WorldWideScience

Sample records for volga sa-2 static

  1. Athena konverentsi- ja kultuurikeskus ning restoran Volga = Athena Conference and Cultural Centre and Volga Restaurant

    Index Scriptorium Estoniae

    2008-01-01

    Athena konverentsi- ja kultuurikeskuse ning restorani Volga sisekujundusest (Tartus Küütri 1 asuva Athena kinohoone renoveerimine). Sisearhitekt: Aivar Roosaar. Restaureeriti ka muinsuskaitse alla kuuluvad Ferdi Sannamehe neoklassitsistlikud stukkreljeefid kinosaali seintel ja Peet Areni maalid restorani vitraažlaega keldrisaali nishshides. A. Roosaarest, tema tähtsamad tööd. I-III korruse, vahekorruse ja pööningu plaan, värv. välisvaade, 15 sisevaadet, foto A. Roosaarest

  2. Athena konverentsi- ja kultuurikeskus ning restoran Volga = Athena Conference and Cultural Centre and Volga Restaurant

    Index Scriptorium Estoniae

    2008-01-01

    Athena konverentsi- ja kultuurikeskuse ning restorani Volga sisekujundusest (Tartus Küütri 1 asuva Athena kinohoone renoveerimine). Sisearhitekt: Aivar Roosaar. Restaureeriti ka muinsuskaitse alla kuuluvad Ferdi Sannamehe neoklassitsistlikud stukkreljeefid kinosaali seintel ja Peet Areni maalid restorani vitraažlaega keldrisaali nishshides. A. Roosaarest, tema tähtsamad tööd. I-III korruse, vahekorruse ja pööningu plaan, värv. välisvaade, 15 sisevaadet, foto A. Roosaarest

  3. Hydroecological monitoring in the headwaters of the Volga River

    Science.gov (United States)

    Kuzovlev, Viacheslav V.; Zhenikov, Yuri N.; Zhenikov, Kyrill Y.; Shaporenko, Sergey I.; Haun, Stefan; Füreder, Leopold; Schletterer, Martin

    2016-04-01

    Europe's largest river, the Volga (3551 km), has experienced multiple stressors from human activities (i.e. the Volga Basin comprises about 40 % of the Russian population, 45 % of the country's industry and more than 50 % of its agriculture). During the research expedition "Upper Volga 2005" an assessment of hydrological, limnochemical and biological parameters was carried out by scientists from the Russian Federation and from Austria. The extensive sampling in 2005 showed that the free-flowing section of the Volga River, located upstream of Tver, represents conditions which are either reference or least disturbed - thus it can be considered as a refugial system for freshwater biota of the European lowlands. Subsequently three stretches in the headwaters of the Volga River (Rzhev, Staritsa, Tver) were selected for the monitoring programme "REFCOND_VOLGA", which is in operation since 2006. These locations correspond also with the sampling sites of ROSHYDROMET, i.e. at Tver physic-chemical samples are taken monthly and at Rzhev samples are taken in the main hydrological periods. The laboratory ship "ROSHYDROMET 11" conducted monthly cruises between Tver and Kalyazin (Ivankovskoye and Uglichskoye reservoirs on Volga) in the headwaters during the navigation period (May - October). This also includes measurements with ADCP, which further allow the analyses of the spatial distribution of the suspended solids within cross sections. In addition sediment fluxes were derived by using the acoustic backscatter signal strength from the acoustic current Doppler profiler (ADCP). We exemplify at the monitoring sites the spatial distribution of different sediments, i.e. choriotope types, according the longitudinal profile of the river. We show that it is highly influenced by morphodynamics in the different river sections and this corresponds with the zoobenthos fauna accordingly. This interdisciplinary approach, including sediment conditions, limnochemistry, hydrology and

  4. Balance of heavy metals in the Volga River delta

    Science.gov (United States)

    Kur'yakova, A. N.

    2011-08-01

    The results of many years of geochemical research of aquatic landscapes are presented. Data on the average annual and seasonal concentrations of heavy metals in water and suspended sediments are given. Factors of migration and accumulation of elements in aquatic landscapes are discussed. Masses of heavy metals annually incoming and accumulated in the Volga River delta were calculated.

  5. ANKYLOSING SPONDYLITIS IN THE VOLGA BULGARIA

    Directory of Open Access Journals (Sweden)

    D. I. Abdulganieva

    2015-01-01

    Full Text Available There is much evidence that ankylosing spondylitis (AS is a disease that is also much older than early human civilizations and man as a whole. Until now, the Russia's earliest (14th c ntury archaeological finding of such a patient remains a Volga Bulgaria inhabitant suffering with AS during his life. In the Republic of Tatarstan, at the site of an ancient Bulgar settlement appearing in the early ninth century, archaeologists have discovered an unusual grave: the deceased sitting with his back against the western wall of a tomb pitand having a bronze crosslet under his fingers. According to a historical source, it was the way of burying Christian hierarchs as pastors sitting on the altar and anticipating the great assize during which the destinies of human souls should be ruled. Anthropological analysis showed that the bones belonged to a 35–45-year-old man who was 158–163 cm tall. During the examination of the remains,attention was called to the following features of the spinal structure: ankylosis of the inferior cervical and superior thoracic vertebrae (СV–ThI and inferior thoracic and lumbar spine (ThIV–LII predominantly due to ossification of the anterior longitudinal ligament. Facet vertebral joints and costotransverse joints were also ankylosed at the same levels. The man's neck was fixed in a bent-over position with the head down, the chin touching the breast bone – the socalled soliciting posture. By and large, the vertebral changes are characteristic of late (X-ray stage III spondylitis. Spinal and pelvic photos and X-films are given for demonstration. The studies conducted by historical scientists and forensic medical experts suggest that the found remains are most likely to belong to Christian Theodore nicknamed Jerusaleman, also further known as Holy Theodore philosopher Kamsky (Bulgarian, who was mentioned in the Nikon chronicle in 1323.

  6. Microprocessor supervised stability control system for the united power system of Middle Volga in fault conditions

    Energy Technology Data Exchange (ETDEWEB)

    Berdnikov, V.I.; Birgel, E.R.; Kovalev, V.D.; Kuznestov, A.N.

    1994-12-31

    The development of the 500 kV UPS of Middle Volga, the complication of its configuration and operating conditions particularly in connection with concentration of the generating power at Balakovo NPS have aggravated the problem of stability of the Middle Volga UPS when high power is transmitted along the 500 kV transient system. In this case the necessity for improving control actions` dosage accuracy has also appeared. This work discusses solution to the above mentioned issue. (author) 3 figs.

  7. Maastrichtian sedimentation and palaeoenvironments of the Saratov Volga region

    Science.gov (United States)

    Iakovishina, Elena; Blinova, Irina; Kopaevich, Ludmila; Vishnevskaya, Valentina; Bordunov, Sergey

    2016-04-01

    The Saratov Volga region was a shallow-marine epicontinental basin North-Eastern shelf zone of the Tethys Ocean in the Maastrichtian. The basis for the modeling conditions of sedimentation was the detection mineral composition of rocks, as well as the contents of various chemical elements in rocks in three reference sections: Lower Bannovka, quarries "Bolshevik" and "Kommunar". Rocks of quarries "Bolshevik" and "Kommunar" characterized by quartz-calcite mineral association. The main rock-forming mineral is calcite, small amounts in rocks contain quartz. Other mineral composition characterized section Lower Bannovka. At the base of the section in the rock marked the presence of the opal. The source of silica are radiolarians. Favorable conditions for the existence of which is cold deep water enriched with SiO2. Above the section marked authigenic glauconite, which are confined to zones of skip in sedimentation.Further up begins to dominate the accumulation of calcite with rich bentic foraminifera. Clay minerals in rocks of the section Lower Bannovka presented montmorillonite and illite. The relationship of chemical elements and their alkali modules allow to detail the conditions of sedimentation. The ratio of Fe/Mn in them varies from 44 to 5729. Higher values are characteristic of glauconite sandstones. Up the section marked decrease in the Ti/Zr, indicating that the increase in the distance from the source area to the place of deposition. The similarity values of the ratio Ti/Zr samples indicates a community source area. Sedimentation Model revealed the impact of the PreUral strait connecting Tethys and Paleoarktic. Through the Strait of deep cold water saturated with SiO2, penetrated into the of the Saratov Volga region, were accumulated clay. The closing of the PreUral Strait changed the conditions of sedimentation, the associated fall in sea levels due to global cooling reflected in the crisis of radiolarians, increase in the number of glauconite. Subsequent

  8. V.F. Gening and issues on the archaeology of Volga Bulgaria

    Directory of Open Access Journals (Sweden)

    Rudenko Konstantin A.

    2014-03-01

    Full Text Available V.F. Gening’s contribution to the study of the Volga Bulgaria and his views concerning the history and archaeology of this state formation are considered in the article. His sphere of interest first of all included the links between the Volga Bulgaria population and the tribes belonging to preceding cultures, such as Pyanoborye and Imenkovo ones. V.F. Gening investigated the Bolshie Tarkhany, Turaevo and Rozdestveno burial grounds dated by the 8-9th, 5th and 6-7th centuries A.D., and the materials collected modified the notion of the time and character of the Bulgars arrival in the Volga area. He reconsidered the chronology and interpretation of the archaeological monuments, which referred to the epoch preceding the Bulgars appearance on the Volga, and proposed a hypothesis of the Volga Bulgars as a Turkic-Ugrian ethnos. V.F. Gening created a periodization of the Bolgars history in Eastern Europe within the time span between 1st-3rd centuries AD and the early 13th century AD

  9. Geoinformation mapping of soil erosion in the Middle Volga region

    Science.gov (United States)

    Yermolaev, O. P.

    2017-01-01

    The results of a medium-scale geoinformation mapping of soil erosion on an area of about 150000 km2 in the Middle Volga region are analyzed using the catchment-based approach. A quantitative index of the development of soil erosion on the agricultural lands is suggested. It reflects the intensity of soil erosion on slopes within the river catchments. A computer-based vector map of the boundaries of 3331 elementary catchments has been developed. It represents the territorial units for the analysis of soil erosion. Archive materials from the former institutes for land survey have been used to compile a series of the maps of soil erosion in river catchments on a scale of 1: 200000. The zoning of erosional processes has been performed, and the natural and anthropogenic levels of soil erosion in different basins have been estimated. The analysis of these materials shows that the topography and agricultural activity of humans are the major factors controlling the development of erosion. The maximum development of soil erosion in the studied region is typical of the subzone of broadleaved forests.

  10. Clinical, epidemiological and social characteristics of long-lived persons of the Volga region industrial centre

    Directory of Open Access Journals (Sweden)

    Malinova L.I.

    2011-09-01

    Full Text Available Aim: In spite of recent achievements in public health, average lifetime in the Volga region as in whole Russia is rather short. Issues of longevity in the region produce scientific interest by clinical, epidemiological and social characteristics of long-lived persons. Material and methods: In total 167 long-lived persons were examined. Medical, social, psychic, emotional and epidemiological characteristics were assessed. Results: The typical long-lived person of the Volga region was brought out. The high quality of life was revealed. The negative influence of smoking and alcoholism on the longevity was shown. Most of the patients needed communication. Lack of complaints was revealed, patients mentioned only the general weakness. Conclusion: The study has explained new social and demographic features of the Volga region long-livers

  11. [Abundance of Trans-Volga population of the great bustard (Otis tarda L.)].

