratorie acute e croniche concomitanti alle epidemie stagionali da virus influenzale dal 1999 al 2003, in relazione con la segnalazione dei casi di sindrome influenzale (ILI da parte dei medici sentinella. 2 Misurare l’eccesso dell’ospedalizzazione influenza-correlata nelle diverse fasce di età rispetto ai periodi non epidemici. 3 Analizzare le modificazioni del ricorso al ricovero ospedaliero in relazione al tasso di copertura della vaccinazione antinfluenzale nella popolazione anziana, su scala regionale e nelle diverse ASL.

    Metodi: sono stati estratti dal Sistema Informativo
    Ospedaliero i ricoveri per patologie respiratorie
    influenza-correlate (codici ICD9-CM: 480-487; 460-
    466; 490-496 relativi agli anni 1999-2003.
    L’incidenza di ILI è stata stimata sulla base delle
    segnalazioni dei medici sentinella afferenti alla
    rete FLU-ISS dell’Istituto Superiore di Sanità.

    Per il calcolo dei tassi di copertura è stato utilizzato l’archivio
    nominativo dei soggetti vaccinati contro l’influenza,
    attivo nella regione Lazio dal 1999. Nel periodo considerato sono stati messi in relazione i tassi di ospedalizzazione età-specifici, le incidenze di ILI e le coperture vaccinali. L’eccesso di ospedalizzazione è stato misurato confrontando i tassi relativi ai periodi epidemici e non epidemici.

    Risultati: i tassi di ospedalizzazione per malattie respiratorie sono risultati costantemente superiori nei periodi di maggiore circolazione virale, in particolare negli ultrasessantaquattrenni. Con il progressivo aumento del tasso di copertura vaccinale regionale (da circa il 25% della stagione 1999-2000 a oltre il 60% della stagione 2002-2003 non si è registrata una corrispondente diminuzione dei ricoveri ospedalieri per patologie influenza-correlate.
    L

  16. Antiteatrodocumentário: Verdade e ficção em Conversas com meu pai, de Janaína Leite e Alexandre Dal Farra

    Directory of Open Access Journals (Sweden)

    Artur Kon

    2017-12-01

    Full Text Available O ensaio pretende investigar o modo pelo qual classificações como “teatro documentário” ou “teatros do real”, muito em voga nas recentes discussões teóricas sobre a cena contemporânea, são colocados em questão, desconstruídos e ampliados pelo espetáculo paulistano Conversas com meu pai, de 2014, parceria da atriz Janaína Leite com o dramaturgo Alexandre Dal Farra. Para tal, o autor se apoia em reflexões de Jacques Rancière, Georges Didi-Huberman e Hans-Thies Lehmann sobre os encontros e separações entre arte e realidade.

  17. La passió pel real i la reacció contra la metàfora en la poètica de Salvador Dalí

    Directory of Open Access Journals (Sweden)

    Vicent Santamaria de Mingo

    2014-09-01

    Full Text Available Between 1927 and 1937, Dalí was author of a remarkable work of poetry simultaneous to his paintings. This article attempts at analysing the theoretical corpus in which his work is based on. Dali’s ideas about poetry were always determined by the same objectivist ambition and a permanent interest in reality, in convergence with scientific research. Against the cunning arguments the painter ascribes to metaphorical processes, it will be imposed, at first, the knowledge of the outside world, thanks to Bergson and, later, the investigation of the internal world due to Freud’s sponsorship, as a result of the incorporation of Surrealism. In the last analysis, this article aims at being an innovative approach to Dali’s poetry from the theory of knowledge.

  18. The structural evolution of the Dialé-Daléma basin, Kédougou-Kéniéba Inlier, eastern Senegal

    Science.gov (United States)

    Diatta, Famara; Ndiaye, Papa Moussa; Diène, Mahamadane; Amponsah, Prince Ofori; Ganne, Jérôme

    2017-05-01

    The Dialé-Daléma group is located in the eastern part of the Kédougou-Kenieba Inlier (KKI) and is essentially composed of Paleoproterozoic rock formations. Lithostructural studies in this area, hassuggested, often controversial, deformational regimes and geodynamic evolution models. In this study, we suggest the existence of an initial tangential D1 deformation and transpressional D2 deformational phases. D1 is characterized by an initial metamorphic schistosity denoted as S1 and by F1 folds with the main shortening stress direction generally oriented in NW-SE direction. D2 in the study area is divided into two stages. The first stage designated as D2a is coaxial and compressive in nature. It is characterized by a N-S to NNE-SSW trending metamorphic schistosity termed S2a. The D2a phase evolves gradually to a transcurrent phase connoted as D2b and characterized by a NNE-SSW S2b metamorphic schistosity which is axial planar to the F2b folds with subvertical fold axes. During the D2 phase, the main shortening stress direction rotates gradually in a clockwise motion from an E-W to a NW-SE direction within a continuum of deformation. The third deformation phase D3 in the Dialé-Daléma basin, is also divided into two stages, thus D3a and D3b. D3a is transcurrent and transtensive in nature and is characterized by NE-SW sinistral shear corridors with local extensional jogs. During this deformation stage, the maximum shortening stress (σ1) direction acts in a N-S direction and rotate to a NE-SW direction, thereby creating a N-S transcurrent dextral shear corridors. D3b component of the D3 deformation is compressive in nature with a weak sinistral shear component. The D4 corresponds to a N-S extensional phase which is characterized by E-W directed normal faults. D4 in the study area denotes the final stage of the evolution of the Eburnean orogeny in the KKI.

  19. Muusikamaailm : Gaudeamuse muusikanädal Amsterdamis. The Last Night of the Prom"s. Uusaastakontsert tuleb Uus-Meremaalt. Baieri Riigiooperi orkestri Euroopa reis. Kimanen jääb aastaks eemale Kuhmost / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    12. sept. lõppes Amsterdamis Gaudeamuse rahvusvaheline muusikanädal "Surprising New Sounds". Promenaadikontserdid Londoni Royal Albert Hallis (16.07-11.09) lõppesid suure lõppkontserdiga. Traditsioonilise uusaastakontserdi asemel Viinis kantakse sel aastavahetusel üle kontsert Uus-Meremaalt Gisborne"ist. Seoses R. Straussi mälestusaastapäevaga toimus Baieri Riigiooperi orkestri ringreis Euroopas. 30 aastat Kuhmo kammermuusikafestivali juhtinud S. Kimanen võtab aasta puhkust

  20. The DAL10 gene from Norway spruce (Picea abies) belongs to a potentially gymnosperm-specific subclass of MADS-box genes and is specifically active in seed cones and pollen cones.

    Science.gov (United States)

    Carlsbecker, Annelie; Sundström, Jens; Tandre, Karolina; Englund, Marie; Kvarnheden, Anders; Johanson, Urban; Engström, Peter

    2003-01-01

    Transcription factors encoded by different members of the MADS-box gene family have evolved central roles in the regulation of reproductive organ development in the flowering plants, the angiosperms. Development of the stamens and carpels, the pollen- and seed-bearing organs, involves the B- and C-organ-identity MADS-box genes. B- and C-type gene orthologs with activities specifically in developing pollen- and seed-bearing organs are also present in the distantly related gymnosperms: the conifers and the gnetophytes. We now report on the characterization of DAL10, a novel MADS-box gene from the conifer Norway spruce, which unlike the B- and C-type conifer genes shows no distinct orthology relationship to any angiosperm gene or clade in phylogenetic analyses. Like the B- and C-type genes, it is active specifically in developing pollen cones and seed cones. In situ RNA localization experiments show DAL10 to be expressed in the cone axis, which carry the microsporophylls of the young pollen cone. In contrast, in the seed cone it is expressed both in the cone axis and in the bracts, which subtend the ovuliferous scales. Expression data and the phenotype of transgenic Arabidopsis plants expressing DAL10 suggest that the gene may act upstream to or in concert with the B- and C-type genes in the establishment of reproductive identity of developing cones.

  1. L'autografia d'autore Cambiamenti nella realizzazione e nella concezione del libro dal XII secolo all'invenzione della stampa

    Directory of Open Access Journals (Sweden)

    Micol Long

    2012-06-01

    Full Text Available Si ritiene a volte che l'invenzione della stampa abbia innescato il cambiamento nel modo di concepire l'oggetto libro, segnando il passaggio dall'idea medievale a quella moderna. Occorre però tenere presente che esiste un'importante evoluzione interna al medioevo e che l'invenzione della stampa, per quanto fondamentale, è da inserire all'interno di questo processo più ampio, che a partire dal XII secolo circa trasforma l'uso e la funzione stessa della scrittura, rivoluziona il modo di leggere e di conseguenza il libro stesso, sia concettualmente sia come oggetto fisico. L'approccio scelto per questo studio mira a risalire alle radici culturali dei cambiamenti nelle pratiche del lavoro intellettuale e, viceversa, a indagare se e come tali cambiamenti abbiano potuto influenzare, attraverso le opere stesse, la cultura dell'epoca. Il fenomeno oggetto specifico dell'indagine è l'autografia letteraria d'autore che, eccezionale nell'alto medioevo, è testimoniata da una nuova e ininterrotta serie di casi a partire dall'XI-XII secolo, per poi diffondersi nei secoli successivi. Il panorama culturale della fine del medioevo appare dunque caratterizzato dalla tensione tra una ricorrente aspirazione all'individualizzazione del rapporto tra l'autore e il suo testo, che si realizzava in un modello di produzione libraria basato su uno stretto controllo dell'autore sul prodotto finale, dal punto di vista sia filologico-testuale sia grafico e materiale, e l'opposta tendenza all'allentamento del controllo dell'autore sulla propria opera, come naturale conseguenza di una sempre più vasta circolazione dei testi ma anche di una diversa concezione del ruolo autoriale. It is generally believed that the invention of printing triggered a cultural change, marking the passage between the medieval idea of the book and the modern one. It should be noted, though, that there was an important evolution through the Late Middle Ages, and that the printing revolution

  2. KÖPEKLERİN GIDA ALERJİLERİNİN TEDAVİSİNDE STEROİDAL VE NONSTEROİDAL ANTİENFLAMATUVAR İLAÇLARIN KLİNİK ETKİNLİKLERİNİN KARŞILAŞTIRILMASI

    OpenAIRE

    Maden, Mehmet; Sevinç, Mutlu; Or, Erman

    1997-01-01

    Bu araştırmanın amacı, gıda alerıısinın tedavisınde steroidal ve nonsteroıdal antıenflamatuvar ilaçların klınik et­kinli�ının karşılaştırılmasıdır. Bu amaçla 11'i steroid. 13'0 nonsteroid antlenflamatuvar ilaç uygulanan gruplarda olmak uzere toplam 24 gıda alerjilı köpek kullanıldı. Köpekların tedavı öncesi klinik muayeneleri yapıldı, tüm köpekların yaş, ırk ve cınsıyelleri ile deri lazyonların ın (kaşıntı, alopesı. erıtem. hıperpıgmentasyon, papüller, püstüller. kabuklanma, sa­borh...

  3. Ageltrude: dal ducato di Spoleto al cuore del regno italico Ageltrude: from the Duchy of Spoleto to the heart of the Italic Kingdom

    Directory of Open Access Journals (Sweden)

    Paola Guglielmotti

    2012-10-01

    Full Text Available

    La vicenda patrimoniale di Ageltrude, che proviene dai duchi di Benevento ed è moglie del primo imperatore non carolingio in Italia, è documentariamente piuttosto accidentata ed è ricostruibile nella sua articolazione soppesando un gran numero di informazioni. Ageltrude può gestire il dotario costituitole con beni fiscali da Guido, dei duchi di Spoleto, e dal figlio Lamberto per un tempo veramente breve e in una fase particolarmente conflittuale, quale è l’ultimo decennio del secolo IX. Tuttavia, se si osservano le potenzialità insite nella gestione di beni fiscali, si può constatare che il pur sostanzioso dotario nella città di Pavia risulta troppo concentrato per poter essere usato quale trampolino per una politica di consolidamento e di attivazione di relazioni. Tale funzione è assolta piuttosto da altri beni sparsi trasmessi ad Ageltrude e soprattutto dall’immissione in un sistema di relazioni di cui si  è in grado di apprezzare solo qualche spezzone. L’ex imperatrice persegue strenuamente un progetto, avviato da Guido e Lamberto, che è sia di consolidamento personale sia di appoggio al fronte che si oppone all’imperatore Berengario.

    The events surrounding the administration of the patrimony of Ageltrude, member of the house of Benevento and wife of the first non Carolingian emperor in Italy, is uneven from a documentary perspective and can thus be reconstructed in its articulations only by weighing large quantities of information. Ageltrude could administrate her dower composed of fiscal goods bestowed by Guido, of the dukes of Spoleto, and by her son Lambert, for a very brief period of time and during a particularly conflict-ridden phase such as the last decade of the 9th century. Yet, if one observes the potential inherent in the administration of fiscal goods, it can be noted that despite the presence of substantial property in Pavia, this patrimony is far too concentrated to be used as a

  4. O uso de pinturas de Dalí como ferramenta para avaliação das alterações na percepção de forma e tamanho em pacientes esquizofrênicos

    Directory of Open Access Journals (Sweden)

    Maria Lúcia de Bustamante Simas

    2011-01-01

    Full Text Available Estudos envolvendo portadores de esquizofrenia têm mostrado alterações severas da percepção e cognição. A maioria dos diagnósticos, entretanto, é baseada na avaliação de processos cognitivos. Nossos estudos investigaram a percepção alterada de forma e tamanho em pacientes com esquizofrenia e com depressão maior utilizando 24 pinturas de Salvador Dalí. Conduzimos dois estudos comparando grupos experimental e controle e observamos, em ambos os casos, que os portadores de esquizofrenia perceberam figuras 1,5 e 3,0 vezes maior do que os respectivos grupos controle. Em outro estudo com pacientes com depressão maior não foram observadas alterações na percepção de tamanho comparado ao grupo controle. Concluímos que este efeito de percepção de forma e tamanho alterados pode servir como marcador no diagnóstico precoce da presença de sintomas positivos na esquizofrenia. Sugerimos que estas pinturas de Salvador Dalí sejam utilizadas como ferramenta para avaliar alterações na percepção de formas e tamanhos em pacientes portadores de esquizofrenia e, assim, prevenir o agravamento dos sintomas cognitivos.

  5. Il cervello dal di dentro

    Directory of Open Access Journals (Sweden)

    di Porzio Umberto

    2011-06-01

    Full Text Available The functional magnetic resonance imaging (fMRI techniques are a potent probe able to visualize brain functions, by analyzing modification of blood oxygenation, and see the action in specific brain areas in response to activity or thoughts. fMRI thus promise to be a formidable tool not only to draw a new cartography of brain functional areas, but also a new tool to understand some aspects of brain function’s evolution, as well to get insights and to breach the wall into cognition, morality and consciousness. Nevertheless fMRI is not deprived of pitfalls such as limitation in spatial accuracy, reliable reproducibility of brain scan amongst different individuals or in the same person at different stages of life ( age or health versus disease, the different time scale of fMRI measurements (seconds and neuron’s action potentials (milliseconds. Thus often caution is required in the appreciation of fMRI results and conclusions, that could lead to incorrect interpretation of brain signals and induce to draw spurious conclusions. New applications combining fMRI and real time visualization of one's own brain activity in healthy volunteers or patients promise to enable individuals to modify brain response and thus therapeutically or with other goals intervene in modifying individual behaviors. Specially this last aspect, as well as the concern about the confidentiality and storage of sensible information or forensic uses of such approaches, raises the problem of mind privacy and new ethical questions.

  6. Sul rientro dal debito pubblico

    Directory of Open Access Journals (Sweden)

    Francesco Carlucci

    2012-06-01

    Full Text Available A theoretical model is developed for the ratio primary-surplus/GDP that a Country has to attain over a given number of years, to lower its public debt from the present value to one a-priori fixed. Such a ratio depends on the average interest rate paid on the outstanding stock of debt as well as inflation and real growth rates. The ratio primary-surplus/GDP is then determined for Germany, Greece and Italy, supposing that 20 years are necessary for lowering the debt to 60% of GDP, as indicated in the Budget Pact approved by 25 EU member States. Results are reported in graphs and show how the German debt can be easily diminished, whilst debts in Greece and Italy can be reduced with a greater difficulty.

  7. Pop nädal

    Index Scriptorium Estoniae

    2002-01-01

    21. okt müügile saabuvast singlist "Tom Jones International". 31. okt. Saku Suurhallis oma maailmatuuri "Too Close For Comfort" raames esinevast austraalia poplauljast Darren Hayesist. Oasise algkoosseisu trummar Tony Mc Caroll kirjutab raamatut. Robi Williamsi eraelust

  8. Reading Intermediality: Lorca’s Viaje a la luna (“Journey to the Moon,” 1929 and Un chien andalou (Buñuel/Dalí, 1929

    Directory of Open Access Journals (Sweden)

    Paul Julian Smith

    2014-10-01

    Full Text Available This article will treat two experimental short films, the first one of the most famous in cinema history; the second a little known script, lost for many years and brought to the screen only sixty years after it was written. The former is Un chien andalou of 1929, generally attributed to both director Luis Buñuel and Catalan painter Salvador Dalí (who claims first screenwriting credit in the film itself. The latter is Viaje a la luna, written also in 1929 by poet and dramatist Federico García Lorca and filmed by Frederic Amat, a contemporary Catalan painter, in 1998, the centenary of Lorca’s birth. Normal 0 false false false EN-US JA X-NONE

  9. ОНІРИЧНИЙ ХРОНОТОП РОМАНУ ВОЛОДИМИРА ЄШКІЛЄВА «ІМПЕРАТОР ПОВЕНІ» ЯК ПРИКЛАД ПОСТМОДЕРНОЇ ГРИ / ONEIRIC CHRONOPOTOPE OF THE NOVEL «THE EMPEROR OF FLOOD» BY VOLODYMYR YESHKILIEV AS THE EXAMPLE OF A POSTMODERN GAME

    Directory of Open Access Journals (Sweden)

    Богдан СТРІЛЬЧИК

    2017-09-01

    рнистской прозы. Ключевые слова: хронотоп, онирика, постмодерн, мультивселенная, психоанализ. Strilchyk Bohdan. Oneiric chronopotope of the novel «The Emperor of Flood» by Volodymyr Yeshkiliev as the example of a postmodern game. The article observes theoretical and practical aspects of constructing oneiric-based fiction realities in the novel «Flood emperor» by Volodymyr Yeshkilev. Relying on the contemporary literary studies about postmodern in Ukrainian literature (Kharchuk, oneiric discourse of contemporary prose (Lazarenko, Kosheluk and Volodymyr Yeshkilev’s creative method (Holnyk we have offered a hypothesis of the necessity of studying the novel The Emperor of Flood in the context of oneiric analysis. Analyzing subconscious phenomena with psychoanalytic (Jung and ideological (Zizek methods and literary analysis we have explicited the terms «oneiric», «oneiric chronotope», and «fiction machine» and formed combinatory approach to oneiric layer of the text. The author suggests considering the novel as a postmodern game and differentiating oneiric chronotope itself («Opadlo» locus and other alternative worlds from dream layer which stylizes the text. The elements of postmodern stylisation were extracted from the whole oneiric layer of the novel. We have also made the anal- ysis of the author’s cinematographic style of «breaking the fourth wall» which is realized in Yeshkilev’s almost direct quoting of literary (Bakhtin’s statements about time and space in the novel are present in the text of The Emperor of Flood itself as ontological characteristics of the topos, theoretico-literary (Borges’s idea of «4 main cycles» forms the ontology of the novel and philosophical (Nietzsche’s concept of the eternal return makes the main time-and-space law of the artistic world ideas. In addition oneiric traits characteristic for the locus Opadlo that make object of direct psychoanalytical

  10. Volodymyr Vynnychenko about spiritual crisis of the society as a result of person’s evening out

    Directory of Open Access Journals (Sweden)

    Lyudmyla G. Pavlyshyn

    2016-01-01

    Full Text Available In the article explored V.Vynnychenko’s views on a state of the a society, analyzed the causes of the decline of the spiritual of a man, founded a ways of overcoming disharmony of the individual. The author discovers the common views of the representatives of nonclassical period of philosophy such as V.Vynnychenko, F.Nietzsche, M. Heidegger, S.Kirkegard. The key problems associated with human leveling, seen from the perspective of the ratio of general and individual, external and internal. The study analyzed the human attitude towards the problem of life and death, eternal and finite as immutable attributes that cause to ponder the meaning of life, happiness, etc., demonstrated the specifical points of view of thinkers concerning the overcoming of human’s disharmony. In his works V.Vynnychenko usually reflects the inner world of characters, as much as possible he tries to show the psychology of a man, her attitude toward a life and death, good and evil, reflections on the essence of the human being. Focusing on the problem of a human destination in the world Vynnychenko proves that a human does not go blindly for her fate, has the right to choose, struggle and death. At the heart of his philosophical and ethical worldview – disobedience of a human, her resistance to life’s difficulties.

  11. From petroleum to natural gas. New assets in electric power industry; Dal petrolio al gas naturale. Nuovi assetti e linee di sviluppo nel settore dell'energia elettrica

    Energy Technology Data Exchange (ETDEWEB)

    Velona' , F. [Bari Politecnico, Bari (Italy). Centrali Termiche della Facolta' di Ingegneria

    2002-02-01

    Luigi Einaudi Foundation Group organized on November 5th 2001 a roundtable on the theme: Energy in Italy, how to change for surviving. In the congress hall in the National Federation of Italian Press, Valerio Zanone, the president, and other important persons such as Jan Keppler (Associazione Italiana Editori), Edgardo Curcio (Associazione Italiana Economisti dell'Energia), Emilio Gerelli (Pavia University) and Franco Velona' (Bari Politecnico) presented their relations on the theme of competitivity in the italian energy system, on the environmental compatibility and on the diversification sources from petroleum. Among the most interesting ones were those by ing. Machi', president of Gestore Rete Trasmissione Nazionale, by ing. Clavarino, president of Assocarboni, and by ing. Serena, president of Sondel. It seemed that the dialogue between the academies and the production system was taken again successfully. [Italian] La fondazione Luigi Einaudi ha organizzato il 5 novembre 2001 una giornata di studio sul tema L'Energia in Italia, Cambiare per sopravvivere. Nella bella sala convegni della Federazione nazionale della stampa italiana in Roma si sono succeduti dopo l'introduzione del Presidente della Federazione, Valerio Zanone, Jan Keppler dell'AIE, Edgardo Curcio dell'AIEE, Emilio Gerelli dell'Universita' di Pavia e Franco Velona' del Politecnico di Bari, che hanno introdotto le discussioni sulla competitivita' del sistema energetico italiano, sulla compatibilita' ambientale sulla diversificazione dal petrolio. Fra i numerosi interventi, di particolare importanza sono stati quelli dell'in. S. Machi', presidente del Grtn, dell'ing. Clavarino, presidente dell'Assocarboni, dell'ing. Serena della Sondel. Ha concluso i lavori Marcello Inghilesi, che ha ripreso i punti di vista piu' salienti espressi dalle aziende, dai ministeri e dalle associazioni ambientaliste, Il dialogo tra

  12. «Come i Visconti asediaro Pavia». Sieges and military operations around Pavia from 1356 to 1359 «Come i Visconti asediaro Pavia». Assedi e operazioni militari intorno a Pavia dal 1356 al 1359

    Directory of Open Access Journals (Sweden)

    Fabio Romanoni

    2007-12-01

    società pavese, impegnata nell’ultima disperata difesa dell’autonomia municipale, sostenuta dal frate agostiniano Iacopo Bussolari in funzione di predicatore ma anche di leader politico: emergono dunque i dissensi e i contrasti politici tra i cittadini, la loro mobilitazione in armi, ma anche il fuoruscitismo.

  13. Dal Big Bang infiniti universi nascosti

    CERN Multimedia

    Valsecchi, Maria Cristina

    2005-01-01

    The intensity of the gravitational force, the speed with which the universe expands, the electric power of the electron, the speed of the light. That's some fundamental constants, some values which determine the characteristics of the universe surrounding us (½ page)

  14. Disaininädal Stockholmis / Kersti Pikk

    Index Scriptorium Estoniae

    Pikk, Kersti

    2015-01-01

    Stockholmi mööbli- ja valgustimess veebruaris 2015. Tartu Kõrgema Kunstikooli üliõpilaste ja Triin Maripuu looming Greenhouse näitusealal. Näiteid messil eksponeeritud mööblist ja valgustitest

  15. dal Riigikogus / Ramon Loik

    Index Scriptorium Estoniae

    Loik, Ramon

    2003-01-01

    Järg 7.,14.,21. mai, 4.,11.,18. juuni, 24.september, 1.,15.,22.,29. oktoober, 12.,19.,26. november, 10.,17.,24. detsember, 5.,21.,28. jaanuar 2004. a., 4.,18., 25. veebruar, 3.,17.,24. märts, 21., 28. aprill, 12., 19., 26. mai, 9.,16. juuni, 22.,29. sept. lk. 5. Riigikogu töö tutvustus

  16. Dal Big Bang ai buchi neri

    CERN Document Server

    Hawking, Stephen W

    1988-01-01

    "Che cosa sappiamo sull'universo, e come lo sappiamo? Da dove è venuto, e dove sta andando? L'universo ebbe un inizio e, in tal caso cosa c'era prima? Il tempo avrà mai una fine?" Con questi quesiti Stephen Hawking introduce il lettore in una straordinaria avventura: un'emozionante cavalcata nel tempo. L'espansione dell'universo, il principio di indeterminazione, le particelle elementari e le forze della natura, l'origine e la sorte dell'universo, l'unificazione della fisica sono le grandi tappe di questo viaggio indimenticabile. Ma oltre a riassumere le conoscenze tradizionali Hawking illustra le ultime teorie sulla fisica dei buchi neri, il principio antropico, la teoria dell'universo inflazionario, l'universo contenuto in una bolla. Il titolo viene ripubblicato in una nuova veste editoriale, con la copertina che per l'occasione è stata realizzata da Hennie Haworth.

  17. Helsingis tuleb Puccini nädal

    Index Scriptorium Estoniae

    2001-01-01

    Soome Rahvusooper toob !4.-21. jaanuarini 2002 Helsingis lavale G. Puccini ooperid "Tosca", "Boheem", "Tütarlaps Kuldsest L äänest", "Madame Butterfly" ja 18. jaanuaril esietenduva "La Rondine". Lõppeva aasta novembris lavastati Haydni ooper "Orlando Paladino"

  18. Lavoro e mondializzazione: sguardi dal Nord e dal Sud (Ettore Gelpi

    Directory of Open Access Journals (Sweden)

    Georges Bertin

    2004-03-01

    Full Text Available Conosciamo l'influenza considerevole esercitata da Ettore Gelpi. Questo educatore sociale di 'terreno' come egli amava definirsi, esperto dell'UNESCO, docente universitario e, soprattutto, uomo sul campo, ha lasciato una considerevole opera tanto come agitatore di idee quanto come animatore culturale ed educatore, nell' interezza contrassegnata dalla sua capacità di considerare il rapporto dialettico tra i tre poli: pensiero/azione/cultura e che mai cessò di rendere condivisibile in una riflessione con i suoi interlocutori dei cinque continenti.

  19. Fonologia etrusaa fonetiaa toscana, Il problema del sostra­ to, Atti della Giornata di Studi organizzata dal Gruppo Archeo­ logico Colligiano, Colle di Val d'Elsa, 4 aprile 1982; a cura di L. Agostiniani e L. Giannelli, Biblioteca dell' "Archivum Romanicu

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1983-01-01

    Full Text Available Che cosa sia la gorgia tosaana lo sanno probabilmente tutti i cultori della linguistica romanza nel mondo; ed è risaputo anche che, dopo poco meno di un secolo di discussioni, il volume di H. J. Izzo Tuscan and Etruscan, Toronto 1972 sembrò dare il colpo di grazia alla tesi sostratista: "La gorgia etru­sca è morta!" si credette di pater dire, adattando la prima par­te del celebre detto francese. Perciò sorprenderà non poco che, a distanza di dieci anni dal libra di Izzo, si veda risuscitare l'ipotesi dell'origine preromana della gorgia; ossia, che forse si debba dire - continuando il citato detto - "viva la gorgia etrusca!". Si, il richiamo alla nota formula francese non è senza una sua giustificazione, perché l'ipotesi della gorgia etrusca - oltre ad essere sostenuta da una netta minoranza de­ glistudiosi- ci si presenta semmai in una veste nueva. Chi vorrà leggere i contributi nel ricco ed interessante volume che qui recensiamo, potrà convincersi che la discussione sul possi­bile influsso del sostrato etrusco nella gorgia toscana non è per niente esaurita rna continua, con argomenti nuovi basati su ricerche recenti.

  20. Patērētāju uzvedības pētījums par ēdienu piegādes portālu Hungryhouse.co.uk kā e-komercijas dalībnieku.

    OpenAIRE

    Dembovska, Gerda

    2013-01-01

    Darba tēma -patērētāju uzvedības pētījums par ēdienu piegādes portālu Hungryhouse.co.uk kā e-komercijas dalībnieku. Autore apraksta patērētāja uzvedības izpētes un e-komercijas teorētiskos aspektus,analizē uzņēmuma Hungryhouse.co.uk. darbību Lielbritānijā,veic aptauju par Hungryhouse.co.uk.pastāvēšanas iespējām Latvijā. Darba mērķis -pamatojoties uz patērētāju uzvedības un e-komercijas teorētiskām atziņām,kā arī uz iedzīvotāju aptaujas rezultātiem, izpētīt ēdiena piegādes portāla Hungryho...

  1. Soukromé hodiny doučování na středních školách: diagnóza a směry dalšího výzkumu/ Private tutoring lessons in upper-secondary schools: Diagnosis and future research directions

    Directory of Open Access Journals (Sweden)

    Vít Šťastný

    2017-01-01

    Full Text Available Cílem studie je provést „diagnózu“ (poskytnout základní deskriptivní informace o podobě a charakteru soukromých hodin doučování využívaných studenty středních škol, diskutovat jejich implikace pro formální vzdělávací systém a na základě toho navrhnout další možné směry výzkumu. V první části autor vymezuje základní pojmy a přináší informace o soukromých hodinách v komparativní perspektivě. Druhá část popisuje smíšený design výzkumu, který sestával z kvantitativního dotazníkového šetření studentů maturitních ročníků (n = 1265 a kvalitativních hloubkových rozhovorů se soukromými doučujícími (n = 22. Ve třetí části jsou prezentována zjištění týkající se míry využívání soukromých hodin doučování, nejčastěji doučovaných předmětů, organizační formy soukromých hodin, intenzity či poskytovatelů. Výsledky výzkumu naznačují úzkou spojitost soukromých hodin s formálním vzdělávacím systémem. Učitelé běžných škol tvoří významnou skupinu poskytovatelů soukromého doučování a toto zjištění se úzce dotýká otázek učitelské profesní etiky.

  2. Fondamenti di meccanica relativistica redatti dal Prof. E. Persico

    CERN Document Server

    Levi-Civita, T

    1982-01-01

    Evoluzione della meccanica e dell'ottica geometrica, loro subordinazione ad uno schema quadridimensionale secondo Einstein ; le equazioni gravitationali e la relatività generale ; sulla curvatura degli spazi riemanniani a tre dimensioni ; Tullio Regge : il trasporto parallelo di Levi-Civita e sue generalizzazioni.

  3. Dal cosmo immutabile all'universo in evoluzione

    CERN Document Server

    Bergia, Silvio

    1995-01-01

    L'esplorazione dell'universo è una delle più grandi avventure intellettuali dell'ultimo mezzo secolo. Con il suo saggio Bergia vuole ricostruire il senso e il fascino di questa avventura intellettuale, raccontandone gli eventi e i personaggi. La vera rivoluzione concettuale nel modo di concepire l'universo fu il passaggio da una concezione statica a una dinamica dell'universo. Questo è il punto di partenza della cosmologia contemporanea che ha scardinato un intero sistema di concezioni introducendo l'idea dell'evoluzione. Rispetto all'immagine del cosmo immutabile è un vero sovvertimento di valori.

  4. Dal laboratorio all’impresa: l’economia sperimentale

    NARCIS (Netherlands)

    Bucciol, A.; Maggian, V.; Montinari, N.; Piovesan, M.

    2010-01-01

    I recenti contributi della psicologia cognitiva e della neurobiologia hanno permesso di scrivere modelli economici più aderenti alla realtà disegnando regole e istituzioni più efficaci. Grazie ai contributi dell’economia comportamentale e sperimentale, concetti come tentazioni e problemi di

  5. Come ti leggo un palinsesto, e altre storie dal passato

    OpenAIRE

    Salerno, Emanuele

    2016-01-01

    This lecture tells the story of an important medieval palimpsest containing several treatises by Archimedes of Syracuse, hidden under a XIII-century liturgical text. A private project succeeded in the physical restoration of this document and in its study through noninvasive technologies. This is an example of how technology can be exploited for the study and safeguard of our cultural heritage, and gives us the opportunity to show how physical and information technologies can both improve the...

  6. Dal computer crime al computer-related crime

    Directory of Open Access Journals (Sweden)

    Antonio Apruzzese

    2007-04-01

    Full Text Available Nowadays, Digital Identity Theft has become one of the most lucrative illegitimate business. Also known as “phishing”, it consists in unauthorized access to an individual’s personal financial data aiming to capture information relative to on line banking and on line financial services. At the beginning people were the victims of such scams, currently the attention is directed to computer networks. “Pharming” and “keylogging” are some of the latest and utmost sophisticated data processing techniques used by computer crime fraudsters. Latest entries are the “botnets”, herds of infected machines, usually managed by one sole command centre which can determine serious damages to network systems. Botnets have made large scale identity theft much simpler to realize. Organized crime is becoming more and more involved in this new crime world that can easily assure huge profits. The Italian State Police, in order to respond more effectively to this new rising challenge, has created, with the Postal and Communication Police, an agency highly specialized in combating such new phenomenon

  7. Popnädal. Inglismaa TOP 20 Albumid / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Okt. lõpus USAs Brooklyni muusikaakadeemias esiettekandele tulevast ooperist "Woyzeck". 12. nov. müügile saabuvast Bondi-filmi "Die Another Day" soundtrackist (filmi nimiloo esitajaks Madonna). Ansamblite Wu-Tang Clani ja Limp Bizkiti plaanidest anda järgmisel aastal välja oma uued albumid. Ansamblist Bet Shop Boys. 4. nov. müügile saabuvast Justin Timberlake'i sooloalbumist "Justified".

  8. Attivita sismica in italia dal 1953 al 1957

    Directory of Open Access Journals (Sweden)

    M. De Panfilis

    1959-06-01

    Full Text Available molto notevole. In tale periodo, le scosse sismiche di cui abbiamo potutoavere sicura notizia, comprese quelle di leggera e leggerissima intensitàe le repliche dei sismi più importanti, hanno superato di poco il numerodi 400. Invece tale attività si deve considerare piuttosto elevata neiriguardi dell'intensità, poiché 160 delle scosse predette hanno superatoil IV grado della Scala Mercalli. Due di esse, anzi, l'una avvenuta nelGargano nel febbraio 1955 e l'altra nei Monti Volsini, a nord del Lago diBolsena, nel dicembre 1957, raggiunsero nella zona epicentrale un'intensitàquasi rovinosa, fortunatamente senza vittime, ma con danniingenti ai fabbricati.Assai diversamente, poi, si è distribuita l'attività sismica nei singolianni del quinquennio. La minima si è avuta nel 1954 con un totale di52 scosse e la massima

  9. immaginazioni dell'aldilà nella narrativa italiana dal secondo ...

    African Journals Online (AJOL)

    User

    Alla luce di queste considerazioni appare naturale che gli autori presi in considerazione, immaginando l'aldilà nei termini fin qui osservati, riducendo spesso al minimo i confini tra vita e morte, descrivano la condizione dei defunti come uno stato di sradicamento molto simile, se non identico, allo stato di solitudine moderna.

  10. Popnädal. Inglise Top 20 Albumid / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Briti ansamblist Duran Duran. George Harrisoni albumist "Brainwashed". Sloveenia kultusbändi Laibach 7. dets. kontserdist Zagrebis, mis lõpetab ansambli 1997. aastal alustatud maailmatuuri "Jesus Christ Superstar". Saksa ansambli Guano Apesi kolmandast albumist

  11. Pop nädal. Inglise Top 20 Albumid

    Index Scriptorium Estoniae

    2002-01-01

    Brainstormi laulja Renars Kaupers loodab juhtida 2003. a. Eurovisiooni lauluvõistlust Riias. Räppar Ice Cube'i uuest filmist "Barbershop". Ansambli The Stone Roses' taas kokku tulemisest. Michael Jacksoni albumist "Invincible"

  12. Pop nädal. Billboard Top 20 / Jott Laulik

    Index Scriptorium Estoniae

    Laulik, Jott, pseud., 1959-

    2002-01-01

    Okt. lõpus müügile jõudvast filmimuusika kogumikplaadist "The Best Of Bond...James Bond". 18. nov müügile saabuvast Robbie Williamsi uuest albumist "Escapology". 14. okt. müügile saabunud USA action-režissööri Rob Coheni uue filmi "xXx" singlist "Feuer Frei!" ansambli Rammstein esituses ning 21. okt. müügile saabunud "xXx" soundtrack-plaadist. Fatboy Slimi uutest albumitest. Popduo Erasure uuest kauamängivast heliplaadist"Other People's Songs".

  13. Un altare funerario con scena di filatura dal territorio friulano

    OpenAIRE

    Sperti, L.

    2012-01-01

    In this paper I will examine a Roman funerary altar preserved in a church of a town near Tolmezzo (in the Friuli Venezia-Giulia region) that presents in the left side a very unusual motiv, the image of a spinning woman. The classicistic style of this figure recalls the style of a small group of altars in the Archaeological Museum of Aquileia, and shows the continuity of Greek imagery of the Classical period in the Roman funerary monuments of early Imperial age.

  14. Dal mondo del pressappoco all'universo della precisione

    CERN Document Server

    Koyré, Alexandre

    1992-01-01

    I temi affrontati in questo libro da uno dei più autorevoli storici della scienza, Alexandre Koyré, sono oggetto di un vivace interesse da parte della nostra cultura. Koyré discute qui l'origine, la natura e la valutazione delle macchine e degli strumenti scientifici, considerati nei loro riflessi umani e sociali, più ancora che nelle loro caratteristiche tecniche. La sua analisi chiarisce i termini di alcune questioni fondamentali per la storia della tecnologia e della scienza, e del loro rapporto storico; perché ad esempio la scienza greca, scopritrice di fondamentali principi poi applicati trionfalmente dalla fisica moderna, non abbia cercato di tradurli in innovazioni tecniche; perché i notevolissimi ritrovati tecnici delle civiltà orientali e del Medioevo abbiano fallito a questo scopo; perché la rivoluzione scientifica dell'età moderna ci abbia dato col suo concetto dell'esperienza gli strumenti che sono alla base della civiltà industriale; quale sia infine il rapporto tra tecnica e scienza pu...

  15. Pop nädal : Oscarite muusika / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Oscarid said filmi "Sõrmuste isanda" epopöa 1. osa Howard Shore muusika ja Yann Tierseni muusika filmile "Amelie". Heliplaatidest The Lords of the Rings: The Fellowship of the Ring ja Yann Tiersen - Amelie from Montmartre

  16. Dal CAD al GIS: il trasferimento di informazioni cartografiche

    Directory of Open Access Journals (Sweden)

    Andrea Scianna

    2005-10-01

    necessario verificare quali siano le informazioni che rimangono associate agli oggetti della classe al momento del caricamento dei dati, in formato DXF, all’interno di software GIS. Negli ultimi anni a livello internazionale sono state fissate norme tendenti a individuare linee guida per la definizione della struttura del contenuto semantico della cartografia numerica, delle caratteristiche geometriche e delle relazioni topologiche dell’informazione geografica.

  17. Le donne e lo sport dal dopoguerra a oggi

    Directory of Open Access Journals (Sweden)

    Eugenia Porro

    2013-04-01

    Full Text Available La pratica sportiva femminile nell'Italia postbellica appare per alcuni versi un oggetto misterioso, collocandosi all'interno di quelli che fino a qualche anno fa venivano considerati due sotto-universi della sociologia: la sociologia dello sport e la sociologia di genere. È dunque importante analizzare l'evoluzione della pratica sportiva al femminile tenendo conto di variabili diverse sul piano socio-culturale e facendo altresì riferimento al patrimonio statistico di cui si dispone. In questo senso, per una più corretta analisi del fenomeno, si è scelto di differenziare il sistema della prestazione assoluta da quello della prestazione relativa. In tal modo, vengono poste in luce le dinamiche che interessano le politiche di genere, come la rivendicazione di diritti o di riforme sociali che diano impulso alla diffusione della pratica femminile. Insieme, si concentra l’analisi su fenomeni particolarmente rilevanti per il settore sportivo in generale quali la mediatizzazione e la politicizzazione.

  18. Dal calore all'entropia una introduzione alla termodinamica

    CERN Document Server

    Vicentini Missoni, Matilde

    1992-01-01

    Panta rei : processi ed equilibrio ; l'universo termodinamico : l'aspetto processuale ; il punto di vista dei processi come bilancio tra proprietà dell'equilibrio ; il fluire dell'energia ; automobili, frigoriferi e pompe di calore : informazioni tecnologiche ; e allora ? l'entropia ; la termostatica come teoria assiomatica ; la termodinamica dei processi.

  19. Approccio dal basso, servizi alla persona e memorie interculturali

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2003-06-01

    Full Text Available Valorizzare le memorie dei migranti risponde ad una precisa esigenza di riconoscimento, nella storia collettiva e nello spazio politico nazionale, della memoria interculturale di intere collettività ... Queste condizioni implicano l'esigenza del riconoscimento della memoria dei migranti traducendosi in uno stimolo per lo sviluppo di nuove politiche sociali e culturali e di nuovi interventi focalizzati su questo stesso riconoscimento che interessa direttamente anche gli operatori sociali e culturali delle amministrazioni pubbliche e del terzo settore.

  20. Dal Bit ai Big Data: stratoanalisi per un nuovo nomadismo

    Directory of Open Access Journals (Sweden)

    Pierluca D'Amato

    2016-11-01

    Full Text Available The development of modern information and communication technologies has enabled the spread of tools and procedures dedicated to the discretization of reality, already involving inconceivable and unprecedented swathes of informations. The diversity, volume and velocity of data has made possible a vast set of digital contents: this is not just a form of technical externalization, of data storage, or of symbolic representation, but also the tangible basis for a new form of power, ‘algorithmic governmentality’, which uses the mathematical analysis of this vast gathering of data to prescribe and proscribe particular concrete behaviours. Evaluating these procedures for the discretization of reality, together with processes of dividualization, data behaviourism and personal profiling, this article examines the complex of techniques applied to digital contents. The basis for this examination is here the Deleuzian concept of stratoanalysis: this will initially involve studying the forms and spaces generated and composed by digital technologies, so as to assess the viability of the concept of ‘digital stratum’. By then analysing the relationship between the anthropomorphic stratum and the digital stratum, and the way that algorithmic governmentality strives to control this relationship, it will become possible to propose a line of flight that sets out and sets off from this logic of control.

  1. Presidendi nädal : punk on põhiline!

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilvese ja proua Evelin Ilvese suvistest tegemistest. Kadrioru lossi aias 4. juunil 2008 toimunud presidendi kantselei kinnisel peol esines Vaiko Eplik & Eliit. President käis 4. juunil ka Saku suurhallis Bob Dylani kontserdil ja kohtus hiljem muusikuga ning külastas 5. juunil Tallinna vanalinna päevade öökontserti "Tšellorock vanalinnas" Toompea muusikasalongis (esines tšellokvartett C-JAM). Koos abikaasa ja pisitütrega käis riigipea 6. juunil Muhumaal Riigikogu liikmele Imre Sooäärele kuuluva Pädaste mõisa härrastemaja avamisel (esinesid mõisaomanik Imre Sooäär, ooperilauljad Pille Lill, Oliver Kuusik ja poplauljad Maarja-Liis Ilus ning Koit Toome). President võttis sõna ka Rakveres maailma esimesel punklaulupeol 7. juunil. Proua Evelin Ilvesel on 2008. a. juuni algusest Eesti Televisiooni hommikusaates oma isiklikud spordiminutid, kus ta õpetab rahvale rulluisutamise nõkse. Vt. samas: Patroonluse perekonnavõistlus. President T. H. Ilvese ja proua E. Ilvese patroneeritavad asutused ja projektid. Vt. ka foto lk. A9. Ilmunud ka: SL Õhtuleht 13. juuni 2008, lk. 15, pealk.: Bob Dylan saatis Ilvese pikalt (lüh.); Bravo! 26. juuni 2008, nr. 26, lk. 6 (lüh.)