    Science.gov (United States)

    Oparin, M L; Kondratenkov, I A; Oparina, O S

    2003-01-01

    We studied the abundance, spatial structure, and democratic parameters of the Trans-Volga population of great bustard as well as this species connection to the habitats during premigratory movements. The data were obtained by monitoring a test area of 1,200,000 hectares in 1998-2000. Time-related changes in the structure of great bustard habitats in Saratov Trans-Volga Region during the 20th century are described and the mechanisms underlying the changes in this species connection to the habitats under the influence of anthropogenic factors are proposed.

  12. CURRENT STATE OF WATER BIORESOURCES OF THE VOLGA AND CASPIAN SEA BASIN

    Directory of Open Access Journals (Sweden)

    L. M. Vasileva

    2012-01-01

    Full Text Available The article considers the issues of current degraded state of aquatic biological resources of the Volga-Caspian Sea basin and provides specific data on commercial stocks of fish. The main reasons for decrease in natural stocks of ichthyofauna are regulation and pollution of the spawning rivers, adverse hydrological conditions, injudicious hunting, poaching pressure. To improve the state of natural stocks of fish it is necessary to increase their reproduction and implement measures to restore and rational exploitation of aquatic bioresources of the Volga- Caspian Sea basin.

  13. [Enterobacteria isolated from commercial fishes from the Volga-Caspian basin].

    Science.gov (United States)

    Lartseva, L V; Rogatkina, I Iu; Bormotova, S V

    1996-01-01

    Enteric bacteria, such as Proteus, Citrobacter [correction of Cytobacter], and Providencia, were found to be prevalent particularly in the gills and intestines of marketable fishes of the Volga and Caspian Seas. Half of all the enteric bacteria was detected in the fish kidneys, spleen, and liver. This shows it necessary to standardize different types of fish raw materials.

  14. COMMODITY TABLES FOR ESTIMATION OF ARTIFICIAL ORIGIN OAK FORESTS IN THE LOWER VOLGA REGION

    Directory of Open Access Journals (Sweden)

    Chernykh V. L.

    2014-01-01

    Full Text Available The article proposes a system of regression equations to estimate the parameters of the normal probability distribution of the number of trunk diameters in stands of oak plantations of Lower Volga. Commodity tables for estimation of forest stands are developed

  15. On the Chronological Aspect of Productive Economy Origin in the Lower Volga Region

    Directory of Open Access Journals (Sweden)

    Vybornov Aleksandr A.

    2016-09-01

    Full Text Available The Lower Volga region territory plays a large part in studying the origin of producing economy. It is particularly important to determine the time of this process commencement. The researchers assumed the coexistence of the late Neolithic and Early Eneolithic monuments in this area. On that basis they highlighted the Neo-Eneolithic period. The researchers dated it to the middle of the 5 millennium BC. They associated this period and the emergence of producing economy at the territory under discussion. The weak point of this hypothesis was a small number of radiocarbon dates on this issue. Obtained after 2007, the radiocarbon dates on the Neolithic and Eneolithic monuments in the Lower Volga region demonstrate a 500-year chronological gap between them. That is why the hypothesis of the Neo-Eneolithic period is not confirmed. At the same time there is a reason to believe that the Late Neolithic and the Caspian Sea region culture coexisted during 5800-5500 BC. However, the referring of the Caspian Sea region culture to the Eneolithic suffers from the lack of evidence that its carriers were familiar with metal. There is also no evidence that they had cattle breeding. The situation changed after studying the Oroshaemoye I archaeological site in the Lower Volga region in 2014-2015. Cultural layer with materials from only the Caspian Sea region culture was found there. This increases the significance of the monument. The bones of domestic sheep and goats were found in this cultural layer. This is the first significant evidence of producing economy existing among the population of the Lower Volga region. AMS radiocarbon dates 4800 and 4700 BC were obtained from domestic sheep bones from this site. Thus, it is possible to make a reasoned conclusion that producing economy had being formed in the Lower Volga region among the carriers of the Caspian Sea region culture. This process can be reliably dated to the beginning of the 5 millennium BC.

  16. The Rationale for Comparative Effectiveness of Tourist Potential Realization (Case Study of the Volga Region

    Directory of Open Access Journals (Sweden)

    Anna Nikolaevna Polukhina

    2016-11-01

    Full Text Available The article presents the analysis of long-term tourism development programs of the Volga Region. Great attention is given to the sector’s financing measures set out in development programs. Domestic and foreign tourist potential assessment methods are analyzed. Tourist potential dynamics of the Volga Region is studied based on expert opinion. Using econometric approach the authors study the correlation between tourism investments and incomes of the Volga Region for the past six years – from 2009 to 2014. The analysis was carried out using statistics provided by the Russian Tourism Association and the Federal State Statistics Service of the Russian Federation by category of profitability from paid tourist services and from hospitality and catering services. The conducted analysis helped construct the figures showing the differentiation of the Volga regions by tourism investment efficiency and tourist potential realization. It is shown that tourist potential of the territories and its realization are highly differentiated. The sub-regions of the Volga Region are divided into groups according to the effectiveness of potential realization. The effectiveness of implementation of natural recreational and historical and cultural potential is higher in the sub-regions where places of tourist accommodation and entertainment are developed enough, effective mechanisms for programs implementation control are formed and the indicators of expected effectiveness of measures implementation are elaborated. The study has revealed the need for the development of common indicators of expected final results of tourism development programs. The use of a unified system of standardized indicators should become the principle of monitoring the implementation of regional tourism development programs. Data obtained by the research will be useful for the improvement of the existing regional tourism development programs

  17. Data of evolutionary structure change: 1A4SA-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SA-2ONNF 1A4S 2ONN A F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...HHHHH ------ EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- ... 2ONN F 2ONNF

  18. Basic trends for geological exploration in the Volga-Ural oil and gas province in 1979-1980

    Energy Technology Data Exchange (ETDEWEB)

    Vaynbaum, F.Ya.; Kaz' min, L.L.; Khachatryan, R.O.; Konovalenko, F.F.; Polyakov, V.A.; Surovikov, Ye.Ya.; Tkachenko, I.S.

    1979-01-01

    Features are examined of the condition of geological exploration for oil and gas and potential hydrocarbon resources for oil extracting regions of the Volga-Ural oil and gas province. Basic trends are isolated for geological-geophysical and prospecting-exploration work which guarantee an increase in hydrocarbon reserves in the planned period and which create reserves for the subsequent period. The outlook for further increase in effectiveness of geological exploration in the Volga-Ural oil and gas province were indicated.

  19. [Trematodes of birds (Aves) from the Middle Volga region. 2. Orders Plagiorchiida, Renicolida, Strigeida, and Schistosomatida].

    Science.gov (United States)

    Kirillov, A A; Kirillova, N Iu

    2013-01-01

    Data on trematodes of Plagiorchiida, Renicolida, Strigeida, and Schistosomatida, parasitizing in birds of the Middle Volga region are given. Proceedings of the different authors are supplemented by results of our research. Two species of trematodes (Brachylaima mesostoma and Mosesia amplavaginata) are specified for birds of the middle Volga region for the first time. New hosts were revealed for 2 trematode species: the great tit for Plagiorchis laricola and the common chaffinch for M. amplavaginata. The following characteristics for each parasite are given: it's systematic position, the spectrum of hosts, localization, collecting site, biology, the degree of host specificity and geographical range. The morphological description and original figures of 11 species of trematodes are presented.

  20. Domanik deposits in Volga-Ural basin: Structure and formation conditions

    Science.gov (United States)

    Zavialova, Anna; Chupahina, Vitaliya; Stupakova, Antonina; Suslova, Anna

    2017-04-01

    The high-carbon Domanic deposits within a Mukhano-Erohovsky trough in Volga-Ural Basin was analyzed from materials of the well cores in the region. Detailed macroscopic description of the cores was provided based on samples and thin sections. In this way, the composition, structure, conditions of sedimentation of high-carbon formation, reservoir properties of rocks, and their distributions in the sections were identified. It was concluded that the Volga-Ural basin is a pre-Ural foreland basin where Domanic siliceous carbonate shale formation formed during the peak of Late Devonian transgression. Domanic rich organic formation of Upper Devonian - Lower Carboniferous age is represented by clay-siliceous-carbonate and clean calcareous and siliceous rocks. These rocks formed in a calm sea basin with environments of shallow shelf, intrashelf depressions and their slopes. The most organic-rich deposits were accumulated in the central parts of the depression uncompensated by sediments.

  1. Pathological Condition of Trees and Shrubs of Forest Plantations in the Middle and Lower Volga Region

    Directory of Open Access Journals (Sweden)

    Kolmukidi Svetlana Valeryevna

    2015-09-01

    Full Text Available The materials on the study of the characteristics of pathologies common in the protective forest plantations are presented. The basic factors of deterioration of woody species pathological conditions are identified. The most common and harmful diseases of the major tree species of the Lower and Middle Volga region are determined. The comparative tolerance of systematic structure of the main forest-forming species to diseases are revealed. The complex research of modern pathological condition of trees and shrubs agroforestry plantations in the steppe and dry steppe regions of Lower and Middle Volga is carried out. Arid climate and harsh growing conditions contribute to the weakening of the stability of trees and shrubs and the deterioration of the pathological state plantations. Abnormal weather conditions (high temperatures, insufficiency or lack of precipitation, strong winds, hot winds, careless use of fire were the reason of forest plantations death. The varying degrees of resistance to pathogens among systematic composition rocks of artificial planting: elm, poplar, birch, ash, maple and others are revealed. The diseases of various etiologies, aggressiveness and severity leading to partial or complete loss of epiphytotics are identified. The most harmful are the vascular pathology (Dutch elm disease, Verticillium of maple, necrotic and cancerous disease of poplar, rot, bacterial diseases. The Middle Volga region Submucusracemosa is the most immune to pathogens, but Ribesaureum is quite resistant to anthracnose and powdery mildew, meanwhile it is subject to Verticillium wilt (Fungi of the genus Verticillium. In the Lower Volga region Cotinuscoggygria and Loniceratatarica are resistant to pathogens. Ribesaureum is subject to anthracnose and Verticillium wilt, on the branches of shadberry necrosis sore meets. Leaves of pea tree suffer from Septoria and rust, branch necrosis and cancer. The use of more sustainable, fast-growing species, hybrids

  2. DEVELOPMENT ELECTRONIC MAPS OF ECOLOGICAL STATUS OF WATER OBJECTS OF THE VOLGA RIVER DELTA

    Directory of Open Access Journals (Sweden)

    Z. N. Isenalieva

    2016-01-01

    Full Text Available Abstract. Aim. The aim of this work was the comprehensive study of the ecological state of water objects of the Volga River delta. Methods. The following methods were used: field (collection, observation, organoleptic, uniform chemical analysis techniques are based on colorimetric, settlement, photometric, spectrometric measurement methods. Results. On the basis of results of researches for 2010-2014 performed a comparative analysis of the dynamics of the content of hydro-chemical indicators of environmental quality in waters of the Volga River delta and the residential areas of the background. Applying an integrated approach to the study of biological indicators of water quality. Created digitized map of the quality of aquatic ecosystems of the Volga River delta. Displaying modern ecological condition of watercourses investigated, determined the degree of contamination, the overall trophic and saprobic. Main conclusions. The work has identified adverse environmental situation in water objects of the Astrakhan and the surrounding areas. Average annual concentrations of toxicological substances water objects in the background zone 10 times less than in the water objects of settlements. As a result of work on the basis of ArcGis 10.2.2 created information environment "Eco-monitor", which is a systematic set of information, and quantitatively characterizing the ecological status of water objects. Created on the basis of ArcGis 10.2.2 information environment monitoring system of waterways allows for a temporary and spatial analysis, to assess the quality of different streams in the control sections.

  3. Sarmatian Monuments in the Forest-Steppe Interfluve Area Between the Don and the Volga Rivers (Zoning Experience

    Directory of Open Access Journals (Sweden)

    Berestnev Roman Sergeevich

    2015-06-01

    Full Text Available The article is devoted to the zoning of Sarmatian antiquities in the forest-steppe interfluve area between the Don and the Volga rivers. On the basis of the analysis, the authors allocate four areas of burial monuments in the Northern periphery of the Asian Sarmatia (the river in Voronezh, the Middle Don, the Upper Don, the area between the Khoper and the Volga rivers. The stages of the forest-steppe area development by the Sarmatians in the Don River, the Khoper river and the right bank of the Volga river were also studied. The first stage is characterized by the general description of Sarmatian monuments located in the forest-steppe area between the Volga and the Khoper. The authors carry out the detailed review of the distinctive features of the funeral rites and some peculiar details: stratigraphy, structures beneath barrows, forms of burial pits, postures of the deceased, orientation, use of fire, imported and domestic utensils, weapons and ornaments. Archaeological materials are compared with the data of ancient sources (Claudius Ptolemy. The result of the study consists in the comparative analysis of the binding of specific ethnic groups in the allocated areas. The authors attribute the Sarmatians on the Voronezh river with the Gippofagi ancient authors; the Aseyes and the Sakata – with the area of monuments in the forest between the Volga and the Khoper.

  4. Data of evolutionary structure change: 1A7SA-2GDDC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2GDDC 1A7S 2GDD A C IVGGRKARPRQFPFLASIQNQ---GRHFCGGALIHARFV...FPRFVNVTVTPEDQC-----------------RPNNVCTGVLTRRGGICNGDGGTPLVCE----GLAHGVASFSLGPCGR--GPDFFTRVALFRDWIDGVLNNPGPGP...Y----QDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD...n14> 2GDD C 2GDDC ARG CA 404 PHE CA 422 VAL CA 380

  5. Data of evolutionary structure change: 1A7SA-2IOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2IOTA 1A7S 2IOT A A IVGGRKARPRQFPFLASIQNQ----GRHFCGGALIHARF...ain> 2IOT A 2IOTA CV...in> 1.7549999952316284 13.41100025177002 27.16900062561035 ...73 0.5460000038146973 0.7860000133514404 tion> 3.8209950923919678 2IOT A 2IOTA

  6. M2M在3GPP SA2的研究进展%The Progress of M2M in 3GPP SA2

    Institute of Scientific and Technical Information of China (English)

    杜加懂

    2011-01-01

    With the rapid development of Internet of things,almost all communication standardization organizations put their focus on the standards of M2M.3GPP as the main mobile communication SDO is working hard on research and standards on M2M.Based on the brief introduction of the 3GPP working groups on M2M,this paper mainly introduces the 3GPP SA2 research progress and standardization on M2M.%随着物联网的快速发展,M2M成为各个标准化组织研究和标准制定的工作重点。3GPP作为移动通信技术的主要研究和标准制定者,对M2M的相关研究和标准制定也在加紧进行。本文在介绍3GPP各个工作组的工作情况的基础上,重点介绍了M2M在3GPP在SA2的研究和标准化进展情况。

  7. “BRAINSTORM” OF SUSTAINABLE DEVELOPMENT INDEXES AND INDICATORS (ON THE EXAMPLE OF THE VOLGA BASIN

    Directory of Open Access Journals (Sweden)

    N. V. Kostina

    2016-01-01

    Full Text Available Aim of the research – development of management strategies ensuring sustainable development of the territories of the Volga river basin and its administrative units.Methods. In the research we used various methods of mathematical statistics, systematic principles. We propose the conception of "brainstorming" for the assessment of the territory using indices and indicators of sustainable development.Results. We selected nine indicators and indices. We have conducted a correlation analysis of the selected indices and indicators of sustainable development, all of which reflect the state of social, ecological and economic systems. For an integrated assessment of the two objects one introduced the "critical" and the "reference" state and fixed values for each index and indicator under the review. Factor analysis in the space of two principal components is conducted as well as one carried out the calculation of generalized desirability function for each administrative unit of the Volga river basin. "Brainstorm", taking into consideration indices and indicators of sustainable development, showed similarities in the administrative units of the Volga river basin, which primarily reflects approximately the same socio-ecological-economic development, defined by a single policy and economic decisions.Conclusion. The analysis revealed different management strategies of sustainable development of regions. The first group (strategy A includes the Republic of Tatarstan, and Chuvashia, Moscow and Samara regions, which should pay special attention to investments in improving the "life quality" by stabilizing and reducing the degree of anthropogenic load on the territory. The second group (strategy B: Astrakhan, Volgograd, Kirov, Tver and Kostroma and Perm regions - it is advisable to do finance and investment of resources in public education, increase the average lifetime, increase the incomes of the population. For the remaining areas optimally

  8. DETERMINATION OF HYDRO-ECOLOGICAL FACTORS OF THE VOLGA-CASPIAN AQUATIC ECOSYSTEMS STABILITY IN DESIGNING THEIR PROTECTION

    Directory of Open Access Journals (Sweden)

    Natalia Mitina

    2010-01-01

    Full Text Available This paper discusses possible consequences of changes in the Volga-Caspian aquatic ecosystems resulting from climate change according to the data scenarios of the Worldwide Meteorological Organization. Main hydro-ecological factors of stability of the Northern Caspian Sea ecosystems have been determined. It appears that ecosystem stability in the Northern Caspian Sea is primarily affected by natural conditions. It is essential to model riparian ecosystem processes and winter regime of reservoirs to develop strategies for mitigation of negative impacts of climate change. Such measures may include improvement of existing dams in the Volga region.

  9. Heavy metals in system «Delta of Volga - Northern Caspian Sea

    Directory of Open Access Journals (Sweden)

    E. V. Ostrovscaya

    2008-01-01

    Full Text Available It is displayed that the composition of heavy metals compounds in water and suspensions in the area of marine and riverine waters mixing undergo natural changes due to sedimentation and transformation. The system “Volga Delta – North Caspian” as a geochemical barrier hampers the transfer of toxic heavy metals forms from the sea to the river, although the content of toxic iron and manganese forms at the marine border of coastal waters can reach up to 30% of total concentration.

  10. To the History of Financial and Economic Activity of the Volga River Transport During the NEP and the First Five-Year Period

    Directory of Open Access Journals (Sweden)

    Gomanenko Olesya Aleksandrovna

    2016-04-01

    Full Text Available The Volga transport for 10 years (1923-1934 was influenced by all those changes which happened in the national economy of the country during the periods of the New Economic Policy and its transition to the forced industrialization. Since 1923 attempts of its delivery to concession in connection with the project of creation of the Volga-Don-Azov Sea hydraulic engineering constructions by means of the Western firms and banks took place. In 1929 those attempts ended without any results. Most likely, threat of outflow from the USSR of scarce currency in the form of profits of concessionaires was the main cause. That threat moved promises of foreign firms to significantly modernize and expand the Volga transport with all its coastal infrastructure, and also to promote creation of “new freights” in a zone of operations of the Volga fleet. Up to its reorganization in 1934 the Volga fleet constantly experienced the financial and technical difficulties caused by wear of watercrafts, low tariffs for a cargo transportation, etc. However, these low tariffs allowed the large new enterprises and constructions of the first five-year plans period to reduce their transport expenses. It favorably affected the process of industrialization of the Volga region and other ones. Losses on freight transportation were offset by the Volga water transport due to passenger traffic by increasing the high efficiency of passenger capacity of ships, an intensification of a passenger traffic and increase of a passenger tariff.

  11. Effect of climate changes on the soil freezing depth in the Volga River basin

    Directory of Open Access Journals (Sweden)

    I. L. Kalyuzhny

    2016-01-01

    Full Text Available It is established that the climate warming leads to decrease in depth of soil freezing in the whole area basin of the River Volga. This effect is observed since 1978. Depths of soil freezing averaged over the whole basin decreased relative to values measured during the period of stable climate conditions by 34 cm, i.e. from 92 up to 58 cm, or by 37%. In the Northern part of the basin, the depths have decreased by 49%, in the Western, Eastern, and Southern areas – 39, 24 and 38%, respectively. The spatial variability of the depths is estimated by the example of the river Vyatka, the large tributary of the Volga with area of 124 000 km2 and the site «Log Usadjevsky» with area of 2.0 km2 (a part of experimental polygon of the Valdai waterbalance station. It is shown that the coefficient of variation of the freezing depth decreases when the depth increases. When the depth becomes smaller 60 cm plots of thawed soil appear that significantly increases the infiltration ability of the basin. The technique of estimating the soil freezing depth under change of climate characteristics is proposed.

  12. Two Towns in the Lower Volga Region on the Mappa Mundi, 1457

    Directory of Open Access Journals (Sweden)

    Volkov Igor V.

    2016-06-01

    Full Text Available The author analyzes a medieval cartographic source – an anonymous so called Genoese World Map of 1457, which has been discussed many times, including in relevant monographs. Unfortunately, most publications contain low resolution and thus unreadable images of this map, or just drawings instead of photos. One can even fi nd some wrong dating or erroneous attribution of this map to Paolo dal Pozzo Toscanelli. The cartographer strived to produce a combination of data from all available sources: ancient accounts (Claudius Ptolemy, mainly, medieval ecclesiastic mappae mundi, travel accounts from Marco Polo to Nicolo Conti, and navigational portolano-charts. Sources for presentation of the Volga and Caspian Sea basin on this map are not explicitly identifi ed, because there is no explicit protograph known, and the presentation itself is seen as an independent source. The author dates information about this terrain from the rise of the Golden Horde under Uzbeg Khan (1313 – 1341 and Jani Beg (1342 – 1357 to the rise of Tamerlane (ca 1370. Two towns are shown in the Lower Volga region: Sarai (Sala and “the other Sarai” (Saraalis. Their correlation with the Selitrennoye and Tsarevskoye hillforts is not so obvious as on the maps derived from Fra Mauro’s protograph, but this correlation is most likely. This map is another source demonstrating that the idea of just one Sarai (this idea emerged in 1990s is not plausible.