  2. le competenze di scrittura: dal narrare all'argomentare

    African Journals Online (AJOL)

    User

    Vigner (1982), un argomentario, cioè un inventario di argomenti che potrebbe essere fornito allo scrittore inesperto per imparare strumenti concettuali e linguistici efficaci. È necessario quindi sviluppare la consapevolezza teorica e pratica della polifonia enunciativa e promuovere, sulla scia di. Ducrot (1984), lo studio di ...

  3. Rahvusvaheline nädal TTÜ Raamatukogus / Taimi Nurmiste

    Index Scriptorium Estoniae

    Nurmiste, Taimi, 1949-

    2012-01-01

    19.-23. märtsini 2012 TTÜ-s toimunud rahvusvahelisest nädalast („Erasmus Staff Training Week” Erasmuse programmi partnerülikoolide töötajaile) võttis osa seekord ka raamatukogu, osalenutele korraldati ekskursioon raamatukogu uues hoones ning seminaril tutvustati kogusid ja teenuseid

  4. Popnädal. Inglise TOP 20 albumid

    Index Scriptorium Estoniae

    2002-01-01

    Hiphopar P. Diddy 33. sünnipäeva tähistamisest. Ansamblist Radiohead. Madonna osalemisest USAs telereklaamis. Ansambli Foo Fightersi juhtfiguurist Dave Grohlist. N*E*R*D-i (The Neptunesi lavanimi) debüütalbumi "In Search of..." pärjamisest auhinnaga "Shortlist Prize". Ansamblist Metallica. Britney Spearsi New Yorgis asunud restorani "Nyla" sulgemisest

  5. Rare copy of "Life of Saint Volo-dymyr" (Kyiv, 1670 from the manuscript Corpus of Lives of the Saints as a source for the 17th century Kyiv hagiography study

    Directory of Open Access Journals (Sweden)

    Bondar N. P.

    2017-01-01

    Full Text Available In the article a rare copy of an old-printed edition of “Life of Saint Volodymyr”, published circa 1670 in the Kyiv-Pechersk Lavra printing-house is characterized. The copy was included to Corpus of Lives of the Saints of the17th-18th centuries from the collection of Church and Archeological museum of Kyiv Ecclesiastical Academy (Fond 301, Unit 416L. According to the modern advances of codicology, archeology, filigranology it became possible to critically review the data of descriptions, which brought new results. The approximate dating of the old-printed edition, which has no title and imprint, is confirmed. The publishing history of “Life of Saint Volodymyr” is analyzed. The research of the copy is accompanied by the complex description of overall manuscript hagiography codex, the analysis of its content, specifics, ownership notes and paper filigrees. Archeographic analysis of Corpus of Lives of the Saints was combined with study of formation of Ukrainian hagiography complex of the second half of the 17th - the early 18th centuries.

  6. Radiation-pulse transmission via a long cable without a preamplifier and/or a pulse transformer; Transmission d'impulsions de rayonnement par cable long sans l'adjonction d'un preamplificateur ou d'un transformateur d'impulsions; Peredacha impul'snykh izluchenij no kabelyu na dal'nie rasstoyaniya bez predvaritel'nogo usileniya i/ili bez preobrazovaniya impul'sov; Transmision de impulsos por cables de gran longitud sin preamplificador y/o transformador de impulsos

    Energy Technology Data Exchange (ETDEWEB)

    Miwa, H; Tohyama, T [Kobe Kogyo Corporation, Okubo, Akashi, Hyogo (Japan)

    1962-04-15

    kompleksnoe soprotivlenie usilitelya No. 2 budet sootvetstvovat' kharakteristike kabelya pri pomoshchi vklyuchennogo kompleksnogo i menyayushchegosya soprotivleniya. Takim obrazom, ustrojstvo vida No. 2 bylo v shirokoj mere prisposobleno k nashemu yadernomu pribornomu oborudovaniyu, kak naprimer k nejtronnomu izmeritelyu vlazhnosti pochvy (schetchik BF{sub 3}) analizatoru sostava pochvy (stsintillyatsionnyj spektrometr), tolshchinomeru snega (schetchik Gejgera-Myullera) i distantsionnym kontrol'nym dozimetricheskim priboram. Otsutstvie predvaritel'nykh usilitelej i preobrazovatelej impul'sov delaet vozmozhnym primenenie ehtikh detektorov na mestnosti v osobykh usloviyakh, kak naprimer, pri vysokikh ili nizkikh temperaturakh, bystrom potoke nejtronov (gamma-izluchenij) i t.d. Nalichie tol'ko odnogo koaksial'nogo kabelya uproshchaet rabotu detektorov na dal'nem rasstoyanii. Peredacha impul'sov po kabelyu na dal'nie rasstoyaniya svyshe 500 metrov ne povliyala na stsintillyatsionnuyu spektroskopiyu gamma-izluchenij. (author)

  7. Consolidated Deep Actor Critic Networks (DRAFT)

    NARCIS (Netherlands)

    Van der Laan, T.A.

    2015-01-01

    The works [Volodymyr et al. Playing atari with deep reinforcement learning. arXiv preprint arXiv:1312.5602, 2013.] and [Volodymyr et al. Human-level control through deep reinforcement learning. Nature, 518(7540):529–533, 2015.] have demonstrated the power of combining deep neural networks with

  8. Gazi Üniversitesi Gazi Eğitim Fakültesi Güzel Sanatlar Eğitimi Bölümü Müzik Eğitimi Anabilim Dalı Keman Öğrencilerinin Aldıkları Keman Eğitiminde Karşılaştıkları Sorunlar ve Sorunları Çözmede İzledikleri Yollar Problems Encountered by Violin Students From Gazi University Faculty of Education Department of Education of Fine Arts Department of Music Education During Violin Education and Methods to be Followed to Solve These Problems

    Directory of Open Access Journals (Sweden)

    Gamze Elif TANINMIŞ

    2013-07-01

    Full Text Available This research, aims to determine problems encountered by violinstudents from Gazi University Faculty of Education Department ofEducation of Fine Arts Department of Music Education in the course ofviolin education and methods to be followed to solve these problems.This research is a descriptive work in terms of its aim and quality of thedata collected in accordance with this aim. Resources that are relevantto this topic have been reviewed and 87 undergraduate violin studentspursuing their education in Gazi University Faculty of EducationDepartment of Fine Arts Department of Music Education in academicyear 2011-12 have been surveyed in an effort to designate what kind ofproblems they encounter during their violin education and methodsthey follow to cope with them. The data acquired as results of thesurvey are presented and contrued in the form of charts. Inconsideration of the data, not to begin to start playing violin in an earlyage, not to allocate enough time for daily individual violin practice andinadequacy of course hours are seen as three most important problems.Three most important problems they experience while learning teachingmethods such as practices, etudes, works of art, etc. are the onesassociated with the use of bow, bowing techniques and double stop. It ispointed out that a clear majority of students play the musical pieces inparts, not throughly and receive help from their instructors in order tosolve the problems they encounter when they study teaching methodssuch as practices, etudes, works of art, etc. and instructor/s theyreceive help from find/s solution to their problems at the rate of 68.96. Bu araştırma, Gazi Üniversitesi Gazi Eğitim Fakültesi Güzel Sanatlar Eğitimi Bölümü Müzik Eğitimi Anabilim Dalı keman öğrencilerinin aldıkları keman eğitiminde karşılaştıkları sorunları ve sorunları çözmede izledikleri yolları tespit etmeyi amaçlamaktadır. Araştırma, taşıdığı amaç ve bu amaca uygun

  9. L'aspergillome sphenoïdal : a propos d'un cas ...

    African Journals Online (AJOL)

    Objective : Isolated sphenoidalaspergillosis is rare but potentially grave because of the risk of neuro-meningeal and orbitalextension. althoughitis more common in immuno-compromised, the achievement of immunocompetent has been described. Through an observation, we report the clinic-radiological, therapeutic and ...

  10. Dal parco al progetto di territorio: evoluzione o discontinuità?

    Directory of Open Access Journals (Sweden)

    Alberto Magnaghi

    2015-11-01

    Full Text Available In celebrating Roberto Gambino, I underline the ethical role of his professional activity, systematically oriented to experiment scientific advancements of town planning towards territorial and landscape quality in fostering public interest. On the substantive level, I agree upon many statements, e.g. parks as workshops for putting landscape into value; nevertheless I underline some discontinuity (in objectives, tools, socio- economical implications in moving from parks as policies for protecting specific areas “from” development, towards the territorial project as added value for the entire regional territory, “for” the quality of development itself.

  11. La Gemäldegalerie di Dresda. Evoluzione dal Settecento a fine Ottocento

    Directory of Open Access Journals (Sweden)

    Aloisia Marzotto Caotorta

    2015-12-01

    Full Text Available Since its foundation, the Gemäldegalerie (Old Masters Picture Gallery in Dresden has been considered one of the most magnificent picture galleries in Europe. Not only during the Augustan Age there was a keen interest in the arts, but also a strong understanding of the arts as a means of political power claims. In this context, the Gemäldegalerie was the most representative display of this phenomenon. This article aims to explore the complex role played by the galleries of royal and aristocratic residences in Saxony, concentrating on the Gemäldegalerie between the 18th and 19th centuries as a case study, as well as focusing on its impact on contemporary German literature.

  12. Caratteristiche dei sistemi differenziali e propagazione ondosa lezioni raccolte dal Dott. G. Lampariello

    CERN Document Server

    Levi-Civita, Tullio

    1988-01-01

    L'edizione originale di questo libro (qui riprodatta anastaticamente) fu pubblicata nel 1931 per i tipi di Zanichelli nella serie delle Attualità scientifiche (n.41). Del suo contenuto valga come descrizione e giudizio di sintesi quanto ne scrisse a suo tempo H. Bateman nel Bulletin of the American Mathematical Society: " Theses lectures give a clear account of the branch of partial differential equations in which attention is focused on the problem of Cauchy and its exceptional cases. The theory is well illustrated by examples from hydrodynamics, optics, and the recent theory of the Broglie waves".

  13. [La diagnosi del disturbo da uso di alcol dal punto di vista psicologico].

    Science.gov (United States)

    Coriale, Giovanna; Fiorentino, Daniela; Porrari, Raffaella; Battagliese, Gemma; Capriglione, Ida; Cereatti, Federica; Iannuzzi, Silvia; Mauri, Benilde; Galli, Domenica; Fiore, Marco; Attilia, Maria Luisa; Ceccanti, Mauro

    2018-01-01

    RIASSUNTO. Il disturbo da uso di alcol (DUA) è uno dei disturbi psichiatrici più comuni nella popolazione generale. Il DUA è caratterizzato da un pattern di bere eccessivo, che si mantiene nonostante gli effetti negativi che l'alcol ha sul funzionamento lavorativo, sulla salute, sulle problematiche legali, sull'educazione e sulla vita sociale. Attualmente, il modello bio-psico-sociale è quello che spiega meglio il DUA. Infatti, molte ricerche hanno fornito evidenze su come il DUA sia una patologia multidimensionale. Variabili biologiche, psicologiche e socio-culturali entrano in gioco nell'eziologia, nella natura, nel mantenimento e nel cambiamento nel tempo del disturbo. La fase diagnostica è un momento importante del processo di cura, perché il successo del trattamento dipende in larga misura dall'esattezza e dall'adeguatezza della diagnosi. La diagnosi clinica si basa su una valutazione globale del funzionamento del paziente e utilizza il colloquio e gli strumenti psicometrici come mezzo di raccolta di informazioni. Questo articolo fornirà una panoramica delle dimensioni psicologiche più importanti da valutare e sui migliori strumenti psicometrici da usare per una diagnosi adeguata.

  14. Dal mito classico al mito riciclato: La cultura di massa secondo Roland Barthes

    Directory of Open Access Journals (Sweden)

    Marcel Danesi

    2016-01-01

    Full Text Available This essay makes critical reference to Barthes' Mythologies (1956, the text which has been recognised as fundamental to the semiological study of mass and popular culture. However, the essay also goes beyond paying due homage to this seminal work by moving beyond it to provide the context of North American and British studies of mass culture, based on recent theories of mass media and new media, in which Barthes is completely absent. A final comparison concerns the cognitive sciences as "rival sciences" to the semiotic study of pop culture.

  15. “Questa donna dal viso netto e gioioso”: Simone de Beauvoir e la stampa italiana

    Directory of Open Access Journals (Sweden)

    Clotilde Bertoni

    2018-02-01

    Full Text Available Proseguiamo la riscoperta di Simone de Beauvoir iniziata nel numero precedente: questa volta ripresentiamo due sue interviste dimenticate uscite nel 1959 e nel 1961 sul “Giorno” e su “Paese Sera”.

  16. Pop nädal : popuudised. The Billboard 2000. MTV videoauhindade kandidaadid

    Index Scriptorium Estoniae

    2002-01-01

    Britney Spearsi uuest albumist ja laulust "My Love Was Always There". Eminemi praegusest Põhja-Ameerika turneest Anger Management Tour. Oasise kitarristi Noel Gallagheri uuest singlist "Shoot The Dog". Veteranrokkarid ansamblist Bon Jovi annavad oktoobris välja oma kaheksanda plaadi "Bounce". MTV videoauhindade kandidaatide nimekiri

  17. Il Centro Nascita Montessori. Dal neonato in famiglia al bambino e alla famiglia nel servizio educativo

    Directory of Open Access Journals (Sweden)

    Laura Franceschini

    2010-02-01

    Full Text Available Intervento al Workshop Internazionale “Infanzie e Famiglie in Europa”, del 16 ottobre 2009, presso la Facoltà di Scienze della Formazione, Via Filippo Re, 6 Bologna (Aula Magna. L’intervento illustra i valori fondativi del Centro Nascita Montessori dalle sue origini ai giorni nostri attraverso un percorso che si è allargato nel tempo: dalla focalizzata attenzione e cura al neonato in famiglia o nel brefotrofio fino agli anni ’60 alla cura della crescita del bambino nei servizi educativi e alla cura della relazione con le famiglie dagli anni ‘70 in poi. Tale espansione del campo di interesse e d’indagine operativa ha arricchito il patrimonio di competenze e di conoscenze del C.N.M..

  18. Dal castrum altomedievale al restauro settecentesco: storia e archeologia del castello di Sorrivoli (Roncofreddo - FC

    Directory of Open Access Journals (Sweden)

    Fiorini, Andrea

    2011-12-01

    Full Text Available The methods and tools used to determine the history of construction and building techniques of the castle of Sorrivoli (Roncofreddo - FC are here described. This is a research project carried out within a study coordinated by the teaching of Medieval Archaeology (University of Bologna, which has the purpose of conducting a census of all the medieval castles in Romagna. There is certain news from the tenth century concerning the castle to be studied. However, the investigations have shown that the standing preserved structures must be dated from the fourteenth century onwards. The system of photogrammetric survey of the walls and the technique of threedimensional modelling of the structures are here described. An extended part of this paper is also devoted to results of stratigraphic, typological, geological, metrological and comparative mensio-cronological analysis.No disponible

  19. Così l'antimateria scomparve dal cosmo, Aug 2004

    CERN Multimedia

    Durante, Elisabetta

    2004-01-01

    The matter has a minor decay probability and therefore, had the upper hand - A miliare stone of physics. The international experiment BaBar explained why after the Big Bang an assymetrical Universe is born

  20. Bioetica dal comandamento. Intorno alla riflessione ebraica sulla fecondazione assistita e l’eutanasia

    Directory of Open Access Journals (Sweden)

    CAPORALE, MARIANGELA

    2017-06-01

    Full Text Available Bioethics from Commandment. Concerning Jewish Reflection on FIVET and Euthanasia This paper focuses on the specific nature of the Jewish bioethical thought. My interest regards the peculiarity of the biblical Jewish approach to biomedical questions like FIVET and euthanasia. The paper points out the relationship between Jewish and Christian bioethical view about these questions and it shows the analogies and the differences typical of two creationist faiths.

  1. Pop nädal : popsündmus. POPtabel : DAC Deutsche Alternative Charts

    Index Scriptorium Estoniae

    2002-01-01

    13.-14. juulil toimuvast Baltimaade suurimast tantsumuusika festivalist Sun Dance Music Festivalist. Augustis tuleb müüki George Michaeli uus singel "Shoot the Dog". Ansambli Depeche Mode liige Andrew Fletcher loob oma plaadifirma. Ansambli Duran Duran uuest albumist

  2. Geografia elettorale dell’Emilia Romagna: una cartografia interattiva delle elezioni politiche dal 1976 al 1992

    Directory of Open Access Journals (Sweden)

    Marianna Pino

    2013-05-01

    Full Text Available La rappresentazione cartografica del comportamento elettorale dell’Emilia Romagna può essere un utile strumento di analisi delle traiettorie dei partiti nel cruciale passaggio tra la prima e la seconda Repubblica. La mappatura interattiva, infatti, permette di leggere e comparare su scala comunale i risultati dei maggiori partiti che hanno partecipato alle cinque elezioni politiche tenutesi tra il 1976 e il 1992.

  3. 13 CFR 120.312 - DAL-1 use of proceeds and other program conditions.

    Science.gov (United States)

    2010-01-01

    ... assistance are available from another Federal source; or (2) For supportive services (expenses incurred by a... have a conflict of interest if one or more of its Associates is an Associate of the Lender. ...

  4. 4.-10. XI toimub traditsiooniline Põhjamaade raamatukogunädal...

    Index Scriptorium Estoniae

    2002-01-01

    Rahvusraamatukogus Fred Jüssi fotonäitus Islandist "Jää ja maa vahel" 6. XI-6. XII, taani kunstniku Peter Stougaardi maalinäitus "Kujutlused", 8. XI P. Stougaardiga diskussioon teemal "Kunst ja inimene kunstis"

  5. La funzion delle preferenze delle autorità monetarie in Italia dal 1958 al 1969.

    Directory of Open Access Journals (Sweden)

    P. RANUZZI DE BIANCHI

    2014-08-01

    Full Text Available Lo scopo principale della ricerca è quello di  costruire un modelle di comportamento delle azioni delle autorità monetarie in Italia in modo da poterlo introdurre in un modello completo del sistema economico italiano ed arrivare così ad migliore identificazione dei parametri . Inoltre, un altro vantaggio che si può ricavare è dato dall’avere messo in forma matematica le preferenze delle autorità monetarie che così possono essere usate anche in altri studi.

  6. Un rimedio esasperato dal male. Ovvero i due corpi di Valéry

    Directory of Open Access Journals (Sweden)

    Ciro Felice Papparo

    2012-05-01

    Full Text Available In his Cahiers, Valéry says that writing two of his major dialogues, Eupalinos and L’âme et la danse, was an antidote to his ravaging mood: literature and spirituality are the remedy generated by a necessary and not eliminable evil, particularly the one that shows itself as ‘rage’ in love. The essay investigates thoroughly this contradictory logic and focuses on the problem of sensitiveness in Valéry’s work, pointing out a twofold presence of the ‘body’. Preserving these two presences, the writing incessantly tries to make up “une fureur intelligente et expérimentale” and to give a new form, without deleting it, to sensitiveness’ acute pain.

  7. Relative Bioavailability of Iron in Bangladeshi Traditional Meals Prepared with Iron-Fortified Lentil Dal

    Directory of Open Access Journals (Sweden)

    Rajib Podder

    2018-03-01

    Full Text Available Due to low Fe bioavailability and low consumption per meal, lentil must be fortified to contribute significant bioavailable Fe in the Bangladeshi diet. Moreover, since red lentil is dehulled prior to consumption, an opportunity exists at this point to fortify lentil with Fe. Thus, in the present study, lentil was Fe-fortified (using a fortificant Fe concentration of 2800 µg g−1 and used in 30 traditional Bangladeshi meals with broad differences in concentrations of iron, phytic acid (PA, and relative Fe bioavailability (RFeB%. Fortification with NaFeEDTA increased the iron concentration in lentil from 60 to 439 µg g−1 and resulted in a 79% increase in the amount of available Fe as estimated by Caco-2 cell ferritin formation. Phytic acid levels were reduced from 6.2 to 4.6 mg g−1 when fortified lentil was added, thereby reducing the PA:Fe molar ratio from 8.8 to 0.9. This effect was presumably due to dephytinization of fortified lentil during the fortification process. A significant (p ≤ 0.01 Pearson correlation was observed between Fe concentration and RFeB% and between RFeB% and PA:Fe molar ratio in meals with fortified lentil, but not for the meal with unfortified lentil. In conclusion, fortified lentil can contribute significant bioavailable Fe to populations at risk of Fe deficiency.

  8. Relative Bioavailability of Iron in Bangladeshi Traditional Meals Prepared with Iron-Fortified Lentil Dal.

    Science.gov (United States)

    Podder, Rajib; M DellaValle, Diane; T Tyler, Robert; P Glahn, Raymond; Tako, Elad; Vandenberg, Albert

    2018-03-15

    Due to low Fe bioavailability and low consumption per meal, lentil must be fortified to contribute significant bioavailable Fe in the Bangladeshi diet. Moreover, since red lentil is dehulled prior to consumption, an opportunity exists at this point to fortify lentil with Fe. Thus, in the present study, lentil was Fe-fortified (using a fortificant Fe concentration of 2800 µg g -1 ) and used in 30 traditional Bangladeshi meals with broad differences in concentrations of iron, phytic acid (PA), and relative Fe bioavailability (RFeB%). Fortification with NaFeEDTA increased the iron concentration in lentil from 60 to 439 µg g -1 and resulted in a 79% increase in the amount of available Fe as estimated by Caco-2 cell ferritin formation. Phytic acid levels were reduced from 6.2 to 4.6 mg g -1 when fortified lentil was added, thereby reducing the PA:Fe molar ratio from 8.8 to 0.9. This effect was presumably due to dephytinization of fortified lentil during the fortification process. A significant ( p ≤ 0.01) Pearson correlation was observed between Fe concentration and RFeB% and between RFeB% and PA:Fe molar ratio in meals with fortified lentil, but not for the meal with unfortified lentil. In conclusion, fortified lentil can contribute significant bioavailable Fe to populations at risk of Fe deficiency.

  9. Business Intelligence a supporto del GIS: ultime novità dal mondo GFOSS

    Directory of Open Access Journals (Sweden)

    Fabio D'Ovidio

    2009-03-01

    Full Text Available GeoBI (GeoSpatial Business Intelligence open source projectGeoBI (GeoSpatial Business Intelligence, a new open source project coming from Italy, look at the Geographic Information Systems (GIS from a different point of view because it proposes to manage the alphanumeric component of cartographic data through Business Intelligence tools. This implies multidimensional webGIS usage in order to display charts, dials and diagrams on the map and spatially navigate OLAP cubes.

  10. Business Intelligence a supporto del GIS: ultime novità dal mondo GFOSS

    Directory of Open Access Journals (Sweden)

    Fabio D'Ovidio

    2009-03-01

    Full Text Available GeoBI (GeoSpatial Business Intelligence open source project GeoBI (GeoSpatial Business Intelligence, a new open source project coming from Italy, look at the Geographic Information Systems (GIS from a different point of view because it proposes to manage the alphanumeric component of cartographic data through Business Intelligence tools. This implies multidimensional webGIS usage in order to display charts, dials and diagrams on the map and spatially navigate OLAP cubes.

  11. Pop nädal : popuudised. Plaadid. Top 20 DAC Deutsche Alternative Charts singlid / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Jean Michel Jarre uuest kontsertprojektist "Aero" ja samanimelisest albumist. Inglise kitarripopparite Jesus Jones'i uuest singlist "Come On Home", hitikogumikust "Never Enough" ja kontserttuurist koos DVDga. Suri 34-aastane bändi Alice in Chains juhtfiguur, laulja ja kitarrist Layne Staley. Filmimuusika heliplaadist "The Royal Tenenbaums"

  12. Stress Wave attenuation in SiC3D/Al Composite

    International Nuclear Information System (INIS)

    Yuan Chunyuan; Wang Yangwei; Li Guoju; Zhang Xu; Gao Jubin

    2013-01-01

    SiC 3D /Al composite is a kind of special composite with interpenetrating network microstructure. The attenuation properties of stress wave propagation along the SiC 3D /Al composite are studied by a Split Hopkinson Pressure Bar system and FEM simulations, and the attenuation mechanism is discussed in this paper. Results show that the attenuation rate of the stress wave in the composite is up to 1.73MPa·mm −1 . The reduction of the amplitude of waves is caused by that plenty of interfaces between SiC and Al within the composite acting with stress waves. When the incident plane wave reaches the SiC 3D /Al interface, reflection wave and transmission wave propagates in different directions along the irregular interface between SiC phase and aluminium phase due to the impedance mismatch of them, which leads to the divergence of stress wave. At the same time, some stress micro-focuses occurs in the aluminium phase for the complex wave superimposition, and some plastic deformation may take place within such micro-regions, which results in the consumption of stress wave energy. In conclusion, the stress wave attenuation is derived from divergence and consumption of stress wave.

  13. Tallinna moenädal pole mägede taga! / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2010-01-01

    Nahkaksessuaare pakkuv Inglise firma Mulberry ja eesti moedisainer Oksana Tandit avasid ühise kaupluse "Süda" Tallinnas Suur-Karja tänavas. Oksana Tanditi moekollektsiooni "Pierrot" on teist korda võimalik näha Tallinn Fashion Week'il kinos Sõprus. Nimetatud Tallinna moenädala raames oma loomingut näitavaid kunstnikke

  14. Dal ricordo al racconto. Origine e alterazione della memoria in Tristano muore

    Directory of Open Access Journals (Sweden)

    Alessandro Ceteroni

    2013-06-01

    Full Text Available Quando in un romanzo il materiale narrativo coincide interamente con la memoria del personaggio, diviene necessario chiedersi come si stabilisca il grado di verità della sua testimonianza. In questo articolo cercheremo di ricostruire i processi psichici che determinano la percezione e la rielaborazione dell’esperienza da parte di Tristano, cercando di spiegare in che modo i ricordi si originino, si alterino e si organizzino in quel racconto orale, che lo scrittore/testimone avrà il compito di tradurre in forma scritta.

  15. Scuola, infanzie e culture in Quebec. Le politiche educative interculturali dal paradigma culturalista al paradigma civico

    Directory of Open Access Journals (Sweden)

    Letizia Caronia

    2009-07-01

    Full Text Available Questo articolo propone un’analisi storica e una riflessione critica sui modi con cui il Quebec ha affrontato e costantemente riaffronta il problema della scuola pubblica in una società storicamente multiculturale, multietnica e plurilingue. In particolare, la riflessione riguarda il piano normativo e legislativo e le politiche scolastiche via via elaborate, per rispondere alla sfida di pensare e costruire una scuola pubblica capace di costruire una “infanzia quebecchese”. Una lettura del’curricolo ideale’ - si dirà - ci dice poco sulla ‘realtà’ educativa di un paese. Eppure, in Quebec come altrove, le politiche scolastiche costituiscono i segnali pubblici del modo con cui un paese – rappresentando pubblicamente e ufficialmente la sua scuola - rappresenta se stesso, i propri valori, le proprie concezioni di ‘infanzia’. Dopo un breve quadro storico inteso a tracciare l’origine multiculturale del Quebec (come di tutti gli stati nordamericani, par.1, saranno presi in esame la legge 101 (1977 che sancisce il francese come lingua ufficiale di insegnamento e il dibattito sempre vivo e lacerante che ha accompagnato questa legge e le sue successive modifiche (parr. 2-4. In secondo luogo, saranno presi in esame il recente processo di laicizzazione della scuola quebecchese sancito dalla legge 118 (giugno 2000 e le profonde implicazioni culturali, politiche e identitarie di tale processo (parr. 5-8. In un paese che storicamente ha fatto un uso a carattere esplicitamente identitario del riferimento alle religioni dei due gruppi maggioritari, che ha costruito su esso la propria organizzazione sociale, le identità dei gruppi e i loro rapporti di forza, la deconfessionalizzazione della scuola pubblica ha implicazioni e significati culturali del tutto peculiari. Infine sarà analizzata l’assunzione ufficiale della vocazione interculturale della scuola pubblica (parr. 9-11. L’incrocio di questi tagli prospettici fa emergere i paradossi insiti in una società che vuole abbandonare la logica delle “communities” senza per questo abbracciare la reductio ad unum di alcuni modelli europei. L’articolo si conclude con un’analisi critica dei modelli pedagogici relativi all’educazione interculturale e con un confronto tra il modello quebecchese e alcuni modelli europei, tra questi il modello italiano.

  16. Trolling a další nestandardní chování na internetu

    OpenAIRE

    Stěpanovová, Anna

    2016-01-01

    My thesis is titled Trolling and other unusual online behaviours. It focuses on deviant behaviours of internet users in Czech and foreign context. Trolling and hate became inseparable part of online environment, it is sort of a side product of the development of technology. The aim of this thesis is to reveal strategies hidden behind behaviour of users of the internet who intentionally disrupt the continuity of online environment (trolling etc.), also depicting the profile of this kind of int...

  17. Pop nädal : popuudised. Venemaa MTV.RU edetabel TOP 20

    Index Scriptorium Estoniae

    2002-01-01

    Inglismaa gothic-metal kvintett Paradise Lost annab välja esimese DVD "Evolve" ja uue plaadialbumi. Marc Almond esines 23. juunil Moskvas ja annab 24. juunil välja oma esimese kontsert-DVD "Marc Almond - A Willing Sinner Live In Berlin". 15. juulil saabub müügile Marilyn Mansoni DVD "Guns, God and Government". Ansambel Rammstein 15. juunil Soomes Provinssirockil, 17. juunil Peterburis St. Petrovski staadionil, 19. juunil Moskvas Tushino lennuväljal ja 21. juunil Kiievis

  18. Täiskasvanud õppija nädal 2010 / Reet Saar

    Index Scriptorium Estoniae

    Saar, Reet, 1959-

    2010-01-01

    Raplamaa Aasta õppija on Märjamaa perearstikeskuse õde Ljudmilla Tamp, Aasta koolitaja tantsuõpetaja Lilli Teesalu, Aasta koolitussõbralikum organisatsioon on Kehtna põhikool ja aasta koolitussõbralikum omavalitsus Kohila vald

  19. Pop nädal : Popuudised. Raadio 2 annab rohkem alternatiivmuusikat / J. L.

    Index Scriptorium Estoniae

    J. L.

    2002-01-01

    Ansambli Toto uuest albumist "Trough the Looking Glass", mis tuleb müügile 14. okt. ning Toto Euroopa-maailmaturneest alates 27. oktoobrist ja lõpetades 2003. aastal. Ansambli The Breeders uuest albumist "Son of Three". Ansambli The Hives' lepingust plaadifirmaga Universal Records. 21. okt. müügile saabuvast Richard Ashcrofti plaadist "Human Conditions" ja singlist "Check the Meaning". Ansambli U2 uuest singlist "Electrical Storm". Raadio 2 poolt pakutavast moodsast klubimuusikast

  20. Donato Menichella: dal risanamento di banche e industrie allo sviluppo del Mezzogiorno

    Directory of Open Access Journals (Sweden)

    Mario Sarcinelli

    2013-06-01

    Full Text Available Donato Menichella was the central-bank governor when Italy's reconstruction and economic miracle took place. While well known are the merits he acquired in the '50s, less understood is the role he played to resolve the nexus between banks and industrial concerns in the '20s and above all in the '30s, when he was called upon to organise IRI, the Institute for Industrial Reconstruction conceived by Beneduce, and to write, together with others, the fundamental banking law of 1936. As a governor native of the South, he was well aware of Mezzogiorno's backward conditions. His was the idea as well as the bill that eventually set up Cassa del Mezzogiorno, the Development Fund for the South. Menichella was a great manager and a grand commis with a high sense of equity and a strong aversion to the limelight, either academic or political.  JEL Codes: B3 

  1. Donato Menichella: dal risanamento di banche e industrie allo sviluppo del Mezzogiorno

    Directory of Open Access Journals (Sweden)

    Mario Sarcinelli

    2007-09-01

    Full Text Available Donato Menichella was the central-bank governor when Italy's reconstruction and economic miracle took place. While well known are the merits he acquired in the '50s, less understood is the role he played to resolve the nexus between banks and industrial concerns in the '20s and above all in the '30s, when he was called upon to organise IRI, the Institute for Industrial Reconstruction conceived by Beneduce, and to write, together with others, the fundamental banking law of 1936. As a governor native of the South, he was well aware of Mezzogiorno's backward conditions. His was the idea as well as the bill that eventually set up Cassa del Mezzogiorno, the Development Fund for the South. Menichella was a great manager and a grand commis with a high sense of equity and a strong aversion to the limelight, either academic or political.

  2. Il design italiano attraverso moda, arte, cinema, grafica e musica dal Secondo Dopoguerra al 1969

    Directory of Open Access Journals (Sweden)

    LAGHEZZA, Eugenia

    2016-06-01

    Full Text Available This paper investigates the relationship between Italian design and the wider cultural context in which it is rooted. Italian design has witnessed social, cultural and economical transformations since the Post War reconstruction. In doing so, it has interacted with contemporary cultural forms like art, fashion design, cinema, graphic design, advertising and music in a mutual and fertile exchange. This paper shortly describes the first phase in which the profession of the designer was defined and consolidated, during the Post War reconstruction. After the Second World War, Italy needed to reconstruct its social, political and economic systems. New buildings for new working families needed to be furnished; the early generation of architects/designers like Castiglioni or Magistretti found a fertile dialogue with bright entrepreneurs from Northern Italy like Cesare Cassina or Ernesto Gismondi (Artemide. Designers started to acquire a professional identity and in 1956 ADI (Association for the Industrial Design was born. Moreover, this paper describes how Italian design interacted with the national popular culture, contributing to the construction of myths and cultural symbols.

  3. Riflessioni sull’evoluzione metodologica delle discipline Diritto ecclesiastico e Diritto canonico, dal 1929 a oggi

    Directory of Open Access Journals (Sweden)

    Vittorio Parlato

    2014-05-01

    Full Text Available Il contributo, non sottoposto a valutazione, riproduce l’intervento, corredato da note, presentato al Convegno Nazionale dell’ADEC sul tema “Per una disciplina che cambia. Il diritto canonico e il diritto ecclesiastico nel tempo presente”(Bologna, 7-9 novembre 2013 ed è destinato alla pubblicazione negli Atti.SOMMARIO: 1. La metodologia internazionalista e storicista: rilevanza del diritto canonico - 2. Il metodo pubblicistico e la legislatio libertatis - 3. La metodologia comparatista in campo statale e religioso - 4. Le nuove tematiche legate a principî confessionali. Abstract : Nel breve intervento si evidenzia, per sommi capi, il cambiamento di metodologia e di tematiche relative allo studio e didattica del Diritto ecclesiastico e del Diritto canonico, con riferimento ad alcuni eventi che hanno segnato queste discipline. Dapprima i Patti Lateranensi con i problemi interpretativi connessi; poi la promulgazione della Costituzione repubblicana e il Concilio Vaticano II, con l’affermarsi dei diritti di libertà religiosa; successivamente la comparazione giuridica in campo secolare e religioso a seguito della apertura dell’ordinamento italiano verso altri ordinamenti; infine l’interesse non tanto degli istituti confessionali, quanto dei principî etici, specie cattolici, proposti alle legislazioni statuali

  4. Popnädal. Billboard 200 Albumid Top 20 / Jaan Tamm

    Index Scriptorium Estoniae

    Tamm, Jaan

    2002-01-01

    Ansambli The Smiths 20. sünnipäeva puhul ilmunud joonisfilmist. Jennifer Lopezist filmis "Enough". Peter Gabrieli albumist "Up". Duo Elton John ja Bernie autasustamisest Music Industry Trust galal. Duubelplaadist Yann Tiersen "C'Etait ICI". Filmist muusiku Gram Parsoni elust. Iiri poistebändist Westlife

  5. Salario protetto dal meccanismo di scala mobile a "punto pieno". Una postilla.

    Directory of Open Access Journals (Sweden)

    G. FAUSTINI

    2014-09-01

    Full Text Available The automatic adjustment of earnings to the cost of living usually had two objectives, to protect wages in whole or in part from the effects of inflation and to avoid a spate of destabilising wage claims. Recently, however, in Italy a third aim has been added, that of reducing the differences in remuneration. The present article looks at the experience and prospects of wage indexing in Italy, limiting the analysis to the sliding-scale in industry. The author first considers how wage indexing works in Italian industry. The average effectiveness of wage indexing is then examined. Finally, the specific effectiveness of the method of indexing related to the unified value of the point is analysed. JEL: E31, E24, J31

  6. Welfare locale e innovazione sociale: una buona pratica dal terzo settore

    Directory of Open Access Journals (Sweden)

    Antonella Golino

    2016-06-01

    Full Text Available The local welfare -among other possibilities- effectively enhances the contribution of volunteering and nonprofit. On the local level we can identify the third sector institutions or companies operating on the market with which to make agreements to carry out activities of new welfare and social innovation, i.e. new ideas (products, services and models to meet social needs, improve the quality of human life and well-being, and create new relationships and social inclusion. The paper describes a good practice to social innovation performed by volunteers of the Università Cattolica del Sacro Cuore, Research Foundation and Care John Paul II of Campobasso. The social innovation initiative in the health field, by developing new forms of co-operation between public actors of the third sector, shows that the actors are able to develop appropriate responses and affordable to different social needs in the area and to mobilize resources for this purpose and private skills, pro- ducing value for society as a whole in a perspective of innovative welfare.

  7. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  8. Come difendere la globalizzazione e salvaguardare i sistemi bancari dal contagio?

    Directory of Open Access Journals (Sweden)

    Mario Sarcinelli

    2012-03-01

    Full Text Available The work summarises the main literature on the impact of globalisation and of the crisis on banking systems. The main conclusion is that a more compelling approach to financial regulation appears as necessary, though the complete homogenisation of financial systems is not a goal to be sought. The current approaches in the Anglo-Saxon countries, based on the segmentation of banking activities seems a right choice, due to both the political difficulties in enacting a stricter regulation of finance and the practical difficulty of regulating a sector pervaded by financial innovation. However, both the Volcker rule and the British approach of ring-fencing, suffer from two limitations: the risk of transferring even more risk to the shadow banking system, and the difficulty in practice to distinguish between legitimate hedging activities and forbidden speculative activities.

  9. FORMALITÀ E MATERIALITÀ DELL’ETICA. DAL DOVER ESSERE ALL’EVIDENZA ASSIOLOGICA

    Directory of Open Access Journals (Sweden)

    Speranza, Maria Teresa

    2015-12-01

    Full Text Available The paper intends to investigate the deconstruction of the kantian ethical formalism by Max Scheler, who, adopting the phenomenological method, establishes an order of a priori knowledge absolutely distinct from natural and the scientific knowledge. Phenomenological knowledge leads to intuition of essences, that, according to their degree of generality, can be formal or material. Identifying a form of knowledge different from intellectual synthesis and the sensitive perception, namely fühlen or axiological feeling, Scheler releases the a priori from legislator mechanism of intellect and also from characteristics of objects. The a priori is rather a plainness that appears immediately in eidetic intuition, such as hierarchical structure of meanings and values, which constitutes the logos that permeates the universe.

  10. Dal record al dato. Linked data e ricerca dell’informazione nell’OPAC.

    Directory of Open Access Journals (Sweden)

    Antonella Iacono

    2013-12-01

    In this paper the author explores the possibility the new record deconstructed and connected with the other data on the Web is able to facilitate the creation of knowledge in the use of the catalogue. The author then analyzes the potential of application of linked data to the catalogue with regards to the capabilities for research, the new possibilities of semantic search and the ways to access bibliographic data.

  11. P. Ortoleva, Dal sesso al gioco. Un’ossessione per il XXI° secolo?

    Directory of Open Access Journals (Sweden)

    Mauro Salvador

    2013-03-01

    Full Text Available In questo pamphlet edito da Espress per la collana “Tazzine di caffé con panna” Ortoleva riprende le fila del discorso avviato ne Il secolo dei media (2008. L’autore riparte dalla liberazione sessuale e dalla diffusione della pornografia della seconda metà del Novecento per giungere a parlare del contemporaneo processo di “ludicizzazione del reale”

  12. L'influenza del Giappone sulla moda italiana dal XVI al XX secolo

    OpenAIRE

    Dimitrio, Laura

    2016-01-01

    Questa ricerca ha per oggetto lo studio dell’influenza del Giappone sulla moda italiana, dalla metà del XVI alla fine del XX secolo. Le prime notizie sugli abiti giapponesi giunsero in Italia intorno al 1550, dopo che il Giappone era stato ‘scoperto’ nel 1543 da alcuni mercanti portoghesi naufragati sulle sue coste. Tuttavia i primi timidi influssi giapponesi nella moda italiana si manifestarono solo dopo la seconda metà del XVII secolo, quando i nobiluomini italiani cominciarono a indoss...

  13. Immaginario: spazio e tempo della cura. Dal Rêve-Eveillé all’ Esperienza Immaginativa

    Directory of Open Access Journals (Sweden)

    Alberto Passerini

    2012-10-01

    Full Text Available Object of interest and philosophical speculation, sometimes examined as in contrast to the perception and knowledge, Imaginary has generated, in the history of thought, conflicting theories that have defined it, alternately, positive enhancer of knowledge or element disturbing element of pure and  rational knowledge, a real obstacle to the learning process. Years of psychotherapy that, since the Rêve-Eveillè of Desoille (1930 led us to the current definition of Imaginative Experience, have confirmed, as stated Desoille, that the psychotherapy with the imaginative experience is a privileged way to approach the unconscious. Privileged way, in which the contributions of neuroscience, through the studies of neural substrate (Passerini, 2009 and a new explanation of neuro- psycho - biological imaginative phenomenon, have allowed us to identify a new way of working. Psychotherapy with Imaginative Experience, psychodynamic model based on the privileged use of the imaginative production, exploits Imaginary as the main place of the treatment. It is situated within a theoretical framework referable to the depth psychology, since it interacts and mobilizes psychic energies that when are conflictual, traumatic or deficient, can lead to suffering. Beyond the resolution of the symptoms, the methodology with Imaginative Experience, through a specifically structured psychodynamic setting, allows to recover the subjectivity of the individual who, at the beginning of the treatment, is suffering from the disease and is calling for help. It also allows to bring to mind, through movement in the imaginative place, "all the scattered elements of the psyche in order to make a synthesis" (Desoille. The stimulating imagination, born of the therapeutic relationship between two individual who interact since they need love, to be loved and recognized for their values ​​and meanings, leads to conflictual and unconscious areas. That can trigger real transformative movement that is the result of the creative function of Imaginary, and that has already been recognized in the mid-twentieth century by Gaston Bachelard who declared: "Imagine is a fundamental mental activity" (1975.

  14. Pol Verhoven : ja bõ dal Sheron Stoun po morde! / Paul Verhoeven ; interv. Stass Tõrkin

    Index Scriptorium Estoniae

    Verhoeven, Paul

    2007-01-01

    Hollandi päritolu filmirežissöör endast ja oma filmidest "Basic Instinct" (1992) ja "Zwartboek" ("Black Book", 2006). Tema tulevikuplaanides oleks ka Boriss Akunini krimiromaani "Azazel" ekraniseerimine

  15. Dal "San Marco" al "Vega". (English Title: From "San Marco" to Vega)

    Science.gov (United States)

    Savi, E.

    2017-10-01

    Apart from the two superpowers, among the other countries Italy has had an important role in astronautics. The roots of Italian astronautics' history runs deep in the hottest years of the Cold War, and it had its first remarkable achievement in the San Marco project..after years of advanced technologies testing, they achieved European cooperation and built VEGA, the current Arianespace light launcher.