  13. The technique of reconstruction the settlements fortifications of X–XVI centuries in the Middle Volga

    Directory of Open Access Journals (Sweden)

    Gubaidullin Airat M.

    2015-09-01

    Full Text Available The article deals with archaeological data on defensive structures of medieval settlements and in particular on the monuments of fortification of Volga Bulgaria and the Kazan Khanate. In this regard, an important aim is to establish their original appearance. The author gives a reconstruction technique the medieval fortifications, located on the territory of the Middle Volga. On the basis of significant information the author attempts to determine the original appearance of defensive structures, based on the results of archaeological research. The materials of the excavation of several settlements that existed in the X–VI centuries are represented as an example. The author analyzes each monument of military architecture, discusses its characteristics and analogies. Technological methods of construction of some medieval military fortifications are also considered. These include various types of structures made of wood and soil, which have been marked by researchers long ago. In addition, it is known a large number of defensive embankments constructed only from the ground. Therefore in order to reconstruct them it is necessary to have data of their composition. This can provide the information about their original shape and size. Thus, some regularity in the definition of basic and additional fortifications can be traced. The author points at the need for theoretical developments for a general reconstruction of defensive sites reflected in the literature on fortifications.

  14. Morphological and molecular observations on the cereal cyst nematode Heterodera filipjevi from the Volga and South Ural regions of Russia

    Science.gov (United States)

    During 2010-2012, a survey was conducted to determine the distribution and species diversity of the cereal cyst nematode Heterodera filipjevi within the Volga and South Ural regions of the Russian Federation. A total of 270 soil samples were collected. Seven populations of CCN were found in the rhiz...

  15. Assessment of undiscovered oil and gas resources of the Volga-Ural Region Province, Russia and Kazakhstan, 2010

    Science.gov (United States)

    Klett, T.R.; Schenk, Christopher J.; Charpentier, Ronald R.; Brownfield, Michael E.; Pitman, Janet K.; Cook, Troy A.; Tennyson, Marilyn E.

    2010-01-01

    The U.S. Geological Survey estimated mean volumes of technically recoverable, conventional, undiscovered petroleum resources at 1.4 billion barrels of crude oil, 2.4 trillion cubic feet of natural gas, and 85 million barrels of natural gas liquids for the Volga-Ural Region Province, using a geology-based assessment methodology.

  16. The importance of flooded terrestrial habitats for larval fish in a semi-natural large floodplain (Volga, Russian Federation)

    NARCIS (Netherlands)

    Gorski, Konrad; Leeuw, De Joep; Winter, Hendrik; Khoruzhaya, Victoria; Boldyrev, Vasily; Vekhov, Dmitry; Nagelkerke, Leo

    2016-01-01

    We assessed the importance of flooded terrestrial habitats for fish larvae in a semi-natural large floodplain (Volga, Russian Federation) by comparing abundances at the shoreline of permanent waterbodies with flooded terrestrial habitats. We found that overall larval abundance at the shoreline of

  17. [Role of Aeromonas in the monitoring of a hydroecosystem in the Volga-Caspian area].

    Science.gov (United States)

    Obukhova, O V; Lartseva, L V; Lisitskaia, I A

    2011-01-01

    The paper gives data obtained over many years on the quantity of bacteria of the genus Aeromonas in the hydroecosystems of the delta of the Volga and Caspian Sea and in commercial fishes (sturgeon (Acipenseridae), pike perch (Stizostedion), carp (Cyprinus carpio), silurus (Silurus glanis), etc.). It provides a detailed analysis of their seasonal trends and spatial distribution, markers of their pathogenicity, and antibiotic resistance. The findings suggest that Aeromonas is a causative agent of sapronoses and meets the criteria for natural focal infections. They show a wide range of tolerance to the abiotic factors of hydroecosystems, as well as mixotrophy and autrophic nutrition in the environment and they are of great sanitary and hygienic importance.

  18. Problems and Prospects of Tourism Development on Specially Protected Territories of Trans-Volga Region

    Directory of Open Access Journals (Sweden)

    Kursakova Nadezhda Aleksandrovna

    2015-09-01

    Full Text Available The vital topic of the development of tourism in the Volgograd region is studied in the article. The growing demand for recreational resources of local importance is shown. The positive and negative aspects of direct and indirect impact of tourism activities on specially protected natural territories of Trans-Volga region are examined. It is noted that the extreme sensitivity of arid zone landscape to recreational impact, even slight scattered recreational load (the passage of several dozens of people through the territory causes significant changes in phytocenosis – reduced plant cover, the share of weed species. The changes in geobotanical characteristics of the territory clearly persist throughout the growing season, the next season will not eliminate differences in the characteristics of the control and experimental plots. The changes arising from a linear recreational load are even more sustained, and they affect the most attractive natural objects, intensively visited by tourists. The role of the Volga-Akhtuba Floodplain and Eltonsky nature parks in the development of ecological tourism is shown in the article. It is emphasized that the interests of travelers should not be in conflict with the basic objectives of protected areas and should also match with the offered range of destinations. It is proposed to switch the attention of tourists so as not to lose those wishing to visit the territory, do not jeopardize the fragile natural systems. It is proposed to use both global and Russian experience of creating alternative forms of recreation that harmoniously blend into the landscape, contribute to the preservation of natural, historical and cultural heritage of the territory and gave the tourists a sense of belonging to the ethnic traditions of past eras.

  19. 3GPP SA2 architecture and functions for 5G mobile communication system

    Directory of Open Access Journals (Sweden)

    Junseok Kim

    2017-03-01

    Full Text Available The on-going development of Fifth Generation (5G mobile communication technology will be the cornerstone for applying Information and Communication Technology (ICT to various fields, e.g., smart city, smart home, connected car, etc. The 3rd Generation Partnership Project (3GPP, which has developed the most successful standard technologies in the mobile communication market such as Universal Mobile Telecommunication System (UMTS and Long Term Evolution (LTE, is currently carrying out the standardization of both 5G access network system and 5G core network system at the same time. Within 3GPP, Service and System Aspects Working Group 2 (SA2 is responsible for identifying the main functions and entities of the network. In December 2016, the 3GPP SA2 group finalized the first phase of study for the architecture and main functions of 5G mobile communication system under the study item of Next Generation system (NextGen. Currently, normative standardization is on-going based on the agreements made in the NextGen Phase 1 study. In this paper, we present the architecture and functions of 5G mobile communication system agreed in the NextGen study.

  20. Bioremediation potential of a highly mercury resistant bacterial strain Sphingobium SA2 isolated from contaminated soil.

    Science.gov (United States)

    Mahbub, Khandaker Rayhan; Krishnan, Kannan; Megharaj, Mallavarapu; Naidu, Ravi

    2016-02-01

    A mercury resistant bacterial strain, SA2, was isolated from soil contaminated with mercury. The 16S rRNA gene sequence of this isolate showed 99% sequence similarity to the genera Sphingobium and Sphingomonas of α-proteobacteria group. However, the isolate formed a distinct phyletic line with the genus Sphingobium suggesting the strain belongs to Sphingobium sp. Toxicity studies indicated resistance to high levels of mercury with estimated EC50 values 4.5 mg L(-1) and 44.15 mg L(-1) and MIC values 5.1 mg L(-1) and 48.48 mg L(-1) in minimal and rich media, respectively. The strain SA2 was able to volatilize mercury by producing mercuric reductase enzyme which makes it potential candidate for remediating mercury. ICP-QQQ-MS analysis of Hg supplemented culture solutions confirmed that almost 79% mercury in the culture suspension was volatilized in 6 h. A very small amount of mercury was observed to accumulate in cell pellets which was also evident according to ESEM-EDX analysis. The mercuric reductase gene merA was amplified and sequenced. The deduced amino acid sequence demonstrated sequence homology with α-proteobacteria and Ascomycota group.

  1. [Trematodes of birds (Aves) from the Middle Volga region. 1. Orders Brachylaimidae, Cyclocoelida, Echinostomatida, Notocotylida, and Opisthorchiida].

    Science.gov (United States)

    Kirillov, A A; Kitillova, N Iu

    2013-01-01

    The data on trematodes of the orders Brachylaimidae, Cyclocoelida, Echinostomatida, Notocotylida, and Opisthorchiida from the Middle Volga region are given. Records of different authors are supplemented with the results of our own research. Reliable records are confirmed for 61 trematode species. The following characteristics for each parasite species are given: the systematic position, the host spectrum, locality, collecting sites, biology, degree of host specificity, and the geographical range. Morphological descriptions and original figures of 3 trematodes species are given.

  2. Assessment of the Influence of the Hydrological Regime of the Volga River on the Dynamics of Flooding on Sarpinsky Island

    Directory of Open Access Journals (Sweden)

    A.S. Rulev

    2017-03-01

    Full Text Available The seasonal dynamics of flooding on Sarpinsky Island, which is included in the city of Volgograd, following the damming by the Volga HPP has been considered. The following research problems have been set: firstly, to establish seasonal patterns of flooding in the island territory; secondly, to find out if there is a flooding threat to social infrastructure facilities. The flooded area of the island has been assessed by Landsat multispectral images with a spatial resolution of 30 m. Only images with the survey date corresponding to the peak of high waters (with the difference of not more than 7–10 days have been analyzed. The flooding areas of the island have been calculated for the date when flooding peaked (April–May during the period from 1985 to 2016. The phases of spring flooding determined by the island landscape and the water discharge from the Volga HPP have been revealed. The curve of the area of flooding reaches maximum values after the water discharge is up to 11–12 km3, which depends on the initial filling of floodplain reservoirs (landscape depressions in depth without any increase in the area of flooding. The average shift between the peaks of water discharge and the area of flooding is 10–15 days and reflects gradual filling of floodplain reservoirs on Sarpinsky Island after the beginning of water discharge from the Volga HPP. It has been found that there is no threat to infrastructure facilities on Sarpinsky Island under the current volumes of water discharge during the flooding period. The obtained results are important for urban planning on the island, as well as for management of the regimes of water passage through the dam of the Volga HPP.

  3. A Simple Harmonic Model for FAPAR Temporal Dynamics in the Wetlands of the Volga-Akhtuba Floodplain

    Directory of Open Access Journals (Sweden)

    Alexander Kozlov

    2016-09-01

    Full Text Available The paper reports a technique used to construct a reference time series for the fraction of absorbed photosynthetically-active radiation (FAPAR based on remotely-sensed data in the largest Russian arid wetland territory. For the arid Volga-Akhtuba wetlands, FAPAR appears to be an informative spectral index for estimating plant cover health and its seasonal and annual dynamics. Since FAPAR algorithms are developed for multiple satellite sensors, all FAPAR-based models are suggested to be universal and useful for future studies and long-term monitoring of plant cover, particularly in wetlands. The model developed in the present work for FAPAR temporal dynamics clearly reflects the field-observed seasonal and annual changes of plant cover in the Volga-Akhtuba floodplain wetlands. Various types of wetland plant communities were categorized by the specific parameters of the model seasonal vegetation curve. In addition, the values derived from the model function allow quantitative estimation of wetland plant cover health. This information is particularly important for the Volga-Akhtuba floodplain, because its hydrological regime is regulated by the Volzhskaya hydropower plant. The ecosystem is extremely fragile and sensitive to human impact, and wetland plant cover health is a key indicator of regulatory efficiency. The present study is another step towards developing a methodology focused on arid wetland vegetation monitoring and conservation of its biodiversity and natural conditions.

  4. Construction and Operation of Railway Bridges and Ferries in the Lower Volga Streamflow (End of 19th – First Half of 20th Century

    Directory of Open Access Journals (Sweden)

    OPALEV M.N.

    2014-06-01

    Full Text Available The article deals with the history of operation of Russia’s first railway ferry and the process of bridge construction across the lower Volga streamflows at Ryazan-Ural (now Volga railway line in Saratov, Stalingrad (Volgograd and Astrakhan. River railway ferries “Saratovskaya pereprava” and “Saratovsky ledokol” were built in 1894 in England and water crafts “Vtoraya pereprava” (1909 and “Stalin” (1926 were floated out in Volga in Nizhny Novgorod, from the Sormov plant. As a rule, the organization of transportations by means of steam locomotives and waggons through Volga during the first half of the 20th century preceded the construction of capital metal railway bridges, such as Astrakhan (1909 and Saratov (1935, and also a combined railway-automobile bridge through the Volga (Stalingrad Hydro-Electric Power Station (1961. The article is devoted not only to the technical features of ferries, bridges, but their efficient use in peace time and war time. So, the carrying capacity of the Saratov railway ferry increased in more than three times from 1907 to 1916. The Ryazan-Ural railway ferries were actively used by new Bolshevist regime. After the railroad construction on the left bank of Volga in autumn and winter of 1941, railway ferries “Stalin” and “Saratovskaya pereprava” were used for the carriage of military trains and population evacuation from the western bank of Volga. The author describes one of the most heroic and tragic facts in the history of Stalingrad battle using the example of the special operation railway ferry flooding and its consequent reconstruction.

  5. The Country Council Work on Extracurricular Enlightenment of Adults in the Volga-Ural Region

    Directory of Open Access Journals (Sweden)

    Timur A. Magsumov

    2015-12-01

    Full Text Available The article reveals the activity of the Volga and Ural country councils to create a system of extracurricular enlightenment of adults in the later period of the existence of the Russian empire. The article is based on the statistical and mass sources, including office records from regional archives. The authors, resorting to a comparative multiaspect approach to the study of the country councils’ forms and methods of work to organize extracurricular establishments and popular educational events, make an overview of tendencies and directions, progress and problems in their development. The belated formation of the extracurricular adult education system the authors explain by the country councils; focus on primary education. The study revealed the dominant poison of country councils in the sphere of extracurricular enlightenment, a financial and pedagogical availability of this education form for great masses of population of this education form, combining general knowledge and professional skills. The social and cultural activity of country councils in the late XIXth – early XXth c.c. was profound and diverse as far as enlightenment is concerned, and helped achieve top results within a short period of time.

  6. Comparison of Levels and Sources of Lead in Modern and Ancient Soils in Low Volga Steppes

    Directory of Open Access Journals (Sweden)

    Pampura T. V.

    2013-04-01

    Full Text Available Concentrations and isotopic compositions of lead in the total and mobile (acid-soluble and carbonate- bound forms were determined in remote and roadside Chestnut soils in the dry steppe region of Low Volga, Russia. As a reference to evaluate the level of modern soil contamination with lead, we used ancient soil buried under a Bronze Age kurgan about 4500 years ago. In comparison with buried soil, the roadside modern soils showed clear signs of anthropogenic influence such as elevated total and mobile Pb concentrations and fractions of the mobile forms in the total pool of Pb, higher ratios of Pb/Ti and Pb/Sc, and a shift of Pb isotopic compositions towards the less radiogenic signatures found in modern Russian aerosols and gasoline. In the remote modern soils, however, these signs of anthropogenic influence were much less pronounced and could be observed only in the mobile fractions of Pb, but were practically undetectable in terms of concentrations and isotopic compositions of total lead.

  7. Studying the Permian Cross-section (Volga Region) Using Chemical and Isotopic Investigations

    Science.gov (United States)

    Gareev, B. I.; Batalin, G. A.; Nurgalieva, N. G.; Nourgaliev, D. K.

    2016-12-01

    This paper presents a study of international important site: the cross-section of Permian system's Urzhumian Stagein the ravine "Pechischy". Outcrop is located on the right bank of the Volga River (about 10 km West of Kazan). Ithas local, regional and planetary correlation features and also footprints of different geographical scale events.The main objective in the research is the deep study of sediments using chemical and isotopic investigations. XRFspectrometer was used for chemical investigations of samples. Chemistry of carbonates and clastic rocks includesthe analysis of chemical elements, compounds, petrochemical (lithogeochemical) modules for the interpretationof the genesis of lithotypes. For the review of the geochemistry of stable isotopes of carbon (oxygen) we usedIRMS. The main objective is the nature of the isotope fractionation issues, to addressing the issues of stratigraphyand paleogeography.The measurements have shown the variability of chemical parameters in cross-section. It gives us opportunity tosee small changes in sedimentation and recognize the factors that influence to the process.The work was carried out according to the Russian Government's Program of Competitive Growth of KazanFederal University, supported by the grant provided to the Kazan State University for performing the state programin the field of scientific research.

  8. Comparative expression analysis of isolated human adipocytes and the human adipose cell lines LiSa-2 and PAZ6

    NARCIS (Netherlands)

    Beek, van E.A.; Bakker, A.H.; Kruyt, P.M.; Vink, C.; Saris, W.H.; Keijer, J.

    2008-01-01

    Objective: To obtain insight in the extent to which the human cell lines LiSa-2 and PAZ6 resemble isolated primary human adipocytes. Design: A combination of cDNA subtraction (representative difference analysis; RDA) and cDNA microarray analysis was used to select adipose specific genes to compare i

  9. The Genesis of the Urban Culture of the Steppe of the Volga Region and Sociocultural Development of the Region

    Directory of Open Access Journals (Sweden)

    Nadezhda V. Dulina

    2016-06-01

    Full Text Available The article is devoted to the problems of the genesis of socio-historical processes of urban culture of the steppe of the Volga region, is based on historical documents, materials of scientific expeditions conducted in the lower Volga region encyclopedic scientists from the second half of the XVIII century, and the results of archaeological research here settlement sites. Based on the fact that the whole history of mankind is the history of the reference person of its economy, the authors believe that the analysis of the spaces of the modern city must be waged simultaneously in multiple coordinate systems – involving knowledge of scientific disciplines such as history and archeology, sociology, Economics etc. Attention is focused on the events in the Volga steppes of socio-economic and cultural-historical transformation, reflected in the distinctive dynamics of sociocultural development of the medieval (Khazar, the Golden Horde, Russian and modern cities in the region. The authors come to the following conclusions: the city created (and covered by most throughout the centuries (and even millennia by many generations, carry a spatial-temporal characteristics and the variety of creative ideas that make them diverse, aesthetically balanced. The growth of these cities, like all living things, inevitably threatens the time, which naturally destroys some of their historical (and in fact – "root" part to "make room" for new construction. To the relentless dynamism of our era was not able to destroy formed for many generations the idea that is subordinated to the formation and development of each particular city, you should each time from a separate historical parts of the city (or temporal-spatial "fragments" to try to reproduce it in its entirety, as the unity and integrity, while maintaining its inherent identity.

  10. Influence of nanomirelal phases on development processes of oil reservoirs in Volga-Ural region

    Science.gov (United States)

    Izotov, Victor; Sitdikova, Lyalya

    2010-05-01

    The optimisation of oil-field development by enhancing oil recovery is the most important target in further improvement of oil production processes. The resulting economic benefits often exceed those from discoveries of new fields, especially in hard-to-reach regions. Despite the wide use of enhanced oil recovery methods, their efficiency is in many cases not as high as expected. For instance, in terrigenous reservoirs of the Volga-Ural region oil recovery rarely exceeds 0.4, and in carbonate reservoirs with the complex structure, variability and high oil viscosity it can be as low as 0.15-0.20. In natural bitumen fields, the recovery factor is even lower. Analysis of the conducted EOR optimisation operations indicates that EOR methods mainly aim to change the hydrodynamic conditions in the reservoir under development or the physicochemical properties of oil, - for instance, to decrease its viscosity or to change its lyophilic behaviour. The impact of EOR methods on the reservoir's mineral component remains largely unstudied. It is generally believed that the mineral component of the reservoir, its matrix, is inert and remains unaffected by EOR methods. However, the analysis of oil-field development processes and the available studies allow the conclusion that natural hydrocarbon reservoirs are sensitive to any impact on both the near-wellbore zone and the whole reservoir. The authors' research in the reservoir's mineral phase dynamics has permitted the conclusion that the reservoir's fluid phases (including hydrocarbons) and the reservoir itself form a lithogeochemical system that remains in unstable equilibrium. Any external impact, such as the reservoir penetration or the use of EOR methods, disturbs this equilibrium and changes the filtration characteristics of the reservoir, the fluid chemistry and the reaction of the reservoir's mineral component to the impact. In order to characterise the processes in the reservoir in the course of its development, the

  11. Computer-based technology for elaboration of morphometric characteristics of Volga reservoirs

    Science.gov (United States)

    Shikunova, E.

    2009-04-01

    There are nine biggest Russian reservoirs in Volga basin. Total capacity is about 168 km3, effective capacity - 80 km3, total square is equal 24 000 km2 and total length - 3 500 km. Water resources are used in hydroenergetic, navigation, water supply, fishing industry, etc. It is important to know current morphometric characteristics of all reservoirs. For getting all morphometric characteristics we need bottom and coastal zone digital elevation model (DEM) for each reservoir. In 2008 in State Oceanographic Institute methodology and computer-based technology of creating DEM were developed and evaluated on Uglichsky reservoir. The information base includes field survey data, remote sensing data and large-scale maps. Bathymetric survey was made by crosslines with intervals 500 m or 250 m. Expedition team of State Oceanographic Institute made survey using special complex of echo sounder, GPS and specialized computer. This complex allows to determine X, Y, Z coordinates in a moment and display this information. 370 crosslines were measured and they included 416 000 survey data. Large-scale maps were used for vectorization of coastline and relief data. For elaboration coastline in the most difficult zones were used remote sensing data. All received polygonal and line objects were transformed into point's data type with point's frequency 2.5-3 m. The total amount of points was 1 400 000. Water area was breaked up on small zones including 4 crosslines. For each zone grid was created (cell 5x5m) using method Natural Neighbor. Anisotropy depends on channel orientation. Further middle part of grid was clipped. DEM is the result of mosaic of small grids. This technology allows to create bottom and coastline DEM for evaluation of actual morphometric characteristics of reservoirs that is useful for effective water management. Next year State Oceanographic Institute plans to continue works on Gorkovsky, Volgogradsky reservoirs and several reservoirs of Moscow region.