  16. Popnädal : Popuudised. Plaadid. Top 20 20 Raadio 2 / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Industrial-ikooni Frontline Assembly ning projekti Delerium liige Rhys Fulber annab juulis välja oma uue sooloprojekti "Conjure One" albumi. Massive Attacki DVD-kogumikust "Eleven Promos". Ansambli The Orb plaadist "Daleth of Elphame". Rock-pop legendi Bryan Ferry uuest sooloplaadist "Frantic". Heliplaatidest "Ocean's Eleven" ja "Neil Young - Are You Passionate?". Edetabel eelmise nädala Raadio 2 enimmängitud lugudest

  17. Energia dal mare: modelli numerici e GIS per la valutazione del potenziale energetico

    Directory of Open Access Journals (Sweden)

    Emanela Caiaffa

    2012-04-01

    Full Text Available Attraverso l’uso di modelli numerici oceanografici applicati al Mar Mediterraneo i ricercatori del laboratoriodi modellistica climatica e impatti dell’ENEA stanno valutando il potenziale energetico contenuto nel motoondoso lungo la fascia costiera e più in generale nei mari italiani, allo scopo di identificare i siti più idoneiall’installazione di impianti di conversione del moto ondoso in energia elettrica. Energy from the sea: numerical models and GIS for the evaluation of potential production Marine renewable energy is an emerging sector with great potential to contribute in achieving European renewable energy and decarbonisation targets. Marine renewable energy is here defined to include both wave and tidal current energy. With a diverse set of technologies in development and policy support mechanisms introduced in a number of European countries, the sector is working towards achieving commercial deployments in the near future. The present paper after a short and simple description of the WAve prediction Model (WAM, a numerical wave model to assess the wave potential energy in the Mediterranean basin, describes the potential advantages in in-tegrating the numerical results in a GIS (Geographic Information System containing environmental  and  territorial  data.  The  analysis  of  multiple  layers  of  geo-referenced information allows to explore the spatial relationship between the wave energy poten-tial and other variables such as the location of protected areas or navigational routes. This kind of analysis helps identifying the most suitable areas for the the installation of wave energy converters. As an example, in order to better highlight the results along the Italian coast, the values of the potential energy, extracted along the coast (about 12 km from the coast, have been included in a series of thematic maps.

  18. Energia dal mare: modelli numerici e GIS per la valutazione del potenziale energetico

    Directory of Open Access Journals (Sweden)

    Emanela Caiaffa

    2012-04-01

    Full Text Available Attraverso l’uso di modelli numerici oceanografici applicati al Mar Mediterraneo i ricercatori del laboratoriodi modellistica climatica e impatti dell’ENEA stanno valutando il potenziale energetico contenuto nel motoondoso lungo la fascia costiera e più in generale nei mari italiani, allo scopo di identificare i siti più idoneiall’installazione di impianti di conversione del moto ondoso in energia elettrica.   Energy from the sea: numerical models and GIS for the evaluation of potential production Marine renewable energy is an emerging sector with great potential to contribute in achieving European renewable energy and decarbonisation targets. Marine renewable energy is here defined to include both wave and tidal current energy. With a diverse set of technologies in development and policy support mechanisms introduced in a number of European countries, the sector is working towards achieving commercial deployments in the near future. The present paper after a short and simple description of the WAve prediction Model (WAM, a numerical wave model to assess the wave potential energy in the Mediterranean basin, describes the potential advantages in in-tegrating the numerical results in a GIS (Geographic Information System containing environmental  and  territorial  data.  The  analysis  of  multiple  layers  of  geo-referenced information allows to explore the spatial relationship between the wave energy poten-tial and other variables such as the location of protected areas or navigational routes. This kind of analysis helps identifying the most suitable areas for the the installation of wave energy converters. As an example, in order to better highlight the results along the Italian coast, the values of the potential energy, extracted along the coast (about 12 km from the coast, have been included in a series of thematic maps.

  19. Dal sultanato alla monarchia: fondamenti ideologici e simbolici del Marocco post-coloniale

    Directory of Open Access Journals (Sweden)

    Barbara De Poli

    2013-12-01

    Full Text Available This paper highlights some key aspects of the construction of the modern Morocco, during a nation building process which affects the Arab countries during the first half of the twentieth century. In particular, it will focus on the transition from sultanate to constitutional monarchy, which created changes in the institutional order and implied the adjustment of the symbolic capital investing the local Power, with an evident ‘invention of tradition’. This process is essential to the axial role which the Alawite dynasty played during the anticolonial struggle by sustaining the nationalist movements in order to pursue the political hegemony in the post-independence and ensure a strong continuity.

  20. Pop nädal : popuudised. UK Album Chart Top 20

    Index Scriptorium Estoniae

    2002-01-01

    1. juulil tuleb müügile ansambli Prodigy uus singel "Baby's Got a Temper". Pet Shop Boys'i uue albumi "Release" tuuri avakontsert oli Hispaanias. Inglise juhtiv synth-electropop-artist Mesh planeerib oma teist turneed Euroopas, Põhja- ja Kesk-Ameerikas, Rootsis ja Venemaal. Depeche Mode'i liikmed lõpetavad oma sooloalbumeid. Rammsteini kontsert Moskvas 19. juulil jääb ära

  1. Pop nädal. MTV.RU TOP 20 / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    8. okt müügile saabunud albumist "Cobblestone Runway". Nickelbacki kontsertsalvestisest "Live at Home". Norra Jean Mihael Jarre Fanclub koostöös plaadifirmaga Hyperion Media annab välja tribuutalbumi "Jarre Forever". USA plaadifirma Immortal Records/ Virgin Records poolt välja antud albumist "30 Seconds To Mars". Fatboy Slimi DVDst "Big Beach Boutige II"

  2. WEB, BOSONI E MENDACI NEUTRINI. LEZIONI EPISTEMOLOGICHE DAL TEMPIO DELLA COMUNICAZIONE TOTALE

    Directory of Open Access Journals (Sweden)

    Greco Pietro

    2013-06-01

    Full Text Available The European Laboratory for Particle Physics (CERN in Geneva is the world biggest physics laboratory. But CERN is a communication laboratory, too. At CERN twenty years ago it was created the web. Today in CERN physicists are testing science communication in original situation: both in cases of successful researches (as the recent discovery of “Higgs boson” both in case of “salutiferi errori”, providential errors, (as the recent saga of “neutrino faster than light”.

  3. Eurokriisi otsustav nädal. Piiratud võimalused / Katri Soe-Surén

    Index Scriptorium Estoniae

    Soe-Surén, Katri

    2011-01-01

    23. oktoobril toimuvaks EL-i tippkohtumiseks peab G20 nõudmisel EL jõudma üksmeelele, kui suur osa Kreeka võlast läheb erasektoris mahakandmisele, samuti tuleb kokku leppida Euroopa pankade rekapitaliseerimises ja seada tulemüür Kreeka võlakriisi levimisele teistesse riikidesse. Kreekas on suurimad ametiühinguliidud välja kuulutanud streigid

  4. Dal “criminal profiling” all’autopsia psicologica della vittima

    OpenAIRE

    Laura Volpini

    2012-01-01

    Investigative psychology as a field of research, study and application of forensic psychology has come into being in our country in the last fifteen years. In particular, act 397 on defensive investigations in 2000, has, at the stage of preliminary investigation, expanded the possibilities for action and cooperation with the judicial authorities and with the defense. It is therefore necessary to test and spread tools and techniques to improve investigative strategies as well as techniques to ...

  5. Pop nädal : Pink muutis taas imagot. Billboard 200 TOP 20 / Karolina Põder

    Index Scriptorium Estoniae

    Põder, Karolina

    2002-01-01

    Ameerika popstaarist Pink (Alecia Moorist). Crazy Town'i uuest albumist "Darkhorse". Hard Rock Club' üritusest Biker's Pubis Tallinnas 5. okt.. Impaled Nazarene HR STAR üritusel Nõmme kultuurimajas 25. okt.. Saksa popkuulsuse Alphaville saabumisest Riiga Krasdtmala festivalile 4. oktoobril

  6. El yelmo de Mambrino: dal cartòn a la ceràmica

    Directory of Open Access Journals (Sweden)

    José Manuel Lucìa Megìas

    2013-12-01

    Full Text Available Illustrations of Don Quixote started to appear in the seventeenth century. The images published in the 1657 editions undoubtedly affected the novel's reception, exactly at the time when it was becoming the object of new interpretations. Those illustrations rapidly spread to courtly environments (through tapestries, ceramics, engravings, but also among ordinary people (playing cards. This is well exemplified by the “theft of images” inspired by Don Quixote , which can be found in the pictorial repertoire created by Charles Antoine Coypel in the eighteenth century.

  7. Sul rientro dal debito pubblico. (On the Reduction of Public Debt

    Directory of Open Access Journals (Sweden)

    Francesco Carlucci

    2012-08-01

    Full Text Available A theoretical model is developed for the ratio primary-surplus/GDP that a Country has to attain over a given number of years, to lower its public debt from the present value to one a-priori fixed. Such a ratio depends on the average interest rate paid on the outstanding stock of debt as well as inflation and real growth rates. The ratio primary-surplus/GDP is then determined for Germany, Greece and Italy, supposing that 20 years are necessary for lowering the debt to 60% of GDP, as indicated in the Budget Pact approved by 25 EU member States. Results are reported in graphs and show how the German debt can be easily diminished, whilst debts in Greece and Italy can be reduced with a greater difficulty.  JEL: E63, H62, C65 

  8. Kuu sündmus: Saksa filmide nädal / Maria Ulfsak-Šeripova

    Index Scriptorium Estoniae

    Ulfsak-Šeripova, Maria, 1981-

    2009-01-01

    1.-6. juunini toimub Vanalinnapäevade raames kinos Sõprus saksa filmide festival "Pärast sõda, enne müüri". Filmisoovitused: "Kadunud mees", režissöör, peaosatäitja Peter Lorre (1951) ja Ernst Marischka "Sissi" (1955)

  9. h Se erbicid lective dal pot e isolat tential agai tion an and e nst Ve ...

    African Journals Online (AJOL)

    SAM

    ates were cu e extracted w ... gly de. be to ion and of of cal contro restric often public assoc. (Defa been pestic integr ... alternata possible roduction but usage i herbicides can ention curren tal problem ... metabolites extracted from fungi was evaluated against ... added to 990 ml of water and from this 1 ml was spread in Petri.

  10. dal täis suurepärast ooperimuusikat / Laine Lehto

    Index Scriptorium Estoniae

    Lehto, Laine

    2009-01-01

    Ülevaade Saaremaa ooperipäevadest: 24. juulil toimunud galakontserdist (dirigendid Modestas Pitrenas ja Eri Klas); Vanemuise teatri "Trubaduuri" etendusest 25. juulil; 26. juulil toimunud Verdi "Reekviemi" ettekandest, kus Läti Rahvusooperi koori ja orkestri juhatas Neeme Järvi; Estonia Poistekoori kirikukontsertidest "Ave Maria" Saaremaa kirikutes Hirvo Surva juhatusel; Eesti Rahvusmeeskoori ja Tallinna Saksofonikvarteti kontserdist Kuressaare kuursaali kõlakojas 25. juulil

  11. Dal manichino alla real doll. La bambola nella visualità contemporanea

    Directory of Open Access Journals (Sweden)

    Alessandra Olivares

    2014-12-01

    Full Text Available The doll, in its various manifestations of substitute of real woman for at least forty years is a subject at the heart of poetics of many artists that through it convey stereotypes, ideas and experiences related to the feminine universe. And yet over time is profoundly changed the way of understanding and representing this object, that is one of the most discussed and controversial of our time for the disturbing familiarity that does not leave indifferent those who observe. Particularly in the case of real dolls or sex dolls, so likely and cured in the minimums details to seem real. Disregarding the controversies and aspects related to the questionable erotic business that these dolls are part, what cannot be ignored is that more and more often they are at the heart of art projects that seem real psychological studies around the emotional sphere of the individual.There are many artists who through a skilful use of the photographic instrument, combined with set designed down to the smallest details, accessories and poses, committed their search around the possibility to transpire emotions from a subject who notoriously cannot try them.But why is it so important to provide with a soul these inanimate bodies? Why do we so much need of these surrogates to bring out human feelings and emotions?After excessive and obsessive use of the poetics of the doll in the Surrealism, starting in the 1970s, this subject is recovered and used as a kind of mirror to reflect the process of manipulation and reification of a body increasingly artificial, and advances in plastic surgery and genetic engineering as the crucial stages of the construction of a man-machine-thing. Among the exponents of this art, notoriously defined post-human, there are the pioneer Helmut Newton, followed by Cindy Sherman, Nick Knight, Charles Ray and Vanessa Beecroft, just to name a few.What however that is investigated is the inversion of march that we see in many artists. In the poetics of Laurie Simmons, Beatrice Morabito, Azusa Itagaki and Elena Dorfman, emerge the urgency to recover humanity and vulnerability, peculiar features that mass-medial messages have for long time tried to cancel in the name of depersonalizing ratification and culture of success at all costs. That’s how the doll from the classic stereotype of women-object, of a body increasingly manipulated and artificial, becomes a subject to love and care for or to share real experiences and emotions. Reflection of a society suffering from autism and narcissism?

  12. Il teatro di Edna Mazya: dal dramma famigliare a quello storico-politico

    Directory of Open Access Journals (Sweden)

    Gabriella Steindler Moscati

    2011-06-01

    Full Text Available A macroscopic trend in contemporary Israeli literature concerns the growing success and increase of women writers. Even in theatre - a genre which, in current Jewish culture, is new in many aspects -, many women dramatists are gaining considerable achievements. The incidence of this phenomenon may be valued in the light of some innovative contributions, such as the elaboration of various female - or feminist - themes. The dramatic writings of Edna Mazya are particularly eloquent if read according to this analysis. In this article we will deal with some of her literary topics, which recur especially in her drama Herod (May 2000: on the one hand, the biblical inspiration and the actualization of biblical features and Mazya's leitmotif, i.e. the representation of marginalized characters and their stories in contrast to the “main stream”.

  13. Alanud nädal süstib dokfilmivitamiine / Madis Aesma

    Index Scriptorium Estoniae

    Aesma, Madis

    2006-01-01

    Tartus täna algavast ja nädala lõpuni kestvast visuaalse kultuuri festivalist Maailmafilm, kus näha ca 50 dokfilmi ning kolm aafrika mängufilmi (Burkina Fasost, Senegalist, Tshaadist). Avatud on ka Rain Tamme fotonäitus. Lisatud nimekiri "Valik filme"

  14. Dal dissenso alla rivoluzione: satira e potere nel mondo arabo contemporaneo

    Directory of Open Access Journals (Sweden)

    Barbara De Poli

    2012-10-01

    Full Text Available The satire against Authority can provide a special understanding of contemporary history of Arab countries, especially exploring humour expressions before, during and after the 2011 revolts. After an historical review of satirical expressions in the MENA region in XX century, this study investigate the role that humour and satire played in particular during the Tunisian and Egyptian revolts. Even during the rough and brutal moments of the riots, Tunisians and Egyptians could laugh at the fading power of Ben Alì and Mubarak, testifying their pungent derision of the regimes. Their fall has therefore consented a wider degree of freedom of expression including various forms of humour, chiefly satirical, that nowadays, especially on web sites, provide a parallel overview of recent events.

  15. Dal pixel all'acquerello: la tecnologia NPR nelle illustrazioni di architettura

    Directory of Open Access Journals (Sweden)

    Simone Garagnani

    2008-12-01

    Full Text Available Il progetto in architettura nasce dall’intuizione, concretizzata dapprima con schizzi istintivi atti ad esprimere compiutamente ciò che la parola non riesce a descrivere. Poi i disegni si fanno più dettagliati, recando graficismi e simboli normati per meglio descrivere il particolare. La computer grafica permette di orientare la comunicazione del progetto fino a simulazioni contestualizzate fortemente simili alla realtà. Tale forma di espressione tuttavia non sempre è appropriata, restituendo sovente l’impressione di osservare soluzioni definitive di progetto, mentre in realtà si è pervenuti forse ad una fase di sviluppo dove ancora le alternative sono possibili e dove il realismo digitale non riesce a rendere conto di tutti gli aspetti, anche emozionali, insiti nell’idea da rappresentare. Sono stati sviluppati software indirizzati al rendering non fotorealistico (NPR per fornire uno strumento flessibile al progettista che vuole raccontare la sua intuizione. In questo scritto vengono presentati alcuni risultati ottenibili con due programmi NPR specifici: Informatix Piranesi 5 e Autodesk Impression.

  16. Evoluzione dell' abitudine al fumo nei locali dellíAzienda Ospedaliera Universitaria Senese dal 1998 al 2003

    Directory of Open Access Journals (Sweden)

    B. Bianconi

    2003-05-01

    Full Text Available

    Obiettivi: l’ospedale dovrebbe rappresentare un modello per la promozione della salute, tuttavia, nonostante i divieti di legge, l’abitudine di fumare in ospedale è ancora diffusa. Obiettivo dello studio è rilevare l’abitudine al fumo di personale sanitario, pazienti e visitatori, nei locali dell’AOUS.

    Metodi: alcuni studenti universitari, durante le loro attività curricolari, hanno percorso i locali del policlinico in orari diversi, contando il numero di persone incontrate, operatori sanitari e pazienti/visitatori, e indicando il numero di coloro che stavano fumando, in entrambe le categorie. Questo studio è stato ripetuto negli anni 1998, 1999 e 2003.

    Risultati: la prevalenza di persone che stavano fumando è risultata del 6,4% nel 1998, del 3,8% nel 1999 e dell’1,1% nel 2003. La prevalenza di operatori sanitari che fumavano rispetto al totale dei fumatori è risultata rispettivamente del 25%, del 26% e del 23,8%. Nei due anni passati, nell’atrio, nel bar e nelle zone antistanti i reparti c’era una maggiore presenza di persone che fumavano; mentre nell’ultima indagine sono stati riscontrati più fumatori, oltre che nell’atrio, nei corridoi del piano didattico, zona non indagata in precedenza. Nell’ultima rilevazione, non sono stati individuati fumatori nei due bar del policlinico; mentre sono sempre stati rilevati, in numero esiguo, operatori sanitari che fumano all’interno delle corsie di degenza.

    Conclusioni: la diminuzione costante del numero di fumatori in ospedale, mostra come ci sia stato negli ultimi anni un rispetto sempre maggiore del divieto di fumo nei luoghi di cura. Il coinvolgimento di futuri medici permette di promuovere il problema fumo in ospedale.

  17. Pop nädal : popuudised. HIM - Soome rocksähvatus Euroopas. The Billboard Hot 20

    Index Scriptorium Estoniae

    2002-01-01

    Ville Valo poolt 1995. aastal loodud love metal bändist HIM (His Infernal Majesty), ning tema heliplaatidest "Greatest Lovesongs vol.666", "Razorblade" ja "Deep Shadows & Brilliant Highlights". Joy Divison ja New Order annavad 16. juulil välja oma BBCs salvestatud kontsertlindistused heliplaadil "Before & After". 17.septembril ilmub Ladytroni uus album "Light and Magic". Ignorabimuse singlist "Hüpodermic pleasure"

  18. Interagire con la complessità sonora interna ed esterna: dal microsuono alla composizione con suoni del paesaggio

    Directory of Open Access Journals (Sweden)

    Barry Truax

    2016-06-01

    Full Text Available It is possible to think of the two extremes of the world of sound as the inner domain of microsound (less than 50 ms where frequency and time are interdependent, and the external world of sonic complexity, namely the soundscape. In terms of sonic design, the computer is increasingly providing tools for dealing with each of these domains, through such practices as granular synthesis and multi-channel soundscape composition.

  19. MOnOPOlI DAlAM PReSPekTIf BISnIS SYARI‘AH

    Directory of Open Access Journals (Sweden)

    Emi Chulaimi

    2016-01-01

    Full Text Available Islam come wishing to uphold justice below/under wings of market norm. big Human respect small, strong assist weak, stupid learn from bright, and human being oppose brutality. Ih}tikār in modern economics defied as monopolistic process of and supply of demand commodity as a mean to get certain advantage. Monopolies and pricing can be conducted if situation of marketing price leap highly. It is of course, what more entitled to control pricing and monopolies power on condition that for the kemaslahatan of throng. Monopolistic and pricing basically harm throng, but, both can be gone into effect in a pinch and unstable price. So that, requirement of throng intention can overcome

  20. Khush Hal Nameh: dal teatro all’emozione etnografica - Khush Hal Nameh: from theatre to ethnographic emotion

    Directory of Open Access Journals (Sweden)

    Veronica Boldrin

    2011-12-01

    Full Text Available During the summer of 2011 the theatre company of an Italian High School puts on “Khush Hal Nameh”, an ethnographic drama by Ariane Baghaï, which through the tale of the rivalry between two Pashtun brothers projects both actors and spectators in the heart of Afghan society and in its kinship structures and dynamics of power. The article concentrates on the protagonists of this initiative, above all on the young actors, in order to understand what their “structure of experience” was like. It therefore follows the various phases of the staging process starting with the motivations of the students to take part to the experiment and the assessment of additional knowledge and competence; it also analyzes a wide range of relationships such as between actors and characters, between the theatre company and outside world and also between students and schoolinstitution. The theatre laboratory reveals itself as an ideal space to reflect about social relations and ethnographic drama as in Victor Turner’s performing ethnography: a valid instrument reach to an emotional and cognitive comprehension of the Other.

  1. Dal carnalis concubitus all’heretica pravitate. Sesso, matrimonio ed eresia nel tribunale di Jacques Fournier (1318-1325

    Directory of Open Access Journals (Sweden)

    Irene Bueno

    2009-07-01

    Full Text Available Amore, sessualità e matrimonio sono tematiche ricorrenti nei documenti inquisitoriali due-trecenteschi ed entrano con forza nel registro di Jacques Fournier, vescovo-inquisitore di Pamiers (1318-1325. Il significato di questi racconti non si può comprendere senza chiarire quale interesse essi rivestissero agli occhi dell’autorità ecclesiastica: i rapporti adulterini, incestuosi, omosessuali di imputati e imputate sono in effetti mediati dalla figura di Fournier nell’ambito di una corte che sovrappone competenze vescovili e inquisitoriali. Collegando condotte ed affermazioni licenziose alle posizioni antimatrimoniali dei catari, il vescovo stabilisce in sede processuale un nesso fra carnalis concubitus extraconiugale ed heretica pravitate. Ogni trasgressione allo spazio sacro del matrimonio diventa indizio di eresia e contribuisce a disegnare un ritratto dissoluto e vizioso di eretici ed eretiche, funzionale al successo e alla popolarità della repressione.Love, sex, and marriage are recurring themes in inquisition records of the thirteenth and fourteenth centuries, and especially in the register of Jacques Fournier, bishop-inquisitor of Pamiers from 1318 to 1325. The significance of these confessions cannot be  understood without indicating the ecclesiastical authority’s interest: adultery, incest and homosexual relations of the accused are in fact mediated by Fournier within a court that superimposes episcopal and inquisitorial competences. Linking licentious conducts and libertine statements to the anti-matrimonial tenets of the Cathars, the bishop establishes, during the trial, a connection between sexual sin and heretical crime. Any transgression of the sacred space of marriage is understood to be an indication sign of heresy and contributes to depict a dissolute and vicious portrait of the heretical believers, which is ultimately functional to the success and popularity of repression.

  2. Pop nädal : Popuudised. Uus plaat. Deutsche Alternative Charts albumid Top 10. A-Ha video / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Kurt Cobaini raamatust"Kurt Cobain: The Journals". 2. juulil müügile tulevast ansambli The White Stripes' albumist "Dead Leaves and the Dirty Ground". Ansambli R.E.M. uuest albumist. Ansambli ZLO plaadist "Machopask". Ansambli A-Ha videost, mis põhineb 1991. a. vändatud lühifilmil "A Year along the Abonded Road"

  3. Popnädal : Punkprintsess kõigutab edetabeleid. Billboard Hot 100 Top20 Albumid / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Poplauljatari Avril Lavigne albumitest "Let Go" ja singlitest "Complicated" ning "Sk8er Boi". Muusika-satelliidi VH1 Big In 2002 Awards üritusest Los Angleses, osavõtjateks teiste seas räppar Jam Master Jay ja Run DMC. Räppar DMX'i filmiprojektist "Cradle 2 the Grave". Briti kitarribändi Blur uuest albumist. Sharon Osbourne (Ozzy Osbourne' manageri ja OzzyFesti korraldaja) valimisest Londoni West Endis Aasta Naiseks

  4. Pop nädal : popuudised. Värsket filmimuusikat. MTV Euroopa TOP 20 8. aprill 2002 edetabel / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Pet Shop Boysi uuest singlist "Home and Dry" albumilt "Release". 3. aprillil suri elektroonilise muusika pioneer Frank Tovey aka Fad Gadget. Industriali lipulaev KMFDM on tühistanud oma peatselt algama pidanud Euroopa turnee. Alison Moyet' uuest albumist "Hometime". Shockrockar Marilyn Manson osaleb filmis Party Monster.Filmimuusika heliplaatidest "Treeningpäev/ Training Day" ja "Long Time Dead"

  5. dal pakub kolme näituse jagu eesti nüüdisaegset kunsti / Mart Niineste

    Index Scriptorium Estoniae

    Niineste, Mart, 1983-

    2011-01-01

    Mihkel Kleisi uusima maaliloomingu näitus "Guts´n´Roses" Tallinnas Hobusepea galeriis. Graafik Silvi Liiva näitus "Piirideta" Tallinna Kunstihoone galeriis. Katrin ja Peeter Pere ühisnäitus "Laoseis" Tallinnas Tõnismäel Parikase majas

  6. L’elogio del superficiale. Dal chiasma tattile a quello visivo, considerazioni tra Portmann e Merleau-Ponty

    Directory of Open Access Journals (Sweden)

    Alessandra Scotti

    2014-06-01

    Full Text Available This work investigates Maurice Merleau-Ponty’s concept of chiasme and his philosophical link with the biology by Adolf Portmann. The paper invokes a different meaning of "profondeur" surfaces, according to the notion of self-presentation. Through the studies of Merleau-Ponty, Arendt and Portmann himself it emerges the possibility of overcaming the opposition between inside/outside and a new conception of inter-animal-ity.

  7. Dal Centro Storico alla Città Storica: la dimensione progettuale della conservazione − Il caso di Roma

    Directory of Open Access Journals (Sweden)

    Elio Trusiani

    2004-01-01

    Full Text Available Com a adoção do Plano Regulador, Roma finalmente adquiriu uma nova perspectiva para construir o seu desenvolvimento, partir de um sistema histórico-ambiental tutelado e valorizado (base concreta da sustentabilidade, valorizando a reorganização funcional e espacial das suas estruturas subterrâneas. Uma cidade projetada em uma dimensão metropolitana e organizada segundo um modelo policêntrico – no qual se chama atenção aos trabalhos regulares e superamentos do velho conceito de centro “histórico”, conjugado à parte mais antiga do centro urbano, e a assunção do conceito de “cidade histórica” – compreende um universo mais vasto e difuso no território (do medieval ao Renascimento ao Novecentos. Um método inovador de leitura da cidade, não mais por zonas homogêneas mas por tecidos − isso permite superar o modo de tratamento unitário por zonas inteiras e lê-las ao invés de diferenciá-las, sobretudo em uma cidade como Roma, e para tanto ler as atuais exigências de transformação, procurando conferir, ou restituir, ao final cidade histórica a difícil tarefa de regular a valorização, orientar as estratégias de requalificação, construir as condições do projeto, recuperando, em tal sentido, a dimensão projetual da conservação.

  8. Dal Centro Storico alla Città Storica: la dimensione progettuale della conservazione − Il caso di Roma

    OpenAIRE

    Elio Trusiani

    2004-01-01

    Com a adoção do Plano Regulador, Roma finalmente adquiriu uma nova perspectiva para construir o seu desenvolvimento, partir de um sistema histórico-ambiental tutelado e valorizado (base concreta da sustentabilidade), valorizando a reorganização funcional e espacial das suas estruturas subterrâneas. Uma cidade projetada em uma dimensão metropolitana e organizada segundo um modelo policêntrico – no qual se chama atenção aos trabalhos regulares e superamentos do velho conceito de centro “históri...

  9. Europeizace a zahraniční politika: prostor pro další výzkum

    Directory of Open Access Journals (Sweden)

    Tomáš Weiss

    2013-12-01

    Full Text Available This paper aims to review the existing debate on the relations between national and European levels in the EU and identify existing gaps. It aims at showing the current compartelization of the academic debate and suggesting a possible remedy. It discusses the current trends in Europeanization studies and shows that one of the dimensions (bottom-up remains understudied. Similarly, the concept has been applied in the area of foreign policy in a very limited way to the detriment of our understanding of reality. Following these findings, the article suggests, firstly, that the relationship between the adjustment to European integration and the ability to pursue one's interest should be studied, both in terms of form and results, and, secondly, that foreign policy should be included in this research framework.

  10. Obezita a další rizikové faktory aterosklerózy v obecné populaci

    Czech Academy of Sciences Publication Activity Database

    Tomečková, Marie; Hlásenská, Jana; Grünfeldová, H.; Hanuš, P.; Peleška, Jan

    2004-01-01

    Roč. 7, 3 Suppl. (2004), s. 15 ISSN 1211-9326. [Kongres o ateroskleróze /8./. 02.12.2004-04.12.2004, Špindlerův Mlýn] R&D Projects: GA MŠk LN00B107 Keywords : risk factors * atherosclerosis Subject RIV: BB - Applied Statistics, Operational Research

  11. Il curricolo multiculturale e le competenze di comunicazio- ne interculturale degli insegnanti: riflessioni a partire dal caso brasiliano

    Directory of Open Access Journals (Sweden)

    Laura Cristina Vieira Pizzi

    2014-11-01

    Full Text Available This article proposes a reflection on multicultural curriculum in Brazil and its implications in the relationship between education, identity and citizenship. From these considerations, the reflection continuies on the training of teachers working in multicultural contexts, with a specific focus on their intercultural communicative skills. The analysis relies, in particular, on the contributions of cultural and postcolonial pedagogical framework in which, from its origin in the Anglo-Saxon context, engage in unmask hegemonic tendencies of certain policies, models and educational practices, which for years have been prevailing in the contexts of formal education.

  12. DAL "CRÈME CARAMEL" AL "CUPCAKE": L’INVASIONE DEGLI ANGLICISMI IN CUCINA, AL RISTORANTE E AL BAR

    Directory of Open Access Journals (Sweden)

    Stefano Ondelli

    2018-03-01

    A review of the relevant literature on culinary language shows that this variety of Italian has always been characterized by a strong presence of foreign words. Today, English seems to have replaced French as the source language of the majority of loan words found in recipes, restaurant reviews and other texts dealing with food and drink. The automatic analysis of a corpus comprising different types of articles published online confirms the presence of a large number of loan words – also from Spanish and Japanese – as well as the dominant role of English words in Italian culinary language. However, a qualitative analysis shows that, with the notable exception of alcoholic drinks, cakes and desserts, French words are still commonly used to refer to ingredients and cooking techniques, whereas English words are mainly used to give a touch of modernity and globalization to all social activities connected to the production, distribution and consumption of food and drink.

  13. DAL "CRÈME CARAMEL" AL "CUPCAKE": L’INVASIONE DEGLI ANGLICISMI IN CUCINA, AL RISTORANTE E AL BAR

    OpenAIRE

    Stefano Ondelli

    2018-01-01

    Gli studi disponibili sull’italiano della cucina notano come questa varietà linguistica sia sempre stata molto permeabile ai forestierismi. Tuttavia oggi l’inglese sembra aver scalzato il francese come lingua di provenienza della maggioranza dei prestiti che si rinvengono in ricette, recensioni di ristoranti e altri testi divulgativi di argomento enogastronomico. L’analisi automatica di un corpus comprendente articoli di vario genere pubblicati online conferma la numerosità dei prestiti non a...

  14. Dal dono al souvenir. Pratiche del dare e avere tra economia del turismo e cultura dell’ospitalità

    Directory of Open Access Journals (Sweden)

    Lucilla Rami Ceci

    2014-04-01

    Full Text Available The Tourist economy is now the most obvious tip of the complex structure of the post –colonial societies. The tourist economy substituted in many countries defined as emerging, gradually and not without destabilizing effect on social and political relations, the traditional economy with western models of development. In these societies the tourism has become essential for the presence of an attractive cultural heritage – often valued only for the archaeological endowment – and the lack  of other industrial activities. Here, just a long time, sites of historical and natural interest make up the scene of contacts between locals and visitors.The anthropologist who critically recalls  his role is seen as  internal into business and symbolic practices belonging representative and cultural objects. The dynamics of knowledge are confused with those of the exchange and solicit reflections on the meaning of the gift and its utilitarian implications. The ethnographic and iconographic documents, collected by the author of the speech, during more ten years of research in South Jordan illustrate how the repertoire of cultural productions, narrative and objects is taking place into the global economic circuits. How the meaning of the hospitality changes? What do the visitors leave into the local society?  It seems that the global  management  of the culture and its products, reproducing, displaying and placing on the market the traditional assets, translates the diversity into a pure and simple representation. 

  15. Salmonella spp. e antibiotico-resistenza in Mammiferi e Uccelli selvatici in Italia nord-occidentale dal 2002 al 2010

    Directory of Open Access Journals (Sweden)

    Velca Botti

    2013-06-01

    Full Text Available La Salmonella è un importante agente patogeno responsabile di zoonosi di notevole rilevanza economica. In Europa la salmonellosi è la seconda infezione trasmessa per via alimentare, in Italia il microrganismo continua ad essere la causa più frequente di infezione alimentare. In Europa sono in atto molti piani di sorveglianza di Salmonella in animali da allevamento, tuttavia il monitoraggio del microrganismo in animali selvatici è effettuato solo occasionalmente. Lo studio ha avuto l'obiettivo di indagare la presenza di Salmonella in animali selvatici e i ceppi antibiotico-resistenti. Nel periodo 2002-2010, 2.713 animali selvatici (Canidi, Mustelidi, Uccelli, Roditori e Ungulati, provenienti da aree dell'Italia nord-occidentale, sono stati testati per Salmonella mediante metodo microbiologico colturale seguito da tipizzazione sierologica e biochimica. Di questi, 117 (63 Canidi, 25 Mustelidi, 24 Uccelli, 5 Ungulati sono risultati positivi per Salmonella (4,3%. Sono stati isolati 130 ceppi appartenenti a diversi sierotipi e Salmonella Typhimurium è risultato quello più rappresentato. La sensibilità agli antibiotici è stata testata su 88 ceppi con test di disco-diffusione. La maggior parte dei ceppi analizzati (97,7% si sono mostrati intermedi (I o resistenti (R ad almeno una classe di antibiotici. I più alti valori sono stati osservati per la classe delle tetracicline. La presenza di sierotipi di Salmonella antibiotico-resistenti e responsabili di zoonosi è stata riscontrata in diverse specie di animali selvatici.

  16. Dal mondo dell’arte al regno delle ombre (e ritorno. Arthur Danto, Maya Lin e la bellezza interna

    Directory of Open Access Journals (Sweden)

    Filippo Fimiani

    2012-05-01

    Full Text Available Arthur Danto asserts that Maya Lin’s Vietnam Veterans Memorial in Washington embodies the rhetoric paradigm of internal beauty’s meaning. However, the relationship to the Kant’s pulchritudo adhaerens is not an easy one: Danto’s recalls against the self-referent formalism of Greenberg’s Modernism and his tacit issues about the environmental non-monumentality of Richard Serra’s Minimalism, are, most importantly, haunted by the unquestioned spectral logic of the image embodiment. The beholders’ reflecting shape on the funeral Wall is, finally, both a pathetic index and a medial incarnation (Verkörperung of the underworld.

  17. L’utilizzo delle cavità naturali nella media età del Bronzo: nuovi dati dal Lazio meridionale

    NARCIS (Netherlands)

    Alessandri, Luca; Rolfo, Mario Federico

    2016-01-01

    Explorations conducted by speleological groups are a precious source of information on the use of natural caves in different periods, especially during the Metal Ages. Pottery shards dating from the Middle Bronze Age were recently found in southem Latium in the Caverna di San Pietro a Campea, the

  18. Dal parco-spiaggia al paesaggio che in-segna: significati sovrapposti della natura intorno alla metropoli

    Directory of Open Access Journals (Sweden)

    Tomaso Colombo

    2013-03-01

    Full Text Available The author, cultural manager of Parco Nord (Milano, points out the key elements of this periurbanpark that since the Seventies has been managing to turn out an outskirts in a new attractive point ofthe town.A park has not only an environmental meaning but also a cultural one: its identity may influencepeople’s behaviours, uses and expectations as well. Thus territorial and hystorical features becomeopportunities for cultural planning, and they are taken in account when devicing opportunities forfruition and animation, always aiming at reinforcing the parks’s own identity.Colombo articulates the three guiding principles that steer the park’s cultural planning, then he recallsseveral site-specific events, from Biodiversity festival, that takes place every year, to the theaterperformances in nature such as The third Step, a visionary walk through the park at night and at dawn,taken as a symbol of a certain way of doing culture strictly connected to a way of living in nature.

  19. Dal Conte di Montecristo ai Promessi Sposi (passando per Melissa): l’Italia all’ombra degli sceneggiati Rai

    OpenAIRE

    Campanile, Achille; Rodari, Gianni; Cipriani, Ivano

    2016-01-01

    Come Gianluigi Rossini spiega nel libro Le serie TV, e come questo numero illustra, le tante diverse forme di serialità narrativa hanno via via creato tante diverse forme di dipendenza. Ma una delle più memorabili resta quella innescata dai cosiddetti “sceneggiati” che la nostra Rai manda in onda tra gli anni Cinquanta e i Settanta, dipendenza vissuta pressoché da tutti con la stessa assolutezza, cerimonia laica, passione (e non di rado ossessione) condivisa negli stessi tempi e modi: non sol...

  20. Dal CERN, flusso si dati a una media di 600 megabytes al secondo per dieci giorni consecutivi

    CERN Multimedia

    2005-01-01

    The supercomputer Grid took up successfully its first technologic challenge. Egiht supercomputing centers have supported on internet a continuous flow of data from CERN in Geneva and directed them to seven centers in Europe and United States

  1. Il "complesso di Louise": la mostra Tempo libero (13. Triennale, Milano 1964, dentro e fuori dal Palazzo

    Directory of Open Access Journals (Sweden)

    Francesca Zanella

    2012-01-01

    Full Text Available «Il “complesso di Louise” aleggia sulla Triennale: intendo ovviamente riferirmi a Louise Nevelson [...] per l’intero processo di ‘riempimento’ operato dagli allestitori nei confronti del palazzo di Giovanni Muzio, sede ormai deprecata di questa manifestazione» (Tentori 1964, p. 49. This is the Francesco Tentori’s review on the 13th Triennale exhibition in Milan on Leisure. The Louise Nevelson sculptures become a metaphore of the dialogue between layout, objects, images and Giovanni Muzio’s architecture. This is one of the crucial themes of the exhibition that has been pointed out as one of the most significant experiment for the dialogue between visual arts and exhibit design in the main and theoretical area. An other element of interest is the interaction between the central section and national displays. The Great Britain section is one of the most interesting for the ‘pop’ visualization of the theme designed by Theo Crosby, with contributions of Natasha Kroll and Fletcher Forbes e Gill, and Joe Tilson, Eduardo Paolozzi, Peter Startup, Barnet Saidman, Roger Mayne, Johnny Scott, Harold Cohen.

  2. La politica monetaria in Italia dal 1947 al 1978 (Monetary policy in Italy from 1947 to 1978

    Directory of Open Access Journals (Sweden)

    A. FAZIO

    2014-03-01

    Full Text Available Since the Second World War, monetary policy in Italy has taken on a fundamental role in the control of the production cycle, the balance daily payments and prices. The present study analyzes the reasons for and effects of monetary policy over the last decade, when destabilizing impulses, both internal and external, became more frequent and intense and as a result required numerous interventions. The author also considers  the stabilization policies of 1947-48 as well as those of the sixties, the control of interest rates and the evolution of monetary aggregates during the periods of development of the fifties and sixties, highlighting the similarities and differences in the instruments and performance with respect to the actions taken in the most recent period. The description is implemented in chronological order, situating the analysis of monetary policy actions in the context of economic developments, and in relation to other economic policy measures.JEL: E52, E43 

  3. Il simil sync o semi-sinc nel panorama italiano: lo slittamento e offuscamento dei confini previsti dal CCNL

    Directory of Open Access Journals (Sweden)

    Angela Sileo

    2018-02-01

    Full Text Available Although Italy has always been a dubbing country, mainly due to cultural and historical reasons, the recent introduction of new TV formats, resulting from the hybridization between previously existing formats (such as docu-realities, a hybrid between documentaries and reality shows, has required the development of more suitable translation processes. Simil sync results from the hybridization between dubbing and voice-over, but it has not been clearly defined both from a theoretical point of view (as a separate branch within AVT, whose boundaries are blurred by the mentioned phenomenon of hybridization and from a contractual point of view (the national collective agreement does not contain any reference to it and to its payment either. Consequently, the aim of the present work is to define simil sync as clearly as possible, also by providing a more suitable and less anglicized label for this translation practice (that is, semi-sinc.

  4. Prime osservazioni in tema di rappresentanza sindacale: dal protocollo del 31 maggio 2013 alla sentenza della Corte Costitu­zionale n. 231 del 2013

    Directory of Open Access Journals (Sweden)

    Marina Capobianco

    2013-07-01

    Full Text Available Abstract - The author tackles the thorny issue of union representation in the light of the conclusion of the recent Intesa bearing indications concerning the measurement of representat­iveness, signed as a unit by the social partners to put an end to the tragic divisions that have occurred in recent years on the endo-union. The Protocol is in perfect continuity with the pre­vious Interfederation Agreement of 28 June 2011, differentiating however, on some parts. Within this framework, it analyses the recent decision of the consultation on the constitutional­ity of Article. 19 of the Statute of Workers today, retracing the stages of progressive develop­ment of the new jurisprudence aimed at finding compromise solutions to end the age-old ques­tion “not risen” representation within the legislative gap in union's area. Résumé - 6. El auteur analyse le sujet “épineux” de la représentativité syndicale par rapport à l’accord ,signé par les acteurs sociaux, en ce qui concerne la détermination de la représentativité pour terminer les dramatiques divisions qui se sont vérifiées dans les dernières années dans le front endo-syndical. Le Protocole se pose dans une ligne de continuité avec le précédent Accord du 28 juin 2011 mais avec certaines différences. Dans ce contexte on analyse le récent arrêt de la Court Constitutionnelle sur la légitimité de l’art. 19 de le “Statuto dei Lavoratori” aujourd’hui, en parcourant de nouveau l’iter d’affirmation de la nouvelle jurisprudence qui est un compromis pour réglementer le problème de la représentation, qui n’a pas été solutionné dans l’absence d’une législation syndicale. Resumen - El autor afronta el espinoso tema de la representación sindical a la luz de la es­tipulación del reciente Acuerdo que incluye indicaciones en tema de medición de la represen­tatividad, suscrito unitariamente por las partes sociales para poner punto final a las dramáti­cas divisiones averiguadas en los últimos años entre los sindicatos. El Protocolo se pone en perfecta línea de continuidad con el anterior Acuerdo Interconfederal del 28 junio del 2011, diferenciándose de ello, sin embargo, en algunas partes. Dentro de este escenario, se analiza la reciente pronunciación de la Corte Constitucional sobre la legitimidad constitucional del art. 19 del Estatuto de los Trabajadores hoy, recorriendo las etapas de progresiva afirmación de la nueva orientación jurisprudencial dirigida a encontrar soluciones de compromiso para poner punto final a la añosa cuestión de la representación "irrisorta", en el ámbito del vacío legislativo en materia sindical. Riassunto - L'Autore affronta lo spinoso tema della rappresentanza sindacale alla luce del­la stipulazione della recente Intesa recante indicazioni in tema di misurazione della rappresen­tatività, sottoscritta unitariamente dalle parti sociali per porre fine alle drammatiche divisioni verificatesi negli ultimi anni sul fronte endo-sindacale. Il Protocollo si pone in perfetta linea di continuità con il precedente Accordo Interconfederale del 28 giugno del 2011, differenziando­sene, tuttavia, su alcune parti. Entro tale scenario, si analizza la recente pronuncia della Con­sulta sulla legittimità costituzionale dell'art. 19 dello Statuto dei Lavoratori oggi, ripercorren­dosi le tappe di progressiva affermazione del nuovo orientamento giurisprudenziale volto a trovare soluzioni di compromesso per porre fine alla annosa questione della rappresentanza “irrisorta”, nell'ambito del vuoto legislativo in materia sindacale. Sommario – 1. L'Accordo del 31 maggio 2013 nel quadro dei previgenti accordi interconfe­derali – 2. Le nuove misure di rappresentatività – 3. L'efficacia soggettiva ed i criteri di votazio­ne - 4. La clausola di esigibilità e di tregua sindacale – 5. La portata e gli effetti del nuovo accordo – 6. La recente decisione della Consulta e le "soluzioni" al problema della "esclusione sindacale".

  5. Muusikamaailm. Festival "Ultraschall" Berliinis. Puccini nädal Helsingis. 94aastane Kurt Pahlen veel tegev. Dortmundile uus saal. Preemiaid ja tunnustusi. / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Jaanuari lõpus Berliinis toimuvast nüüdismuusikafestivalist "Ultraschall". Helsingis toimuvast Puccini nädalast. 94aastase muusikamaailma legendi Kurt Pahleni tegemistest. Dortmundis septembris avatavast uuest kontserdisaalist. Preemiatest ja tunnustustest muusikamaailmas

  6. Tinder a další seznamovací aplikace aneb proč dnes hledáme partnera on-line

    OpenAIRE

    STUHLOVÁ, Barbora

    2017-01-01

    This thesis deals with the problematics of usage of dating applications between young people of the Czech republic and their views on partnerships. The introduction is dedicated to theoretical findings and basic terminology related with on-line dating. The first half of the theoretical part introduces the reader to different views on partnerships and their core pillars based on psychological theories. In connection with these attributes, the second part of the thesis concentrates on theories ...

  7. Dal “modello 3D” alla “scena 3D”. Prospettive e opportunità per la valorizzazione del patrimonio culturale architettonico e urbano.

    Directory of Open Access Journals (Sweden)

    Elena Ippoliti

    2010-12-01

    Full Text Available La multimedialità è fatta di “ricchezza audiovisiva, profondità conoscitiva e informativa, interattività”[i] e, ancora, un prodotto multimediale dovrebbe essere “ricco, profondo e mobile, avvincente come un film, sistematico come un libro e interattivo come un videogioco”[ii]. A partire da tali definizioni, il contributo proposto intende indagare su alcune delle opportunità che le più recenti innovazioni tecnologiche offrono per l’ampliamento e la diffusione delle conoscenze sul patrimonio culturale, in particolare soffermandosi sulle applicazioni che privilegiano la “scena digitale 3D” del bene culturale, architettonico e urbano, sia in quanto interfaccia di accesso ai contenuti culturali e sia in quanto luogo in cui si costruiscono informazioni. Tale modalità di approccio, analoga e interattiva, incardinata sul coinvolgimento sensoriale ed emozionale, si costituisce di fatto come un valore aggiunto per la comunicazione, la fruizione e l’elaborazione di informazioni e contenuti, qualificandosi utilmente per la valorizzazione del patrimonio culturale. [i] Negroponte N., Essere digitali, Sperling & Kupfer, Milano, 2004. [ii] Maragliano R., Manuale di didattica multimediale, Laterza, Roma-Bari, 1994. p.43.

  8. Gesto e movimento per la comprensione musicale. Ascolto dal “Carnevale degli animali” di Camille Saint-Saëns

    Directory of Open Access Journals (Sweden)

    Chiara Sintoni

    2012-11-01

    Full Text Available Questo percorso didattico è rivolto alle ultime due classi della scuola dell’infanzia e alle prime due classi della scuola primaria, ed è incentrato su alcuni brani da Le Carnaval des Animaux (1886 del compositore, pianista e organista francese Camille Saint-Saëns (Parigi,1835-Algeri,1921. Il percorso è adatto alla scuola dell’infanzia e primaria perché insegna alcune nozioni di base della musica e una prima grammatica della comprensione musicale all’ascolto. Il lavoro si basa sull’utilizzo del gesto e del movimento finalizzati alla comprensione del brano all’ascolto. Gesto e movimento sono due risorse utilissime nella didattica rivolta all’infanzia: nel nostro caso, daremo un esempio di come possano sviluppare nei bambini la capacità di ascoltare la musica in profondità e di promuoverne un ascolto oggettivo, ovvero riflessivo.

  9. Muusikamaailm : Helsingi pidunädalad tänasest. Rossini festival Pesaros. Soome nädal "Promenaadisarjas". Preemia György Kurtagile / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Soome muusikafestivalist Helsingin Juhlaviikot. Rossini festivalist Pesaros. Soome muusikute esinemisest "Promenaadikontsertidel" Londoni Royal Albert Hallis. G. Kurtagile määrati Saksamaal Tübingenis välja antav Friedrich Hölderlini preemia

  10. Osobnost typu C (cancer personality): současný stav poznatků a implikace pro další výzkum

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Adam, Z.

    2008-01-01

    Roč. 54, č. 6 (2008), s. 523-530 ISSN 0042-773X R&D Projects: GA ČR GA406/07/1384 Institutional research plan: CEZ:AV0Z70250504 Keywords : cancer * cancer-prone personality * methodology Subject RIV: AN - Psychology

  11. Antonio Mollari e l’architettura nelle Marche dal Neoclassico al Purismo / Antonio Mollari and architecture in Marche region from Neoclassicism to Purism

    Directory of Open Access Journals (Sweden)

    Fabio Mariano

    2015-02-01

    The early architectural "functionalist" Neoclassicism introduced in the Papal State by the genius of Vanvitelli, with his early works in the Marches, had defined a new design language and a particular simplified taste in architectural decorum, played on the widespread use of clay enriched with essential emphases stone, which will affect the architectural production in the Marches to beyond the eighteenth century. The Napoleonic invasion (1797 will shake the backwardness of the state papal introducing new modern principles of land management and planning, mapping and cadastral new tools, new types of architecture-related services, new roles assigned to public engineers and architects. Linearity, proportion and good taste became theoretical assumptions; constructive correctness and rational correspondence between functions and plans became the yardstick; a serene simplification of forms constantly connected to the economic program was married with recovery of the classical models and Vitruvian read back through the mediation treatises of Vignola and especially of Palladio. All news largely implemented after the Restoration of the Papal rule, where the professional figure of Antonio Mollari, after his exploits in the new Stock Exchange Building in Trieste, is inserted in the vein of architectural Purism. It was "more than a passing circumvention the neoclassical experience", it was a final declination of the broader cultural movement of the European neoclassical, by now exhausted, placed in a few decades, until the papacy of Pius IX, and before the next eclectic anthology of historical revivals.

  12. Principy spravedlnosti lokálních institucí: zásluha, potřeba, talent a mnohé další

    Czech Academy of Sciences Publication Activity Database

    Brabec, Martin

    2016-01-01

    Roč. 13, č. 1 (2016), s. 171-196 ISSN 1214-4967 R&D Projects: GA ČR GA14-19416S Institutional support: RVO:67985955 Keywords : justice * local institutions * merit * need * talent * output * efficiency Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0260376

  13. Pop nädal : popuudised. Edetabel MTV.RU Videode Top 20. Plaadiarvustus : Various - Scooby-Doo. We're a Happy Family lugude nimekiri / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    5. nov. saabuvad müügile country-legendi Johnny Cashi plaat "American IV: The Man "Comes Around"" ja Rob Zombie "We're a Happy Family". Filmimuusika heliplaadist "Scooby-Doo". 17. sept. saabub müügile Disneymania-kogumik, kus laulavad Ashanti, Christina Aguilera ja 'N Synk

  14. L’arte di murare in mattoni a Milano dal IV al XIV secolo. Considerazioni sullo stato delle attuali conoscenze e percorsi di ricerca

    Directory of Open Access Journals (Sweden)

    Fieni, Laura

    2005-12-01

    Full Text Available En este artículo se presentan los resultados de un amplio estudio realizado en la basílica de San Lorenzo Maggiore de Milán, que ha tenido como objeto analizar la historia del edificio. El conjunto arquitectónico fue excavado sin control arqueológico en el curso de la restauración realizada por G. Chierici en los años 1936-1943, por lo que ha sido necesario diseñar una estrategia compleja que permitiese la revisión de la secuencia constructiva, recurriendo a análisis arqueológicos y arqueométricos. Para llevar a cabo esta labor se ha realizado una lectura estratigráfica de los paramentos conservados, un estudio de los materiales constructivos empleados, un análisis de las dimensiones de los ladrillos y una caracterización petrográfica de las argamasas utilizadas. Se han obtenido, asimismo, nuevas dataciones a través de la técnica del radiocarbono y de la termoluminiscencia. A partir de estos estudios se ha realizado una revisión de la historia del edificio desde período tardoantiguo hasta el medieval.

  15. Il neutrino alla velocità della luce E' cominciato con un successo il test per capire la storia dell'universo dal big bang fino a oggi

    CERN Document Server

    Beccaria, Gabriele

    2006-01-01

    A neutrino beam sent from Cern in Geneva is arrived in 2,5 milliseconds, travelling underground, to Gran Sasso: the first test to try to understand the invisible neutrino and its metamorphoses (1 page)

  16. Muusikamaailm : Berliini Filharmoonikute omalaadne kontserdireis. Klaverinädal Espoos. shtshedrini Klaverikontsert Los Angeleses. Domingo ja Pavarotti kõrvuti Metropolitanis. Pendereckile preemia Duisburgist / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Berliini Filharmoonikute kontsertreisist II Maailmasõja võitnud riikide pealinnades tähistamaks Saksa Liitvabariigi moodustamise 50. aastapäeva. 12.-17. okt. Soomes Espoos toimunud 5. rahvusvahelisest pianistide festivalist. R.shtshedrini Viienda Klaverikontserdi maailmaesiettekandest Los Angeleses 21. okt. L. Pavarotti laulab ooperis "Tosca"ja P. Domingo ooperites "Talupoja au" ning "Pajatsid" New Yorgi Metropolitan Operas. Tänavune Duisburgi Muusikapreemia anti K. Pendereckile

  17. Profiling, analisi delle prestazioni e proposte per l'ottimizzazione del RDBMS MySQL utilizzato dal progetto DIRAC/LHCbDIRAC

    CERN Document Server

    Mesin, Alberto

    Il lavoro presentato in questa tesi riguarda lo studio, l'analisi e la formula- zione di proposte per il miglioramento del database di back-end del progetto DIRAC/LHCbDIRAC. LHCbDIRAC, basato su DIRAC, e il sistema di sot- tomissione per l'accesso all'infrastruttura distribuita Grid per l'esperimento LHCb del CERN. Ad esso e adata la gestione dei job di Produzione, Mer- ge, Ricostruzione degli Eventi e Analisi per i dati sperimentali e simulati. Il sistema utilizza un RDBMS MySQL per la gestione di numerosi databa- se. La volonta di passare ad un motore relazionale e transazionale per la denizione schemi e la possibilita che, in un recente futuro, il DBMS possa rappresentare un serio limite alle prestazioni del sistema stesso hanno reso necessario questo studio. Il lavoro svolto si e concentrato sul proling di un singolo schema relazionale per il quale sono stati utilizzati metodi di analisi e fornite soluzioni ai problemi riscontrati il quanto piu possibile generali e per tanto validi per l'intero sistema. L...

  18. Author’s Song and Plastic in Franco’s decline: Paco Ibáñez/Dalí-Raimon/ Equipo Crónica-Miró

    Directory of Open Access Journals (Sweden)

    Juan Garzón Gómez

    2016-12-01

    Full Text Available Spain in the last decades of Franco, the author song became a vehicle of expression against the established system. The voice of the troubadours of the twentieth century was popular tool cohesion by which it was adopted a particular social ethics and politically compromised position. Around this genre there was an important cultural movement which were not outside the arts. This article is an approach to the relationship between the creations of singerwriters and painters through the involvement of the latter as illustrators of record folders of the time.

  19. kOnSeP ASURAnSI DAlAM kOnSTRUkSI BISnIS ISlAM (Kajian Reflktif Perspektif Fikih Muamalah

    Directory of Open Access Journals (Sweden)

    Moh Nafih

    2016-01-01

    Full Text Available Application of equilibrium principal in Islam very is suggested, to be comprehended as life balance in world and eternity which must be carried by entrepreneur of moslem in this bearing ( Insurance. Hence this balance concept, inviting to all entrepreneur of moslem to be able to realize actions in business which can place x’self a others and moslem prosperity of life safety and world eternity.Other side, in have business to oblige the existence of business ethics Islamly which is put down above values of normatifias religion. Ethics is ideal moral values which must be applied in Islam business as business identity which have Islam bases. Business of Islam is the way of have business which clear of manipulation actions, exploitation, and from goods of lap. But most principal in characteristic have business of Islam conducted on the basis of is voluntary (antaradhin and accepting each other between one another. So that from conducting business transaction it in an optimal fashion.In this ” concerning insurance”, representing new problem to Islam, and have the character of ijtihad, which must be tilled by moslem intelectuals to be able to know law status, operational procedure, and elementary principle of Islam, and also can be applied by society.

  20. L'assistenza psicologica nell'ambito dell'emergenza “profughi provenienti dal Nord Africa”: quale ottica culturale, quale trauma, quale intervento?

    Directory of Open Access Journals (Sweden)

    Manuela Boni

    2012-03-01

    Full Text Available This paper presents a psychological intervention in an emergency situation with strong intercultural implications: the psychological support intervention provided in the context of the reception project for North-African refugees landed in Italy in 2011. Here, the theoretical models of cross-cultural psychology meet and intertwine with the meanings and the practices of the emergency intervention. Special attention is given to two topics: trauma and the ways which the time factor changes the needs of the people to which the intervention is provided - with the consequent need of an analysis aimed at rethinking and changing our responses to them. The intervention model comprises three levels - institutional, psychosocial e clinical – which are differently modulated in the various temporal phases of the reception project. The psychological support intervention comprised the following actions: promotion and participation to coordination meetings, counseling interviews and training for the workers, group meetings, psychological triage interviews and provision of a psychological care and support service. The proposed activities, which are discussed in the article, have been developed in an integrated manner within the wider project that involved different actors – with the prominent role fo Trento's Protezione Civile and Assessorato Provinciale alla Solidarietà e alla Convivenza.

  1. Grigori Petrišin: Ajalehes Kesknädal 25. märtsil 2009 ilmunud publikatsiooni ümberlükkamine / Grigori Petrišin

    Index Scriptorium Estoniae

    Petrišin, Grigori

    2009-01-01

    Riigikogu liikme, endise Tallinna abilinnapea Kalev Kallo poole pöördus ettevõtja Grigori Petrišin, keda kaitsepolitsei oli sundinud väidetavalt oma firma nimel kirjutama linnajuhte kompromiteerivaid kirju. Nüüd väidab ettevõtja, et teda on ära kasutatud valimiseelsetes võimumängudes

  2. Dai fuseaux ai leggings, dal crème caramel ai cupcakes: l’inglese alla conquista della moda e della cucina italiane

    OpenAIRE

    Università degli Studi di Trieste

    2017-01-01

    Video della lezione Cosa rappresenta il made in Italy più della moda o della cucina? Probabilmente nulla: l’immagine che gli stranieri hanno degli italiani è quella di un popolo maniaco dell’eleganza e del buon cibo. Eppure, quando parliamo di questi argomenti, usiamo sempre un gran numero di parole straniere, negli ultimi anni soprattutto inglesi. Vedremo alcuni esempi di questa invasione e cercheremo di spiegarne il perché.

  3. DAL PIANO PARTICOLAREGGIATO AL PROGETTO DI IDENTIFICAZIONE DEI CENTRI STORICI. UN APPROCCIO ANALITICO AI COSTI PARAMETRICI NELLA PROSPETTIVA DI UN MODELLO DI PROGRAMMAZIONE STRATEGICA

    Directory of Open Access Journals (Sweden)

    Vittoria Ventura

    2017-06-01

    Full Text Available In the perspective of the participatory programming, nowadays main-stream in all spheres of urban planning, the analysis of the parametric costs has been affirmed as an important design tool; it’s requested, at all levels, to increase the transparency and flexibility of the plan, and play an important role in the knowledge process for decision makers as well as for users and stakeholders. The experimental context of this study is the old town of Ragusa Superiore, a large urban fabric consisting of 8600 architectural units, quite homogeneous from the constructive point of view, but not from the typological and morphological ones. The analysis supports a strategic planning process based on the design of several option of intervention strategies (more conservative or transformative, envisaging a certain degree of flexibility in sorting the involved Architectural Units between the different Intervention Categories; in this role, the proposed pattern allows us to associate in real time the parametric cost to each of the different Intervention Categories supposed in each simulation. The parametric cost analysis is based on the typing of the analysed fabric, consisting of 1788 architectural units and provides a wide range of unit costs to indicate feasibility and convenience of the real estate investments in order to define a possible incentive program aimed at internalizing the urban externalities resulting from the more general process of enhancement of the entire old town.

  4. Rëubeni Fürst der Juden (Reubeni, principe degli ebrei di Max Brod: un «messia» sionista dal ghetto di Praga

    Directory of Open Access Journals (Sweden)

    Mattia Di Taranto

    2017-12-01

    It is the aim of the present essay to offer a brief albeit accurate analysis of Max Brod’s novel, a little literary gem scarcely read outside of narrow circles of specialists, as well as to explain the reasons behind the choice of David Reubeni, an almost entirely forgotten Jewish pseudo-Messiah of the XVI century, as the main character. By closely examining some of the novel’s most salient passages, this paper particularly intends to show how the historical and cultural context in which it was composed – the city of Prague in the wake of the dissolution of the Habsburg Empire, the heated debate within the Zionist movement – can provide us with a persuasive key to understanding its hidden message.

  5. Knihovna Jiřího Ribaye a možnosti dalšího výzkumu

    Czech Academy of Sciences Publication Activity Database

    Pišna, Jan

    2017-01-01

    Roč. 62, 3/4 (2017), s. 37-41 ISSN 2570-6861 Institutional support: RVO:68378068 Keywords : early printed books * manuscripts * book collecting * book culture * Age of Enlightenment * provenances * book catalogues Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  6. Česká hovorovost a hovorová čeština (v kontextu dalších slovanských jazyků

    Czech Academy of Sciences Publication Activity Database

    Hoffmannová, Jana

    2013-01-01

    Roč. 82, 1/2 (2013), s. 125-136 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : colloquiality * colloquial style * Colloquial Czech * Literary Czech * Common Czech * spoken Czech Subject RIV: AI - Linguistics

  7. Elektrochemická analýza poškození, hybridizace a dalších interakcí DNA

    Czech Academy of Sciences Publication Activity Database

    Vacek, Jan; Havran, Luděk; Fojta, Miroslav

    2011-01-01

    Roč. 105, č. 1 (2011), s. 15-26 ISSN 0009-2770 R&D Projects: GA MŠk(CZ) LC06035 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : electrodes * nucleic acids * electrochemistry Subject RIV: BO - Biophysics Impact factor: 0.529, year: 2011

  8. La tracciabilità della filiera vitivinicola: dal sistema di cantina alla gestione completa dell’azienda vitivinicola con strumenti GIS-Oriented

    Directory of Open Access Journals (Sweden)

    Luigi Rosadini

    2013-03-01

    Full Text Available Nell’ultimo decennio le aziende Agrarie e Vitivinicole in particolare hanno visto aumentare in maniera considerevole le difficoltà di mercato ed al contempo hanno registrato una maturità e sensibilità da parte del consumatore. Questo nuovo contesto ha fatto sì che le esigenze di automazione, informatizzazione e relativa tracciabilità di prodotto sifacessero più pressanti e dettagliate, tanto da richiedere lo sviluppo di veri e propri Sistemi Informativi di Cantina eGIS agrario-vitivinicoli anche partendo da una analisi e un relativo approccio geospaziale delle problematiche presenti.AbstractThe new context of agricultural and wine-devoted farm duringlast decades has brought to the needs of automation, computerizationand traceability of its product, requiring the developmentof real Information Systems as a GIS agrarian wine cellar,starting from an analysis and the approach to the geospatialissues. 

  9. De Velázquez a Dalí: las concepciones implícitas de los profesores sobre el aprendizaje

    Directory of Open Access Journals (Sweden)

    José Alfredo Aparicio

    2004-01-01

    Full Text Available Este artículo presenta los resultados de investigacion de un análisis cuantitativo de las concepciones implícitas sobre el aprendizaje que poseen una muestra de 100 profesores de educación básica de la ciudad de Barranquilla, y analiza si existe relación entre tales concepciones y la experiencia docente, el contexto y tipos de contenido de aprendizaje, y el dominio de conocimiento de las tareas propuestas. Se presenta un análisis de los datos en función de cuatro procesos: Retención, relación, organización y recuperación de los conocimientos. Los resultados encontrados señalan que estos profesores poseen en su mayoría concepciones realistas o interpretativas del aprendizaje y muy pocos de ellos concepciones constructivistas. No se halló relación entre la experiencia docente y el dominio de conocimiento con las concepciones sobre el aprendizaje. Las concepciones sobre la retención de conocimientos están relacionadas con el contexto de aprendizaje, y las concepciones sobre relación y recuperación se relacionan con la variable tipo de contenidos. Finalmente, parece existir un vínculo entre las concepciones implícitas de los profesores sobre la adquisición y organización de los conocimientos y entre la relación y la recuperación.

  10. Privatizovaná univerzita: o jedné další 'velké transformaci' vzdělávání

    Czech Academy of Sciences Publication Activity Database

    Balon, Jan

    2015-01-01

    Roč. 37, č. 4 (2015), s. 453-463 ISSN 1210-0250 Institutional support: RVO:67985955 Keywords : higher education * education market * UK university reform * funding * public university * student repayment loans Subject RIV: AA - Philosophy ; Religion

  11. Tekstowy korpus a dalše informaciske srědki wo hornjoserbskej rěči w interneće

    Directory of Open Access Journals (Sweden)

    Sonja Wölkowa

    2014-12-01

    Full Text Available The Upper Sorbian text corpus and further sources of information with regard to Upper Sorbian in the Internet In the present era of globalisation and the omnipresence of the Internet, Sorbian linguistics faces new challenges along the lines “What is not in the Internet, does not exist”. The demand for digital sources of information with regard to Upper and Lower Sorbian and those accessible online as working tools and reference points for language practice and as a source for academic research increases. As a result of this ongoing development, the Foundation for the Sorbian People established a workgroup called “Sorbian in the new media” at the end of 2012, which has pointed out the creation of an online German­Upper Sorbian dictionary as the major task in this field of activities.  The focus of this article, however, is the Upper-­Sorbian text corpus HoTKo, which has been created by the Sorbian Institute and which has been made available in co-­operation with the Institute of the Czech National Corpus at the Charles University in Prague. The article presents the history and development of the corpus, its extent and shape as well as its link to or incorporation into further planned digital projects of the Sorbian Institute with regard to the Upper Sorbian language.

  12. Depresivní symptomatika ve věku 12-15 let - mezipohlavní rozdíly a další souvisosti

    Czech Academy of Sciences Publication Activity Database

    Fráňová, Lenka

    2004-01-01

    Roč. 48, č. 6 (2004), s. 510-522 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : adolescence * global self - esteem * depressive symptoms Subject RIV: AN - Psychology Impact factor: 0.209, year: 2004

  13. Muusikamaailm : Brüsseli La Monnaie ئ 300. Uusooper San Franciscos. Sibeliuse nädal esiettekannetega. Cesare Valletti surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Brüsseli teater Theatre Royal de la Monnaie sai linnalt 300. juubeli kingituseks lisaruume, hooaja ooperiesiettekannetest teatris. J. Heggie ooperi "Dead man walking" maailmaesiettekandest San Francisco Ooperis. 30.sept.-8. okt. toimunud Sibeliuse nädalast Järvenpää-talos. Lühidalt C. Vallettist

  14. Il pensiero e lo spazio estetico. Osservazioni sull’opera pittorica del caregiver di una persona affetta dal morbo di Alzheimer

    Directory of Open Access Journals (Sweden)

    Gian Luca Barbieri

    2010-12-01

    Full Text Available Nel contributo vengono studiate, attraverso una prospettiva psicoanalitica, le dinamiche psichiche attivate dalla produzione pittorica del caregiver di un paziente colpito da morbo di Alzheimer. In particolare si indagano i modi in cui la creazione di uno spazio estetico ha reso possibile al pittore elaborare il trauma e il lutto connessi alla ricaduta della malattia sulla mente della moglie e si osservano le potenzialità insite nell’attività artistica di costituire una protezione per il caregiver nei confronti di una potenziale simmetrica atrofizzazione mentale.

  15. I prodromi della partita doppia in una corporazione monastica: la contabilità dell'Abbazia di San Pietro in Perugia dal 1461 al 1464

    Directory of Open Access Journals (Sweden)

    Alessandro Montrone

    2009-07-01

    Nuestro análisis se concentra en el Diario y el Mayor de los años 1461 a 1464, es decir, más de treinta años antes de la publicación del Tractatus De Computis et Scripturis de Luca Pacioli. Ello demuestra que en esa época la contabilidad por partida doble ya era aplicada en la Abadía de San Pedro. Aunque esta contabilidad no registra ni el capital ni los beneficios, sí permitía de cualquier modo una mejor administración y una mejor toma de decisiones.

  16. Dal materiale all’immateriale. Verso un approccio sostenibile alla gestione nel contesto glocale / From material to immaterial: towards a sustainable approach to management in the glocal context

    Directory of Open Access Journals (Sweden)

    Mara Cerquetti

    2015-02-01

    Full Text Available Il saggio ripercorre le principali tappe del dibattito internazionale che negli ultimi anni ha condotto ad una nozione di cultural heritage aperta e dinamica, volta al superamento del dualismo tra materiale e immateriale e attenta al ruolo delle comunità locali nei processi di riconoscimento, tutela e valorizzazione del patrimonio stesso. Dopo aver preso in esame l’apporto degli studi giuridici, con specifico riferimento al contesto italiano, si analizza il contributo delle scienze sociali, soprattutto manageriali, particolarmente sensibili al tema della sostenibilità delle politiche e delle azioni finalizzate alla valorizzazione del patrimonio culturale materiale e immateriale anche attraverso l’applicazione di strumenti partecipativi. In quest’ottica, riconoscendo un ruolo centrale alla governance e alla collaborazione tra attori pubblici e privati che operano in un medesimo contesto, si porta infine l’attenzione sugli ecomusei, come caso esemplare dell’“immateriale che vive nella materialità”, evidenziando i nodi problematici che emergono dall’analisi della realtà italiana e suggerendo possibili linee di ricerca future.   The paper traces the main steps of the international debate that during the last years lead to an open and dynamic notion of cultural heritage, overcoming the dualism between tangible and intangible and considering the role of local communities in the processes of heritage recognition, safeguarding and enhancement. After examining the contribution of legal studies, above all in Italy, the approach of social sciences is analysed, focusing on management. These studies have explored the sustainability of policies and actions towards tangible and intangible cultural heritage enhancement, also through the application of participatory tools. In this perspective, governance and collaboration among different actors working in the same context gain a central role. Finally, the attention is focused on eco-museums as an exemplar case of “intangible that lives in tangible”, highlighting some crucial issues emerging from the analysis of the Italian context and suggesting possible future research lines.

  17. Il conflitto generazionale: soggettivazione e caratteristiche comportamentali in Italia dal teenager degli anni Cinquanta al proletariato giovanile metropolitano degli anni Settanta

    Directory of Open Access Journals (Sweden)

    Luca Benvenga

    2015-06-01

    Full Text Available The paper aims at drawing a sort of possible history of the generational conflict in Italy from the fifties to the sixties of the twentieth century, with the purpose to present some fundamental conceptual instruments and a documentary basis to build on for further in-depth analysis. Specifically, the paper solicits to meditate on the political-ideological dimension of the working and middle class juvenile aggregations, so to reach, through an interpretative grid, a wider view of how styles and behaviour models change in connection with economic-productive contingencies.

  18. Pop nädal : Popuudised. Edetabel The Billboard 200 Top 20. Plaadiarvustus : The Jesus and Mary Chain - 21 Singles / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    8. okt. saabub müügile ansambli Jurassic 5 uus album "Power In Numbers", millel laulab ka Nelly Furtado. Šokk-rokkar Marilyn Manson avaldab peatselt uue kontsert-video/DVD "Guns, God and Government". Intellektuaalset industriaalmuusikat viljelev ansambel Einstürzende Neubauten annab oma Interneti aadressi: http://www.neubauten.org., teatades, et 23. sünnipäeva tähistamiseks peaks 2003. aasta kevadeks valmima bändil uus album. Christina Aguilera uuest singlist "Let's Get Dirty". Ansamblist The Jesus and Mary Chain

  19. Další vzdělávání sociálních pracovníků

    OpenAIRE

    VEJVODOVÁ, Veronika

    2014-01-01

    Bachelor thesis deals with further education of social workers. Theoretic part is focused on social workers profession standards and conditions of further education. The aim of practical part is to find the interest of social workers in compulsory further education.

  20. ‹‹IN AIUTO ALL’UNITÀ DELLA LINGUA E CONTRO GLI ERRORI PROVENIENTI DAL DIALETTO››. IL SILLABARIO E IL VOCABOLARIETTO DI ANTONINO TRAINA

    Directory of Open Access Journals (Sweden)

    Michela Dota

    2016-02-01

    Full Text Available Il titolo del presente contributo condensa da una parte le coordinate operative della legislazione scolastica elementare post-unitaria, in particolare riguardo all’ortoepia, e d’altra parte la ricezione di quelle coordinate nella pubblicistica scolastica elementare coeva. Il saggio considera entrambi i cardini della questione: dopo aver esposto brevemente le linee guida della legislazione circa il rapporto tra lingua e dialetti e sulla corretta pronuncia, si analizzano due strumenti didattici, concepiti per la duplice utenza dei maestri e degli alunni, nei quali si concretano due atteggiamenti sensibilmente diversi sulla questione ortoepica. Infine, dall’analisi di questi due sussidi si dedurrà il rapporto, raccomandato più o meno esplicitamente, che doveva intercorrere tra dialetto e lingua nelle aule scolastiche. «In help to the unit of language and against the mistakes coming from dialects». Spelling book and little vocabulary by Antonino TrainaThe title of this contribution epitomizes the praxis of the post-unification legislation concerning primary school, particularly about orthoepy, and the reception of that legislation by the authors of textbooksfor primary school. After having exposed the guidelines of the legislation about the relation between Italian and dialects and about correct pronunciation, this article analyzes two teaching tools (a spelling book and a vocabulary, that can be used by both teachers and students. It’s notable that the spelling book and the vocabulary have a different perspective on orthoepy. Finally, from their analysis it is deduced the model proposed for the relation between Italian and dialects in classrooms.

  1. Popnädal : popuudised. Pet Shop Boys - Release. Music from Vanilla Sky. Billboard Top 20 20. aprill 2002 edetabel / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Moby uuest singlist "We Are All Made Of Stars" albumilt "18". Eesti sõltumatu tantsulise elektroonika plaadifirma Umblu saadab turule kolmanda väljalaske: koosluse Tallinn 73 meets Kalm split-albumi "Autopiloot". Filmimuusika heliplaatidest.

  2. Přehled stanovení formaldehydu a dalších karbonylových sloučenin v ovzduší

    Czech Academy of Sciences Publication Activity Database

    Motyka, Kamil; Mikuška, Pavel

    2005-01-01

    Roč. 99, č. 1 (2005), s. 13-20 ISSN 0009-2770 R&D Projects: GA ČR(CZ) GA525/04/0011; GA ČR(CZ) GA526/03/1182 Institutional research plan: CEZ:AV0Z40310501 Keywords : formaldehyde * carbonyl compounds * air Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.445, year: 2005

  3. The Logic of Introducing Innovation Activities into the Regional Labor Market in the Context of its Cyclical Development

    Directory of Open Access Journals (Sweden)

    Gnatenko Irina A.

    2017-08-01

    Full Text Available The article is aimed at implementing an implication of the theory of wave-like (cyclical evolutionary development of the economic system with regard to the regional labor market and determining the time for the most effective introduction of innovation influence according to development cycle of the labor markets in the Donetsk and Lugansk regions. The article schematically depicts the dissipative system of the cyclical evolutionary development of the regional labor market. The status of the regional labor market in each of the phases of the development cycle has been characterized. An evaluation of the efficiency of introducing innovations in the regional labor market, depending on the development cycle of this market, has been provided. The phase of the development cycle in which the labor markets of the Donetsk and Lugansk regions are effective has been defined, and the causal relationships that show these markets being in the «crisis» phase, have been described. It has been concluded that it would be useful to modify the existing policy of innovation impact on the regional labor markets of the Donetsk and Lugansk regions in line with the development phase of the markets indicated.

  4. Sсietific-pedagogical and social-political activity of V.O. Gerynovych (1900-s – 1940-s): source study aspect

    OpenAIRE

    V. M. Ostrovyi

    2014-01-01

    Complex characteristics and systematization of the source base of the problem, which allowed us to investigate scientific­pedagogical and public­political activity of the famous Ukrainian scientist, pedagogue Volodymyr Oleksandrovych Gerynovych (1900­s – 1940­s.) have been done in the article. The source base of the research consists of the complex of different published, and also promulgated for the first time archival documents, materials from the funds of six archives of Ukraine: Centra...

  5. The Role of Deployments in Competency Development: Experience from Prince Sultan Air Base and Eskan Village in Saudia Arabia

    National Research Council Canada - National Science Library

    Castaneda, Laura W; Hanser, Lawrence M; Davis, Constance H

    2004-01-01

    The U.S. Air Force (USAF) Developing Aerospace Leaders (DAL) initiative, according to the DAL charter, was designed "to examine and recommend actions necessary to prepare the USAF Total Force for leadership into the 21st century...

  6. Õun. Minu kõige mõttetum ost : [jutt] / Anna Hints

    Index Scriptorium Estoniae

    Hints, Anna

    2006-01-01

    Sisu: Juuli 2004 ; August 2004 ; September 2004 ; September 2004, kuskil keskel ; September 2004, lõpus ; Oktoober 2004, 1. nädal ; Oktoober 2004, 2. nädal ; Oktoober 2004, 3. nädala alguses ; Oktoober 2004, 3. nädala lõpupoole ; Oktoober 2004, 4. nädal ; November 2004, 1. nädal ; November 2004, lõpp ; Jaanuar 2005, täna

  7. Il Cilento ‘fuori di sé’. Crisi e conflitti psicologici, sociali e culturali in un’emigrazione dal Sud Italia verso altri continenti (fine ‘800-‘900

    Directory of Open Access Journals (Sweden)

    Domenico Ienna

    2016-05-01

    Full Text Available This anthropological research - connected to individual/collective criticalities and conflicts which interested the migratory movement from Cilento (Salerno towards other continents (end '800-'900 - is planning to investigate the umpteenth challenge to which was called a southern culture which was, in the course of the centuries, on the fringe of society, also exhausted from serious difficulties. The contribution makes use of the analysis of many letters, sent from migrants to Americas and Australia to relatives and friends of native villages, to act as an intermediary between country frustrations and suffered/inebriating transoceanic "disorientations".

  8. Economical study on the choice of the methods for processing radioactive waste with regard for their further burial.; Ehkonomicheskie issledovaniya po vyboru sposobov pererabotki radioaktivnykh otkhodov s uchetom ikh dal`nejshego zakhoroneniya.

    Energy Technology Data Exchange (ETDEWEB)

    Avdeev, O K; Lyakhov, V F [Naukovo-Tekhnyichnij Tsentr z dezaktivatsyiyi ta kompleksnogo povodzhennya z radyioaktivnimi vyidkhodami, Zhovtyi Vodi (Ukraine)

    1994-12-31

    Results of economical studies in the field of rational application of different methods of processing of low- and middle-active RAW are presented. They are as follows: burning, compaction, metal decontamination by chemical treatment and remelting, hardening of RAW. It is shown that efficient use of the processes of burning, supercompaction, chemical and pyrodecontamination of metal may be achieved only when processing considerable amounts of waste under conditions of a single Centre for processing and burial of RAW.

  9. Vērtības izglītības sistēmas tiesību aktos un izglītības procesa dalībnieku izpratnē

    OpenAIRE

    Bokta, Rūta

    2016-01-01

    Latvijas valsts vērtības ir deklarētas LR Satversmē. Izglītībā svarīgākās vērtības ir minētas Izglītības likumā. Izglītības saturā tās aktualizē izglītības standarti. Pētījuma mērķis bija izpētīt, cik lielā mērā Satversmes un Izglītības likuma vērtības ir iekļautas izglītības standartos, kā tās izprot skolēni un kā skolotāji tās piedāvā skolēniem mācību procesā. Tika veikta literatūras un dokumentu analīze, kā arī veikts pētījums, lai noskaidrotu skolotāju un skolēnu personiskās vērtības, mā...

  10. Lidská monstra ve Vokabuláři zvaném Lactifer a v dalších středověkých pramenech

    Czech Academy of Sciences Publication Activity Database

    Šedinová, Hana

    2004-01-01

    Roč. 127, 3-4 (2004), s. 237-283 ISSN 0024-4457 Institutional research plan: CEZ:AV0Z9009908; CEZ:AV0Z9062906 Keywords : human monsters * Greek geography * Medieval literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. Kapalinová extrakce fytosterolů a dalších cenných látek z tálových mýdel

    Czech Academy of Sciences Publication Activity Database

    Rousková, Milena; Heyberger, Aleš; Tříska, Jan; Krtička, M.

    2011-01-01

    Roč. 105, č. 4 (2011), s. 251-255 ISSN 0009-2770 Institutional research plan: CEZ:AV0Z40720504; CEZ:AV0Z60870520 Keywords : liquid - liquid extraction * tall soap * phytosterols Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.529, year: 2011

  12. Typologie antisociálního chování v rané adolescenci a jeho vztah k dalším formám rizikového chování

    Czech Academy of Sciences Publication Activity Database

    Sobotková, Veronika; Blatný, Marek; Jelínek, Martin; Hrdlička, M.; Urbánek, Tomáš

    2009-01-01

    Roč. 53, č. 5 (2009), s. 428-440 ISSN 0009-062X R&D Projects: GA AV ČR IBS7025354 Institutional research plan: CEZ:AV0Z70250504 Keywords : antisocial behavior * typology * early adolescence Subject RIV: AN - Psychology Impact factor: 0.226, year: 2009

  13. Vliv zákaznické spokojenosti a dalších ukazatelů na tržní podíl společnosti

    OpenAIRE

    Dvořáková, Monika

    2014-01-01

    In the present hypercompetitive market environment of car producers established especially at the developed west european markets is very difficult to gain new customers and increase the market share. The car producing companies have to build and increase customer loyalty to ensure the sustainable growth of market share in the future. One possibility how to improve customer's loyality to brand is to provide the highest standard at both sales and service department and carefully monitor the cu...

  14. "Karantánsko-köttlašský" šperk na jihozápadním Slovensku a v dalších částech Karpatské kotliny

    Czech Academy of Sciences Publication Activity Database

    Ungerman, Šimon

    2016-01-01

    Roč. 57, č. 2 (2016), s. 11-48 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Early Middle Ages * jewellery * "Köttlach culture" * Carpathian Basin * Eastern Alps region Subject RIV: AC - Archeology, Anthropology, Ethnology http://prehled-vyzkumu.arub.avcr.cz/miranda2/export/sitesavcr/arub-prehled-vyzkumu/prehled-cisel-a-clanku/prehled-vydanych-cisel/files/PV-57_2_studie-1.pdf

  15. The Basics of the Methodological/mo dal professional improvements of the physical/ sports edu ca tors from the aspect of ther actual values of life and professio nal pedagogical activity

    Directory of Open Access Journals (Sweden)

    Grujo Bjeković

    2007-05-01

    Full Text Available Whi le sol ving in cre a sed le vel of pro fes si o nal pre pa ra tion of the physi cal edu cation te ac hers, in mo dern days in cre a sed at ten tion is gi ven to in tel lec tual, mo ral, cul tu ral an pro fes si o nal in cre a se of the cre a ti ve un de pen da bi lity of the fu tu re spe ci a lists with the aim to cre a te shift from pre sently do mi nant physi cal edu ca tion, which is pri ma rily orien ted to wards the de ve lop ment of the physi cal ca pa bi li ti es for ming the per fect mo ving abi li ti es and ha bits, to de ve lop ment of the who le hu man be ing The lead ro le of the se tasks be longs to the ac me o logy, a mul ti di sci pli nary sci en ce abo ut a hu man and so ci ety. In this pa per, a ba sic ca te go rial ap pa ra tus of ac me o logy has bean de fi ned, ac cording to the le vel of it’s mo dern de ve lop ment, co ve ring pro fes si o na lism and com pe tency. To re ach de fi ned goal the fol lo wing sci en ti fi c met hods ha ve been used: analysis of met hodo lo gi cal li te ra tu re, qu e sti on na i re and mo de ling. Twenty pro fes sors of the physi cal edu ca tion with up to 10 year s and mo re as well as 20 stu dents of the Physi cal edu ca tion fa culty from the third and forth year of study ha ve been qu e sti o ned.

  16. Microsismicità e variazione della pressione sul fondo di un Bacino idrico - (Attivià sismica nella zona del Vajont dal 20 Marzo 1964 al 31 Dicembre 1966

    Directory of Open Access Journals (Sweden)

    M. MIGANI

    1968-06-01

    Full Text Available The note summarizes the activity of microshocks which
    took place in the Vajont area over a period extending from March 1964 to
    December 1966. Once again, the preponderant action of sudden floods —
    which are followed by abrupt increases of the level of Lake Erto — are
    made evident as the cause of intensification of local microseismicity.

  17. Non fu tutta colpa di padre Giacinto: spiegazioni troppo semplici e realtà (come sempre complesse nel cammino di Oxalis pes-caprae L. dal Sudafrica al Mediterraneo

    Directory of Open Access Journals (Sweden)

    Maria Adele Signorini

    2013-11-01

    Full Text Available Oxalis pes-caprae L. (= Oxalis cernua Thunb. is a geophyte native to South Africa (Cape region that was introduced in Europe in the second half of the eighteenth century as a cultivated plant. It is currently widely naturalized in many regions with mild climates all over the world and in several countries it has become a very noxious weed, due to its impressive capability of spreading through bulbils. According to a theory reported also in Pignatti’s Flora of Italy, all populations currently growing in Europe and the Mediterranean basin originated from a single plant introduced in the island of Malta by an English lady, who gave the plant collected in South Africa as a present to padre Giacinto, a monk and a botanist who founded the Botanical Garden in La Valletta. Starting from Malta, Oxalis pes-caprae would have subsequently spread along Mediterranean coasts and later in the whole continent. According to this theory, all European and Mediterranean populations would be merely parts of the same clone, made up of individuals genetically identical to the one originally arrived in Malta. An investigation based on original data mainly taken from herbarium specimens and bibliographic sources, definitely contradicts this theory, in favor of a more articulated explanation: the species invasion in the area is most likely the result of several different arrivals – both intentional and unintentional – occurred in different times and different places.

  18. Loket pravěký - další indicie prehistorického osídlení loketského meandru řeky Ohře

    Czech Academy of Sciences Publication Activity Database

    Prekop, F.; Kočár, Petr

    2016-01-01

    Roč. 2016, č. 10 (2016), s. 45-54 ISSN 1804-2953 Institutional support: RVO:67985912 Keywords : Karlovy Vary Region * Late Bronze Age * archaeobotanical analysis * radiocarbon dating Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. „Opustíš-li mne, zahyneš…“ Akademická dráha Otakara Machotky a dalších českých sociologů v emigraci po únoru 1948

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2017-01-01

    Roč. 53, č. 5 (2017), s. 737-764 ISSN 0038-0288 R&D Projects: GA MŠk(CZ) EF16_013/0001796 Institutional support: RVO:68378025 Keywords : Machotka * Otakar * Czech sociology Subject RIV: AO - Sociology , Demography OBOR OECD: Sociology Impact factor: 0.143, year: 2016

  20. Turismo e cinema a Verona: dal mito di Giulietta e Romeo riflessioni geografiche su vecchie e nuove location cinematografiche / Tourism and cinema in Verona: geographical considerations about old and new cinematographic locations from Romeo and Juliet myth

    Directory of Open Access Journals (Sweden)

    Maria Laura Pappalardo

    2016-05-01

    Full Text Available Il contributo analizza, in chiave geografica, le dinamiche che legano il turismo e il cinema a Verona, città meta consolidata di turismo urbano. Consapevoli che il mito di Giulietta e Romeo svolga un ruolo considerevole all’interno delle motivazioni che inducono il turista a soggiornare nella città veneta, risulta utile soffermarsi sulla funzione svolta dai film, di “antica” e recente realizzazione, nella conoscenza dei luoghi. In virtù delle sempre mutevoli richieste dei visitatori, pare interessante riflettere se sia “conveniente” per Verona, non tanto e non solo economicamente ma, soprattutto, in una logica di sostenibilità, continuare a proporre al turista il cliché della città degli innamorati o se non si debba, al contrario, pensare a nuove esperienze emozionali attraverso la promozione di itinerari le cui tappe non siano solo il balcone di Giulietta, la casa di Romeo, la tomba di Giulietta ma luoghi decisamente più veri quali le piazze storiche della città, i negozi tipici, i centri culturali. The paper analyzes, in geographical key, the dynamics that bind tourism and film in Verona, the city consolidated urban tourism destination. Aware that the myth of Romeo and Juliet plays a considerable role in the reasons for the tourist to stay in the Venetian city, it is useful to focus on the role played by "old" and recently shot films in the knowledge of the places. By virtue of the ever-changing demands of visitors, it seems interesting to consider whether it is “convenient” for Verona, not so much and not only economically but, above all, in a logic of sustainability, to continue to offer to the tourist the cliché of the city of lovers or if it is better to hink of new emotional experiences through the promotion of itineraries whose stages are not just Juliet's balcony, the house of Romeo, Juliet's tomb but places much more real as the historical squares of the city, the local shops and the cultural centers.