  12. The Protective Properties of Common Reed Plantations on Shores of the Lower Volga Region

    Directory of Open Access Journals (Sweden)

    Solodovnikov Denis Anatolyevich

    2014-12-01

    Full Text Available The abrasion processing of shores is a pressing problem of large water basins of the Lower Volga region and other Russian regions. About 3 km2 of shoreland is annually lost in the zone of the Volgograd water basin as a result of this process. The existing methods of shores protection are connected with the creation of concrete structures having a high level of erosion resistance. They are extremely expensive and in most cases they are not affordable for rural municipalities suffering from abrasion. The authors offer cheap and environmentally friendly way of protecting the shores of large water basins from abrasion. The method is based on the plantation of a common reed strip on a water basin’s shallow. The biological characteristics of common reed as the main component of shore protection structures are described. The terms and milestones of the work in the conditions of the Volgograd water basin are developed. The main result of applying our methodology is the complete cessation of abrasion processing of the shore at the corresponding piece of land. The authors overview the positive qualities of reed plantations, their biocenotic, barrier and waterproof role in on-shore ecosystems. The application of the described method will allow saving for the national economy dozens of hectares of valuable shore lands annually, in particular, irrigated cropland, settlement lands, infrastructure. In addition to the direct benefits associated with the conservation of land resources, the intensity of adverse processes associated with erosion of shores (water basin muddying, deterioration of sanitary qualities of water will decrease. Due to the wide geographic spread of common reed described in the present work, the technology of shores stabilization can be applied at almost all lowland water basins of Russia.

  13. Exclusion mapping of familial Alzheimer disease (FAD) in the Volga Germans

    Energy Technology Data Exchange (ETDEWEB)

    Levy-Lehad, E.; Wijsman, E.M. [Univ. of Washington, Seattle, WA (United States); Bird, T.D. [Veterans` Affairs Medical Center, Seattle, WA (United States)] [and others

    1994-09-01

    The Volga Germans (VG) are an ethnically distinct group of 8 families in whom early-onset (mean age-of-onset <60 years) FAD segregates as an autosomal dominant trait, probably due to a founder effect. Known FAD loci are a chromosome 14q24.3 locus for which the majority of early-onset FAD families show linkage, and the ApoE4 allele of the apolipoprotein E (ApoE) gene on chromosome 19q11.3. Linkage of VG FAD to markers on chromosomes 14, 21 and 19 has been excluded, and no APP mutations were found in affected VG subjects. The VG have an increased frequency of ApoE4 but do not show an association of FAD with the ApoE4 allele. In contrast to late-onset FAD families, ApoE4 does not modify age-of-onset in the VG: mean age-of-onset is 62.2{plus_minus}10.0 years for affected individuals with no ApoE4 alleles, 62.0{plus_minus}6.0 for affecteds homozygous for ApoE4. Therefore FAD in the VG group is caused by a locus which is as yet unidentified. To map this locus we have undertaken a genome-side search using short-tandem-repeat (STRP) markers evenly spaced (about every 20 cM) on all the autosomes. We have analyzed over 30 RFLPs and over 100 STRP markers. Approximately 50% of the genome has been excluded. An exclusion map, using the EXCLUDE program, is continuously updated to indicate regions of high likelihood for linkage.

  14. [Genetic characterization of populations of the Volga-Ural region according to the variability of the Y-chromosome].

    Science.gov (United States)

    Trofimova, N V; Litvinov, S S; Khusainova, R I; Penkin, L N; Akhmetova, V L; Akhatova, F S; Khusnutdinova, É K

    2015-01-01

    An analysis of genetic diversity in nine ethnic groups of the Volga-Ural region was carried out using 15 biallelic loci in the nonrecombining region of the Y-chromosome. The major Y-chromosome haplogroups in the region are R1a-M198, R1b-M269, and N-M231. It was found that Bashkirs show the greatest difference from other populations of the Volga-Ural region according both to F(st) and to the principal component analysis. In addition, analysis of the frequency distribution of Y-chromosome haplogroups was carried out in the Besermyan population, which was not studied previously from the Y-chromosome perspective. The results of this study revealed the predominance of haplogroup N-M231 (54.7%) in this ethnic group, which may indicate the prevalence of the Finno-Ugric component in the formation of the patrilineal component in the gene pool of the Besermyan ethnic group.

  15. Appearance and chronology of Textile ceramics in the Middle and Upper Volga region: critical comparison of conventional 14C-, AMS- and typological chronologies

    Directory of Open Access Journals (Sweden)

    Lavento Mika T.

    2015-06-01

    Full Text Available The article offers a comparison of three different methods of chronology construction – conventional 14C (radiocarbon dating, AMS (accelerator mass-spectrometry dating and the so called typological chronology – to date the textile ceramics of the Bronze – Early Iron Age in the Northern Coniferous Zone of Europe, from the Upper and Middle Volga and Kama Rivers to the Baltic region and Scandinavia. The Textile Ceramics Culture (also known as “Net”, “Pseudo-textile”, “Spun-and-speckled” is often associated with a Finnish-speaking community from the Bronze – beginning of the Iron Age. The earliest date of the Textile Ceramics sites on the Middle Oka River is presumably considered to be the 18 th century BC. Datings of the reference sites in the Middle Volga region were fixed within the 15 th – 8 th centuries BC. Comparing these data with the AMS chronology available for the materials from Finland and Estonia, the authors conclude that appearance of the Textile Ceramics was almost synchronous in the Volga and the Baltic regions, although chronology of the early tradition of the Textile Ceramics seems to be different in these areas. The results of yet a small number of AMS dates should be treated only as preliminary. However, AMS-dating seems to be the most efficient tool for further refining of the Textile Ceramics chronology over a vast territory, including in the Volga region.

  16. [Typhus fever morbidity among the military personnel and civilians in the regions around Volga river during World War I].

    Science.gov (United States)

    Raĭkova, S V; Zav'ialov, A I

    2013-07-01

    The article is concerned to the materials about epidemiologic situation of typhus fever in the regions around Volga river (Saratovsky, Samarsky and others) during World War I (1914-1918) among the military personnel of the Russian army and among the civilians. The main reasons for spread of infection, ways of the transmission, and also measures for decreasing of level of morbidity on the different stages of evacuation of patients with typhus fever in the safer hospitals are shown. The most important methods of fighting against epidemic of typhus fever were: isolation of patients in separate special hospitals, desincection and disinfection measures in the foci of infection and organization appropriate sanitary conditions for military man in the army and among civilians. Acquired valuable experience of territorial and military doctors during the period of epidemic of typhus fever allowed receiving complex effective antiepidemic measures of fighting and prevention from this disease.

  17. Shale Hydrocarbon Prospecting in the Central Part of the Volga-Ural Oil and Gas Province

    Science.gov (United States)

    Muslimov, Renat Kh.; Plotnikova, Irina N.

    2014-05-01

    Until now nobody has prospected or estimated the oil shale resources in Tatarstan, although the high-carbon rocks of Domanikoidtype often became an object of studies dedicated to assessment of the generation potential of liquid and gaseous hydrocarbons. The evaluation of oil-shale deposits in Tatarstan should base on the well-known geological, geochemical and technological criteria. The main, determining conditions for shale oil and gas deposit formation are the following: high content of organic matter (OM) in the rock, and its certain catagenetic maturity; special features of the mineral composition of rocks that contribute to the formation of fractures; and the presence of overlying and underlying impermeable dense strata that ensure the safety of hydrocarbons in the shale series. In Tatarstan, the development prospects of shale oil fields should be associated primarily with the rocks ofDomanikoid formations of Upper Devonian - such as Semiluksky (Domanik) horizon, as well asRechitsky (Mendymsky) horizon and Domanikoid formations of central and side areas of the Kama-Kinel trough system. Studies on Domanikwere started in the middle of the last century, when the Ural-Volga region experienced active interest for oil exploration. Then the research of Domanikoid series was carried out at the Department of Oil and Gas Geology, Kazan State University. Butback then the prospecting was not clearly associated with an estimate of shale oil resources. As revealed during rock geochemical studies of the rock, the average content of organic matter in deposits of Semiluksky and Mendymsky horizons is 8.35 and 2.56 % respectively, which is enough to takethese horizons as the main object of research and resource assessment. The presence of silica rocks and dense limestone in such a large proportion is a favorable factor in terms of assessing the effectiveness of fracturing. So we have a quite clear understanding of how to explore Domanik. In fact, the geological structure of our

  18. Geology of the Volga-Ural petroleum province and detailed description of the Ramashkino and Arlan oil fields

    Science.gov (United States)

    Peterson, James A.; Clarke, James W.

    1983-01-01

    The Volga-Ural petroleum province is in general coincident with the Volga-Ural regional high, a broad upwarp of the east-central part of the Russian (East European) platform. The central part of the province is occupied by the Tatar arch, which contains the major share of the oil fields of the province. The Perm-Bashkir arch forms the northeastern part of the regional high, and the Zhigulevsko-Orenburg arch makes up the southern part. These arches are separated from one another by elongate downwarps. The platform cover overlies an Archean crystalline basement and consists of seven main sedimentation cycles as follows: 1) Riphean (lower Bavly) continental sandstone, shale, and conglomerate beds from 500 to 5,000 m thick deposited in aulacogens. 2) Vendian (upper Bavly) continental and marine shale and sandstone up to 3,000 m thick. 3) Middle Devonian-Tournaisian transgressive deposits, which are sandstone, siltstone, and shale in the lower part and carbonates with abundant reefs in the upper; thickness is 300-1,000 m. In the upper carbonate part is the Kamsko-Kinel trough system, which consists of narrow interconnected deep-water troughs. 4) The Visean-Namurian-Bashkirian cycle, which began with deposition of Visean clastics that draped over reefs of the previous cycle and filled in an erosional relief that had formed in some places on the sediments of the previous cycle. The Visean clastics are overlain by marine carbonates. Thickness of the cycle is 50-800 m. 5) Early Moscovian-Early Permian terrigenous clastic deposits and marine carbonate beds 1,000-3,000 m thick. 6) The late Early Permian-Late Permian cycle, which reflects maximum growth of the Ural Mountains and associated Ural foredeep. Evaporites were first deposited, then marine limestones and dolomites, which intertongue eastward with clastic sediments from the Ural Mountains. 7) Continental redbeds of Triassic age and mixed continental and marine elastic beds of Jurassic and Cretaceous age, which were

  19. Primary production of phytoplankton in the estuaries of different types (by the example of the Curonian and Vistula Lagoons of the Baltic Sea and the Volga delta)

    Science.gov (United States)

    Aleksandrov, Sergei; Gorbunova, Julia

    2016-04-01

    The aim was to analyze the long-term change of the primary production in large estuaries of different types (Volga delta, Curonian and Vistula Lagoons) under the impact of environmental factors (e.g. climate changes, algal blooms, invasion mollusk). The researches (primary production, chlorophyll, nutrients and others) were carried out monthly from March-April to November in the Vistula and Curonian Lagoons since 1991 to 2015, and in the Lower part of the Volga Delta and fore-delta since 1996 to 2007. The Volga River is the largest river in Europe that flows into the Caspian Sea and it forms a great delta. According to the analysis of long-term data (from the 1960s), the maximum eutrophication and primary production (85-100 gCṡm-2ṡyear-1) in the Volga Delta was observed in the 1980s. In the 1990s, fertilizers use and the input of nutrients into the Volga Delta decreased significantly. Due of the high-flow exchange in the delta, especially during high-water years, observed in the 1980s - early 2000s, this led to a significant decrease in the concentration of nutrients in the water in the Volga Delta. As a result, in the 1990-2000s, the primary production has decreased to the level of 1960s-1970s (40-60 gCṡm-2ṡyear-1) and the process of eutrophication was replaced by de-eutrophication. At present, the trophic status of the Volga delta assessed as mesotrophic. The future trend of phytoplankton primary production of the Volga delta will greatly depend on the scenario of nutrients loading and river runoff. The Curonian Lagoon and Vistula Lagoon are the largest coastal lagoons of the Baltic Sea, relating to the most highly productive water bodies of Europe. The Curonian Lagoon is choke mostly freshwater lagoon, while the Vistula Lagoon is restricted brackish water lagoon. In the last decades the nutrients loading changes, warming trend and biological invasions are observed. The Curonian Lagoon may be characterized as hypertrophic water body. The local climate

  20. The study of filaggrin gene mutations and copy number variation in atopic dermatitis patients from Volga-Ural region of Russia.