  1. UN PROGETTO DI TERRITORIO PER IL TURISMO SOSTENIBILE L’ESPERIENZA DI RICERCA APPLICATA DEL PISL “SLOW LIFE. VIAGGIO TRA CULTURE E NATURA NEL PARCO NAZIONALE D'ASPROMONTE, DAL TRE PIZZI AL LIMINA”

    Directory of Open Access Journals (Sweden)

    Raffaella Campanella

    2015-06-01

    Full Text Available Issues about the protection, enhancement, promotion of environmental resources have been for a long time the basis of a method of approach to a 'form' of territorial project based on strategies for local development focused on fruition of tourist in historical, cultural, heritage places and landscape. But if on the one hand tourism is a possible device to revitalize local economies in crisis, at the same time in many cases it tends to accentuate the degradation and the loss of identity of these places during the last years. Arises, therefore, the need to reverse this process and to overcome the idea of cultural heritage and landscape conceived as a commodity, and reaffirm the right to the city territories-landscapes to be areas of social life. You need to identify new design procedures able to impact on local systems and at the same time to enter into relationships with global networks, transforming specific values in local values recognizable and globally recognized using local significances to express global meanings.

  2. Možnosti dalšího vzdělávání žen na rodičovské dovolené v regionu České Budějovice

    OpenAIRE

    VONDRUŠKOVÁ, Lenka

    2015-01-01

    This work deals continuing education opportunities for women on maternity leave in the region Czech Budejovice. The aim is to answer the research questions: What are the most prevalent reasons for women on maternity leave for further education? Is the one of the main reasons better compete in the job market after leaving parental leave? The theoretical part of this thesis deals with the definition of concepts and key words, such as maternity and parental leave, training, motivation, job marke...

  3. Tělesné modifikace - fenomén dnešní doby? : Motivy pro piercing, tetování a další tělesné modifikace v historii a dnes

    OpenAIRE

    Fučíková, Tereza

    2013-01-01

    This bachelor's work deals with the theme of body modifications, especially with two which are the most common in our society: tattoo and piercing. In the theoretical part, there are emphasized roots of these modifications in the past, their changes and development till the present. This is done by compilation and comparison of books and professional works dealing with this topic. The second part is practical. It encompasses quantitative research completed with parts of interviews from pre-re...

  4. Dipendenza-Indipendenza dal Campo e Linguaggio Scritto: Uno Studio su Gruppi di Studenti di Scuola Media Superiore (Field Dependence-Field Independence and the Written Language: A Study of Groups of Senior High School Students).

    Science.gov (United States)

    Cappelletto, Anna Maria

    1995-01-01

    This article describes research carried out with 389 Italian senior high school students to test the hypothesis that there is a relationship between one's written language and cognitive style. This study takes previous research in the area of field dependence and field independence in a new direction. (CFM)

  5. In margine a un convegno. Gli intellettuali/scrittori ebrei e il dovere della testimonianza. Per Giorgio Bassani, “di là dal cuore” (Firenze, 7-8-9 novembre 2016

    Directory of Open Access Journals (Sweden)

    Martina Romanelli

    2016-12-01

    Full Text Available This brief article aims to investigate some aspects of an international conference held last November in Florence. In the year devoted to Giorgio Bassani, it was an occasion to address aspects of Jewish cultural data, with special reference to the reactions of writers in general and an individual in particular to the unspeakable horrors of the Holocaust. The conference acknowledged the need to face up to harsh reality and search for an adequate historiographical, ethical and literary response.

  6. Friedman and Schwartz sui trend monetari in USA e UK dal 1867 al 1975: una prima valutazione. (Friedman and Schwartz on monetary trends in the USA and UK from 1867 to 1975: a first assessment

    Directory of Open Access Journals (Sweden)

    M. TONVERONACHI

    2013-12-01

    Full Text Available Il lavoro esamina le tendenze monetarie , il terzo di una serie di volumi pubblicati nel corso degli ultimi venti anni da Milton Friedman e Anna Schwartz sotto gli auspici del NBER . A causa della portata limitata di questo articolo , l'autore ruota la discussione su due questioni che sembrano essere cruciali e dei dubbi leggittimi che le opere precedenti di Friedman non sono riuscite a dissipare. Il primo èil punto di vista  vista di Friedman per quanto riguarda l'assenza di divisioni teoriche tra monetaristi "buoni" e keynesiani , e il secondo è la capacità dei test di svolgere un ruolo cruciale nella scelta tra teorie contrastanti . L'autore con la presentazione e la discussione del nucleo della teoria e delle proposizioni supplementari desidera i esaminare se le loro previsioni sono conformi alle prove empiriche .The work examines Monetary Trends, the third in a series of volumes published over the last twenty years by Milton Friedman and Anna Schwartz under the auspices of the NBER. Due to the limited scope of the article, the author pivots the discussion on two questions which appear to be crucial and which Friedman’s previous works have not succeeded in dissipating legitimate doubts. The first is Friedman’s view regarding the absence of theoretical divisions between “good” monetarists and Keynesians, and the second is the ability of tests to play a crucial part in the choice between conflicting theories. The author deals with the presentation and discussion of the core of the theory and of the additional propositions before examining if their predictions conform to empirical evidence.JEL: B31, E42

  7. The Nature of Science and Librarianship and Information Science as a Discipline of Science Bilimin İçeriği ve Bir Bilim Dalı Olarak Kütüphanecilik ve Enformasyon Bilimi

    Directory of Open Access Journals (Sweden)

    Oya Gürdal

    1993-09-01

    Full Text Available Science is a systemized from of knowledge which is a product of human creativity. The aim of this study is to try to explain the nature of the concept of science, and to evaluate librarianship and information science as a scientific discipline in accordance with the synthesis achieved; and invite colleagues to consider this issue. Bilim insan yaratıcılığıyla üretilen bilginin sistematiğe edilmiş şeklidir. Bu çalışmanın amacı, bilim kavramının içeriğini açımlamaya çalışmak; varılacak sentezlerle kütüphanecilik ve enformasyon biliminin bir "bilim disiplini" olarak değerlendirmesini sunmak ve meslektaşları konu üzerinde düşünmeye çağırmaktır.

  8. Ricostruire le risorse locali per competere nel turismo. Alcune evidenze dal caso di Sextantio Hotel / The rediscovery of local assets for tourism competition. Some evidence from the case of Sextantio Hotel

    Directory of Open Access Journals (Sweden)

    Ornella Papaluca

    2016-06-01

    Full Text Available In questo paper si vuole mostrare come un prodotto turistico non mainstream possa portare alla “riscoperta” di risorse, tradizioni e conoscenze caratteristiche di un’area locale quando si coinvolgano attori all’esterno del comparto turistico. La ricerca si avvale del metodo del case study con lo scopo di illustrare le modalità con cui si è avviato un progetto imprenditoriale che ha portato ad un processo di sviluppo sostenibile. Il lavoro non si focalizza sui risultati economici, ma indaga le motivazioni e le modalità che hanno portato allo sviluppo del progetto imprenditoriale. Il processo di ricerca ha mostrato come un progetto imprenditoriale, in seguito premiato dall’Unione Europea, possa generare benefici per il borgo, come agglomerato urbano, e per la valorizzazione delle sue specifiche risorse culturali quando esso sia strutturato in modo da trarre vantaggio dalla valorizzazione degli elementi di autenticità. Il caso, che rappresenta chiaramente una best practice, mostra una possibile modalità di utilizzare lo stesso processo di avvio come modalità per sostenere economicamente il restauro dei borghi minori. Il caso ha evidenti implicazioni sia per la pubblica amministrazione che per il privato. In this paper we have shown that a no mainstream tourism product can lead to “rediscover” the local area’s typical resources, traditions and knowledge when the entrepreneur engages players outside the tourism industry. In this research we have used the case study methodology to show how an entrepreneurial project has led to a sustainable development process. This work does not focus on the economic results of the enterprise but on the motivations and on the choices that have led to its specific design. The research process shows that an entrepreneurial project, that has been awarded by a European Union Commission, can have positive effects on the village, as a human settlement, and it can appreciate village-specific cultural resources when the product has been designed to leverage on authenticity. This case, that is clearly a single best-practice, shows one way to exploit the very same start-up process as a way to sustain the restoration processes needed in these projects. Its practical implications are useful for the public and private sectors as well.

  9. Riziko ICHS určené podle různých indexů aterogenity ovlivňují i další rizikové faktory

    Czech Academy of Sciences Publication Activity Database

    Tomečková, Marie; Marušiaková, M.; Grünfeldová, H.; Peleška, Jan; Hanuš, P.

    2005-01-01

    Roč. 8, 3 Suppl. (2005), s. 43-44 ISSN 1211-9326. [Kongres o ateroskleróze /9./. 01.12.2005-03.12.2005, Špindlerův Mlýn] Institutional research plan: CEZ:AV0Z10300504 Keywords : atherogenetic indexes * risk of coronary heart disease Subject RIV: BB - Applied Statistics, Operational Research

  10. dragging the history behind in brackets. intervista a ivan vladislavic1

    African Journals Online (AJOL)

    User

    Domanda (NA): Nella novella “Afritude Sauce”, tratta dal suo libro. The Exploded View, il personaggio ... D'altro canto, è anche vero che un buon libro spesso non dipende dal soggetto, quanto dal modo in cui questo ... mondo quanto a livello di alfabetizzazione e preparazione matematica, o che si trovasse ad arrancare ...

  11. Natural Language Video Description using Deep Recurrent Neural Networks

    Science.gov (United States)

    2015-11-23

    ht = f (Wxhxt + Whhht−1) (2.1) zt = g(Wzhht) (2.2) where f and g are element-wise non-linear functions such as a sigmoid or hyperbolic tan - gent, xt...space. arXiv preprint arXiv:1301.3781, 2013. 22 [68] Volodymyr Mnih, Nicolas Heess, Alex Graves, et al. Recurrent models of visual attention. In...2010. 2 36 Bibliography [107] Li Yao, Atousa Torabi, Kyunghyun Cho, Nicolas Ballas, Christopher Pal, Hugo Larochelle, and Aaron Courville. Describing

  12. Berluskoni zakrõl grud na kartine / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2008-01-01

    Itaalia peaminister Silvio Berlusconi lasi oma ametiresidentsis Giovanni Battista Tiepolo maali "La Verita svelata dal Tempo" koopial naise palja rinna kinni katta. Maali originaal asub Vicenza muuseumis

  13. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ression is sensitive to nitrogen catabolite repression and regulated by Dal80p; contains transmembrane domai...n; Dcg1p [Saccharomyces cerevisiae] METRILVVNPNSSKSMTVSLRETIEKTFSMESCKISYFTGPDTSPPQIDGQETSIKSMEACLPLLIDDQESV

  14. Features of formation of the individual students in secondary and high school

    Directory of Open Access Journals (Sweden)

    V.O. Sutula

    2014-03-01

    Full Text Available Purpose: Analyzed features of motivation to achievement and need to praise the students of secondary and high school. Material: In the survey took part 1634 students of secondary school in Kharkov, Vinnitsa and Lugansk regions. Carried out a comprehensive psychological testing, which allowed to find out the level of motivation of students to achievement and need for praise. Results: It is shown that during the period of study at school from fifth to eleventh classes a number of students have a low motivation to achievements, and low need for praise. Confirmed provision indicates that the modern school is still not fully realized the potential of educational pedagogy. Conclusions: It is shown that the formation personality physical education students in general education is possible only with the active and conscious of their participation in various forms of sports and recreation activities undertaken in the modern school.

  15. The Periodization of Fighting on Donbass in 2014–2015 years

    Directory of Open Access Journals (Sweden)

    Nikolai V. Mityukov

    2016-03-01

    Full Text Available The article based on the analysis of the data gives the attempt of the periodical press of combat actions on the territory of Donbas in 2014-2015: there are presented clearly two periods. The first is the period of the maneuvers from 7 April 2014 to 5 September 2014, characterized by the presence of fortified centres which both sides tried to get around to entering the operating room. In this period there is no clear front line, fighting was an interaction maneuverable shock groups. The second period is the period position of action from September 5 to the present time, characterized by clearly formed the front line, as a rule, deeply echeloned. Active hostilities reached a peak during the battle for Lugansk and the Donetsk airport and Debaltsevo during the operation.

  16. PROSPECTS OF COOPERATION OF BORDER REGIONS OF THE SOUTH OF RUSSIA AND SOUTHEAST OF UKRAINE: MEDIUM-TERM SCENARIO

    Directory of Open Access Journals (Sweden)

    Inna Mitrofanova

    2015-10-01

    Full Text Available In article the main competitive advantages of the region «Donbass», the priority directions of long-term development of a border territorial and economic complex of the Rostov region are revealed; potential of the remaining economic relations between social-production complexes of the republics of Donetsk people’s Republic, Lugansk people’s Republic and Russia, taking into account activation of integration processes in the Russian economy in the sphere of monetary circulation is opened; formats of economic cooperation between the Ukrainian and Russian regions capable to give incentive for restoration of development of the industry of Donbass are considered, will open new sales markets of production.

  17. 13 CFR 120.315 - Interest rate and loan limit.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Interest rate and loan limit. 120... Special Purpose Loans Disabled Assistance Loan Program (dal) § 120.315 Interest rate and loan limit. The interest rate on direct DAL loans is three percent. There is an administrative limit of $150,000 on a...

  18. High-level production of α-amylase by manipulating the expression of alanine racamase in Bacillus licheniformis.

    Science.gov (United States)

    He, Penghui; Zhang, Zeying; Cai, Dongbo; Chen, Yaozhong; Wang, Hao; Wei, Xuetuan; Li, Shunyi; Chen, Shouwen

    2017-09-01

    To improve target protein production by manipulating expression levels of alanine racemase in Bacillus licheniformis. The gene of dal was identified to be responsible for alanine racemase function. Based on the selection marker of dal, a food-grade expression system was constructed in B. licheniformis, and effects of different dal expression levels mediated by promoters on α-amylase production were investigated. The highest α-amylase activity (155 U/ml) was obtained in BL10D/pP43SAT-PtetDal, increased by 27% compared with that of the control strain BL10/pP43SAT in tetracycline-based system (123 U/ml). Moreover, the dal transcriptional level was not correlated positively with that of amyL. A food-grade system for high-level production of α-amylase was constructed in B. licheniformis, revealing that expression levels of selection marker significantly affected target protein production.

  19. Resim-İş Eğitimi Anabilim Dalı Atölye (Grafik Dersinde Yazı ve Tipografi Öğretimi Uygulamaları / Practices of Writing and Typography Teaching at the Department of Fine Arts Education Workshop (Graphic Design Course

    Directory of Open Access Journals (Sweden)

    Şirin BENUĞUR

    2012-06-01

    Full Text Available Bu araştırmanın amacı, Eğitim Fakültesi Güzel Sanatlar Eğitimi Bölümü Resim İş Eğitimi ABD Anasanat Atölye (Grafik ve/veya Seçmeli Sanat Atölye (Grafik derslerinde tipografi eğitiminin nasıl gerçekleştirildiğini ortaya koymaktır. Araştırma tarama modelinde desenlenmiştir. Hazırlanan anket, 2007-2008 öğretim yılının bahar döneminde 24 üniversitede bu dersi veren/vermiş olan 45 öğretim elemanına uygulanmıştır. Ayrıca çalışma evreninden 7 öğretim elemanıyla yarı yapılandırılmış görüşme gerçekleştirilmiştir. Araştırma sonucunda sanat eğitimcisi yetiştirmede tipografi eğitiminin çok önemli ve gerekli olduğu, tipografi öğretimini planlarken farklı konu ve tekniklerden yararlanılarak uygulama yapılmasına, kuramsal bilgi vermeye, proje çalışmaları yaptırmaya, örneklerle konuyu açıklamaya, çesitli öğretim yöntem ve tekniklerinden yararlanmaya, tipografi öğretimini desteklemeye yönelik çeşitli etkinlikler gerçekleştirmeye önem verildiği belirlenmiştir. Tipografi öğretiminde öğrenciden, kaynak kitap ve ders saati süresinin yetersizliğinden kaynaklanan sorunlar yaşandığı belirlenmiştir. Yazı dersinin tipografi öğretimine temel oluşturacağını ifade eden öğretim elemanları, dersin içeriğinin alan uzmanları tarafından zenginleştirilmesine, ders süresinin arttırılmasına ve tipografi dersleriyle desteklenmesine yönelik önerilerde bulunmuşlardır.

  20. Diverzita či odlišné chování? Sociální distance od Romů, gayů, lidí s AIDS a dalších menšin

    Czech Academy of Sciences Publication Activity Database

    Klicperová-Baker, Martina; Košťál, J.

    2012-01-01

    Roč. 56, č. 4 (2012), s. 297-314 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : diversity * minorities * social distance Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  1. Zpráva o prvním archeobotanickém nálezu líčidla amerického (Phytolacca americana L.) ve střední Evropě a o dalších druzích užitkových rostlin z Prahy-Hradčan

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    2007-01-01

    Roč. 59, č. 2 (2007), s. 353-370 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : plant macroremains * medieval time * early modern times * Prague-Hradčany * utility plants * Phytolacca americana Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Jak vypráví drama aneb O generativním a inscenačním vypravěči, zcizovaném vyprávění, voice-overu a dalších vyprávěcích strategiích dramatu

    Czech Academy of Sciences Publication Activity Database

    Merenus, Aleš

    2014-01-01

    Roč. 17, č. 1 (2014), s. 301-314 ISSN 1803-845X Institutional support: RVO:68378068 Keywords : narrating in drama * inner and outer communication system in drama * typology of narrative strategies in drama * modern drama Subject RIV: AJ - Letters, Mass-media, Audiovision

  3. Lidar fluoro sensor measurements of pine trees affected by the Blastophagus destruens Wollaston in the Frascati ENEA centre; Monitoraggio mediante lidar fluorosensore di piante di pino domestico attaccate dal coleottero Scolitide Blastofago Distruttore (Blastophagus Destruens W.) al centro ENEA di Frascati

    Energy Technology Data Exchange (ETDEWEB)

    Barbini, R.; Colao, F.; Fantoni, R.; Palucci, A.; Ribezzo, S. [ENEA, Centro Ricerche Frascati, Rome (Italy). Dip. Innovazione; Cinti, S. [Osservatorio per le Malattie delle Piante, Regione Lazio, Rome (Italy); Paparatti, B. [Tuscia Univ., Viterbo (Italy). Dip. Protezione delle Piante, Sez. Entomologia

    1996-10-01

    The lidar fluoro sensor available at ENEA-Frascati has been used for a series of laboratory measurements to monitor the health of pine trees (Pinus Pinea L.) cut branches. The present campaign has been carried out in the Frascati Research Center to investigate pine plants affected by a parasite (Blastophagus destruens Wollaston), and to follow the effects of the phyto-chemical substances used in the therapy. The laboratory tests have been carried on during the first week of therapy and in the following months. A probe laser has been used to measure the chlorophyll LIF (laser induced fluorescence) signals at 690 nm, before and after switching on either a saturating actinic lamp or an intense laser pulse. The detected induction curves supplied us with information on the plant photosynthetic activity and on its time adaptation to the light exposure.

  4. Global solar irradiation in Italy during 1994 : monthly average daily values for 1614 sites estimated from Meteosat images; Radiazione solare globale al suolo in Italia nel 1994 : valori medi mensili per 1.614 localita` italiane stimate a partire dalle immagini fornite dal satellite Meteosat

    Energy Technology Data Exchange (ETDEWEB)

    Cogliani, E; Mancini, M; Petrarca, S; Spinelli, F [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dip. Energia

    1995-10-01

    The global solar radiation over Italy is estimated from Meteosat secondary images in the visible band. The stimation method relies on the fact that the cloud cover on a given area of the Earth`s surface statistically determines the amount of solar radiation falling on that area. Estimated values of the monthly average daily global radiation on a horizontal surface for the 1994 have been compared with values computed from data measured by the stations of the two Italian radiation networks: the Meteorological Service of the Italian Air Force and the National Agrometeorological Network (a total of 36 stations have been considered). The mean percentage difference between estimated and computed values over the year is 6 per cent. In the present report, the monthly maps of radiation over Italy and the estimated monthly average daily values for over 1600 sites (having more than 10,000 inhabitants) are given. In the yearly reports to be issued in the years to come, maps and mean values over the period starting with 1994 will be given as well.

  5. Dal divario Nord-Sud alla convergenza: il modelo dell'intervento straordinario a l'azione della Cassa per in Mezzogiorno, durante e oltre la golden age = From the North-South gap to the convergence: The model of the extraordinary intervention and the...

    Directory of Open Access Journals (Sweden)

    Amedeo Lepore

    2012-07-01

    Full Text Available La storiografia incentrata sul tema della Cassa per il Mezzogiorno è molto ampia e si sviluppa in relazione non solo alle questioni generali riguardanti l’intervento straordinario, ma anche alle molteplici forme di articolazione settoriale e territoriale dell’iniziativa pubblica per la ripresa e lo sviluppo del Sud. Una ricostruzione puntuale delle vicende della Cassa, che per oltre un quarantennio– anche se con diversità di impostazione nelle varie fasi –ha operato come strumento delle strategie per lo sviluppo del Mezzogiorno, richiede un impegno molto approfondito. Tuttavia, anche senza effettuare una dettagliata cronistoria dell’attività dell’Ente, si può ricomporre una visione d’insieme, attraverso l’interpretazione di un modello di intervento pubblico collegato strettamente agli eventi economici concreti e all’andamento dei processi di industrializzazione che hanno interessato i territori meridionali.La scelta di una prospettiva di lungo periodo, imperniata sull’analisi dell’intervento straordinario nel suo complesso, ha permesso un giudizio più equilibrato su tutta l’epoca dell’azione “aggiuntiva” dello Stato per il recupero del divario meridionale, superando eccessive semplificazioni nella valutazione di quell’esperienza e confutando pareri sommari sui suoi risultati, spesso privi di fondamento. Al tempo stesso, una visione ampia ha fatto emergere un percorso in grado di associare il caso della Cassa per il Mezzogiorno, controverso e difficile, ma considerato anche un modello tra i più avanzati a livello internazionale, a un tema di grande importanza, come quello delle politiche di sviluppo adottate per affrontare i problemi dell’arretratezza economica e per avviare a soluzione i dilemmi del dualismo.L’analisi effettuata ha provato l’esistenza di un indiscutibile progresso economico nel periodo della golden age. Durante quell’epoca di prosperità non solo si realizzò un notevole avanzamento delle aree del Paese che già possedevano un’armatura industriale, ma si ottenne, contemporaneamente, il risultato, per nulla scontato, di una modernizzazione della struttura economica del Mezzogiorno –attraverso la politica delle opere pubbliche, prima, e dell’industrializzazione vera e propria, poi– nonché, di un recupero del divario accumulato con le regioni settentrionali. In questo modo, l’intervento straordinario, indirizzato verso obiettivi macroeconomici e guidato da una tecnostruttura come quella della Cassa, al tempo stesso autonoma e reattiva alle scelte strategiche del governo, si dimostrò lo strumento più efficace e innovativo per fare dell’Italia intera una potenza industriale. L’allontanamento da questi esiti, nella fase successiva dominata dalla crisi petrolifera e dalle politiche di ristrutturazione industriale, pur determinando una netta inversione di tendenza, non ha messo in discussione il valore dell’esperienza iniziale della Cassa per il Mezzogiorno, capace di aprire la strada alla crescita economica italiana negli anni del boom.Historiography focusing on the Cassa per il Mezzogiorno is indeed vast and developed not only in regard to the main issues concerning the extraordinary intervention, but also to the various sectorial and territorial articulations public interventions for the recovery of Southern Italy undertook. Achieving a punctual reconstruction of the goings-on of the Cassa, an istitution that, for more than forty years –despite some differences in planning during its various phases– operated as an instrument to implement the strategies focusing on developing Southern Italy, requires a very deep commitment. However, an effective overall view can be reconstructed by interpreting a public intervention model strictly linked to the concrete economic events and to the trends of those industrial processes implemented in Southern Italy, even without going through a detailed chronicle of this entity.The choice of a long-term perspective, focused on the analysis of the extraordinary intervention in its entirety, allowed for a more balanced evaluation of all the era regarding the “supplementary” actions the Italian State carried out to bridge the gap of its Southern regions, going beyond the exaggerated simplifications plaguing the evaluations of such an experience and confuting those hasty, often baseless, judgments on the results it achieved. At the same time, a wide viewpoint on the matter let a research path emerge, able to link the specific case of the Cassa per il Mezzogiorno, itself difficult and controversial, while being considered one of the most advanced models internationally, with a very significant theme, such as the development policies implemented to tackle the problems of economic backwardness and to begin solving the dilemmas brought by the dualism.The analysis which was carried out proved the existence of an unquestionable economic progress during the golden age. In that era of prosperity, not only did the areas in Italy already possessing a significant industrial presence experience significant advancement, all the while, the result, by no means granted, of a modernized economic structure in Southern Italy was achieved –first through a policy focused on public works and then by true forms of industrialization– and of a significant recovery of the gap the area had towards the Northern regions of Italy. Thus, the extraordinary intervention, focused on macroeconomic goals and driven by a technical structure such as the Cassa, itself autonomous and reacting towards governmental choices at the same time, revealed itself to be the most effective and innovative tool in turning the whole of Italy into an industrial power. The departure from such results in the following phase, dominated by the oil crisis and by the policies of industrial reconstruction, despite triggering a significant trend inversion, never questioned the value of the Cassa per il Mezzogiorno’s initial experience, which was able to open and show the way to economical growth, during the Italian boom years.

  6. Další využití šedé literatury - propojení výsledků výzkumu a plných textů publikací:Vybrané předběžné výsledky

    OpenAIRE

    Farace, Dominic

    2011-01-01

    This presentation deals with the research design and preliminary results of EPP, an Enhanced Publications Project carried out among a pool of over 280 authors in the International Conference Series on Grey Literature. In a way, this project seeks to circumvent the data vs. documents camp in the grey literature community by way of a middle ground provided through enhanced publications. Enhanced publications allow for a fuller understanding of the process in which data and information are used ...

  7. Problematika rizikového chování vývoje dětí a dospívajících: hlavní témata a implikace pro další výzkum

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Polišenská, Veronika; Balaštíková, Veronika; Hrdlička, M.

    2005-01-01

    Roč. 49, č. 6 (2005), s. 524-539 ISSN 0009-062X R&D Projects: GA AV ČR IBS7025354 Institutional research plan: CEZ:AV0Z70250504 Keywords : adolescence * development * risky behavior Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

  8. Inzulínová rezistence a postprandiální stav u diabetu 2. typu. Vliv frekvence a složení jídel na metabolismus glukózy a další projevy metabolického syndromu

    OpenAIRE

    Thieme, Lenka

    2017-01-01

    The project focuses on dietary interventions in type 2 diabetes(T2D). The aim was to investigate how glucose metabolism and other manifestations of insulin resistance should be influenced by a) the composition of macronutrients and b) frequency of meals; and to characterize the possible mechanisms of these dietary interventions in patients with T2D. A. In a randomized crossover study, 50 patients T2D and 50 age-matched healthy subjects underwent in a random order meal tolerance tests with thr...

  9. Analýza vztahu náboženského vyznání a plodnosti ve Sčítání lidu 2011 (se zařazením vlivu dalších proměnných)

    Czech Academy of Sciences Publication Activity Database

    Růžičková, Markéta; Hamplová, Dana

    2016-01-01

    Roč. 58, č. 3 (2016), s. 213-229 ISSN 0011-8265 R&D Projects: GA ČR(CZ) GA14-15008S; GA ČR GB14-36154G Institutional support: RVO:68378025 Keywords : religious belief * fertility * census Subject RIV: AO - Sociology, Demography

  10. Další vzdělávání dospělých v České republice – kdo se ho účastní a s jakými důsledky?

    Czech Academy of Sciences Publication Activity Database

    Simonová, N.; Hamplová, Dana

    2016-01-01

    Roč. 52, č. 1 (2016), s. 3-25 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GA14-15008S Institutional support: RVO:68378025 Keywords : adult education * participation in education * occupational prestige Subject RIV: AO - Sociology , Demography Impact factor: 0.143, year: 2016

  11. Modelování dopadů ekologické daňové reformy a možné směry jejího dalšího vývoje

    OpenAIRE

    Koderová, Alena

    2008-01-01

    The main objective of the thesis is to identify appropriate approach to evaluation of impacts of the first phase of the ecological tax reform in the Czech Republic, its consequent adaption and application for the particular purpose. The input-output analysis has been found as the most convenient solution for such a sort of analysis. The analysis has been used for the evaluation of impacts on final production prices of each NACE sector resulting from introduction of new taxes on electricity, s...

  12. IMPREMAS Project, Pilo project for the integration between Environmental Management System and safety Management System; Il Progetto IMPREMAS, Progetto pilota per l'eco-gestion delle Piccole e Medie Imprese classificate a rischio per l'uso e lo stoccaggio di sostanze pericolose previste dal DPR 17.5.1988 n. 175

    Energy Technology Data Exchange (ETDEWEB)

    Luciani, R.; Andriola, L.; Brunetti, N.; Caropreso, G. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The topic discussed in this report can be inserted within the context of case studies carried out by ENEA in the promotion of Environmental Management Systems (EMAS-ISO14000). During the IMPREMAS project ENEA has therefore set up a method of integration between Environmental Management System and Safety Management System. [Italian] L'argomento trattato nel presente lavoro si inserisce nel contesto degli studi effettuati dall'ENEA nella promozione dei Sistemi di Gestione Ambientale (EMAS-ISO14000). ENEA durante il progetto IMPREMAS ha sviluppato un metodo per l'integrazione dei Sistemi di Gestione Ambientale con i Sistemi di Gestione della Sicurezza.

  13. Hra na flétnu v předškolním věku a význam hudby v dalším životě dítěte

    OpenAIRE

    PAVLIŠOVÁ, Irena

    2013-01-01

    This bachelor thesis called "Playing a Flute at Preschool Age and the Importance of Music for Further Life of a Child" aims to find out what is the importance of music for further life of children who learnt to play a flute at preschool age. The theoretical part introduces terms such as a recorder, it also focuses on the therapeutic playing a flute and its history and it also deals with the idea of professor Václav Žilka as reflected in his book called "Veselé pískání - zdravé dýchání". Other...

  14. Myšlenka přirozenosti umění v díle J. H. Alsteda, dalších protestantských myslitelů jeho doby a J. A. Komenského

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Kateřina

    2015-01-01

    Roč. 45, 93/94 (2015), s. 116-127 ISSN 0323-2220 R&D Projects: GA ČR GB14-37038G Institutional support: RVO:67985955 Keywords : Comenius * J. H. Alsted * ars imitatur naturam Subject RIV: AA - Philosophy ; Religion

  15. The Control of Fast Reactors: Current Methods and Future Prospects; Controle des Reacteurs a Neutrons Rapides. Methodes Actuelles et Perspectives d'Avenir; Upravlenie reaktorami na bystrykh nejtronakh. sushchestvuyushchie metody i dal'nejshie perspektivy; Control de Reactores Rapidos: Metodos Actuales y Perspectivas

    Energy Technology Data Exchange (ETDEWEB)

    Loewenstein, W. B. [Argonne National Laboratory, IL (United States)

    1964-06-15

    The practical aspects of providing adequate reactivity for the control of fast reactors which differ significantly from those used to control thermal-neutron systems are discussed. These differences result primarily from the rather small fast-neutron cross-sections. There are no strong poisons in a fast-neutron system. As a result, the strong thermal-reactor fission-product poisons (e.g. Xe and Sm) require significantly less reactivity override than the reactivity loss from destruction, by fission and capture, of fissionable material. Because the fast-spectrum atomic cross-sections are relatively small compared with their thermal counterparts, the atomic density of the material plays an important role in the choice of control materials. The current generation of fast-neutron reactor control mechanisms is described. These tend to exploit neutron leakage control, where applicable. If leakage control is not feasible, control by moving of core material has found considerable acceptance. Limited absorber control is also being used. None of these methods has significant advantages for application to the large conceptual central-station power-breeder reactor system unless the internal (core) breeding ratio is very high. Considerable ingenuity will have to be applied for use of either absorber or spectral-shift control methods without seriously affecting the desired and often required neutron economy. Exploratory results pertaining to the advanced systems are cited. The reactivity for control is dictated by reactor shutdown requirements, the reactor fuel cycle (excess reactivity) and, to a lesser extent, the dominant feedbacks. The excess reactivity requirements can be quite well specified in terms of a given fuel cycle but may vary considerably for several similar systems operating on different fuel cycles. The required shutdown reactivity, may be almost arbitrarily specified beyond certain limits. However, there are certain philosophical implications which prevail regarding the specification of this parameter. These considerations are discussed in terms of control reactivity in existing fast reactors as opposed to the amount that is really required for fast power-breeder reactor operation. Typical power- and temperature-dependent feedback parameters are cited for determination of their influence upon the control reactivity requirements. The methods used to predict the reactivity worth of control mechanisms have evolved from crude estimates to quite reliable calculations which can be confirmed by experimental data from critical assemblies. Experimental results and currently reliable analytical techniques are described. Critical experiments for the current generation of fast reactors included many investigations pertaining to the reactivity worth of their control mechanisms as well as peripheral experiments for larger-core-volume advanced systems. Exploratory analytical studies, which indicate that detailed experimental mockup investigations may not be required in the future, are cited. (author) [French] L'auteur examine dans ce memoire les aspects pratiques du probleme qui consiste a fournir une reactivite suffisante pour le controle des reacteurs a neutrons rapides; ce probleme differe dans une grande mesure de celui du controle des reacteurs a neutrons thenniques. Ces differences sont dues en premier lieu au fait que les sections efficaces d'absorption des neutrons rapides sont assez faibles. Il n'existe pas de poisons forts dans un reacteur a neutrons rapides. En consequence, les poisons forts que sont certains produits de fission dans un reacteur thermique (par exemple Xe et Sm) exigent un exces de reactivite beaucoup moins important que n'en exige la perte de reactivite due a la destruction de produit fissile par fission et capture. Comme les sections efficaces pour les neutrons rapides sont relativement petites comparees aux valeurs correspondantes pour les neutrons thermiques, la densite atomique du materiau joue un role important dans le choix des materiaux absorbants. L'auteur decrit les modeles actuels de mecanismes de controle d'un reacteur a neutrons rapides. Ceux-ci ont tendance a tirer parti, la ou cela est possible, du principe du controle des fuites de neutrons. La ou il n'est pas possible d'appliquer ce principe, on a frequemment recours au controle par deplacement de matieres du coeur. On a egalement recours dans une certaine mesure au controle par absorbant. Aucune de ces methodes ne presente d'avantages notables lorsqu'elle est appliquee au reacteur surgenerateur d'une centrale, a moins que le rapport de conversion dans le coeur ne soit tres eleve. Il faudra deployer beaucoup d'ingeniosite pour trouver le moyen d'utiliser les methodes de controle par absorbant ou par modification du spectre sans affecter gravement l'economie des neutrons souhaitee et souvent necessaire. L'auteur mentionne les resultats d'etudes portant sur les systemes les plus perfectionnes. La reactivite qu'il faut donner aux barres de controle est determinee par la reactivite necessaire pour l'arret brusque du reacteur, le cycle du combustible (exces de reactivite) et dans une mesure mouns grande, les effets des facteurs dominants. On peut fixer tres exactement l'exces de reactivite pour un cycle de combustible donne, mais cet exces peut varier considerablement pouf des reacteurs similaires, s'ils fonctionnent avec des cycles de combustible differents. On peut, dans certaines limites, fixer presque arbitrairement la reactivite necessaire pour l'arret brusque. Cependant, certaines considerations militent en faveur d'une determination precise de ce parametre. L'auteur examine la question sous tous ces aspects en comparant la reactivite des barres de controle dans les reacteurs a neutrons rapides actuels et la quantite de reactivite dont on a reellement besoin pour le fonctionnement d'un reacteur surgenerateur a neutrons rapides.. P cite les parametres typiques dependant de la puissance et de la temperature pour determiner leurs effets sur la quantite de reactivite qu'il faut donner aux barres de controle. Les methodes utilisees pour la prevision de l'efficacite des mecanismes de controle ont evolue: au debut, il s'agissait d'evaluations approximatives; on fait maintenant des calculs tout a fait surs que peuvent confirmer les donnees experimentales obtenues grace aux assemblages critiques. L'auteur indique dans ce memoire certains resultats experimentaux et expose les methodes analytiques sflres que l'on emploie couramment. Les experiences critiques portant sur la generation actuelle de reacteurs a neutrons rapides ont comporte de nombreuses recherches concernant l'efficacite de leur mecanisme de commande, ainsi que des experiences a la peripherie du coeur pour l'etude de reacteurs perfectionnes ayant un coeur d'un plus grand volume. L'auteur mentionne des etudes analytiques preliminaires qui montrent qu'il ne faudra peut-etre pas proceder dans l'avenir a des recherches experimentales detaillees sur maquette. (author) [Spanish] El autor examina los aspectos practicos del problema consistente en obtener una reactividad suficiente para el control de los reactores de neutrones rapidos, control que es muy diferente del utilizado en los sistemas de neutrones termicos. Las diferencias se deben en primer lugar a los valores relativamente pequenos de las secciones eficaces para los neutrones rapidos. En un sistema de neutrones rapidos no hay venenos fuertes. Como consecuencia, los fuertes venenos de fision (por ejemplo, el Xe y el Sm) en los reactores termicos exigen un exceso de reactividad mucho menor que la perdida de reactividad causada por la destruccion del material fisionable por fision y captura. Como las secciones eficaces del espectro de neutrones rapidos son relativamente pequenas comparadas con las correspondientes a los neutrones termicos, la densidad atomica del material desempena un papel importante al elegir los materiales de las barras de control. El autor examina los actuales mecanismos de control de los reactores de neutrones rapidos. En la medida de lo posible aprovechan el control por medio de fugas neutronicas. Si este metodo no es aplicable se suele recurrir al control por desplazamiento de los materiales del cuerpo. Igualmente se recurre a un control limitado utilizando un absorbente. Ninguno de estos metodos presenta ventajas considerables cuando se aplica a los'grandes reactores de potencia regeneradores, a menos que la razon interna de regeneracion (del cuerpo) sea muy elevada. Se requerira mucha habilidad para utilizar metodos de control basados en el empleo de un absorbente o en el desplazamiento espectral sin afectar en grado apreciable la economia neutronica deseada y a menudo necesaria. El autor cita algunos resultados preliminares obtenidos con sistemas perfeccionados. La reactividad de control viene determinada por los requisitos relativos a la parada del reactor, al ciclo del combustible (exceso de reactividad) y, en menor medida, por la realimentacion dominante. Pueden especificarse perfectamente los requisitos relativos al exceso de reactividad para un ciclo de combustible determinado, pero esos requisitos varian de modo considerable en otros sistemas similares que funcionen con distintos ciclos de combustible. A partir de ciertos limites, pueden fijarse casi arbitrariamente les requisitos relativos al exceso de reactividad. Sin embargo, existen algunas consideraciones generales que rigen la determinacion de este parametro. Se tienen en cuenta dichas consideraciones al examinar la reactividad de control en los actuales reactores de neutrones rapidos comparandola a la cantidad realmente necesaria para el funcionamiento de reactores de potencia regeneradores y neutrones rapidos. El autor cita parametros tipicos de potencia y de realimentacion en funcion de la temperatura a fin de determinar su influencia en los requisitos relativos a la reactividad de control. Los metodos utilizados para predecir la efectividad de los mecanismos de control han evolucionado desde evaluaciones poco precisas hasta calculos muy fidedignos confirmados experimentalmente en conjuntos criticos. El autor describe los resultados experimentales y las tecnicas analiticas, que suelen ser seguras. Los experimentos criticos que precedieron la construccion de los actuales modelos de reactores de neutrones rapidos comprendieron muchas investigaciones sobre la efectividad de sus mecanismos de control y experimentos marginales para sistemas perfeccionados en los que el cuerpo tiene un volumen mayor. El autor cita algunos estudios analiticos provisionales de los que se puede deducir que no habra necesidad de efectuar en lo sucesivo investigaciones experimentales detalladas en maquetas. (author) [Russian] Obsuzhdajutsja prakticheskie aspekty obespechenija sootvetstvujushhej reaktivnosti dlja upravlenija reaktorami na bystryh nejtronah, kotorye sushhestvenno otlichajutsja ot analogichnyh aspektov pri osushhestvlenii kontrolja sistem teplovyh nejtronov. Jeti razlichija vyzvany glavnym obrazom blagodarja nebol'shim sechenijam na bystryh nejtronah. V sistemah na bystryh nejtronah otsutstvujut sil'nye poglotiteli nejtronov. V rezul'tate jetogo takie sil'nye poglotiteli nejtronov v teplovyh reaktorah, kak produkty raspada (naprimer He i Zt)trebujut znachitel'no men'she reaktivnosti na ih kompensaciju, chem poterja reaktivnosti, vyzvannaja deleniem i zahvatom rasshhepljajushhihsja materialov. Poskol'ku atomnye sechenija bystrogo spektra dovol'no maly po sravneniju s sechenijami dlja teplovyh nejtronov atomnaja plotnost' materiala igraet vazhnuju rol' pri vybore materialov dlja regulirujushhih sterzhnej. Opisyvajutsja sushhestvujushhie tipy kontrol'nyh mehanizmov reaktorov na bystryh nejtronah. Jeti sposoby napravleny na vozmozhnost' ispol'zovanija, tam, gde jeto priemlemo,, kontrolja za utechkoj nejtronov. Kogda takoj kontrol' prakticheski neosushhestvim, to pri menjaetsja kontrol' s pomoshh'ju peredvizhenija materialov aktivnoj zon'/. Primenjaetsja takzhe ogranichennyj kontrol' s pomoshh'ju poglotitelej. Odnako ni odin iz jetih metodov ne daet sushhestvennogo preimushhestva dlja togo, chtoby ego primenjat' k jenergeticheskim reaktoram- razmnozhiteljam krupnyh central'nyh atomnyh stancij, esli vnutrennij (v aktivnoj zone) kojefficient vosproizvodstva ne javljaetsja ochen' vysokim. Dolzhna byt' projavlena bol'shaja izobretatel'nost' dlja togo, cht.oby ispol'zovat' libo metod poglotitelja, libo metod regulirovki spektral'nogo smeshhenija, ne okazav ser'eznogo vlijanija na zhelaemuju i ..chasto trebuemuju jekonomiju nejtronov. Privodjatsja rezul'taty issledovanij, imejushhie-otnoshenie k usovershenstvovannym sistemam. Reaktivnost', neobhodimaja dlja upravlenija reaktorom, opredeljaetsja potrebnostjami ostanovki reaktora, toplivnym ciklom reaktora (izbytochnaja reaktivnost') i v gorazdo men'shej stepeni dominirujushhej obratnoj svjaz'ju. Trebovanija k izbytochnoj reaktivnosti, mogut byt' s uspehom opredeleny dannym toplivnym ciklom, odnako mogut znachitel'no var'irovat'sja dlja celogo rjada analogichnyh sistem, rabotajushhih na razlichnyh toplivnyh ciklah. Neobhodimuju ostatochnuju reaktivnost' mozhno ustanovit' pochti proizvol'no vyshe opredelennoj predel'noj velichiny. Odnako imeetsja celyj rjad filosofskih momentov, kotorye kasajutsja specifikacii jetogo parametra. Jeti soobrazhenija obsuzhdajutsja s tochki zrenija regulirovki reaktivnosti v sushhestvujushhih reaktorah na bystryh nejtronah, poskol'ku jeto svjazano s kolichestvom, kotoroe dejstvitel'no trebuetsja dlja jekspluatacii jenergeticheskih reaktorov-razmnozhitelej. Privodjatsja tipichnye parametry moshhnosti i parametry temperatury, zavisjashhej ot obratnoj svjazi dlja togo, chtoby opredelit' ih vlijanie na trebovanija po upravleniju reaktivnost'ju . Metody, ispol'zuemye dlja togo, chtoby predopredelit' reaktivnost' sootvetstvujushhih kontrol'nyh mehanizmov, polucheny na osnove grubyh podschetov, a takzhe s pomoshh'ju vpolne nadezhnyh vychislenij, kotorye mogut byt' podtverzhdeny jeksperimental'nymi dannymi, poluchennymi na kriticheskih sborkah. Opisyvajutsja jeksperimental'nye rezul'taty i nedavno ispol'zovannye tochnye analiticheskie metody. Kriticheskie jeksperimenty dlja sushhestvujushhej gruppy reaktorov na bystryh nejtronah vkljuchajut mnogo issledovanij, otnosjashhihsja k reaktivnoj sposobnosti ih kontrol'nyh mehanizmov', a takzhe pereferijnyh jeksperimentov dlja usovershenstvovannyh sistem s gorazdo bol'shim ob{sup e}mom aktivnoj zony. Privodjatsja issledovatel'skie analiticheskie raboty, kotorye ukazyvajut na to, chto v budushhem, vozmozhno, ne potrebuetsja provedenie podrobnyh issledovanij na jeksperimental'nyh modeljah v natural'nuju velichinu. (author)

  16. Návrh změn marketingových aktivit vybrané společnosti zaměřených na podporu volby dalšího vzdělávání

    OpenAIRE

    Šatníková, Zuzana

    2015-01-01

    Diplomová práce se zaměřuje na propagaci oboru Mechanik plastikářských strojů na Středním odborném učilišti Svitavy za podpory společnosti REHAU, s.r.o. za účelem získání více uchazečů o obor. Na základě finančních analýz a realizovaného marketingového výzkumu jsou provedeny návrhy. Pro SOU Svitavy a společnost REHAU, s.r.o. jsou navrženy změny komunikačních aktivit, vylepšení produktu školy a úprava personálního informačního systému. This Master’s thesis focuses on promoting of specializa...

  17. „Medicinisches Pest-Consilium” a další lékařská pojednání publikovaná s podporou úředních autorit v habsburské monarchii v druhé polovině 17. století

    Czech Academy of Sciences Publication Activity Database

    Jirková, Pavla

    2017-01-01

    Roč. 50, č. 2 (2017), s. 122-140 ISSN 0300-4414 R&D Projects: GA ČR GA13-35304S Institutional support: RVO:67985998 Keywords : plague * epidemics * medicine Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  18. Pozdně středověké odpadní jímky na Drůbežím trhu v Opavě: pepř, kmín, cibule, černucha a další rostliny (archeologický výzkum v r. 2005)

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    2011-01-01

    Roč. 60, č. 1 (2011), s. 1-46 ISSN 1211-3131 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeobotanical analyses * medieval Opava * archaeological sites * late medieval cesspits Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. K historii pojmu Východ-Západ a k možnostem jeho dalšího využití ve slavistické literární a kulturní vědě

    Czech Academy of Sciences Publication Activity Database

    Ulbrechtová, Helena

    2008-01-01

    Roč. 77, 1-3 (2008), s. 307-323 ISSN 0037-6736. [Mezinárodní sjezd slavistů /14./. Ochrid, 10.09.2008-16.09.2008] Institutional research plan: CEZ:AV0Z90920516 Keywords : Slavic Studies * interdisciplinary comparative studies * culturology * East-West Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. 150th Anniversary of the Astronomical Observatory Library of Sciences

    Science.gov (United States)

    Solntseva, T.

    The scientific library of the Astronomical observatory of Kyiv Taras Shevchenko University is one of the oldest ones of such a type in Ukraine. Our Astronomical Observatory and its scientific library will celebrate 150th anniversary of their foundation. 900 volumes of duplicates of Olbers' private library underlay our library. These ones were acquired by Russian Academy of Sciences for Poulkovo observatory in 1841 but according to Struve's order were transmitted to Kyiv Saint Volodymyr University. These books are of great value. There are works edited during Copernicus', Kepler's, Galilei's, Newton's, Descartes' lifetime. Our library contains more than 100000 units of storage - monographs, periodical astronomical editions from the first (Astronomische Nachrichten, Astronomical journal, Monthly Notices etc.), editions of the majority of the astronomical observatories and institutions of the world, unique astronomical atlases and maps

  1. Efficiency evaluation of three fluidised aerobic bioreactor based ...

    African Journals Online (AJOL)

    Dil

    2013-04-24

    Apr 24, 2013 ... load of sewage treatment plants (STPs) around the Dal Lake. The results .... MATERIALS AND METHODS. This study ... groups were selected so that number of colonies on plate was ..... pipeline in the Niger Delta (Nigeria).

  2. Kultuuritehas esitleb uusi tooteid / Karina Talts

    Index Scriptorium Estoniae

    Talts, Karina

    2004-01-01

    Tallinna endises Polümeeri kummivabrikus ametlikult uksed avanud Kultuuritehasest Polymer. Avamisüritusest Kultuurinädal. Korraldajaks Madis Mikkor. Toimuvad kunstinäitused, õpitoad, kontserdid, teatrietendused, ISEA 2004 multimeediaprojektid

  3. Berlusconi kattis palja rinna / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2008-01-01

    Itaalia peaminister Silvio Berlusconi lasi oma ametiresidentsis Giovanni Battista Tiepolo maali "La verita svelata dal Tempo" koopial lopsaka figuuriga naise palja rinna kinni katta. Maali originaal asub Vicenza muuseumis

  4. Tutti i colori dell'universo

    CERN Multimedia

    Battiston, Roberto

    2009-01-01

    A partire dal 27 ottobre, una mostra sull'osservazione e lo studio dell'universo affronta la sfida di avvicinare il grande pubblico alle conoscenze scientifiche raccolte decrifrando l'alfabeto del cosmo. (4 pages)

  5. Stabiilne Ashley Jones / Svea Suvi

    Index Scriptorium Estoniae

    Suvi, Svea

    2006-01-01

    Ameerika teleseriaali "Vaprad ja ilusad" ("The Bold and the Beautiful") osatäitja Ashley Jones (Bridget Forrester). Sama artikkel pealkirjaga "Uus Bridget" : Nädal, 30. jan. 2006, nr. 4, lk. 12 : ill

  6. Dredging induced changes in zooplankton community and water ...

    African Journals Online (AJOL)

    user

    water characteristics and zooplankton community structure in Dal Lake. An assessment was done ... et al., 2007; Zhang et al., 2010). In aquatic ecosystems, .... generally high in fine grain sediment (Fisher et al., 1982;. Valiela, 1995). In post ...

  7. Ja polagaju, tshto vsjo sledujet shit! / Anna Korjakina

    Index Scriptorium Estoniae

    Korjakina, Anna

    2005-01-01

    31.03-3.04 toimus Riias moenädal - Riga Fashion Show. Oma töid demonstreerisid Läti, Eesti, Leedu, Venemaa ja Prantsusmaa moeloojad. Eestist Oksana Tandit ja Triinu Pungits. Pikemalt Masha Tsigali kollektsioonist (Venemaa)

  8. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Muusikasündmustest Eestis: Improvizz'05, Jazz'n Motion, muusikafestivali "Eduard Tubin ja tema aeg" pressikonverents, laulumäng "Suur Munamägi" Estonia kammersaalis, modernismi pidunädal Tartu Elleri koolis

  9. Korruptsioon mittetulundusliikumises / Marika K Arendi Elita von Wolsky

    Index Scriptorium Estoniae

    Arendi Elita von Wolsky, Marika K.

    2001-01-01

    Eesti Mittetulundusühingute ja Sihtasutuste Liidus toimunud erakorralisest koosolekust, kus arutati artikli autori avaldusi, mis olid ajendatud tema avalikus kirjas esitatud küsimustest Mall Hellamile. Vt. samas: Kesknädal, 5. dets. 2001, lk. 9

  10. Kanada koolimõrv nõudis ühe ohvri / Rein Kärner

    Index Scriptorium Estoniae

    Kärner, Rein

    1999-01-01

    Veidi enam kui nädal pärast tapatalguid Colorado osariigi Littletoni koolis laskis Kanadas Taberi väikelinnas W. R. Myersi keskkoolis sama kooli endine õpilane Jason Lang maha oma endise koolikaaslase

  11. 1799-1999 Bicentenario dell'invenzione della pila ad opera di Alessandro Volta

    OpenAIRE

    Montalbetti, Claudia

    1998-01-01

    In questo articolo è descritto, dal punto di vista tecnico, il sito Web Volta99, sito ufficiale delle celebrazioni per il bicentenario dell'invenzione della pila ad opera di Alessandro Volta. Indirizzo: http://www.cilea.it/volta99.

  12. Euromüüdid on kukkunud / Uno Silberg

    Index Scriptorium Estoniae

    Silberg, Uno, 1964-

    2001-01-01

    Liikumise "Ei Euroopa Liidule" esimees kolmest ETV saatest, kus said sõna nii Euroopa Liiduga ühinemise pooldajad kui ka selle vastased. Euroskeptitsism. Ilmunud ka: Kesknädal, 21. veebr. 2001, lk. 9

  13. Bisazza - Veneetsiast Eestini

    Index Scriptorium Estoniae

    2007-01-01

    Viimistlussalongi Vivarec turundusjuht Anu Jaanson Bisazza klaas- ja emailmosaiigist, trendidest. Disainer Carlo Dal Bianco on katnud Bisazza mosaiigiga viis Mini autot, lampe ning Fritz Hanseni Superellipse lauad. Eestis pakub Bisazza mosaiike Vivareci viimistlussalong Tallinnas Pärnu mnt. 158

  14. Bisazza uued disainmustrid / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Sise- ja välistingimustesse sobiva klaasmosaiigi valmistaja Bisazza esitles Bologna messil Cersaie nelja disaineri - Marco Braga, Carlo Dal Bianco, Terri Pecora ja Marcel Wandersi 2005. aastaks loodud uusi mustreid. 4 ill

  15. Medieval Studies in Austria: Research Infrastructure and Resources

    OpenAIRE

    Ertl, Thomas

    2014-01-01

    Questo testo intende fornire una veloce panoramica delle istituzioni e delle associazioni austriache che promuovono ricerche di storia medievale e una guida alle opportunità offerte dal mondo della ricerca scientifica e accademica austriaco.

  16. Sequence Classification: 890555 [

    Lifescience Database Archive (English)

    Full Text Available synthase, role in allantoin degradation unknown; expression sensitive to nitrogen catabolite repression and... induced by allophanate, an intermediate in allantoin degradation; Dal7p || http://www.ncbi.nlm.nih.gov/protein/6322222 ...

  17. 77 FR 61645 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2012-10-10

    ... ACI, AGNC, AMLN, AMZN, ANR, APA, ARNA, ATPG, AUY, BAX, BTU, CLF, COP, CRM, CVX, DAL, DD, DE, DIS, DOW... because members would benefit from clear guidance in the fee schedule that describes the manner in which...

  18. Textbook of pharmacoepidemiology

    National Research Council Canada - National Science Library

    Strom, Brian L; Kimmel, Stephen E

    2006-01-01

    ... Pharmacovigilance Reporting Systems, 101 Gerald J. Dal Pan, Marie Lindquist, and Kate Gelperin 8 Overview of Automated Databases in Pharmacoepidemiology, 118 Brian L. Strom 9 Examples of Existing Automated ...

  19. Külamehe kelder hoiab nahkhiire elus / Matti Masing

    Index Scriptorium Estoniae

    Masing, Matti, 1953-

    2004-01-01

    Vt. ka Meie Maa 27. nov., Koit : Nädal 29. nov., Lääne Elu 4. dets. Erinevate pealk. all. Nahkhiirte talvitumisest keldrites, mida teha nahkhiirte kaitseks ning nahkhiirte uurimisest ja kaitsest Euroopas

  20. Enesega piirduv keskpaik / Jan Kaus

    Index Scriptorium Estoniae

    Kaus, Jan, 1971-

    2000-01-01

    1999. a. kirjastuselt "Kunst" ilmunud Salvador Dalí "Geeniuse päevik". Prantsuse keelest tõlkinud Sirje Keevallik. Kolmest aspektist: retoorika, loogika ja hüperloogika, seostamise kunst, enesekesksus. Terminst - logos

  1. Naine, kes ei vaadanud tagasi / Ilona Martson

    Index Scriptorium Estoniae

    Martson, Ilona, 1970-

    2008-01-01

    Raamatututvuistus: Bona, Dominique. Gala : [Dalí võimukas muusa] / prantsuse keelest tõlkinud Margot Endjärv. [Tallinn] : Kunst, 2008. Venelanna Jelena Djakonova (Gala) suhetest prantsuse luuletaja Paul Eluard'iga ja hispaania maalikunstniku Salvador Daliga

  2. Taevalik trio / Laurence Lumiére

    Index Scriptorium Estoniae

    Lumiére, Laurence

    2000-01-01

    Actionfilm "Charlie inglid" : režissöör Joseph McGinty Nichol : peategelased : Drew Barrymore (. Ka produtsent), Cameron Diaz ja Lucy Liu : Ameerika Ühendriigid 2000. Ka : Nädal nr. 47, lk. 90-91

  3. Nedelja modõ v Parizhe

    Index Scriptorium Estoniae

    2004-01-01

    Naistemoe nädal Pariisis näitab valmisriideid kevad-suveks 2005. Kollektsioonid John Gallianolt (Dior), Jean Paul Gaultier'lt (Hermes), Stefano Pilatilt (YSL Rive Gauche), Roberto Menichettilt (Celine)

  4. Mini kannab Bisazzat

    Index Scriptorium Estoniae

    2007-01-01

    Vivarec ja United Motors tutvustasid mai lõpul Eestis BMW ja Bisazza ühisprojekti, mille käigus kaeti Minid klaasmosaiigiga. Eestis viibis Bisazza disainer Carlo Dal Bianco, kes kujundas autode mosaiikkatted

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    into heat via dielectric, electric, magnetic, and/or eddy cur- rent loss mechanisms. ... particles cannot efficiently absorb microwave at room tem- perature. ... hardness testing machine is fitted with a diamond pyrami- dal indenter and attached to ...

  6. Tallinskaja nedelja modõ / Jevgenia Gorski

    Index Scriptorium Estoniae

    Gorski, Jevgenia

    2007-01-01

    Tallinna moenädal (Tallinn Fashion Week) Estonia teatri kammersaalis. Korraldajaks kevadel loodud Eesti Moedisaini Liit. Moenädala programmi lülitatakse ka Viru keskuse moeürituste sari FIBIT. Kommenteerib Oksana Tandit

  7. Õpetajate streik oleneb järgmisest nädalast / Matis Song

    Index Scriptorium Estoniae

    Song, Matis, 1978-

    2003-01-01

    Valitsusdelegatsioon sai 30. oktoobri kohtumisel ametiühingutega nädal aega otsustamiseks, kas nõustuda TALO esitatud palganõuetega või mitte. Kommentaarid TALO juhatuse esimehelt Toivo Roosimaalt

  8. Kaisi kimbutav õlavalu sundis eestlasi turniiri katkestama / Ann Hiiemaa

    Index Scriptorium Estoniae

    Hiiemaa, Ann

    2007-01-01

    dal tagasi maailmameistrivõistlustelt viienda koha rannavõrkpallurid Kristjan Kais ja Rivo Vesik olid Kaisi õlavalu tõttu sunnitud Austrias Klagenfurtis toimuva Grand Slami etapi pooleli jätma

  9. Henning Witte : Estonia-film tuleb / Villem Valme

    Index Scriptorium Estoniae

    Valme, Villem, 1977-

    2000-01-01

    Kavandatavast katastrooffilmist "Baltic Storm", mis on ajendatud väidetest, et "Estonia" uppus maffiavandenõu tõttu. Stsenaristideks on Juta Rabe, Henning Witte ja Kaj Holmberg. Ka : Nädal nr. 47, lk. 5

  10. Miks kesknoori liberaalide poole tõmbab? / Ramon Loik

    Index Scriptorium Estoniae

    Loik, Ramon

    2001-01-01

    Järgneb: Kesknädal, 1. aug. 2001, lk. 4; 8. aug. 2001, lk. 4. Vilniuses toimunud rahvusvahelisest poliitika ja majandusseminarist Vision of the European Society. Liberalistlikust maailmavaatest ja ideoloogiast

  11. Mütsiga lüües : kuidas väärikalt vananeda? / Imbi Jeletsky

    Index Scriptorium Estoniae

    Jeletsky, Imbi

    2007-01-01

    Vt. ka Kesknädal 21. nov., lk. 12. ETV saates "Vabariigi kodanikud" arutleti vananemise teemal. Stuudios olid kirjanik Maimu Berg, rahvastikuteadlane Kalev Katus ja kunstnik Heinz Valk, saatejuht oli Aarne Rannamäe

  12. Anzac 2005 / Leo Laanemaa

    Index Scriptorium Estoniae

    Laanemaa, Leo

    2005-01-01

    25. aprillil 2005 Sydney Eesti Majas ja nädal hiljem Thirlmeres, osa võtsid Eesti Sõjaveteranide Liit ja Eesti Võitlejate Ühing Austraalias. Oli traditsiooniline sõjaveteranide marss ja koosviibimine ühises peolauas

  13. Conifer reproductive development involves B-type MADS-box genes with distinct and different activities in male organ primordia.

    Science.gov (United States)

    Sundström, Jens; Engström, Peter

    2002-07-01

    The Norway spruce MADS-box genes DAL11, DAL12 and DAL13 are phylogenetically related to the angiosperm B-function MADS-box genes: genes that act together with A-function genes in specifying petal identity and with C-function genes in specifying stamen identity to floral organs. In this report we present evidence to suggest that the B-gene function in the specification of identity of the pollen-bearing organs has been conserved between conifers and angiosperms. Expression of DAL11 or DAL12 in transgenic Arabidopsis causes phenotypic changes which partly resemble those caused by ectopic expression of the endogenous B-genes. In similar experiments, flowers of Arabidopsis plants expressing DAL13 showed a different homeotic change in that they formed ectopic anthers in whorls one, two or four. We also demonstrate the capacity of the spruce gene products to form homodimers, and that DAL11 and DAL13 may form heterodimers with each other and with the Arabidopsis B-protein AP3, but not with PI, the second B-gene product in Arabidopsis. In situ hybridization experiments show that the conifer B-like genes are expressed specifically in developing pollen cones, but differ in both temporal and spatial distribution patterns. These results suggest that the B-function in conifers is dual and is separated into a meristem identity and an organ identity function, the latter function possibly being independent of an interaction with the C-function. Thus, even though an ancestral B-function may have acted in combination with C to specify micro- and megasporangia, the B-function has evolved differently in conifers and angiosperms.

  14. Disclosure of investigators' recruitment performance in multicenter clinical trials

    DEFF Research Database (Denmark)

    Dal-Ré, Rafael; Moher, David; Gluud, Christian

    2011-01-01

    Rafael Dal-Ré and colleagues argue that the recruitment targets and performance of all site investigators in multi-centre clinical trials should be disclosed in trial registration sites before a trial starts, and when it ends.......Rafael Dal-Ré and colleagues argue that the recruitment targets and performance of all site investigators in multi-centre clinical trials should be disclosed in trial registration sites before a trial starts, and when it ends....

  15. Minimization of Antinutrients in Idli by Using Response Surface Process Optimization

    NARCIS (Netherlands)

    Sharma, Anand; Kumari, Sarita; Nout, Martinus J.R.; Sarkar, Prabir K.

    2017-01-01

    Deploying response surface methodology, the stages of idli preparation were optimized for minimizing the level of antinutrients. Under optimum conditions of soaking blackgram dal (1:5 of dal and water at 16C, and pH 4.0 for 18 h) and rice (1:5 of rice and water at 16C, and pH 5.6 for 18 h), the

  16. Effects of Repeated Acute Stress in Obese and Non-Obese Rats

    Science.gov (United States)

    2008-04-02

    level of corticosterone occurs approximately 30 minutes after the stressor terminates (Garcia, Marti, Valles, Dal-Zotto, & Armario , 2000). Some studies...Garcia, Marti, Valles, Oal-Zotto, & Armario , 2000; Schrijver et aI., 2002). This repeated, mild stressor provides a model of daily or frequent...Response in Rats. Physiology and Behavior, 63(4),693-697. Garcia, A., Marti, 0., Valles, A., Dal-Zotto, S., & Armario , A. (2000). Recovery of the

  17. Il diritto alla salute dei migranti nei Paesi Bassi

    OpenAIRE

    Romeo, Graziella; Palazzo, Nausica

    2017-01-01

    L’articolo affronta il tema del diritto alla salute del migrante nei Paesi Bassi. Nel far ciò si propone innanzitutto di fornire un inquadramento riguardante la condizione dello straniero dal punto di vista lato sensu costituzionale, e le politiche di assimilazione dello straniero poste in essere dal governo in anni recenti. L’articolo intende in seguito di ricostruire le peculiarità del sistema sanitario olandese e le tipologie di migranti riconosciute a livello domestico, al fine di incroc...

  18. L'argomento comparatistico. Un contributo allo studio del ragionamento giuridico

    OpenAIRE

    Canale, Damiano

    2016-01-01

    Il saggio affronta il tema dell'uso del diritto straniero da parte delle corti dal punto di vista della teoria dell'argomentazione giuridica. Per un verso questa pratica è stata al centro del un vivace dibattito, svoltosi nell'ultimo ventennio, dedicato al tema del "dialogo tra le corti"; per altro verso, tuttavia, è mancata nella letteratura sul tema una ricostruzione sistematica di questo fenomeno dal punto di vista della teoria dell'argomentazione giuridica. Il saggio cerca di colmare ques...

  19. Cinema ed enogastronomia nel portale turistico della Regione Toscana

    OpenAIRE

    Corinto, Gian Luigi

    2016-01-01

    Il presente lavoro tratta il caso della Regione Toscana che dal 2005 ha affidato alla Fondazione Sistema Toscana la missione di coordinare strategicamente le attività di promozione territoriale, tra cui le attività della film commission e del portale web dedicato al turismo. Lo scopo è quello di analizzare il modello di promozione degli itinerari enogastronomici e cinematografici come presentato dal portale turistico toscano. L'analisi dimostra che la scoperta dell'enogastronomia regionale è ...

  20. Müzik Eğitimi Anabilim Dalı 3. ve 4. Sınıf öğrencilerinin Piyano Performansı Özyeterlik Algıları ile Piyano Öğretim Elemanlarının Öğrencilerin Piyano Performansı Hakkındaki Görüşleri (Ege Bölgesi Örneği)

    OpenAIRE

    Pirlibeylioğlu, Bilge

    2015-01-01

    Piyano, müzik eğitimi veren tüm kurumlarda, özellikle Müzik Eğitimi Anabilim Dalları’nda zorunlu ders olarak yer almaktadır. Dolayısıyla müzik öğretmeni adaylarının piyano performansı sergilemesi kaçınılmazdır. Piyano performansı topluluk önünde sergilenmek zorunda olan bir olgu olduğundan; sahne kaygısı, özgüven, özyeterlik gibi duyuşsal özelliklerden büyük ölçüde etkilenmektedir. Bu araştırmada, piyano performansına ilişkin özyeterlik algısı üzerinde durulmuştur. Araştırmanın amacı, Ege Böl...

  1. Iron Fortification of Lentil (Lens culinaris Medik.) to Address Iron Deficiency.

    Science.gov (United States)

    Podder, Rajib; Tar'an, Bunyamin; Tyler, Robert T; Henry, Carol J; DellaValle, Diane M; Vandenberg, Albert

    2017-08-11

    Iron (Fe) deficiency is a major human health concern in areas of the world in which diets are often Fe deficient. In the current study, we aimed to identify appropriate methods and optimal dosage for Fe fortification of lentil ( Lens culinaris Medik.) dal with FeSO₄·7H₂O (ferrous sulphate hepta-hydrate), NaFeEDTA (ethylenediaminetetraacetic acid iron (III) sodium salt) and FeSO₄·H₂O (ferrous sulphate mono-hydrate). We used a colorimetric method to determine the appearance of the dal fortified with fortificants at different Fe concentrations and under different storage conditions. Relative Fe bioavailability was assessed using an in vitro cell culture bioassay. We found that NaFeEDTA was the most suitable fortificant for red lentil dal, and at 1600 ppm, NaFeEDTA provides 13-14 mg of additional Fe per 100 g of dal. Lentil dal sprayed with fortificant solutions, followed by shaking and drying at 75 °C, performed best with respect to drying time and color change. Total Fe and phytic acid concentrations differed significantly between cooked unfortified and fortified lentil, ranging from 68.7 to 238.5 ppm and 7.2 to 8.0 mg g -1 , respectively. The relative Fe bioavailability of cooked fortified lentil was increased by 32.2-36.6% compared to unfortified cooked lentil. We conclude that fortification of lentil dal is effective and could provide significant health benefits to dal-consuming populations vulnerable to Fe deficiency.

  2. Level of infertility in regions according to Ministry of Public Health data

    Directory of Open Access Journals (Sweden)

    Tymchenko O.I.

    2014-09-01

    Full Text Available The aim of the research: estimation of morbidity and prevalence, risks of female and male infertility among the different regions of Ukraine. Materials and methods. The Morbidity and prevalence of female and male infertility were calculated according to Ministry of Public Health official statistics (2002-2012 per 1 000 of population of reproductive age (15-44. Relative risk including 95% confidence interval was calculated for each region in comparison with whole Ukraine. Results. In Ukraine infertility level grows. Over the years interrelation of female infertility prevalence to male decreases. In 2002-2012 prevalence of infertility was 400,1±0,59 per 100 000 of women and 87,41±0,28 per 100 000 of men aged 15-44 years, including infertility morbidity - 122,8±0,33 and 33,63±0,17 per 100 000 accordingly. It was detected the increased risk of female and male infertility deve¬lopment in Odessa, Dnipropetrovsk and Zaporozhzhye regions, and decreased risk in Lviv, Rivne, Kyiv, Cherkassy, Kirovograd, Mykolaiv, Sumy, Kharkiv, Lugansk and Donetsk regions.

  3. OPPORTUNITIES AND RISKS OF CROSS-BORDER COOPERATION OF REGIONS OF THE SOUTHERN MACROREGION OF RUSSIA AND REGIONS OF THE SOUTH-EAST OF UKRAINE IN THE CONDITIONS OF UNCERTAINTY

    Directory of Open Access Journals (Sweden)

    Inna Mitrofanova

    2015-09-01

    Full Text Available In article the political and economic innovations connected with the transformation of the region «Donbass» in the context of decrease of the risks caused by a military-political and economic conflict in Ukraine are investigated. On the basis of creative synthesis of theoretical and practical approaches of studying the evolution of nonlinear economic systems and the formation of megaregions, and also the analysis of the geopolitical situation developing on the world scene between Russia, the USA and China provisions are developed according to which the region «Donbass» can be considered as «a critical point» of the European regionalization. Authors believe that the important strategic prospect of border cooperation of Russia and Ukraine is connected with the formation of a cross-border agglomeration «Nizhnedonbassky» and «Verkhnedonbassky» the creation of which consists in realization of the linking function between Nizhnedonbassky, Volga region, Moscow and Petersburg transport corridors. One of the condition of social and economic stabilization in the subjects of the foreign Caspian and the Black Sea zones is the realization of geotransit capacity of the region «Donbass» with the formation of a geotransit architecture of its economy. Strategically realization of the processes of an international city formation is possible either on the basis of federal principles or by a geopolitical split of the territory of the region “Donbass” on the line Kharkov – Donetsk – Lugansk with a bent to Russia.

  4. Motivational Factors of Survival in a Collapse of the State In the Context of Abraham Maslow’s Hierarchy of Needs

    Directory of Open Access Journals (Sweden)

    Anton Portianyi

    2016-08-01

    Full Text Available The article deals with the psychological paradigm of survival, based on the author’s personal traumatic experience at the territory of the so-called Democratic Republic of Lugansk (Ukraine, which is still temporarily occupied by the separatists. It corresponds with the following conclusions: l. The first reaction of personality in paradigm “I and the World Destroyed” differs from panic and unreal perception of events to the unshakable confidence “It soon will be solved by the competent authorities”. Soon most people lose the illusion of power, order and law. Self-awareness in the paradigm “I and the World Hostile” shapes the complex of intellectual and emotional manifestations in the difficult circumstances of activities. The logical solution is to escape to the stable world. The links with the “World Hostile” induce the person to make a choice: to have a risk returning there or to stay safe without necessary things. The first position forms leadership skills, the second one makes losers and provides the pessimistic world view. The accepted challenge person appears in another paradigm of the world model, based on the principle “I am the Creator of my World”. It generates desire to survive; awakes the power of the spirit; makes do things that were atypical before.

  5. Художник Николай Бодаревский (страницы творческой биографии

    Directory of Open Access Journals (Sweden)

    Pismak

    2017-10-01

    Full Text Available Descendant of the old Moldavian nobility family, Nikolai Kornilievich Bodarevsky (1850–1921 was born in Odessa. He graduated from the St. Petersburg Emperors Academy of Fine Arts. From 1869 to 1873 Nikolai Bodarevsky attended the Emperors Academy of Fine Arts, where he studied with Timofey Neff, Vasily Vereshchagin and Piotr Shamshin. Bodarevsky was member of Society for Travelling Art Exhibitions and South-Russian Art Society. Currently, his works are kept in the State Hermitage, the Russian Museum (St. Petersburg, the Tretyakov Gallery (Moscow, Odessa State Literary Museum, Odessa Fine Art Museum and other museums. Portrait of I. Tereshchenko (1891 by Nikolai Bodarevsky, is in the collection of Lugansk Regional Art Museum. His sister, Catherine Petrokokino (nee Bodarevskaya (1852–1930 was also a painter. She also graduated from the Odessa Art School. Nikolai Bodarevsky and Vasily Surikov are in the same year at Academy of Arts. Bodarevsky’s major works include: Portrait of maestro Vasily Safonov; Portraits of famous composers for the Great Hall of the Moscow Conservatory; Icons for Church of Savior on Blood (St. Petersburg; Portrait of Empress Alexandra Feodorovna; “Deep in the forest”; “Ukrainian Girl tending geese”; “Girl reading a Book” and others.

  6. Nonautonomous discrete bright soliton solutions and interaction management for the Ablowitz-Ladik equation.

    Science.gov (United States)

    Yu, Fajun

    2015-03-01

    We present the nonautonomous discrete bright soliton solutions and their interactions in the discrete Ablowitz-Ladik (DAL) equation with variable coefficients, which possesses complicated wave propagation in time and differs from the usual bright soliton waves. The differential-difference similarity transformation allows us to relate the discrete bright soliton solutions of the inhomogeneous DAL equation to the solutions of the homogeneous DAL equation. Propagation and interaction behaviors of the nonautonomous discrete solitons are analyzed through the one- and two-soliton solutions. We study the discrete snaking behaviors, parabolic behaviors, and interaction behaviors of the discrete solitons. In addition, the interaction management with free functions and dynamic behaviors of these solutions is investigated analytically, which have certain applications in electrical and optical systems.

  7. Using carcinogenic agents in the research laboratories. Rules and procedure; Norme e procedure per l'utilizzo di agenti cancerogeni nei laboratori di ricerca

    Energy Technology Data Exchange (ETDEWEB)

    Lombardi, C.C.; Mancini, C. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The aim of the present work is to outline the criteria for the protection of working people in a complex workplace such as research laboratories, focusing on its peculiar occupational health factors, such as the hazardous exposure to a vast array of chemicals also due to the frequent turnover in the personal activities. [Italian] Il presente lavoro ha lo scopo di fornire indicazioni concrete per la messa in atto delle misure di prevenzione e protezione dei lavoratori, ponendo particolare attenzione ai laboratori di ricerca che costituiscono ambienti lavorativi particolari, caratterizzati dal gran numero di agenti manipolati e dal continuo mutamento delle attivita' e del personale.

  8. Kas president ikka tõesti eksis? / Hillar Padu

    Index Scriptorium Estoniae

    Padu, Hillar

    2008-01-01

    President Toomas Hendrik Ilvese esinemisest Hantõ-Mansiiskis soome-ugri rahvaste maailmakongressil. Autor on seisukohal, et parteiline kriitika president T. H. Ilvese aadressil tunnistab, et demokraatiale pole Eestis ohtu, nagu on mõnel pool mujal Ida-Euroopas. Ungari filosoofi Gaspar Miklos Tamasi artiklist "Tänapäeva Ida-Euroopa". Lisatud karikatuur. Ilmunud ka: Meie Maa : Saarte Suvenädal 11. juuli 2008, lk. 10, pealk.: Kas president Ilves astus ämbrisse?; Meie Maa : Saarte Suvenädal 18. juuli 2008, lk. 10, pealk.: President ei astunud ämbrisse!

  9. Antigona soror. Hofmannsthal, la classicità e il femminile eroico

    Directory of Open Access Journals (Sweden)

    Andrea Landolfi

    2016-12-01

    Full Text Available Muovendo dal soggiorno parigino del febbraio-aprile 1900, nel corso del quale Hofmannsthal scrisse il Vorspiel zur Antigone des Sophokles (Prologo all’Antigone di Sofocle, il saggio cerca di indagare le motivazioni psicologiche e drammaturgiche dalle quali si sviluppò il rapporto del poeta con il personaggio Antigone, e come e perché questa figura, emblematica di un eroismo “sororale” ed emancipatorio, sia stata di lì a poco messa in ombra dal rigore “filiale” e oppressivo di Elettra.

  10. L'invasione del virtuale

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2005-07-01

    Full Text Available L'ormai indiscutibile il fatto di essere talmente circondati dal virtuale sintetico che quasi si fa fatica a riconoscere la realtà, col suo corollario di fatti “veri” legati alla nostra vita, dalle ricostruzioni digitali che permeano la nostra quotidianità (ogni riferimento al mondo di “Matrix” è puramente casuale; con l’avvento dei moderni sensori è poi veramente impressionante vedere quanto ormai il nostro ambiente sia “contaminato” dal virtuale.

  11. Dove sta andando l'analisi musicale? Riflessioni sul VII EuroMac

    Directory of Open Access Journals (Sweden)

    Mario Baroni

    2014-01-01

    Full Text Available Come tutti i lettori della Rivista ormai sapranno, si è svolto a Roma dal 29 settembre al 2 ottobre di quest’anno, presso il Conservatorio di S. Cecilia, il settimo convegno europeo di analisi musicale (VII European Music Analysis Conference ossia VII EuroMac. Nel convegno, organizzato dal GATM e diretto da Giorgio Sanguinetti, sono state presentate 197 relazioni e svolti otto laboratori. Tutti i materiali sono stati riassunti in un volume (Programme and Abstract Book, Iter Edizioni di Subiaco curato da Egidio Pozzi e Antonio Cascelli.

  12. Apprendimento collaborativo in linea: comunità di ricerca e di pratiche (Intervista a Christian Bois

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2003-09-01

    Full Text Available Il sapere deriva per prima cosa dal fatto che si "nominano" le dinamiche che emergono dalla situazione analitica e dai discorsi dei protagonisti. Deriva inoltre da quello che s'identifica nelle rassomiglianze di contenuto e/o nelle forme tra un segno attuale e un fatto passato. O ancora deriva dalla creatività dell'analizzante per predisporre il suo posto nella giungla dei desideri, dei territori, delle gelosie e delle invidie. Deriva infine dal sottile gioco tra il reale, l'immaginario ed il simbolico. Nella comunità di ricerca e di pratiche ci sono anche delle dinamiche sottili da identificare.

  13. Using carcinogenic agents in the research laboratories. Rules and procedure; Norme e procedure per l'utilizzo di agenti cancerogeni nei laboratori di ricerca

    Energy Technology Data Exchange (ETDEWEB)

    Lombardi, C C; Mancini, C [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The aim of the present work is to outline the criteria for the protection of working people in a complex workplace such as research laboratories, focusing on its peculiar occupational health factors, such as the hazardous exposure to a vast array of chemicals also due to the frequent turnover in the personal activities. [Italian] Il presente lavoro ha lo scopo di fornire indicazioni concrete per la messa in atto delle misure di prevenzione e protezione dei lavoratori, ponendo particolare attenzione ai laboratori di ricerca che costituiscono ambienti lavorativi particolari, caratterizzati dal gran numero di agenti manipolati e dal continuo mutamento delle attivita' e del personale.

  14. Guido Boggiani e i Caduvei: I´incontro con l´altro

    Directory of Open Access Journals (Sweden)

    Elisabetta Santoro

    2004-12-01

    Full Text Available Viggiatore, ma soprattutto artista, Boggiani fu affascinato dal mondo degli indios, dalla loro arte e dal loro modo di vivere. Attraverso il disegno, la pittura e la fotografia, ma anche scoprendo l´importanza del capire la loro lingua, cercò di conoscerli e di "impossessarsi" delle imagini che avrebbe potuto porare anche a chi non li aveva visti. È cosi wuesti due mondi entrano in contatto, si influenzano reciprocamente e rappresentano la ricerca di se stessi nell´altro.

  15. USE OF SOCIAL INTERNET SERVICES IN EDUCATIONAL ACTIVITY OF STUDENTS

    Directory of Open Access Journals (Sweden)

    S. A. Shlianchak

    2016-09-01

    Full Text Available The article reviews the key opportunities of using services of web 2. 0 technologies to the educational process. It is shown of Social Software tools: Wiki technology, system of creating blogs, systems of storing and sharing web resources. The basic lines of Wiki-technology, possibility, and methods of the use of it are described in pedagogical practice. The described pedagogical potential of Wiki-technology to organize project activities of students. It should be stressed that Wiki is a piece of server software that allows users to freely create and edit web page content using any web browser. The author focusing on teaching and methodical opportunities of the Internet blogs and systems of storing and sharing web resources (for joint hypertext materials creation, placement of presentations, text documents, photos, video resources, etc. in professional preparation of the future primary school teachers. It is shown efficiency using of web 2. 0 technologies in the educational work future teachers (by the example of their own resources of Kirovograd State Pedagogical University named after Volodymyr Vynnychenko.

  16. The role and place of international organizations in the settlement of armed conflicts in the southeast of Ukraine (legal aspects

    Directory of Open Access Journals (Sweden)

    Ігор Володимирович Євтушенко

    2016-01-01

    Full Text Available Problem setting. Armed conflict in the Donetsk and Lugansk regions led to significant losses as personnel of military units and special law enforcement agencies of Ukraine and civilian casualties Ukraine. Under these conditions, according to most politicians and political scientists to modern standards of international law crisis management in Ukraine is possible only through the mediation of international organizations. International organizations have a tool for early detection, warning and conflict prevention and crisis management and post-conflict rehabilitation, they are engaged in a wide range of security issues, including arms control, preventive diplomacy, confidence-building measures, human rights, monitoring elections, economic and environmental security and so on. Recent research and publications analysis. In the literature of recent years certain issues affecting the regulatory and legal framework of international organizations in the field of security. However, scientific research towards the place and role of international organizations in resolving the internal armed conflict in research paid insufficient attention. Paper objective. The article is to examine the nature of international security organizations, evaluating the effectiveness of their work to resolve the situation in the Donetsk and Lugansk regions and providing relevant proposals. Paper main body. The primary place in the order of settlement of the armed conflict in the South East Ukraine has a key intergovernmental international organizations dealing with peace and security in the world – the United Nations (UN and the Organization for Security and Cooperation in Europe (OSCE. The new National Security Strategy of Ukraine of 05.06.2015 p. Indicated that the aggression of Russia against Ukraine increased the urgency of reforming the Security Council. As part of the UN General Assembly will focus the government of Ukraine will support such initiatives to reform the

  17. Marzo 1991: la residenza del gruppo Gorgona a Brunnenburg

    Directory of Open Access Journals (Sweden)

    Marco Scotti

    2013-12-01

    Full Text Available Questo articolo indaga l'affermazione di una ricezione critica di Gorgona in Italia attraverso uno specifico caso di studio, individuato nella residenza d'artista a cui hanno partecipato alcuni esponenti del gruppo presso il castello di Brunnenburg (Merano, organizzata dal collezionista ed editore veronese Francesco Conz in collaborazione con l’MSU di Zagabria nel 1991.

  18. Identification of Genes and Genetic Variants Associated with Poor Treatment Response in Patients with Prostate Cancer

    Science.gov (United States)

    2012-10-01

    gene DAL-1 (Jiang and Newsham, 2006). The gene NELL1 ( Homo sapiens NEL-like 1) may be involved in cell growth regulation and differentiation by...interval for the pedigree linked to chromosome 11 occurs approximately 34-46 cM. This region contains 13 currently documented genomic features , several

  19. Gregory Crane e i cittadini della repubblica delle lettere

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2012-05-01

    Full Text Available Chi studia l’antichità conosce Gregory Crane anche quando non ne rammenta il nome, non per quello che ha scritto ma per quello che ha reso possibile scrivere. Crane è il direttore del Perseus Project, una biblioteca digitale che libera gli studiosi dal microcosmo chiuso e inaccessibile della monografia accademica, permettendo loro di lavorare sui classici [...

  20. Loss of aphid transmissibility of plum pox virus isolates

    NARCIS (Netherlands)

    Kamenova, I.; Lohuis, H.; Peters, D.

    2002-01-01

    The aphid transmissibility of seven Plum pox virus (PPV) isolates and the amino acid sequences of their coat proteins were analysed Two aphid transmissible isolates PPV-A and PPV-P contained the DAG amino triplet, while DAL or NAG replaced this triplet in the coat proteins of non-aphid transmissible

  1. UNPUBLISHED TEXTS / INEDITI

    African Journals Online (AJOL)

    User

    È come una fetta di luna. L'nguria che assaggi e che sputi non ti puoi saziare come del mare e dell'aria e dei pini marittimi e di questa quercia alberi dal tronco di sughero che è facile strappare, corteccia che ricresce. Non ti puoi saziare di questo mare verde e profondo luminosa acqua pietre pesci coralli gusci di perle.

  2. 77 FR 51724 - Airworthiness Directives; The Boeing Company

    Science.gov (United States)

    2012-08-27

    ... specify that the rework is done by using the procedures in the referenced BAE Systems service bulletins....'' DAL stated that rework of the panel in accordance with only one of the three BAE Systems service... to allow rework of the applicable dash number part according to the applicable BAE component service...

  3. College Seniors' Plans for Graduate School: Do Deep Approaches Learning and Holland Academic Environments Matter?

    Science.gov (United States)

    Rocconi, Louis M.; Ribera, Amy K.; Nelson Laird, Thomas F.

    2015-01-01

    This study examines the extent to which college seniors' plans for graduate school are related to their tendency to engage in deep approaches to learning (DAL) and their academic environments (majors) as classified by Holland type. Using data from the National Survey of Student Engagement, we analyzed responses from over 116,000 seniors attending…

  4. 200 varju uurib sel nädalal tudengielu / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne, 1971-

    2010-01-01

    Sel nädalal toimub Tallinna Ülikoolis ning TLÜ Rakvere ja Haapsalu kolledžites tudengivarju nädal, mis pakub abiturientidele võimaluse osaleda ühe päeva vältel end huvitava eriala õppetöös

  5. Reversing the Brain Drain / Toomas Hendrik Ilves ; interv. Morten Tonnessen

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2008-01-01

    President Toomas Hendrik Ilves tööjõu vabast liikumisest, töötajate ja tööandjate vahelise dialoogi vajalikkusest, immigratsioonipoliitikast, võrdlusest Põhjamaadega. Eestikeelne ülevaade ja kommentaar vt. ka: Kesknädal 13. veebr. 2008, lk. 3, pealk.: Ilves võrdles Eesti ja Norra sotsiaalsüsteemi

  6. APPUNTI PASOLINIANI PER UN'ORESTIADE AFRICANA

    African Journals Online (AJOL)

    User

    in versi del 1964, L'uomo di Bandung, in P. P. Pasolini, Bestemmia, a cura di G. Chiarcossi e W. Siti ... aver visitato Bombay, Calcutta e Nuova Delhi, in febbraio i tre amici ..... africani mossi dal vento, nei silenzi sovraumani, nel cieco istinto di.