    Science.gov (United States)

    Gimalova, Galiya F; Karunas, Alexandra S; Fedorova, Yuliya Y; Khusnutdinova, Elza K

    2016-10-10

    Atopic dermatitis (AD) is a chronic inflammatory skin disease characterized by age-specific localization, dryness, itch and hypersensitivity to allergens. In our study, we investigated FLG gene mutations and CNVs in AD patients and control subjects of different ethnic origin from Volga-Ural region. AD group included 303 patients (177 Russians, 126 Tatars). Control group consisted of 261 healthy individuals (152 Russians, 109 Tatars). The study revealed 66 FLG mutation carriers and demonstrated an association between c.2282del4 deletion and AD development in Russians and Tatars of Volga-Ural region of Russia. In the analysis of the FLG gene CNVs, the most common was 10-repeat allele in both Russian and Tatar patients and controls. We were unable to find any significant difference in CNV repeats count between AD patients and control individuals. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Peculiarities of Social Insurance of Workers of the Middle Volga Steamship Line During the Post-War Restoration Period (1945-1946

    Directory of Open Access Journals (Sweden)

    Gomanenko Olesya Aleksandrovna

    2015-11-01

    Full Text Available During the post-war restoration the work on social insurance in river transport was intensified. It were trade unions including councils of social insurance that dealt with social problems in the Volga Steamship Lines. Trade unions exercised control over the budget of social insurance, over labor safety, etc. In the Middle Volga Steamship Line (SVRP 15 councils for social insurance functioned. They included 140 insurance agents. Their task was to decrease incidence, traumatism, and also to improve the conditions of work and life of river transport workers. Tasks of councils of a social insurance included systematic supervision over a sanitary condition of shops and territories of the industrial enterprises of the steamship line. Financial support was allocated to families of veterans with many children and families in need. Insurance delegates together with a doctor of the health center in workshops registered workers needing additional food for health reasons. Insurance delegates gave social help to patients at home and in hospital. After the end of the war comprehensive plans of improving actions were put through. Financial and food position of river transport workers improved. However in 1946 in SVRP there was a small growth of incidence again. Those who needed treatment, and also the best workers were provided with permits in sanatorium. Managements of Volga Steamship lines showed care of children of river transport workers. During thewinter period camps were decorated with New Year trees, in summer – rest was arranged. On the accounting of the trade-union organizations of the Middle Volga basin families of the lost soldiers, the military personnel, disabled veterans and demobilized consisted. As for labor protection, that, despite increase in allocations for safety measures and labor protection in 1946 at the SVRP enterprises occurred increase in accidents. So, all efforts were directed on further improvement of financial and social

  2. INFLUENCE OF SEASON PATTERN ON PREVALENCE AND SEVERITY OF ACUTE MYOCARDIAL INFARCTION, FUNCTION OF HEMOSTASIS IN PATIENTS WITH ISCHEMIC HEART DESEASE OF CLIMATE AREA OF MIDDLE VOLGA REGION

    Directory of Open Access Journals (Sweden)

    O.K. Rybak

    2007-09-01

    Full Text Available The aim of this study is to evaluate season pattern, severity and outcome of acute myocardial infarction in dependence of yearly patterns of function of hemostasis in middle Volga Region. Season pattern of prevalence myocardial infarction with winter peak was discovered, be accompanied of increase platelet aggregation, deterioration of blood viscosity, fibrinolysis depression. Most serious clinical course of summer myocardial infarction was observed with prosperity of hemostasis.

  3. «Giant child covered by the Upturn»: Memoirs of Napoleon's Army Prisoners about the Formation of the Ethnic Identity of the Peoples of the Volga

    Directory of Open Access Journals (Sweden)

    Sergej V. Belousov

    2016-12-01

    Full Text Available This article analyzes the formation of national and ethnic identity of the Volga peoples based on the study of war memories of Napoleon's army. The authors support the thesis of A. Etkind of internal colonization of Russia. Volga was the internal borders of the empire. The most powerful factor behind the need for awareness of national identity was the Patriotic War of 1812. That is why it is important to analyze the everyday practices of intercultural interaction, developed in this era the territory of multi-ethnic regions. It is important to note that the very fact of placing in the Volga provinces prisoners ofNapoleon's army testifies colonial appointment of the region. In conclusion, the authors note about the high educational value of this type of sources reflecting many aspects of provincial life. The unique experience of the formation of the multinational provincial community was grown on the basis of the recognition of the multiplicity of ethnic identities, and hence tolerance and respect for other cultural environment.

  4. A new immunoreactive recombinant protein designated as rBoSA2 from Babesia ovis: Its molecular characterization, subcellular localization and antibody recognition by infected sheep.

    Science.gov (United States)

    Sevinc, Ferda; Cao, Shinuo; Zhou, Mo; Sevinc, Mutlu; Ceylan, Onur; Xuan, Xuenan

    2015-11-30

    Ovine babesiosis, caused by the intra-erythrocytic protozoan parasite Babesia ovis, is an infectious and economically important tick-borne disease of sheep. Diagnostic testing is an essential tool used for the control of the disease. In order to identify and characterize the immunoreactive proteins which are useful in serological diagnosis of the disease, a complementary DNA (cDNA) expression library was constructed from B. ovis merozoite mRNA. A cDNA clone designated as BoSA2 was identified by immunoscreening of a cDNA library using immune sheep serum. The sequence of the BoSA2 cDNA had a partial open reading frame of 1156 nucleotides encoding a polypeptide of 384 amino acid residues. Theoretical molecular mass for the mature protein was 43.5 kDa. The sequence of the BoSA2 was inserted into the expression vector pGEX-4T-1 and then expressed in Escherichia coli DH5α cells as a glutathione S-transferase (GST)-tagged fusion protein. This recombinant fusion protein (rBoSA2) was purified by GST-affinity chromatography. Immunoreactivity of the rBoSA2 was evaluated by indirect enzyme-linked immunosorbent assay (ELISA) using the sera from the animals naturally and experimentally infected with B. ovis. ELISA results demonstrated that this antigen was useful for the diagnosis of ovine babesiosis. The localization of the BoSA2 protein was shown in and on the parasite and in the cytoplasm of the infected erythrocyte by confocal laser microscope. To our knowledge, rBoSA2 is the second immunoreactive recombinant protein of B. ovis until the present.

  5. Statics of deformable solids

    CERN Document Server

    Bisplinghoff, Raymond L; Pian, Theodore HH

    2014-01-01

    Profusely illustrated exposition of fundamentals of solid mechanics and principles of mechanics, statics, and simple statically indeterminate systems. Covers strain and stress in three-dimensional solids, elementary elasticity, energy principles in solid continuum, and more. 1965 edition.

  6. Exogenous processes study in the coastal zone of the large reservoirs in the archaeological monuments placement (Volga-Kama region)

    Science.gov (United States)

    Gaynullin, Iskander; Usmanov, Bulat

    2014-05-01

    The problem of conservation of archaeological heritage is highly relevant for the Republic of Tatarstan (RT), because in its territory identified, studied and registered around 4,300 archaeological sites. Most of archaeological sites from the Mesolithic to the late Middle Ages, now situated in the coastal zone of reservoirs where archaeological objects destroying because of intensive abrasion processes. The Volga and Kama rivers region attracted people for millennia. This territory of the Russian Plain is abounding in archaeological sites of various ages. During the Upper Paleolithic study region was quite convenient for living activity of the first inhabitants because of its situation out of the glacier limits. The sites on the banks are deposited within deluvial sediments of the Late Valday glaciation which have been accumulated on the slope of the Volga and Kama valleys, placing the third terrace and the segmentations of the second terrace over the flood-plain and now completely or fragmentary destroyed by reservoir waters. The analysis of remote sensing (1958-2013) and field survey (2011-2013) data performed. Georeferencing and alignment of the historical maps with remote sensing data makes possible to reveal mistakes in old site plans and re-create the shape of the destroyed archaeological objects, as well to get the exact size of the monument and its correct orientation. Results showed also that the studying sites caused a great rate of destruction of coastline. Cultural heritage sites monitoring, with information about the chronology, cultural layer value, settlement specifics, etc., taking into account the methods used in landscape ecology and field archaeological survey, allows to evaluate damage and the intensity of archaeological sites destruction through the dangerous exogenous processes estimation. Exogenous processes data and archaeological GIS integration will form unified system of archaeological rescue works, will provide analysis of large amount

  7. Diurnal variations in integrated water vapor derived from a GPS ground network in the Volga-Ural region of Russia

    Science.gov (United States)

    Kalinnikov, Vladislav V.; Khutorova, Olga G.

    2017-03-01

    In this article, we present estimates of diurnal and semidiurnal harmonics of variations in integrated water vapor content (IWV) according to data from 16 GPS stations in the Volga-Ural region of Russia during 2013-2015. Amplitudes of diurnal harmonics are maximal in summer and reach values from 0.37 to 1.01 mm. Time at the maximum of diurnal harmonic is typically in the period from 14:00 to 17:00. Semidiurnal harmonics have the largest amplitudes in spring and autumn, but they do not exceed 0.19 mm. A comparison of the diurnal cycle from GPS data and ERA-Interim reanalysis has revealed significant differences in the phase. It is established that, as a result of evaporation from the underlying surface and convective lifting of moist air, the summer diurnal variations in IWV and surface density of water vapor are in antiphase. The diurnal cycle of IWV is determined by surface air temperature to be 88 % in summer and less than at 35 % in other seasons. It is noted that maximal amplitudes of diurnal harmonic of IWV are observed at stations located on the windward side of mountains.