  7. "Operations & innovation management. Alcuni casi di successo"

    OpenAIRE

    F. Gallmann; V. Veronesi; S. Zamboni

    2007-01-01

    La Unit Produzione e Tecnologia della SDA Bocconi svolge dal 1998 il progetto International Best Factory Award. Il successo dell’iniziativa ha indotto a estendere il campo di indagine al processo di innovazione: nel 2006 sono state lanciate due nuove iniziative di benchmarking, il Best Innovation Award e il Best Service Award.

  8. Vaesed tööloomad / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2008-01-01

    Riikides, kus palgad ja elatustase on madalamad, tehakse rohkem ületunde, samas kui jõukates riikides on töötundide arv väiksem. Vt. samas: Neljapäevane töönädal ei tasunud ära. Diagramm: Reaalselt töötatud tundide arv nädalas riikide kaupa

  9. Agapeist ethics in Giovanni Papini's Storia di Cristo | Hale | Italian ...

    African Journals Online (AJOL)

    La Storia di Cristo (1921) di Giovanni Papini ha segnato l'inizio di una nuova fase nel tortuoso viaggio intellettuale e spirituale dal suo originario ateismo. In questa biografia leggermente romanzata, egli ha posto l'accento sull'etica dell'assoluta rinuncia del sé di Gesù, come appare nel Sermone sul Monte, con particolare ...

  10. Rinnahoidja ja kaks nööriga riidelappi / Sergo Selder

    Index Scriptorium Estoniae

    Selder, Sergo

    2004-01-01

    5. juulil 1946. aastal tutvustas prantsuse disainer Louis Reard maailmale esmakordselt bikiine. Bikiine esitles striptiisitar Micheline Bernardini moeshow'l Pariisi basseini Piscine Molitor ääres. Reard'i kostüüm sai nime Bikini atolli järgi, kus USA oli nädal varem katsetanud tuumapommi

  11. Waterplanten in poelen langs de Tongelreep bij de Achelse Kluis

    NARCIS (Netherlands)

    Bruinsma, John

    2007-01-01

    In 1989 zijn zeer voedselrijke landbouwgronden in het dal van de Tongelreep in eigendom overgegaan naar Staatsbosbeheer. Na een periode waarin zonder bemesting nog landbouwgewassen werden verbouwd, zijn de gronden na 1995 braak gelegd en in begrazing genomen, de Tongelreep is vergraven tot een beek

  12. Il progetto Virgo, Einstein e i computer

    CERN Multimedia

    2003-01-01

    "Virgo sta accendendo i suoi laser: mercoledi e stato inaugurato a Pisa il piu potente rivelatore di onde gravitazionali al mondo, capace eventualmente di segnalare l'arrivo di un'onda dal cosmo, con una sensibilita di un miliardesimo di miliardesimo di metro" (1/2 page)

  13. Enrico Fermi significato di una scoperta

    CERN Document Server

    2001-01-01

    Questo volume è la riedizione, rinnovata ed ampliata, del volume "Enrico Fermi. Significato di una scoperta" edito dal FIEN (Forum Italiano dell'Energia Nucleare) nel 1982 e nel 1992 in occasione, rispettivamente, del 40mo e del 50mo anniversario della pila di Fermi.

  14. Sissejuhatus suure kirjaniku loomingusse : Edgar Allan Poe' väändunud maailm / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2001-01-01

    Prantsusmaa-Itaalia 1968.a. ühisfilm "Erakordsed lood" ("Histoires extraordinaires"), mis koosneb Edgar Allan Poe kolme novelli ekraniseeringutest : "Metzengerstein" (režissöör Roger Vadim), "William Wilson" (režissöör Louis Malle) ja "Toby Dammit" (režissöör Federico Fellini). Ka : Nädal nr. 25, lk. 14

  15. Moostes taas mõtte- ja kunstitalgud

    Index Scriptorium Estoniae

    2002-01-01

    17. ja 18. VIII lõpetatakse Moostes teised "Postsovkhozi" mõtte- ja keskkonnakunsti talgud "Kihid". Organiseerijad Evelyn Müürsepp ja Maia Möller. Moostes nädal aega elanud ja loonud kunstnikud. Seminari kavast, esinejatest, filmiprogrammist

  16. I on sozdal bikini / Irina Kuzina

    Index Scriptorium Estoniae

    Kuzina, Irina

    2006-01-01

    Bikiinide ajaloost aastast 1946 kuni tänapäevani. 5. juulil 1946 demonstreeris disainer Louis Reard uut supelkostüümi Pariisis. Kostüüm sai nime Bikini atolli järgi, kus USA oli nädal varem katsetanud tuumapommi

  17. Nullist sündinud filmid / Jaak Kilmi

    Index Scriptorium Estoniae

    Kilmi, Jaak, 1973-

    2005-01-01

    Sõpruse kinos toimus 1.-6. aprillini "Manifesti filminädal ehk Kuidas nad maailma sündisid", kus näidati TPÜ filmi ja video filmitudengite "Ground Zero" projekti raames valminud lühifilme-kursusetöid. Autor analüüsib eraldi 9 filmi

  18. Come diventare una Rockstar. Gli Houser e l’evoluzione del franchise Grand Theft Auto.

    Directory of Open Access Journals (Sweden)

    Federico Giordano

    2013-03-01

    Full Text Available Wanted. La storia criminale di Grand Theft Auto, Multiplayer, 2012, il libro scritto da David Kushner, giornalista e docente universitario già autore del precedente, molto apprezzato, Master of Doom, è un testo importante per gli studi sui videogiochi, nonostante non si presenti in apparenza – a partire dal titolo evocativo – come testo accademico.

  19. Enhancing Civilian Protection in Peace Operations: Insights from Africa

    Science.gov (United States)

    2010-09-01

    The military assessment of the situation as of 17 April 1994,” Dal- laire (UNAMIR) to Baril (New York, United Nations), April 17, 1994, paragraph 17...Dallaire to Baril , paragraph 19. 75 Jeremy M. Weinstein, Inside Rebellion: The Politics of Insurgent Violence (Cam- bridge: Cambridge University Press

  20. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    Prendi avviso o lettore. Questa pagina fu scritta per amore. (“Esergo”) l poeta stabilisce un dialogo ideale con il lettore. Significativo è il passo che Maffeo pone come presentazione alla sua raccolta, tratto dal poeta inglese Gerald Manley Hopkins: “A che servono le opere d'arte? Ad educare, a essere esempi. Produrre […] ...

  1. Ultrastructure of the accessory venom gland of the puff-adder and ...

    African Journals Online (AJOL)

    membranes (Figure O. The nucleus is situated basally and is flattened or oval .... fusa1es by chemical means (Lowry, Rosenbrough, Farr & Ran-. 59. dalJ 195 J). ... No change in the composition of the perfusate could be measured in any ex-.

  2. Nüüd läheb alles peoks! / Heret Pauskar

    Index Scriptorium Estoniae

    Pauskar, Heret

    2013-01-01

    Tartu Maratonile eelneval nädalal, alates 11. veebruarist on Vilde tervisekohvikus üheks päevaroaks Itaalias toodetav Camporo käsitööpastast valmistatud roog. Maratoni pastanädal lõppes Eesti Maaülikooli spordihoones korraldatud pasta party'ga, kust sai osta ka www.myitali.ee Itaalia toidukaupu

  3. Dall’estetica alla teoria. Note sulla transestetica della letteratura

    Directory of Open Access Journals (Sweden)

    Lorenzo Oropallo

    2012-12-01

    Full Text Available Come ha messo in rilievo Paul De Man, la teoria della letteratura nasce insieme alla letteratura stessa, dunque a partire dal primo romanticismo tedesco e la sua riflessione intorno alla natura dell'arte. In questo senso, la teoria letteraria non si oppone alla pratica della scrittura, ma alla sua estetica, che quindi è necessario superare.

  4. Sustainability Statement and Policy

    Science.gov (United States)

    Journal of Education for Sustainable Development, 2009

    2009-01-01

    This article presents nine resources that focus on environmental education and sustainability. These include: (1) "Sustainability Statement and Policy," Dalhousie University, Nova Scotia, Canada, 2009, which is available at http://office.sustainability.dal.ca/Governance; (2) "Climate Literacy: The Essential Principles of Climate…

  5. l'altra metà futurista: la donna nel futurismo, le donne del futurismo

    African Journals Online (AJOL)

    User

    altro con l'amplesso più totale della vita” è seguito dal brusco ritorno alla realtà di sé stessi e la domanda cosciente e terrificante “si, ma noi cosa siamo? Ci conosciamo?” (Ginanni, 1919:45). Si arriva alla constatazione desolante che rimane.

  6. HYPOGLYCAEMIC EFFECT~ OF BOSWELL/A DALZIEL/I ST E ,1

    African Journals Online (AJOL)

    BSN

    Key Words: Blood Glucose, Glucose Tolerance Test. ... Boswellia gum resin was shown to be a safe and effective therapy in colitis, ... designed to investigate the acti\\ ity of 11 dal:iellii stem bark in normal and .... Some plants have been reported to induce pancreatic beta cells regeneration and ..... Oral hypoglycaemic drugs.

  7. L'EPOPEA DELLA SARDEGNA IN MILLANT'ANNI DI GIULIO ANGIONI

    African Journals Online (AJOL)

    User

    mostrato dal padre in occasione della battaglia di Lepanto, da cui era tornato zoppo e .... antistoriche di attribuzioni di colpe o di valori positivi non toglie che da essa ... terrorismo islamico, che ogni tipo di azione volta a contrastarlo è diventata ...

  8. Armastusest kahel ajajärgul / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2000-01-01

    Mängufilm "Prantsuse leitnandi naine" ("The French Lieutenant's Woman") : stsenarist Harold Pinter John Fowles'i romaani järgi : režissöör Karel Reisz : Suurbritannia 1981. Ka : Nädal nr. 35, lk. 14

  9. Luoghi, tempi e futuri contingenti

    Directory of Open Access Journals (Sweden)

    Fabio Boverio

    2008-07-01

    Full Text Available La complessità dei rapporti tra oggetto mentale, realtà storica e rappresentazione storiografica appare evidente, quando taluni film di fantascienza ripropongono discussioni teoriche, alcune delle quali dal forte sapore medievale, in atmosfere medievali collocate nel futuro.

  10. President Meri lahendamata mõistatus / Ando Leps

    Index Scriptorium Estoniae

    Leps, Ando, 1935-

    2001-01-01

    Järgneb: Kesknädal, 28. märts 2001, lk. 11; 4. apr. 2001, lk. 11; 11. apr. 2001, lk. 11; 18. apr. 2001, lk. 11; 25. apr. 2001, lk. 11; 2. mai 2001, lk. 11; 9. mai 2001, lk. 11; 16. mai 2001, lk. 11. President Lennart Meri minevik

  11. Miks rahvas ajakirjandust ei usalda? / Toomas Alatalu

    Index Scriptorium Estoniae

    Alatalu, Toomas, 1942-

    2001-01-01

    Järgneb: Kesknädal, 6. sept. 2001, lk. 8; 12. sept. 2001, lk. 8; 19. sept. 2001, lk. 8; 26. sept. 2001, lk. 8; 3. okt. 2001, lk. 8; 10. okt. 2001, lk. 8. Väliskapitali omandis ja kolmikliidu teenistuses meedia mures tuleviku pärast

  12. Uue tantsu Superinimene / Ivar Põllu

    Index Scriptorium Estoniae

    Põllu, Ivar

    2007-01-01

    Festivalil "Uue tantsu nädal Tartus " esitatud viiest autorilavastusest : Katrin Essensoni "Manusega mõtted", Renate Valme "Mesta", Mart Kangro "Start. Based on a True Story", Kaja Kannu "There are Laika Dogs living in Estonia" ja Marten Spangbergi "Heja Sverige"

  13. Termodinamica

    CERN Document Server

    Grilli, Mario

    1985-01-01

    Descrizione macroscopica di un sistema termodinamico ; descrizione microscopio : statistica di un sistema termodinamico ; calore e lavoro ; il calore dal punto di vista miscroscopico ; il secondo principio della termodinamica : entropia ; interpretazione miscroscopica-statistica della entropia : postulato di Nernst-Planck ; fenomeni di trasporto.

  14. Estonia hukk jõuab suvel kinodesse / Tarmo Michelson

    Index Scriptorium Estoniae

    Michelson, Tarmo, 1975-

    2002-01-01

    dal tagasi alustati Berliinis poliitilise põnevusfilmi "Baltic Storm" võtetega, mis kujutab parvlaev "Estonia" hukku venelaste vandenõu tulemusena. Produtsendid on Jutta Rabe ja Kaj Holmberg, režissöör Reuben Leder, peaosades Greta Scacchi ja Jürgen Prochnow

  15. Dalla fenomenologia all’ermeneutica. Il pensiero analogico di Bachtin come strategia epistemologica

    Directory of Open Access Journals (Sweden)

    Federico Pellizzi

    2012-12-01

    Full Text Available Si presenta la filosofia etica ed estetica di Michail Bachtin nel suo spazio originale tra fenomeno-logia ed ermeneutica. Riflettendo sulla peculiare logica "analogica" proposta dal pensatore russo, si mostra come tale pensiero riesca a porre in relazione soggettività e mondo, unicità della per-sona e spazio complesso della cultura.

  16. La ‘Société’ a Barcellona

    NARCIS (Netherlands)

    Abatino, B.

    2011-01-01

    Cronaca di convegno, su: LXIV Session della Société internationale F. de Visscher che si è tenuta dal 28 settembre al 2 ottobre 2010, presso il Campus della Universidad Autónoma, sul tema «Comunicazione e pubblicità nell’antichità: profili giuridici, sociali, economici».

  17. Il campo magnetico terrestre

    OpenAIRE

    Meloni, A.; Winkler, A.

    2004-01-01

    La Terra si comporta come se fosse una grande calamita, in grado di influenzare l'ago magnetico delle bussole la quale si orienta approssimativamente verso Nord. La forza che agisce sull’ago, costringendolo ad assumere questa posizione, è generata dal campo magnetico terrestre.

  18. ENEA presenta sistema ADS per trattamento scorie

    CERN Multimedia

    2002-01-01

    "Arriva il sistema Ads (Accelerator driven system) per il trattamento dei rifiuti radioattivi. Lo studio di fattibilita' per l' innovativa tecnologia, realizzato da un gruppo di lavoro congiunto Enea, Cea, Cern e Ansaldo, e' stato presentato oggi nel corso di un workshop presieduto dal premio Nobel per la fisica, Carlo Rubbia" (1/2 page).

  19. 78 FR 4356 - Proposed Modification of the Dallas/Fort Worth Class B Airspace Area; TX

    Science.gov (United States)

    2013-01-22

    ... Dallas/Fort Worth International Airport (DFW) and Dallas Love Field Airport (DAL) within Class B airspace... acknowledge receipt of their comments on this action must submit with those comments a self-addressed, stamped... configuration has not kept pace with airport expansions and increasing operations and the current design makes...

  20. Momenti nella vita di uno scienziato

    CERN Document Server

    Rossi, Bruno

    1987-01-01

    Nel giro di pochi decenni, la nostra visione del mondo fisico, dal mond subatomico al mondo del cosmo, ha subito una profonda evoluzione. In questo libro, uno degli scienziati che hanno contribuito a tale sviluppo narra la storia della sua vita e del suo lavoro.

  1. Complex analyses on clinical information systems using restricted natural language querying to resolve time-event dependencies.

    Science.gov (United States)

    Safari, Leila; Patrick, Jon D

    2018-06-01

    This paper reports on a generic framework to provide clinicians with the ability to conduct complex analyses on elaborate research topics using cascaded queries to resolve internal time-event dependencies in the research questions, as an extension to the proposed Clinical Data Analytics Language (CliniDAL). A cascaded query model is proposed to resolve internal time-event dependencies in the queries which can have up to five levels of criteria starting with a query to define subjects to be admitted into a study, followed by a query to define the time span of the experiment. Three more cascaded queries can be required to define control groups, control variables and output variables which all together simulate a real scientific experiment. According to the complexity of the research questions, the cascaded query model has the flexibility of merging some lower level queries for simple research questions or adding a nested query to each level to compose more complex queries. Three different scenarios (one of them contains two studies) are described and used for evaluation of the proposed solution. CliniDAL's complex analyses solution enables answering complex queries with time-event dependencies at most in a few hours which manually would take many days. An evaluation of results of the research studies based on the comparison between CliniDAL and SQL solutions reveals high usability and efficiency of CliniDAL's solution. Copyright © 2018 Elsevier Inc. All rights reserved.

  2. Sünnipäeval BMW-ga surnuks

    Index Scriptorium Estoniae

    2010-01-01

    Nädala kõmulisimas avariis Kapu külas hukkus oma sünnipäeval noor mees, kolm samas autos viibinud inimest viidi haiglasse. Nädal liikluses (31. mai kuni 6. juuni 2010): hukkunuid 1, vigastatuid 39

  3. Chaos and change: The fall of Mussolini, the signing of the armistice ...

    African Journals Online (AJOL)

    ... dell'armistizio dell'8 settembre 1943. Al centro dell'articolo alcuni passi dal manoscritto inedito In marcia, prodotto da prigionieri di guerra della Gabbia Politica (Block 8) istituita nel campo di concentramento di Zonderwater subito dopo la firma dell'armistizio. Particolare attenzione è posta altema della memoria e del lutto.

  4. Informazioni geografiche per i Location Based Services

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2008-03-01

    Full Text Available Elaborazione digitale della posizione umana e delle sue necessità: è un tentativo di traduzione del termine LBS Location Based Services, servizi basati sulla localizzazione. Un classico esempio? Il navigatore per autovetture, o Tom Tom dal nome del costruttore più diffuso. Un accessorio diffuso quasi al pari del telefono cellulare.

  5. Dual active layer a-IGZO TFT via homogeneous conductive layer formation by photochemical H-doping.

    Science.gov (United States)

    Jeong, Seung-Ki; Kim, Myeong-Ho; Lee, Sang-Yeon; Seo, Hyungtak; Choi, Duck-Kyun

    2014-01-01

    In this study, InGaZnO (IGZO) thin film transistors (TFTs) with a dual active layer (DAL) structure are fabricated by inserting a homogeneous embedded conductive layer (HECL) in an amorphous IGZO (a-IGZO) channel with the aim of enhancing the electrical characteristics of conventional bottom-gate-structure TFTs. A highly conductive HECL (carrier concentration at 1.6 × 10(13) cm(-2), resistivity at 4.6 × 10(-3) Ω∙cm, and Hall mobility at 14.6 cm(2)/Vs at room temperature) is fabricated using photochemical H-doping by irradiating UV light on an a-IGZO film. The electrical properties of the fabricated DAL TFTs are evaluated by varying the HECL length. The results reveal that carrier mobility increased proportionally with the HECL length. Further, a DAL TFT with a 60-μm-long HECL embedded in an 80-μm-long channel exhibits comprehensive and outstanding improvements in its electrical properties: a saturation mobility of 60.2 cm(2)/Vs, threshold voltage of 2.7 V, and subthreshold slope of 0.25 V/decade against the initial values of 19.9 cm(2)/Vs, 4.7 V, and 0.45 V/decade, respectively, for a TFT without HECL. This result confirms that the photochemically H-doped HECL significantly improves the electrical properties of DAL IGZO TFTs.

  6. Fluxus (fayd). Indagine sui fondamenti della Metafisica e della Fisica di Avicenna

    NARCIS (Netherlands)

    Lizzini, O.L.

    2011-01-01

    La teoria della causalità di Avicenna (Ibn Sīnā, m. 1037) è dominata dal concetto neoplatonico di flusso emanativo (in arabo fayḍ). Tutti i piani del sistema avicenniano ne sono interessati: quello metafisico, quello naturale, e quello intellettuale e quindi gnoseologico ed etico. Sulla base di

  7. Kultusfilmide festival kompab Ameerika filmide identiteeti / Ilmar Raag

    Index Scriptorium Estoniae

    Raag, Ilmar, 1968-

    2006-01-01

    27. jaanuarist 3. veebruarini on Sõpruse ekraanil järjekordne Manifesti filminädal, seekord USA filmiajaloo eredamatest teostest. Lähemalt filmidest, eelkõige Robert Aldrich'i film noir'ist "Kiss Me Deadly" (1955). Lisatud filminädala kava

  8. Al CERN prima fase sistema gestione dati LHC

    CERN Multimedia

    2003-01-01

    "Al via la prima fase per la realizzazione del sistema Lhc computing Grid (LCG), progettato per elaborare le quantita' di dati senza precedenti che, a partire dal 2007, saranno prodotte dagli esperimenti eseguiti con il nuovo grande acceleratore Large Hadron Collider (LHC), presso il Cern di Ginevra" 1 page

  9. Work life balance tra limiti istituzionali e pratiche innovative

    Directory of Open Access Journals (Sweden)

    Giovanna Campanella

    2017-12-01

    Full Text Available Come rispondono le politiche di conciliazione cura-lavoro alle esigenze delle lavoratrici e dei lavoratori di nuova generazione: sempre più precari, poveri e instabili dal punto di vista reddituale e/o professionale? Con un sostanziale immobilismo politico.  Questo è il quadro che viene fuori da una rassegna delle principali politiche sociali italiane volte a supporto della genitorialità e alla garanzia dell’occupazione femminile. Il contributo mette in luce i limiti di tali politiche e coglie gli aspetti innovativi di pratiche che si sviluppano dal basso.  Al contempo, una riflessione al margine lascia aperta una importante questione sul rapporto tra flessibilità e conciliazione, ovvero tra organizzazione del lavoro e tempi di cura per la famiglia. Nell’era della rivoluzione digitale,  individuamo forti resistenze al cambiamento, sia da parte delle istituzioni, ma anche e soprattutto dal mondo produttivo, che vanta si modelli “agili” di forme di lavoro da un punto di vista formale (vedi il lavoro agile/ smart working ma che dal punto di vista sostanziale rimane radicato a modelli di contrattazione standar che non agevola né la condizioine lavorativa da un punto di vista di tutele né la conciliaizone cura lavoro e quindi l’occupazione femminile.

  10. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  11. Madame Bovary / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2001-01-01

    Austraalias oma filmikarjääri alustanud näitlejanna Frances O'Connor (1969), kes mängib nimiosa Inglismaa-USA seriaalis Gustave Flaubert'i romaani "Madame Bovary" ainetel. Ka : Nädal nr. 52, lk. 17

  12. CHE COSA RESTA DI CHERUBINI OGGI? DUE CASI DI STUDIO

    Directory of Open Access Journals (Sweden)

    Emanuele Miola

    2016-09-01

    Full Text Available A partire dagli anni Duemila, il fenomeno delle cosiddette risorgenze dialettali si è manifestato, nel panorama linguistico italiano, anche attraverso l’emergenza dei dialetti negli ambiti propri della Comunicazione Mediata dal Computer e, specialmente, sui siti internet creati ‘dal basso’, come l’enciclopedia libera e multilingue online Wikipedia. In questo articolo, si esaminerà il lascito di Cherubini e del suo Vocabolario milanese-italiano sull’edizione regionale lombarda della Wikipedia: gli articoli di quest’ultima saranno passati in rassegna, sia dal punto di vista ortografico, comparando le scelte del lessicografo milanese con quelle più in voga online, sia dal punto di vista morfo-sintattico, discutendo in questo secondo caso la presenza e la produttività di alcuni verbi sintagmatici. What remains of Cherubini today? Two case studies Since the beginning of the twenty-first century, the phenomenon of dialect resurgence has manifested in Italy through the emergence of dialects in Computer Mediated Communication, especially, on bottom-up created Web sites, like the free, multilingual, online encyclopedia Wikipedia. In this article, we will examine the legacy of Cherubini and his Milanese-Italian dictionary on the regional Lombard version of Wikipedia. We will review the articles both in terms of spelling, comparing the choices of Milanese lexicographer with those most utilized currently online, and from a morpho-syntactic point of view, discussing the presence and the productivity of some phrasal verbs.

  13. Hoogsalt moodne Tallinn Fashion Week / Jaanika Terasmaa : intervjueerinud Annely Martin

    Index Scriptorium Estoniae

    Terasmaa, Jaanika

    2010-01-01

    Tallinn Fashion Week kestab 7. novembrini. Üks moenädala korraldajaid Jaanika Terasmaa, sellest, mida moenädal pakub tavainimesele ja kui oluline on selline ettevõtmine moeloojatele, moenädala eesmärgist

  14. Millist presidenti siis vajab Eesti vabariik? / Ando Leps

    Index Scriptorium Estoniae

    Leps, Ando, 1935-

    2001-01-01

    Järg Kesknädal Jul/24, Aug/1;8;15;22 lk. 7. Ilmunud ka Virumaa Teataja Jul/31 lk. 7; Aug/7;15;23 lk. 7. Autor analüüsib viit presidendikandidaati: Peeter Kreitzbergi, Arnold Rüütlit, Toomas Savi, Andres Tarandit ja Peeter Tulvistet. President Lennart Meri kriitika

  15. Gentile e i matematici italiani lettere 1907-1943

    CERN Document Server

    Nastasi, Pietro

    1993-01-01

    Che cosa possono scrivere dodici grandi matematici italiani, tra cui Guido Castelnuovo, Federigo Enriques e Leonida Tonelli, a Giovanni Gentile? La pubblicazione di questo carteggio, ricavato dal patrimonio archivistico del Fondo Gentile, getta una nuova luce su alcuni aspetti della storia della scienza (e della cultura) italiana nel nostro secolo, nonché sulla figura dello stesso Gentile.

  16. Preparation of antinutrients-reduced dhokla using response surface process optimisation

    NARCIS (Netherlands)

    Sharma, Anand; Kumari, Sarita; Nout, Martinus J.R.; Sarkar, Prabir K.

    2018-01-01

    Dhokla, a popular indigenous savoury dish of India, is prepared by soaking bengalgram dal and rice, grinding separately, mixing the batters, and spontaneously fermenting and steaming of mixed batter. Central composite rotatable response surface designs for soaking, fermentation and steaming at

  17. Mis tuleb

    Index Scriptorium Estoniae

    2007-01-01

    2.-8. VII kunstinädal "Kultuurikatapuldid 2007" Haapsalus. 7. VII-3. VIII Haapsalu klaasipäevad. 9.-14. VII Järvamaa kangakudujate päevad Sõrandus. Kuni 22. VII Järvakandi Klaasimuuseumis Mark Anguse meistriklassi klaasimaalide näitus "Maalitud muinaslood"

  18. GEOmedia su Marte Uno sguardo alla nuova cartografia di un pianeta

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-03-01

    Full Text Available L’esplorazione del sistema solare e la necessità di realizzare una cartografia, strumento indispensabile per qualsiasi tipo di indagine il genere umano abbia oggi in mente, ci porta ad affrontare il problema dell’estensione dei sistemi di riferimento, partendo dal presupposto che la Terra non è più ormai il solo oggetto dell’esplorazione geografica.

  19. Eesti kullassepad üllatasid idavirulasi / Irina Kiviselg

    Index Scriptorium Estoniae

    Kiviselg, Irina, 1961-

    1999-01-01

    Vestlus Eesti Proovikoja direktori Tõnu Tõnniste ja tema korraldatud juveliiride konkursi võitja Kristo Pacheliga (teiseks jäi Tatjana Tshõuntshik) eesti juveelikunstist ja proovikoja tegevusest; konkursi töid eksponeeriti nädal aega Kohtla-Järve kaupluses "Miss Lora"

  20. A means of reviewing the customer-bank relationship

    OpenAIRE

    A. Omarini

    2009-01-01

    Il lavoro intende presentare una nuova tendenza nel marketing bancario rappresenta dal concetto di customer experience applicato al mercato finanziario, con particolare riferimento allo sviluppo della multicanalità. Sono inoltre presentati alcuni dati di una ricerca telefonica realizzata nei confronti di un campione di 1000 cliente retail italiani.

  1. Sukeldumine oma ununenud ellu / Aita Kivi

    Index Scriptorium Estoniae

    Kivi, Aita, 1954-

    2000-01-01

    Sisu : Margaret Atwood. Pinnaletõus; Christine Bückner. Pärast lahutust; Danielle Steel. Kingitus; Judith Michael. Valede võrgus; Salvador DalÍ. Geeniuse päevik; Danielle Steel. Kurjus; Vladimir Megre. Anastasia; Theodora Lau. Hiina horoskoop

  2. Salvador Dali Kopenhaagenis / Ave Räkk

    Index Scriptorium Estoniae

    Räkk, Ave

    1999-01-01

    Salvador Dalí näitus Kopenhaageni moodsa kunsti muuseumis Arkenis kuni 2. I 2000. Eksponeeritud 119 originaaljoonistust autobiograafilisest raamatust 'The secret life of Salvador Dali', umbes 300 illustratsiooni, graafikat, skulptuure, kuld ja klaasehistöid, mööblit ja üks maal: 1944. a. valminud, esmakordselt avalikkuse ees olev 'Papillion'.

  3. Research Paper ISSN 0189-6016©2009

    African Journals Online (AJOL)

    hole udder. Buffalo, Cow, Goat. Bombax ceiba. (Semal-Bombaceae). Bark of Bombax ceiba mixed with seeds of Glycine max and grind with water to eat. Vigna mungo. (Kali dal-Fabaceae). Seed powders mixed with ... (Pyaj-Liliaceae). Bulb is grinded and mixed with black salt and used to drink with water. Zingiber officinale.

  4. Fisica Virgo, cosi' raccontera' origine universo

    CERN Multimedia

    Battifogloia, E

    2003-01-01

    "Permettera' di avvicinarsi all'attimo del Big Bang con una precisione senza precedenti, l'antenna Virgo per le onde gravitazionali inaugurata oggi a Cascina, vicino Pisa, e nata da un progetto italo-francese coordinato dall'Istituto nazionale di Fisica Nucleare e dal Centro francese per le Ricerche Scientifiche" (1 page)

  5. 5. Book Reviews

    Directory of Open Access Journals (Sweden)

    André Tiran

    2013-08-01

    Full Text Available Reviews of M.L. Pesante, Come servi. Figure del lavoro salariato dal diritto naturale all’economia politica, Franco Angeli, 2013 ; Joan W. Scott, Genere, politica, storia, éd. par I. Fazio, postface de P. di Cori, Viella, 2013.

  6. 75 FR 53274 - Initiation of Antidumping and Countervailing Duty Administrative Reviews and Deferral of...

    Science.gov (United States)

    2010-08-31

    .... Labor S.r.L. Molino e Pastificio Tomasello, S.p.A. PAM. S.p.A. and its affiliate, Liguori Pastificio dal... Tomasello, S.p.A. Pastificio Antonio Pallante S.r.L. Pastificio Fabianelli S.p.A. The People's Republic of...

  7. Tallinna moenädala staarid

    Index Scriptorium Estoniae

    2008-01-01

    Tallinna moenädalal (Tallinn Fashion Week) 01.-08. nov. 2008. a. Rotermanni kvartali uues ja vanas jahulaos esitlevad oma rõivakollektsioone Kirill Safonov, Triinu Pungits, Ketlin Bachmann-Põldroos, Aldo Järvsoo, Ksenia Jedomskihh, Kalle Aasamäe. Moekunstnikud tutvustavad oma kollektsioonide ideed. Samal teemal lk. 6 sõnum "Tallinnal oma moenädal"

  8. Sügiskaamose puhul tõttavad appi kolmed moepäevad / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2007-01-01

    4.10.2007 alanud Tallinna moenädal Tallinn Fashion Week Estonia teatri kammersaalis toob vaatajateni kodumaiste moedisainerite loomingut. Moenädala raames toimub Viru keskuses ka sügisene FIBIT ning Montoni kauplustes Tallinnas ja Tartus antakse tasuta stiilinõuandeid

  9. Smart cities or dumb cities? Città, riqualificazione urbana e pioggia di dispositivi elettronici

    Directory of Open Access Journals (Sweden)

    Beniamino Murgante

    2013-12-01

    Full Text Available Oggi è molto diffuso un approccio che associa in maniera stret- ta il concetto di Smart City alla repentina diffusione di dispositivi elettronici. Azioni di questo tipo, per quanto di indubbia utilità, se completamente sconnesse dal contesto e soprattutto dalla città possono trasformarsi in un inutile spreco.

  10. Moving beyond "Bookish Knowledge": Using Film-Based Assignments to Promote Deep Learning

    Science.gov (United States)

    Olson, Joann S.; Autry, Linda; Moe, Jeffry

    2016-01-01

    This article investigates the effectiveness of a film-based assignment given to adult learners in a graduate-level group counseling class. Semi-structured interviews were conducted with four students; data analysis suggested film-based assignments may promote deep approaches to learning (DALs). Participants indicated the assignment helped them…

  11. Kuidas õppida klassikutelt? / Ellu Maar

    Index Scriptorium Estoniae

    Maar, Ellu

    2007-01-01

    Anders Härmi ja Priit Raua kureeritud II NU performance'i-festival: Susanne Linke "Akuutne" (2003) ja "Im Dade Wannen" (1980) 9. XI ning Roi Vaara "Möödalöögid" 10. XI Kanuti gildi saalis. Performance'i rekonstrueerimisest

  12. Performance of human observers and an automatic 3-dimensional computer-vision-based locomotion scoring method to detect lameness and hoof lesions in dairy cows

    NARCIS (Netherlands)

    Schlageter-Tello, Andrés; Hertem, Van Tom; Bokkers, Eddie A.M.; Viazzi, Stefano; Bahr, Claudia; Lokhorst, Kees

    2018-01-01

    The objective of this study was to determine if a 3-dimensional computer vision automatic locomotion scoring (3D-ALS) method was able to outperform human observers for classifying cows as lame or nonlame and for detecting cows affected and nonaffected by specific type(s) of hoof lesion. Data

  13. Effects of Petrol Exposure on Glucose, Liver and Muscle glycogen ...

    African Journals Online (AJOL)

    olayemitoyin

    Alford, R.A. and Richards, S. J. (1999). Global amphibian declines: a problem in applied ecology. Annual. Rev.Ecol. Systematics 30 (1): 133-165. Almeida, J. A., Novelli, E. L. B., Dal-Pai Silva, M.,. Alves- Junior, R. (2001). Environmental cadmium exposure and metabolic responses of the Nile tilapia Oreochromis niloticus.

  14. David Cronenberg ja William S. Burroughs kutsuvad teid lantshile / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    1999-01-01

    Mängufilm "Alasti eine" ("Naked Lunch") William S. Burroughs' teose järgi : režissöör ja stsenarist David Cronenberg : Suurbritannia - Kanada 1991. Lähemalt režissööri kohta. Ka Nädal nr. 35, lk. 29

  15. Exiles/Nomads: Journeys through Language and Gender in Italian ...

    African Journals Online (AJOL)

    Le definizioni di esilio e nomadismo elaborate da Rosi Braidotti quali metafore dell'identità postmoderna costituiscono il punto di partenza per la discussione di alcuni scrittori degli anni Novanta (Brizzi, Culicchia, Caliceti, Scarpa, Nove, Ballestra, Campo e Santacroce), la cui narrativa prende le distanze dal contesto sociale ...

  16. Breve Manuale di Geografia Umana

    NARCIS (Netherlands)

    Minca, C.; Colombino, A.

    2012-01-01

    Il percorso per andare al lavoro, la scelta sul dove trascorrere le prossime vacanze, le nostre opinioni sulla politica estera, le nostre preoccupazioni per la crisi economica, le nostre affermazioni di identità, il nostro desiderio di fuga dal quotidiano, perfino la scelta di acquistare una casa in

  17. Pikad pühad ja kallis propaganda / Endel Rihvk

    Index Scriptorium Estoniae

    Rihvk, Endel

    2007-01-01

    Ilmunud ka: Kesknädal, 5. dets. 2007, lk. 4. Autor kritiseerib Eesti Vabariigi 90. aastapäeva aastapikkust tähistamist ja sellega seotud kulutamist ning kampaaniat Tallinna linnavõimu ettevõtmiste näitamist kõverpeeglis

  18. Diasporicità sull’esempio di Erich Auerbach in Gad Lerner e Miro Silvera

    NARCIS (Netherlands)

    Jansen, M.M.; Arts, Clemens

    2011-01-01

    A partire dall’esilio di Erich Auerbach a Istanbul dal 1936 al 1947, il contributo propone una riflessione sui concetti di diaspora e di esilio da adattare a due scrittori italo‐ebrei provenienti dalla diaspora orientale: Miro Silvera con Il passeggero occidentale (2009) e Gad Lerner con Scintille

  19. Editoriale

    Directory of Open Access Journals (Sweden)

    Egidio Pozzi

    2014-01-01

    Full Text Available Questo numero della rivista presenta due articoli proposti rispettivamente al Quarto Incontro di Studio di Analitica, tenuto a Rimini nel marzo del 2006, e all'International Conference on Music Perception and Cognition (ICMPC9 che si svolse a Bologna dal 22 al 26 agosto dello stesso anno.

  20. Hirm, iha ja uudishimu / Svea Suvi

    Index Scriptorium Estoniae

    Suvi, Svea

    2006-01-01

    Vägivaldset surma esineb teleekraanil järjest tihemini ja detailsemalt. Selle trendi loojaks peetavast menusarjast "C.S.I.: Kriminalistid". Sama artikkel pealkirjaga "Telelaibamäed" : Nädal, 30. jan. 2006, nr. 4, lk. 16 : ill

  1. Wind power. A success of a plant; Il successo di un impianto eolico

    Energy Technology Data Exchange (ETDEWEB)

    Pancaldi, A.

    2000-09-01

    Wind power can have an ideal application in particular in the geographical context. Realization problems and project financing are in this work illustrated. [Italian] L'energia eolica trova ideale applicazione in particolari contesti geografici. Una panoramica dei problemi realizzativi, dal finanziamento alla tipologia di impianto sino ai rapporti con l'utenza in una innovativa realizzazione scozzese.

  2. Jone Gaillard Corsi, Il libretto d'autore (1860-1930), West Lafayette ...

    African Journals Online (AJOL)

    User

    secondo piano rispetto alla musica e allo spettacolo, comincia a riacquistare una posizione preminente. Degli scapigliati, è Arrigo. Boito a svolgere un ruolo centrale nella storia del melodramma. Dal Re Orso (1865) al Nerone (1901) sarà sempre vivo l'intendimento di una "creazione in cui veramente le tre arti si trovassero ...

  3. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    User

    per le loro idee lontane da ogni conformismo e da ogni pacificazione, lontane da ogni convenienza, confraternita, piccola corte.” (9) “Eretici” nel senso etimologico del termine, che deriva dal greco hairein, prendere, scegliere, questi poeti scelgono l'assoluto della poesia, l'amore folle e senza riserve, la dedizione oscura e ...

  4. Comparison of anti amoebic activity of stereoisomeric diamino and ...

    Indian Academy of Sciences (India)

    this plant.3 As already reported4,5 comparative eva- lution of antiamoebic ... and to know the quantum of change in the amoebici- dal behaviour of ... in coenine alkaloids of this plant. ∗ ..... Vaid R M 1988 Modulations of Kurchi alkaloids, Ph.D.

  5. SIBILLA ALERAMO OVVERO LA SPECIFICITÀ DEL FEMMINILE1

    African Journals Online (AJOL)

    User

    autorappresentazione artistica. Fin dal suo primo romanzo, Una donna, uscito nel 1906 e presto diventato il suo libro piú famoso, sbalzando la giovane autrice esordiente sulla scena letteraria italiana e internazionale, l'Aleramo perseguí una ridefinizione del concetto patriarcale della donna a favore di una eguaglianza non ...

  6. Through the lens of the east: A study of themes in travel literature ...

    African Journals Online (AJOL)

    Il saggio studia gli scritti di viaggio dedicati da Giorgio Manganelli all'oriente, in particolare il libro Cina e altri orienti (1974): più che per il loro valore documentario, le penetranti pagine manganelliane rivelano un costante gusto di affabulazione letteraria, giocato sulla falsariga di illustri modelli, dal Milione di Marco Polo alle ...

  7. uno sguardo sul colonialismo italiano: gli scritti di erminia dell'oro

    African Journals Online (AJOL)

    User

    un'esperienza vissuta accompagnando il mio nipotino al museo di. Storia Naturale di Milano. Da allora ho continuato a scrivere per i ragazzi l'ultimo mio libro s'intitola Il gatto rapito, edito dal Battello a. Vapore”. Nonostante abbia lasciato l'Eritrea a vent'anni e da quel momento abbia sempre vissuto a Milano, nel corso della ...

  8. ... E OLTRE

    African Journals Online (AJOL)

    User

    dominio sul tempo e di ritorno «allo stato di perfetto equilibrio che caratterizza la materia inerte». Il piacere del verso (metro) è infatti determinato anche dal fatto che la ripetizione (costanza) ritmica consente il minimo dispendio di energia fisica (fonazione) e psichica (previsione, in quanto anche le connesse variazioni sono ...

  9. The Effects of a Museum Art Program on the Self-Concept of Children

    Science.gov (United States)

    Kaufman, Ryan; Rinehardt, Eric; Hine, Hank; Wilkinson, Berney; Tush, Peter; Mead, Bethany; Fernandez, Francisco

    2014-01-01

    Research suggests that art programs have positive therapeutic effects on children, including improved self-concept. This pretest/posttest intervention study examined changes in self-concept in children (N = 176) who participated in an art program at the Dalí Museum in St. Petersburg, Florida. Results indicated significant, positive increases in…

  10. Festival "Meretagune asi" kutsub osa saama vendade Tuulikute loomingust / Ivika Laanet

    Index Scriptorium Estoniae

    Laanet, Ivika

    2009-01-01

    Kuressaares toimub Saaremaa Rahvateatri ja Kuressaare Linnateatri poolt korraldatud harrastusteatrite festival "Meretagune asi", mis on pühendatud vendadele Ülo ja Jüri Tuulikule. Festivali raames toimub kuuldemängunädal, teatri- ja kirjanduskonverents ning Jüri Tuuliku näitemängude päev

  11. L'ISOLA DI ARTURO DI ELSA MORANTE

    African Journals Online (AJOL)

    User

    Vi è una curiosa atmosfera di attesa negli anni '50, ed è questa temperie morale che Elsa Morante rappresenta e interpreta nell'Isola di Arturo. Nel romanzo la Morante ci dà veramente un ritratto intero di quegli anni, nel senso che dal testo sorge una attitudine complessa, contenente in sè la percezione del tempo in corso, ...

  12. Comprehensive investigation of the metal in drums of boilers at thermal power stations

    Science.gov (United States)

    Ozhigov, L. S.; Mitrofanov, A. S.; Tolstolutskaya, G. D.; Vasilenko, R. L.; Rudenko, A. G.; Ruzhytskyi, V. V.; Ribalchenko, N. D.; Shramchenko, S. V.

    2017-05-01

    A comparative investigation of the metal of drums of two TP-100 boilers at the Starobeshevskaya and the Lugansk thermal power stations (TPS) was performed. Their operation time was approximately 300000 hours; the shell of one drum was ruptured during a hydraulic test, and the other drum is in operation. According to the results of the technical diagnostics and a strength analysis, both drums comply with the applicable regulatory requirements. The objects of the investigation were fragments of the ruptured drum and a "plug" cut out of the shell during a scheduled inspection. The investigation was carried out by microscopic metallography methods and the scanning electron microscopy technique. Mechanical tests of metal specimens were performed, and the hydrogen content in these specimens was measured. Prior to the material research, the metal was examined using a magnetic memory method. The investigation yielded specifics of the metal microstructure, mechanical properties, and fracture patterns of the metal specimens at various temperatures. An investigation performed by the method of thermal-desorption mass spectrometry revealed no considerable difference in the hydrogen content in the metal of both drums, thereby excluding the effect of hydrogenation in analyzing the rupture causes. It was established that the drum at the Starobeshevskaya TPS had been damaged due to its low impact strength at room temperature and high brittle-ductile transition point. Comparison of the metallographic study data with the results obtained using the magnetic memory method suggests that the fracture was caused by local formation of the Widmannstatten pattern at points where accessories are welded to the shell. The prospects are demonstrated of the comprehensive approach to nondestructive examination (NDE) of TPS drums using the magnetic memory technique and metallographic methods.

  13. The role of Germany in resolving the ukrainian crisis

    Directory of Open Access Journals (Sweden)

    Olena L. Hilchenko

    2016-02-01

    Full Text Available The article analyzes the participation of Germany in the matter of the Ukrainian crisis 2013-2015 and presents some approaches to the definition of the term «Ukrainian crisis». Reveals the reasons that lead Germany to take an active position in solving the Ukrainian question. Characterized the evolution of German-Russian relations from 90s to 2014, within which examined the St. Petersburg dialogue, «Pact of Putin-Schroeder», «Weimar triangle», «Partnership for modernization», Russian-Georgian conflict 2008. Available analysis of the new strategy of German foreign policy in 2012 «to support globalization – develop partnerships to share responsibility» and a new paradigm of German foreign policy presented in 2014 in the framework of the Munich conference on security policy. Examines the role of Germany in the European integration process of Ukraine during the Euromaidan events, the signing of the Association Agreement of Ukraine with the EU, ratification and future prospects of the enlargement of the European Union through the Eastern partnership countries. Presents the results of the public opinion of the population of Germany on this issue. Analyzes the position of the Germany government regarding the annexation of Crimea, the illegal referendum in Donetsk and Lugansk regions and the military aggression of Russian Federation against Ukraine. Presents description of the Germany role in the process of the diplomatic settlement of the military conflict in the East Ukraine in the framework of Norman four. On the example of polls are considered the public opinion of the population of Germany concerning possible ways of settlement the Ukrainian crisis. Presents the official position of the President of the Federal Republic of Germany. J. Gauck, Chancellor Merkel, Foreign Minister Frank-V. Steinmeier and Minister of Finance Schaeuble on certain issues of the Ukrainian crisis and the prolongations of sanctions against the Russian Federation

  14. Vaccinazione antinfluenzale nella ASL RMF della Regione Lazio: verifica dei risultati e dei costi sostenuti

    Directory of Open Access Journals (Sweden)

    L. Di Marzio

    2003-05-01

    Full Text Available

    Obiettivi: la vaccinazione antinfluenzale nella
    Regione Lazio dalla campagna 1999-2000 viene
    condotta sulla base di un protocollo regionale che,
    per favorire il raggiungimento degli obiettivi stabiliti
    dal Piano Sanitario Nazionale, coinvolge i
    Medici di Medicina Generale (MMG prevedendo
    una remunerazione aggiuntiva in parte fissa (a prestazione, in parte variabile (condizionata dal risultato
    del singolo medico e della ASL.
    Gli autori si propongono una verifica dei risultati raggiunti e dei costi sostenuti dall’ultima campagna eseguita con sole risorse aziendali del 1998-99 a quella del 2002-03.

    Metodi: il protocollo regionale prevede la raccolta
    delle informazioni per ciascun vaccinato presente
    nell’anagrafe informatizzata degli assistiti aziendali
    e ciò consente la valutazione delle coperture vaccinali
    aziendale e per ciascun MMG.
    Parallelamente sono considerati costi dei vaccini
    acquistati e retribuzione aggiuntiva dei MMG.

    Risultati: esaminati gli archivi dal 1998-99 al 2002-
    03, emerge il progressivo coinvolgimento dei MMG fino al recente 97%, l’aumento inequivocabile delle dosi di vaccino somministrate (da 9.406 a 36.692 e del tasso di copertura negli anziani (dal 24,2% al 66%. Invece la percentuale dei vaccini somministrati ai ›65 diminuisce dal 85,47% al 71,77% ed aumenta a favore dei più giovani così da risultare coperture negli ultrasessantacinquenni inferiori alle attese.Con gli anni l’integrazione dell’esperienza del servizio e dei MMG ha favorito un più oculato approvvigionamento
    con diminuzione degli sprechi passando dal 15,56% nel 2000-01 all’attuale 4,45%, ma contestualmente i costi risultano decuplicati (da 90 a 938 milioni di lire per maggior numero di dosi somministrate e costo delle prestazioni dei MMG

  15. Dietary acid load, trabecular bone integrity, and mineral density in an ageing population: the Rotterdam study.

    Science.gov (United States)

    de Jonge, E A L; Koromani, F; Hofman, A; Uitterlinden, A G; Franco, O H; Rivadeneira, F; Kiefte-de Jong, J C

    2017-08-01

    We studied the relation between a diet that is high in acid-forming nutrients (e.g. proteins) and low in base-forming nutrients (e.g. potassium) and bone structure. We showed a negative relation, which was more prominent if proteins were of animal rather than of vegetable origin and if intake of dietary fibre was high. Studies on dietary acid load (DAL) and fractures have shown inconsistent results. Associations between DAL, bone mineral density (BMD) and trabecular bone integrity might play a role in these inconsistencies and might be influenced by renal function and dietary fibre intake. Therefore, our aim was to study (1) associations of DAL with BMD and with the trabecular bone score (TBS) and (2) the potential influence of renal function and dietary fibre in these associations. Dutch individuals aged 45 years and over (n = 4672) participating in the prospective cohort of the Rotterdam study were included. Based on food frequency questionnaires, three indices of DAL were calculated: the net endogenous acid production (NEAP) and the ratios of vegetable or animal protein and potassium (VegPro/K and AnPro/K). Data on lumbar spinal TBS and BMD were derived from dual-energy X-ray absorptiometry measurements. Independent of confounders, NEAP and AnPro/K, but not VegPro/K, were associated with low TBS (standardized β (95%) = -0.04 (-0.07, -0.01) and -0.08 (-0.11, -0.04)) but not with BMD. Associations of AnPro/K and VegPro/K with TBS were non-linear and differently shaped. Unfavourable associations between NEAP, BMD and TBS were mainly present in subgroups with high fibre intake. High NEAP was associated with low TBS. Associations of AnPro/K and VegPro/K and TBS were non-linear and differently shaped. No significant associations of DAL with BMD were observed, nor was there any significant interaction between DAL and renal function. Mainly in participants with high intake of dietary fibre, DAL might be detrimental to bone.

  16. Traits to the social cultural portrait of pedagogues of Kyiv’s gymnasium: Mykola Volodymyrovych Storoshenko

    Directory of Open Access Journals (Sweden)

    Oleksandr A. Moskalenko

    2016-02-01

    Full Text Available It is investigated the life and the pedagogical activity of Ukrainian historian, public and educational worker Mykola Volodymyrovych Storozhenko (1862-1942 in a whole, and the period of his directorship in 1909-1919 in the First Kyev’s gymnasium It is noted that as a historian Мykola Storozhenko was formed in the intellectual and cultural environment of the Kyiv documentary school of Volodymyr Antonovych, under whose direction he was successfully engaged in researching of the history of Ukraine; he was very familiar with many representatives of the Ukrainian scientific and public communities in the end of the XIX – at the beginning of the XX centuries; he was active in the Ukrainian community life as a member of the Kyiv Archaeographic Commission and the Historical Society of Nestor the Chronicler, as a member of journals «Kievan antiquity», «Historical Journal», «Russian Thought», a district activist in the Piryatinschina; he had a family origin from the old petty officers family, well-known since the XVII century. It is proved that the long-term Mykola Storozhenko educational and administrative activities contributed to the fact that he perfectly from the inside knew the system of existence and financing of the secondary education, the government policy of the Ministry of public education as an employee and the administrator, the urgent needs of gymnasiums and pedagogues. It is proved that Mykola Storozhenko occupies a worthy place among the cultural and educational figures of the end of the XIX – at the beginning of the XX centuries in Kyiv, whose activities influenced on the formation and education of Kyiv social and cultural environment, who generated a tradition of education and culture of the city, and were involved in the creation of an integrated socio-cultural portrait of pedagogues of Kyiv’s gymnasium of their time.

  17. Final Report: Radiation-magnetohydrodynamic evolution and instability of conductors driven by megagauss magnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, Bruno, S.; Siemon, Richard, E.

    2008-10-22

    We are pleased to report important progress in experimentally characterizing and numerically modeling the transformation into plasma of walls subjected to pulsed megagauss magnetic fields. Understanding this is important to Magnetized Target Fusion (MTF) because an important limitation to the metal liner approach to MTF comes from the strong eddy current heating on the surface of the metal liner. This has intriguing non-linear aspects when the magnetic field is in the megagauss regime as needed for MTF, and may limit the magnetic field in an MTF implosion. Many faculty, students, and staff have contributed to this work, and, implicitly or explicitly, to this report. Contributors include, in addition to the PIs, Andrey Esaulov, Stephan Fuelling, Irvin Lindemuth, Volodymyr Makhin, Ioana Paraschiv, Milena Angelova, Tom Awe, Tasha Goodrich, Arunkumar Prasadam, Andrew Oxner, Bruno Le Galloudec, Radu Presura, and Vladimir Ivanov. Highlights of the progress made during the grant include: • 12 articles published, and 44 conference and workshop presentations made, on a broad range of issues related to this project; • An ongoing experiment that uses the 1 MA, 100-ns Zebra z-pinch at UNR to apply 2 5 megagauss to a variety of metal surfaces, examining plasma formation and evolution; • Numerical simulation studies of the 1-MA Zebra, and potential Shiva Star and Atlas experiments that include realistic equations of state and radiation effects, using a variety of tables. • Collaboration with other groups doing simulations of this experiment at LANL, VNIIEF, SNL, and NumerEx leading to a successful international workshop at UNR in the spring of 2008.

  18. SOME METHODOLOGICAL ASPECTS OF TRAINING IT PROFESSIONALS

    Directory of Open Access Journals (Sweden)

    Svitlana Leshchuk

    2017-03-01

    Full Text Available The important task of higher educational establishments is preparation of competitive professional, man that easily feels in market conditions and informative society. Next to possessing of informatively-communication technologies necessary abilities to study in a group, skills of prosecution of general projects. The aim of the article is to show possibility of organization of educational activity of students with maintenance and form works that is required by modern industry of information technologies. An author is describe separate steps preparations of future specialists, that is required by a IT-sphere; specialists that own a modern tool are understood by modern approaches in programming; able to work in a command above a general project and to arrive at a result. The basic ideas of the object-oriented programming are considered, methodology of management projects for the flexible Scrum and possibilities of the use of control system by versions software development, as a powerful instrument that gives an opportunity simultaneously, swimmingly to each other, to conduct the prosecution of group projects. Description comes true on the basis of realization of the special course for specialists on the informatics of specialities «Applied mathematics», «Informatics» of physics-mathematics faculty (Ternopil Volodymyr Hnatyuk National Pedagogical University. The table of contents of material is extended also by an acquaintance with the architectural template of MVC and generalization of abilities of work with a programmatic tool, by a necessity for creation of web-projects. The practical achievement of educational activity of students is development of social web-project with the aim of increase of level of culture of society and benevolent atmosphere of city.

  19. The "Kyiv Society of Natural Scientists" library in the holdings of theDepartment of Librarian Gatherings and Historical Collections of theV. Vernadsky National Library of Ukraine

    Directory of Open Access Journals (Sweden)

    Zayets О.

    2014-01-01

    Full Text Available In the article we have defined the degree of the "Kyiv Society of Natural Scientists" activity exploration (1869-1929, examined its origins and defined the goals and objectives of the society activity. We have given special consideration to its library. In particular, we have submitted the data on the scope of the book and magazine collections and details about the library readers. In 1926 the society library was transferred from its previous location in the University of Saint Volodymyr (the Institute of Public Education at that time and its holdings were temporarily transported to the National Library of Ukraine by the request of the society head - an academician I. I. Schmalhausen, and after the society and accordingly the contract liquidation in 1929 they remained permanently deposited in the library as a separate collection. The principal part of the librarian gathering of the society consists in the referential literature, relevant to biology, geology, zoology, geography, meteorology, chemistry, physics, mathematics as well as the scholar notes of universities and research institutions, which deal with nature study issues. Despite the fact, that the focal point of the society activities was the one concerning the theoretical nature study, increased attention was paid to the practical implementation of the research results. In this regard the subscription to the territorial agricultural periodicals was conducted from all the provinces of the empire. Since 1929 the centralization processes in the Academy of Sciences of USSR had intensified and the natural scientists library collection received other periodical editions, which had no ideological orientation and were not popular among the public.

  20. Final Report: Radiation-magnetohydrodynamic evolution and instability of conductors driven by megagauss magnetic fields

    International Nuclear Information System (INIS)

    Bauer, Bruno S.; Siemon, Richard E.

    2008-01-01

    We are pleased to report important progress in experimentally characterizing and numerically modeling the transformation into plasma of walls subjected to pulsed megagauss magnetic fields. Understanding this is important to Magnetized Target Fusion (MTF) because an important limitation to the metal liner approach to MTF comes from the strong eddy current heating on the surface of the metal liner. This has intriguing non-linear aspects when the magnetic field is in the megagauss regime as needed for MTF, and may limit the magnetic field in an MTF implosion. Many faculty, students, and staff have contributed to this work, and, implicitly or explicitly, to this report. Contributors include, in addition to the PIs, Andrey Esaulov, Stephan Fuelling, Irvin Lindemuth, Volodymyr Makhin, Ioana Paraschiv, Milena Angelova, Tom Awe, Tasha Goodrich, Arunkumar Prasadam, Andrew Oxner, Bruno Le Galloudec, Radu Presura, and Vladimir Ivanov. Highlights of the progress made during the grant include: (1) 12 articles published, and 44 conference and workshop presentations made, on a broad range of issues related to this project; (2) An ongoing experiment that uses the 1 MA, 100-ns Zebra z-pinch at UNR to apply 2 5 megagauss to a variety of metal surfaces, examining plasma formation and evolution; (3) Numerical simulation studies of the 1-MA Zebra, and potential Shiva Star and Atlas experiments that include realistic equations of state and radiation effects, using a variety of tables; and (4) Collaboration with other groups doing simulations of this experiment at LANL, VNIIEF, SNL, and NumerEx leading to a successful international workshop at UNR in the spring of 2008.

  1. Mapping query terms to data and schema using content based similarity search in clinical information systems.

    Science.gov (United States)

    Safari, Leila; Patrick, Jon D

    2013-01-01

    This paper reports on the issues in mapping the terms of a query to the field names of the schema of an Entity Relationship (ER) model or to the data part of the Entity Attribute Value (EAV) model using similarity based Top-K algorithm in clinical information system together with an extension of EAV mapping for medication names. In addition, the details of the mapping algorithm and the required pre-processing including NLP (Natural Language Processing) tasks to prepare resources for mapping are explained. The experimental results on an example clinical information system demonstrate more than 84 per cent of accuracy in mapping. The results will be integrated into our proposed Clinical Data Analytics Language (CliniDAL) to automate mapping process in CliniDAL.

  2. Funzioni del tempo presente nella strategia narrativa

    Directory of Open Access Journals (Sweden)

    Aleksandra Koman

    2017-08-01

    Full Text Available La scelta del tempo verbale adatto a una determinata situazione dipende dal rapporto tra il momento dell’avvenimento e quello dell’enunciazione. Se coincidono abbiamo a che fare con il tempo presente (Bertinetto. È necessario, però, ricordare che il presente è in grado di riferirsi agli eventi passati come accade spesso nei testi narrativi. Per capire lo scopo di questa scelta si sono analizzati diversi tipi di scrittura comprovanti che il presente nella narrativa può servire a sottolineare la posizione temporale del narratore (Il fu Mattia Pascal; a evidenziare un momento importante dal punto di vista dello svolgimento dell’azione (Se questo è un uomo; a costruire descrizioni (Vita oppure far entrare il lettore nel vivo del racconto (Gli Italiani in Polonia nei secoli, dando l’impressione che egli sia un testimone diretto degli eventi raccontati.

  3. Vecāku audzināšanas stila saistība ar pusaudžu vientulības izjūtu

    OpenAIRE

    Vlasova, Iveta

    2013-01-01

    Pētījuma jautājums: Vai starp mātes audzināšanas stilu un vientulības līmeni pusaudžiem pastāv saistība? Pētījuma dalībnieki. Viena izlase, pēc pieejamības principa. Dalībnieku vecums: 12-16 gadi, 31 meitene, 23 zēni. Dzīvojoši pilnās ģimenēs. Pētījuma metode. 1.Lieto, lai noteiktu kopējo vientulības izjūtas līmeni, tika izmantota Vientulības skala (UCLA Loneliness Scale/UCLA LS/, VERSION 3; Russel, D.W. 1996).– visu jautājumu summa. 2.Vecāku audzināšanas stila aptauja (Parental...

  4. Air pollution abatement by road traffic and social acceptability. A case study; Misure anti-inquinamento da traffico urbano e partecipazione del cittadino: uno studio del caso

    Energy Technology Data Exchange (ETDEWEB)

    Giuntarelli, P; Borrelli, G; Brini, S [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The paper describes the research, realised via a questionnaire on citizens representative of two roman districts, analyses the social acceptability degree of actions for reducing atmospheric pollution produced by automobile traffic in the city of Rome (Italy). [Italian] Il rapporto descrive una ricerca sul campo, svolta tramite questionario e su un campione di cittadini di due quartieri di Roma, che si propone di esaminare il grado di accettazione sociale di una serie di misure tendenti a ridurre l'inquinamento atmosferico causato dal traffico veicolare urbano, dal momento che trova unanime consenso riconoscere al traffico veicolare e piu' in generale al sistema di vita urbano le maggiori responsabilita' per quanto riguarda la produzione di sostanze inquinanti nell'aria.

  5. E-komercija un paterētāju aizsardzība

    OpenAIRE

    Mošenoka, Olga

    2013-01-01

    Bakalaura darba temats – E-komercija un patērētāju aizsardzība. Izstrādātais darbs sastāv no 70 lapaspusēm, 19 attēliem . Bakalaura darba mērķis: Izpētīt kas ir elektroniska komercija, kādas ir e-komercijas priekšrocības un trūkumi, kas ir e-komercijas dalībnieki, patērētāju aizsardzība. Izvirzītie darba uzdevumi: •noskaidrot kas ir e-bizness un e-komercija; •noskaidrot e-komercijas dalībniekus, priekšrocības, trūkumus; •iepazīties ar visveiksmīgākajiem e-komercijas piem...

  6. Air pollution abatement by road traffic and social acceptability. A case study; Misure anti-inquinamento da traffico urbano e partecipazione del cittadino: uno studio del caso

    Energy Technology Data Exchange (ETDEWEB)

    Giuntarelli, P.; Borrelli, G.; Brini, S. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The paper describes the research, realised via a questionnaire on citizens representative of two roman districts, analyses the social acceptability degree of actions for reducing atmospheric pollution produced by automobile traffic in the city of Rome (Italy). [Italian] Il rapporto descrive una ricerca sul campo, svolta tramite questionario e su un campione di cittadini di due quartieri di Roma, che si propone di esaminare il grado di accettazione sociale di una serie di misure tendenti a ridurre l'inquinamento atmosferico causato dal traffico veicolare urbano, dal momento che trova unanime consenso riconoscere al traffico veicolare e piu' in generale al sistema di vita urbano le maggiori responsabilita' per quanto riguarda la produzione di sostanze inquinanti nell'aria.

  7. Fisica e conoscenza

    CERN Document Server

    Pauli, Wolfgang

    2007-01-01

    Questo libro, curato da Pauli poco prima della morte, raccoglie un insieme di saggi che ben testimoniano la consapevolezza, che egli sempre ebbe vivissima, del significato più generale di ogni ricerca scientifica, valida non solo per il risultato singolo ma per il contributo più ampio al sapere. I saggi, percorsi dal tema comune del valore e dei limiti della conoscenza umana, possono essere distinti in due categorie: la prima puntualizza i personali apporti dell'autore e di altri grandi fisici alla scienza contemporanea; la seconda è dedicata a riflessioni sul potere del pensiero e alla validità di alcuni concetti fondamentali della teoria dell'evoluzione biologica e della psicologia dell'inconscio. Lo stile asciutto e rigoroso è animato dal ricordo personale di uomini ed episodi che fanno oggi parte della leggenda della fisica e, più in generale, della conoscenza umana.

  8. Lingue classiche, complessità e competenze

    Directory of Open Access Journals (Sweden)

    Marialetizia Mangiavini

    2009-10-01

    Full Text Available La traduzione dal latino e dal greco come problem solving: in questo lavoro proponiamo un nuovo framework di riferimento per lo studio delle lingue classiche, nella convinzione che solo un forte ed esplicito cambiamento di paradigma possa restituire loro senso e valore nell’educazione contemporanea e renderle forti promotrici di “skills for life”. Questo framework inserisce le discipline nell’orizzonte concettuale della teoria della complessità, sviluppa un approccio laboratoriale in ambiente tecnologico, in un’ottica di costruzione collaborativa della conoscenza, e ha tra i fini lo sviluppo di high skills, tra le quali la capacità di problem solving e di imparare a imparare.

  9. I musei dell'Unione Sovietica / The museums of the Soviet Union

    Directory of Open Access Journals (Sweden)

    Frederick Antal

    2016-12-01

    Full Text Available Il classico è un estratto di un articolo di Frederick Antaldel 1932, Über museen in der Sowjetunion,  apparso solo nel 1973  in «Kritische Berichte», nn. 2-3. La traduzione italiana si trova  in L. Binni, G. Pinna (1980, Museo. Storia e funzioni di una macchina cultrale dal Cinquecento a oggi, Milano: Garzanti, pp. 197-204.   The classis is an excherpt from a paper of Frederick Antal,  Über museen in der Sowjetunion (1932 published in 1973 in «Kritische Berichte», nn. 2-3. The Italian translation is on  L. Binni, G. Pinna (1980, Museo. Storia e funzioni di una macchina cultrale dal Cinquecento a oggi, Milano: Garzanti, pp. 197-204.

  10. Spettrometro e la segnatura muonica dell'esperimento OPERA

    CERN Document Server

    Di troia, Claudio

    OPERA è un esperimento in fase di installazione presso i Laboratori Nazionali del Gran Sasso che investiga sulla apparizione di neutrino tauonico generato per oscillazione di sapore da un fascio di neutrini muonici inviati dal CERN verso il Gran Sasso: il fascio di long baseline CNGS. OPERA è dotato di 2 spettrometri per l'identificazione dei muoni, la determinazione del momento e l'assegnazione della carica. Sono riportati i risultati dello studio delle proprietà e delle performance degli spettrometri. Per il magnete dipolare sono mostrate le proprietà chimiche, meccaniche e magnetiche; le mappe di campo magnetico atteso sono state simulate e viene descritto come il campo magnetico possa venir monitorato durante la presa dati. Sono descritti i test (i controlli di qualità) eseguiti sui Resistive Plate Chambers, i rivelatori traccianti all'interno del magnete. I test hanno selezionato gli RPC con adeguate proprieta' meccaniche (tramite test pneumatici) ed elettriche (tramite test di condizionamento). Dal...

  11. Koherentas kustības uztvere skolas vecuma bērniem ar sašaurinātu vizuālās uztveres lauku

    OpenAIRE

    Gritāne, Andželika

    2017-01-01

    Maģistra darbs tika uzrakstīts latviešu valodā uz 40 lapām, darbs satur 24 attēlus, 8 tabulas un satur 28 atsauces uz literatūras avotiem. Darba mērķis: Noteikt koherentas kustības slieksni skolas vecuma bērniem ar sašaurinātu vizuālās uzmanības lauku. Metodika: Dalībnieki tika iedalīti divās grupās balstoties un nevārda atpazīšanas testa rezultātiem – grupa ar sašaurinātu vizuālās uztveres lauku un grupa ar attīstībai atbilstošu vizuālās uztveres lauka lielumu. Abu grupu dalībniekiem tika n...

  12. A Look at the Researches of the Syro-Italian Archaeological Mission in Palmyra (PAL.M.A.I.S.

    Directory of Open Access Journals (Sweden)

    Gioia Zenoni

    2014-08-01

    Full Text Available Dal 2007 la Missione Archeologica Italo-Siriana a Palmira (PAL.M.A.I.S., nata da un accordo fra l’Università degli Studi di Milano e la Direzione Generale delle Antichità e dei Musei di Damasco, opera nel sito di Tadmor-Palmira (Siria sotto la direzione della prof. Maria Teresa Grassi. Le ricerche, finalizzate allo studio dell’edilizia residenziale privata della città romana attraverso l’indagine di un settore cruciale, il Quartiere Sud-Ovest, sono state supportate da attività sul campo - fra cui lo scavo stratigrafico dell’Edificio con Peristilio, ora interrotto - e dal 2011 si sono concentrate sullo studio dell’architettura e della cultura materiale in vista della pubblicazione finale.

  13. Siirt Arapçasının Türkçeyle Zenginleştirilmesi

    OpenAIRE

    Bankır, Mehmet Malik; Akdemir, Yılmaz

    2017-01-01

    Bu çalışmamızda dilin sadece bir iletişim aracı olmadığını bunun yanı sıra çok daha önemli unsurları içerdiğini belirtmeye çalışacağız. Dili her bilim dalı kendisine göre bir araç olarak kullandığı gibi dil de her bilim dalından kendince faydalanmak zorundadır. Öncelikle dil her şeyden önce bir iletişim aracıdır. Fakat dile iletişim aracı olarak bakmamak gerekir. Dilin bireyler arasındaki iletişim fonksiyonunun yanında, kültürel, toplumsal, beyins...

  14. La classificazione aristotelica delle scienze in Pietro d'Abano

    Directory of Open Access Journals (Sweden)

    Enrico Berti

    2014-12-01

    Full Text Available La classificazione delle scienze di Pietro d'Abano costituisce un'interessante riformulazione della classificazione analoga, proposta da Aristotele in Metaph. VI, e della teoria degli abiti dianoetici, proposta da Aristotele in Eth. Nic. VI. Come risulta dal Conciliator per quanto concerne la medicina e dal Lucidator per quanto concerne l'astronomia, Pietro segue la classificazione aristotelica e le interpretazioni che di essa erano state date nel medioevo (dottrina dei tre gradi di astrazione e distinzione tra methodus compositiva e methodus resolutiva, aggiungendovi come contributo originale l'introduzione di una parte pratica sia nella medicina che nell'astronomia (astronomia iudicialis, dove quest'ultima deriva da Tolomeo e dagli Arabi.

  15. OSSERVAZIONI SU UNO SCAMBIO DI POEMETTI TRA PIETRO STANCOVICH E MARTINO FIORANTI

    Directory of Open Access Journals (Sweden)

    Sandro Cergna

    2013-01-01

    Full Text Available Il lavoro presenta un’analisi comparata tra due poemetti d’occasione in dialetto istroveneto dell’Istria sud-occidentale. I componimenti, scritti nel 1826 dal dignanese Martino Fioranti e dal canonico di Barbana Pietro Stancovich, rappresentano un’importante attestazione della presenza di un’attività poetica in quella che rappresentava all’epoca la koiné del territorio istriano, cioè l’idioma di diretta derivazione veneziana. I poemetti rivestono scarsa importanza a livello letterario. Più interessanti si rivelano, invece, se osservati da una prospettiva storica e documentaristica, attraverso la quale ci si svela l’ambiente, il costume dell’epoca, e soprattutto il rapporto di cordiale amicizia che univa i due poeti. In chiusura del lavoro si dà un breve confronto tra il poemetto e i tre sonetti di Martino Fioranti, rinvenuti nell’archivio della Biblioteca universitaria di Pola.

  16. Funzioni esecutive in interazione con dispositivi di narrazione multilineare per una formazione generativa evidence based

    Directory of Open Access Journals (Sweden)

    Luisa Salmaso

    2015-12-01

    Full Text Available La promozione degli apprendimenti in partecipazione e cooperazione con gli altri, la pianificazione da concretizzare attraverso azioni organizzate, il far scaturire dal problem setting narrativo un processo dinamico, prospettico e costruttivo, in cui l’alunno viene sostenuto dal formatore e dalla struttura narrativa che guida, sono in grado di sollecitare la scoperta di percorsi possibili, sostenendo il carico cognitivo implicato in processi complessi, quali le funzioni neuropsicologiche di tipo esecutivo (Hughes, 2011; Zoccolotti, 2010. Il modello qui presentato può permettere l’attivazione di processi di apprendimento multiplo, infatti, pur inquadrato nel paradigma socio-culturale costruzionista, implica anche strategie afferenti a modelli istruzionali, cognitivi e metacognitivi dell’apprendimento, offrendo una palestra articolata per uno sviluppo di abilità cognitive e sociali, in una prospettiva formativa generativa evidence based.

  17. Complexity Analysis of Precedence Terminating Infinite Graph Rewrite Systems

    Directory of Open Access Journals (Sweden)

    Naohi Eguchi

    2015-05-01

    Full Text Available The general form of safe recursion (or ramified recurrence can be expressed by an infinite graph rewrite system including unfolding graph rewrite rules introduced by Dal Lago, Martini and Zorzi, in which the size of every normal form by innermost rewriting is polynomially bounded. Every unfolding graph rewrite rule is precedence terminating in the sense of Middeldorp, Ohsaki and Zantema. Although precedence terminating infinite rewrite systems cover all the primitive recursive functions, in this paper we consider graph rewrite systems precedence terminating with argument separation, which form a subclass of precedence terminating graph rewrite systems. We show that for any precedence terminating infinite graph rewrite system G with a specific argument separation, both the runtime complexity of G and the size of every normal form in G can be polynomially bounded. As a corollary, we obtain an alternative proof of the original result by Dal Lago et al.

  18. Energy efficiency indicators. Case study, Liguria; Indicatori di efficienza energetica. Il caso Liguria

    Energy Technology Data Exchange (ETDEWEB)

    Ciarallo, M A [ENEA, Divisione Promozione degli Usi Efficienti e Diversificazione dell' Energia, Centro Ricerche Casaccia, S. Maria Galeria, RM (Italy)

    2001-07-01

    The report examines the trend in the Liguria Region's energy requirements over the period 1988-1996. The trend was analysed using the regional energy balances and energy efficiency indicators, both in aggregate form and on a single sector basis. The residential sector, in particular, was singled out for an in-depth analysis using publishing and processed data. [Italian] Il presente rapporto esamina l'evoluzione delle caratteristiche energetiche della Regione Liguria attraverso l'analisi degli indicatori di efficienza energetica. Tale analisi e' stata svolta sia a livello aggregato che con riferimento ai singoli settori di attivita'. Particolare attenzione e' stata dedicata al settore residenziale, per il quale e' stato svolto un esame piu' approfondito attraverso un lavoro di raccolta e di elaborazione dati. Il periodo di riferimento va dal 1988 al 1966 dal momento che questo e' l'ultimo anno per il quale sono disponibili i dati economici Istat utilizzati per il calcolo degli indicatori.

  19. Unità di conto di bilancio.

    Directory of Open Access Journals (Sweden)

    R. VALCAMONICI

    2014-09-01

    Full Text Available La principale conclusione che si ricava dall’articolo mostra che l’aggravio che deriverebbe ai paesi a moneta debole dalla introduzione dell’UCE e, alternativamente, il vantaggio in favore dei paesi a moneta forte, sono destinati a livellarsi a partire dal 1978 in conseguenza dell’applicazione integrale del sistema delle risorse proprie e della maggiore partecipazione dei nuovi Stati menbri.

  20. The Magic Background of Pearl Harbor. Volume 4. Appendix

    Science.gov (United States)

    1977-01-01

    validita dei detti accorde ed hanno all nopo convenuto quanta segue. Articolo 1. II patto contra d’internazional communista, che resulta dall accordo...decoirere dal25 Novembre 1941. Articol 2. Gli stati che in seguito ad invito del Regio Governo Italiano, del Governo del Reich Germanico e de patto control...l’Internazional Comunista, si propongono di aderire a questo patto , transmetteranno per iscritto Ie lara dichiarazioni di adesione al Governo del Reich

  1. Analisis Sistem Antrian di Departemen Washing pada PT Mark Dynamics Indonesia dengan Menggunakan Teknik Simulasi ProModel

    OpenAIRE

    Limbong, Maraden

    2010-01-01

    Salah satu proses pada pembuatan cetakan sarung tangan di PT. Mark Dynamics Indonesia yaitu proses pencucian yang dilakukan di departemen Washing. Proses pencucian ini lini produksinya di bagi atas 3 lini dimana jenis ukuran yang harus dikerjakan terdiri dari 3 jenis yaitu small, medium dan large dimana waktu pengerjaannya berbeda-beda. Pada proses ini, tiap lini terdiri dari 20 orang dengan waktu kerja normal selama 400 menit (6,67 jam) per hari dengan persentase input ukuran yang masuk dal...

  2. In memory of Gaetano Fichera

    Directory of Open Access Journals (Sweden)

    Francesco Nicolosi

    2007-12-01

    Full Text Available Sono raccolte in questo Volume alcune delle conferenze svolte durante il 3^o Simposio Internazionale Problemi Attuali dell’Analisi e della Fisica Matematica, dedicato alla memoria di Gaetano Fichera, che si è svolto a Taormina dal 29 Giugno al 1 Luglio, 2006. Hanno partecipato al Simposio più di cinquanta studiosi italiani e stranieri (cfr. Elenco dei Partecipanti. Sono state svolte trentasette relazioni.

  3. Giallo rosso

    Directory of Open Access Journals (Sweden)

    Agilulfo Dei Guildiverni

    2014-11-01

    Full Text Available II titolo di questa rubrica non intende richiamare i colori di una celebre squadra di calcio, ma trae spunto proprio dal mondo dello sport nazionale. Potrebbe dunque sembrare totalmente fuori posto su una rivista di Geomatica, ma il lettore disponibile a sorridere trovera - ci auguriamo- qualche interessante e piacevole occasione di riflessione sui mondo a volte troppo serioso delle attivita geotopocartografiche.

  4. Valitsus hämab liikluskindlustuse seadusega / Marika Tuus

    Index Scriptorium Estoniae

    Tuus, Marika, 1951-

    2004-01-01

    Ilmunud ka: Vooremaa, 12. veebr. 2004, lk. 2; Elva Postipoiss, 14. veebr. 2004, lk. 4; Meie Maa, 20. veebr. 2004, lk. 2; Vali Uudised, 20. veebr. 2004, lk. 2; Põhjarannik, 21. veebr. 2004, lk. 2; Severnoje Poberezhje, 21. veebr. 2004, lk. 2; Kesknädal, 25. veebr. 2004, lk. 2; Valgamaalane, 16. märts 2004, lk. 6. Kriitiliselt liikluskindlustuse seaduse eelnõust. Liikluskindlustuse seaduse eelnõu arutelust Riigikogus

  5. TERREMOTI DELLA VAL PADANA DEL 15-16 MAGGIO 1951

    Directory of Open Access Journals (Sweden)

    M. C. SPADEA

    1956-06-01

    Full Text Available Dalle notizie rilevate dalla Stampa
    e da quelle tratte dall'indagine che l'ufficio Centrale di Meteorologia
    ha compiuto per nostro conto, si è potuto stabilire che la zona epicentrale
    cadeva nel lodigiano, dove ha sviluppato una intensità valutata
    dal V I al V I I grado della scala Mercalli.

  6. Ad libitum and restricted day and night sleep architecture.

    Science.gov (United States)

    Korompeli, Anna St; Muurlink, Olav; Gavala, Alexandra; Myrianthefs, Pavlos; Fildissis, Georgios; Baltopoulos, Georgios

    2016-01-01

    This study represents a first controlled comparison of restricted versus unrestricted sleep in both day and night sleep categories. A repeated measures study of a homogenous group of young women without sleep disorders (n=14) found that stage 1, 2, 3 and REM sleep, as well as sleep latency were not statistically different between day ad libitum sleep (DAL) and day interrupted (DI) sleep categories, while night interrupted (NI) and ad libitum (NAL) sleep showed strikingly different architecture.

  7. Sulla ricerca del minimo dei consumi per vetture sportive

    OpenAIRE

    Dolcini, Enrico

    2008-01-01

    La ricerca oggetto di questa tesi, come si evince dal titolo stesso, è volta alla riduzione dei consumi per vetture a forte carattere sportivo ed elevate prestazioni specifiche. In particolare, tutte le attività descritte fanno riferimento ad un ben definito modello di vettura, ovvero la Maserati Quattroporte. Lo scenario all’interno del quale questo lavoro si inquadra, è quello di una forte spinta alla riduzione dei cosiddetti gas serra, ossia dell’anidride carbonica, in linea con quelle ...

  8. LES OSTEOMES SINUSIENS A ExTENSION ORBITAIRE A ...

    African Journals Online (AJOL)

    gine de la constitution d'une néoformation osseuse. Enfin selon une théorie embryologique, l'ostéome résulterait de l'ossification du cartilage fœtal situé à la jonction du sinus frontal et ethmoïdal (3). Sur le plan clinique, les ostéomes sont souvent asymptomatiques lorsque la tumeur est de petite taille et située a distance de ...

  9. Integrating biophysical and socioeconomic information for prioritizing watersheds in a Kashmir Himalayan lake: a remote sensing and GIS approach.

    Science.gov (United States)

    Badar, Bazigha; Romshoo, Shakil A; Khan, M A

    2013-08-01

    Dal Lake, a cradle of Kashmiri civilization has strong linkage with socioeconomics of the state of Jammu and Kashmir. During last few decades, anthropogenic pressures in Dal Lake Catchment have caused environmental deterioration impairing, inter-alia, sustained biotic communities and water quality. The present research was an integrated impact analysis of socioeconomic and biophysical processes at the watershed level on the current status of Dal Lake using multi-sensor and multi-temporal satellite data, simulation modelling together with field data verification. Thirteen watersheds (designated as 'W1-W13') were identified and investigated for land use/land cover change detection, quantification of erosion and sediment loads and socioeconomic analysis (total population, total households, literacy rate and economic development status). All the data for the respective watersheds was integrated into the GIS environment based upon multi-criteria analysis and knowledge-based weightage system was adopted for watershed prioritization based on its factors and after carefully observing the field situation. The land use/land cover change detection revealed significant changes with a uniform trend of decreased vegetation and increased impervious surface cover. Increased erosion and sediment loadings were recorded for the watersheds corresponding to their changing land systems, with bare and agriculture lands being the major contributors. The prioritization analysis revealed that W5 > W2 > W6 > W8 > W1 ranked highest in priority and W13 > W3 > W4 > W11 > W7 under medium priority. W12 > W9 > W10 belonged to low-priority category. The integration of the biophysical and the socioeconomic environment at the watershed level using modern geospatial tools would be of vital importance for the conservation and management strategies of Dal Lake ecosystem.

  10. Bontá a vista d'occhio

    OpenAIRE

    Lunadei, Loredana

    2008-01-01

    I consumatori moderni sono informati ed esigenti e nelle loro scelte alimentari prediligono indubbiamente prodotti di qualità elevata, sia sotto il profi lo nutrizionale che sensoriale e igienico-sanitario. Nel caso dei prodotti ortofrutticoli, l�attributo in grado di condizionare maggiormente l�acquisto è sicuramente l�aspetto, inteso come colore, forma, presenza di difetti esterni, ecc. Per questo motivo, dal momento della raccolta fi no alla distribuzione, risulta di fondamen...

  11. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    User

    (d'ora in poi GGP) che, pur pubblicato per la prima volta a metà degli anni Cinquanta3 , rappresenta la scaturigine di tutta la successiva scrittura. All'interno del più vasto Giornale scelgo di appuntare l'attenzione sul solo Giornale di campagna (d'ora in poi GC), in cui si leggono annotazioni che vanno dal 24 agosto 1915 al ...

  12. 44 Apport du SIG et de la télédétection dans la modélisation spatiale ...

    African Journals Online (AJOL)

    Unicornis

    44. ISSN 1813-548X, http://www.afriquescience.info. Ahmed Nasreddine El FAHCHOUCH et al. Apport du SIG et de la télédétection dans la modélisation spatiale de la susceptibilité aux mouvements de terrain dans la région d'Al Hoceima,. Rif Oriental, Maroc. Ahmed NasreddineEl FAHCHOUCH*, Lahsen AIT BRAHIM, ...

  13. Fostering an entrepreneurial mindset in upper secondary school

    Directory of Open Access Journals (Sweden)

    Manuel Gentile

    2014-08-01

    In questo articolo si descrive il modello di formazione all’EE definito nell’ambito del progetto europeo “Posso ... Non Posso ... Vado! Rev. 2”, finanziato dal programma Leonardo da Vinci – Transfer of Innovation (TOI, ed è fornita una prima valutazione qualitativa dell’attività di sperimentazione condotta con gli studenti del 4° anno di un Istituto Tecnico per il Turismo di Palermo.

  14. Emozione, discorso e politiche della vita quotidiana

    Directory of Open Access Journals (Sweden)

    Lila Abu-Lughod

    2013-07-01

    Full Text Available Le emozioni sono una di quelle nozioni considerate scontate sia dalla conoscenza specialistica che dal discorso quotidiano, che stanno ora diventando parte del dominio della ricerca antropologica. Nonostante che siano ancora principalmente appannaggio della filosofia e della psicologia all’interno delle discipline accademiche, le emozioni sono anche questioni ordinarie del discorso culturale popolare americano,la cui relazione con questi discorsi professionali è complessa e solo parzialmente indagata.

  15. Millist presidenti siis vajab Eesti vabariik? / Ando Leps

    Index Scriptorium Estoniae

    Leps, Ando, 1935-

    2001-01-01

    Autor analüüsib viit presidendikandidaati: Peeter Kreitzbergi, Arnold Rüütlit, Toomas Savi, Andres Tarandit ja Peeter Tulvistet. President Lennart Meri kriitika. Järgneb: Kesknädal, 24. juuli 2001, lk. 7; 1. aug. 2001, lk. 7; 8. aug. 2001, lk. 7; 15. aug. 2001, lk. 7; 22. aug. 2001, lk. 7. Ilmunud ka: Virumaa Teataja, 31. juuli 2001, lk. 7; 7. aug. 2001, lk. 7; 15. aug. 2001, lk. 7; 23. aug. 2001, lk. 7

  16. Minister Looduse aeg on otsas / Toivo Tootsen

    Index Scriptorium Estoniae

    Tootsen, Toivo, 1943-

    2001-01-01

    Ilmunud ka: Hiiumaa, 31. aug. 2001, lk. 6; Meie Maa, 31. aug. 2001, lk. 2; Kesknädal, 6. sept. 2001, lk. 4; Nädaline, 4. sept. 2001, lk. 5; Sakala, 4. sept. 2001, lk. 2; Nädaline, 4. sept. 2001, lk. 5; Vooremaa, 4. sept. 2001, lk. 2; Virumaa Teataja, 5. sept. 2001, lk. 7. Siseminister peaks tagasi astuma. Autor: Keskerakond. Parlamendisaadik

  17. Reformierakond ei kauple põhimõtetega / Meelis Atonen

    Index Scriptorium Estoniae

    Atonen, Meelis, 1966-

    2001-01-01

    Ilmunud ka: Hiiu Leht, 11. dets. 2001, lk. 2; Nädaline, 11. dets. 2001, lk. 4; Valgamaalane, 11. dets. 2001, lk. 2; Järva Teataja, 11. dets. 2001, lk. 2; Kesknädal, 19. dets. 2001, lk. 5. Tallinna võimuliidu lagunemise peapõhjus oli Tallinna 2002. aasta eelarvesse kavandatud 900 mln kuni 1,5 mld krooni suurune laen, millega Reformierakond ei ole kunagi nõustnud. Autor: Reformierakond. Parlamendisaadik

  18. JPRS Report, East Europe.

    Science.gov (United States)

    1990-01-17

    21 Oct] ............................................. 38 THM Dal Plans Clothing Goods Store Franchises [RYNKI ZAGRANICZNE 7 Oct...former classmate Radomir Mladenovic, nick- General Dobrnjac was supposed to have lived. All we named Duce, the owner of the Boter cafe . had left was a... cafe . I know that he would stayed with their mother in Pozarevac. Slobodan not like it, even though he is an idol for many people Milosevic’s father

  19. Pietas, mitezza, felicità dello sguardo. Per un’etica debole della letteratura

    Directory of Open Access Journals (Sweden)

    Pino Menzio

    2016-01-01

    From the beginning, one of the most important features of Weak Thought is its pronounced ethical character, which concerns not only human beings and environment, but also things. In a direct way (Vattimo, Rovatti or in a more mediate form (Dal Lago this attitude has a close relationship with literary experience, which is one of its main starting points. It is thus very easy to re-apply these ethical propositions to literature.

  20. Návrh podnikatelského plánu pro vznik a rozvoj vybraného podniku

    OpenAIRE

    Kropáček, Lukáš

    2014-01-01

    Hlavním cílem předkládané absolventské práce je vytvořit návrh podnikatelského záměru pro vznik a další rozvoj minipivovaru. The main goal of the thesis is to propose a business plan for establishment and development of a microbrewery. A