  8. Late Quaternary chronology of paleo-climatic changes in Caspian Sea region based on Lower Volga sections

    Science.gov (United States)

    Kurbanov, Redzhep; Yanina, Tamara; Murray, Andrew; Svitoch, Alexander; Tkach, Nikolai

    2017-04-01

    Lower Volga is a unique region for understanding the history of the Caspian Sea in the Pleistocene, its correlation of paleogeographic events with glacial-interglacial rhythms of the East European Plain and the global and regional climate changes. The reason is representativeness of Quaternary sections, their completeness, presence of both marine and subaerial sediments, paleontological richness of the materials and available for study. The purpose of this work is to reconstruct the paleogeographic events in the Late Pleistocene of the Lower Volga region on the basis of summarizing the study results for the Srednyaya Akhtuba reference section. Located near city of Volgograd, at Khvaynian plain natural outcrop of Srednyaya Akhtuba section, reveals in a series of exposures a unique to the region series of marine Caspian continental deposits with four levels of buried soil horizons and loess. The results were obtained during 2015 and 2016 complex field research with application of lithological, paleopedological, paleontological, paleocryological, OSL-dating, paleomagnetic methods, that allowed more fundamental approach to the chronological assessment of individual horizons. The structure of the Srednyaya Akhtuba reference section reflects a number of paleogeographic stages of development of the study area. The oldest phase (layers 22-19) is not characterized by OSL dating or faunal material. Based on the sequence of dated layers, we assume its Middle Pleistocene age (MIS-6 stage), corresponding to Moscow stage of the Dnieper glaciation of the East European Plain and the final stage of Early Khazarian transgressive era of Caspian sea. The next stage (layers 18-14), represented by three horizons of paleosols, refers to the first half of the Late Pleistocene (MIS 5). Epoch of soil formation, based on the results the OSL-dating, can be referred to the warm sub-stages (MIS 5c and 5a), with unstable climatically transitional phase from Mikulino (Eemian) interglacial to the

  9. Static electromagnetic frequency changers

    CERN Document Server

    Rozhanskii, L L

    1963-01-01

    Static Electromagnetic Frequency Changers is about the theory, design, construction, and applications of static electromagnetic frequency changers, devices that used for multiplication or division of alternating current frequency. It is originally published in the Russian language. This book is organized into five chapters. The first three chapters introduce the readers to the principles of operation, the construction, and the potential applications of static electromagnetic frequency changers and to the principles of their design. The two concluding chapters use some hitherto unpublished work

  10. The Low Volga Region and Territory of the Don Cossacks in the Unpublished Fragment of Memories by Doctor J.J. Lerche (1749

    Directory of Open Access Journals (Sweden)

    Alexander L. Kleitman

    2015-12-01

    Full Text Available Fragment of the diaries by the traveler, scholar Dr J.J. Lerche which describes his journey on the Low Volga Region and the Territory of the Don Cossacks in spring 1749 is published in the Russian translation. This text was never published before; manuscript of the diary is kept in the National Library of Russia. The document is of interest as a source of social and economic history of the South of Russia, the history of Russian science, the history of Russian-German relations.

  11. Divergence of Populations of Yellow Wagtail, Motacilla flava, and Citrine wagtaill, Motacilla citreola (Motacillidae, Passeriformes, in the Middle Volga of Russia

    Directory of Open Access Journals (Sweden)

    Artemieva E. A.

    2016-04-01

    Full Text Available Blood samples of “yellow” wagtails collected in the areas geographically representing the Middle Volga breeding populations of these species were investigated. After isolation of mtDNA barkoding of studied “yellow” wagtails species was conducted. Amplification of the subunit of cytochrome oxidase I gene used as a genetic marker for the comparison of the samples was carried out. After sequencing and sequence alignment of gene cytochrome c-oxidase I, based on the comparison of genetic distances between individuals of the studied species using Jalview phylogenetic trees of populations of species Motacilla flava Linnaeus, 1758 and Motacilla citreola Pallas, 1776 were constructed.

  12. Steppe landscapes of the Ural-Volga region in response to oil and gas production: Evaluation and minimization of direct geoecological aftereffects

    Science.gov (United States)

    Myachina, K. V.; Chibilev, A. A.; Dubrovskaya, S. A.

    2017-06-01

    This paper reports on the geoecological state of landscapes of oil and gas fields in the Ural-Volga steppe zone. Large-scale direct disturbances and impacts with dramatic aftereffects have been revealed on the basis of field research using the geographic information system (GIS) and data from remote sensing of the Earth. It has been shown that the current land-use pattern in oil and gas production areas is in need of professional control to protect and recover the landscapes in the steppe zone.

  13. Depositional environments of the south-eastern Volga-Ural anteclise in the Early-Middle Devonian.

    Science.gov (United States)

    Selezeneva, Natalia

    2017-04-01

    Nowadays, in the Orenburg region of Russia hydrocarbon potential has been determined down to a depth of 5 km. Therefore, discovery of deep fields is becoming a pressing issue there. Seismic profiles on the south-eastern part of Volga-Ural anteclise indicate two uplifts at the depth of 6-7 km composed of Emsian-Givetian deposits which likely represent large carbonate buildups. Then facies analysis of this territory (based on data of about 100 boreholes) was made and it confirmed the presence of bioherm massifs and showed sedimentary environments. Analysis of the composition and the structure of deposits revealed that in the Emsian stage a shallow-water shelf basin existed, which deepened toward the Ural and North Caspian basins and was characterized by the transgressive evolution. The early stage of transgression was dominated by the terrigenous sedimentation. This region likely had a prodelta with three (proximal, intermediate, and distal) zones. Then the basin was deepened, the amount of terrigenous material decreased and carbonate massifs started to form. At that time following environments occurred: shallow-water coastal zone, intrabasin uplift, shallow-water distal zone, relatively deep-water zone and riftogenic carbonate buildups. Facies analysis of Eifelian sediments showed that there were two shallow-water zones, where carbonates were deposed with formation of small separate organic structures, surrounded by relatively deep-water zone. Continued submergence caused development of bioherm massifs. Givetian deposits differed from the Eifelian by abundant input of the terrigenous material. The growth of the bioherm massifs stopped during this time. Due to facies analyses such paleogeographic zones as shallow-water coastal zone, deep-water shelf zone, submarine fan zone were defined. As a result, two buried reefs were discovered, which could be perspective for finding out oil and gas. These bioherms are covered by the Tournaisian depression sediments that could

  14. [SA]2: uma abordagem consciente de situação para segurança em infraestruturas computacionais

    Directory of Open Access Journals (Sweden)

    Roger da Silva Machado

    2016-06-01

    Full Text Available As tecnologias computacionais estão cada vez mais integradas à vida cotidiana das pessoas, nas comunicações, no setor financeiro e até no entretenimento. Entretanto, todas as facilidades e oportunidades por elas oferecidas também acabam sendo objeto de interesse de pessoas mal-intencionadas, que usam esses recursos para cometer fraudes e ataques contra os sistemas de informação e/ou seus usuários. Logo, as organizações muitas vezes implementam tecnologias de propósitos específicos para promover a segurança de seus sistemas. Apesar de essas tecnologias auxiliarem na segurança do ambiente computacional, elas não proporcionam uma visão do ambiente como um todo. Tendo isso em vista, este artigo apresenta uma abordagem ciente de situação para segurança de ambientes computacionais, denominada [SA]2. A solução destaca-se pela arquitetura concebida para o fornecimento da ciência de situação, explorando diferentes funcionalidades desde a coleta, passando por um processamento híbrido de contexto, o armazenamento de dados contextuais e a decorrente atuação. A abordagem foi avaliada em um ambiente formado por servidores destinados a prover serviços de internet, mostrando-se estável e flexível quanto à visibilidade de aspectos de segurança em ambientes computacionais, possibilitando a detecção de situações de interesse a partir de eventos provenientes de fontes heterogêneas, atendendo às premissas de flexibilidade e dinamicidade das atuais infraestruturas de redes.

  15. Rectifier cabinet static breaker

    Science.gov (United States)

    Costantino, Jr, Roger A.; Gliebe, Ronald J.

    1992-09-01

    A rectifier cabinet static breaker replaces a blocking diode pair with an SCR and the installation of a power transistor in parallel with the latch contactor to commutate the SCR to the off state. The SCR serves as a static breaker with fast turnoff capability providing an alternative way of achieving reactor scram in addition to performing the function of the replaced blocking diodes. The control circuitry for the rectifier cabinet static breaker includes on-line test capability and an LED indicator light to denote successful test completion. Current limit circuitry provides high-speed protection in the event of overload.

  16. Study of anthropogenic and natural impacts on archaeological sites of the Volga Bulgaria period (Republic of Tatarstan) using remote sensing data

    Science.gov (United States)

    Gainullin, I. I.; Khomyakov, P. V.; Sitdikov, A. G.; Usmanov, B. M.

    2016-08-01

    In this paper we consider the possibility of using remote sensing data for determining various negative factors affecting archaeological objects condition on the territory of the Republic of Tatarstan. Fortified settlements, with the system of defensive fortifications, were selected as the objects of study, as they are easily identified by remote sensing data. In our view, the analysis of medieval Volga Bulgars (X-XIII centuries A.D.), the most common in the territory of the Republic of Tatarstan, has the highest priority. The first task by using remote sensing was to obtain actual data on the current condition of archaeological monuments located on the Kuibyshev reservoir shore, where the threat of destruction is maximized. Due to the fact, that most of the Volga-Bulgaria settlements, is located on the small rivers banks, the second task was geomorphological description of monuments placement in order to assess the risk of their destruction by natural processes. Third objective was to evaluate the role of the human factor in archaeological sites destruction. Ancient settlements under different types of negative impact were selected for the study. Deciphering of multitemporal remote sensing data allowed to assess the objects condition and to predict the risk of further damage. Additionally, it made able to correct the form of the Bulgars hillforts in comparison with existing plans, as well their size and location in the landscape, to restore the original appearance of destroyed fortified settlements, to determine precise coordinates for the further use of these data in the archaeological geographic information systems.

  17. Einstein's static universe

    CERN Document Server

    Soares, Domingos Savio

    2012-01-01

    Einstein's static model is the first relativistic cosmological model. The model is static, finite and of spherical spatial symmetry. I use the solution of Einstein's field equations in a homogeneous and isotropic universe -- Friedmann's equation -- to calculate the radius of curvature of the model (also known as "Einstein's universe"). Furthermore, I show, using a Newtonian analogy, the model's mostly known feature, namely, its instability under small perturbations on the state of equilibrium.

  18. Static Analysis Numerical Algorithms

    Science.gov (United States)

    2016-04-01

    STATIC ANALYSIS OF NUMERICAL ALGORITHMS KESTREL TECHNOLOGY, LLC APRIL 2016 FINAL TECHNICAL REPORT APPROVED FOR PUBLIC RELEASE; DISTRIBUTION...3. DATES COVERED (From - To) NOV 2013 – NOV 2015 4. TITLE AND SUBTITLE STATIC ANALYSIS OF NUMERICAL ALGORITHMS 5a. CONTRACT NUMBER FA8750-14-C... algorithms , linear digital filters and integrating accumulators, modifying existing versions of Honeywell’s HiLiTE model-based development system and

  19. Geochemical Features of Shale Hydrocarbons of the Central Part of Volga-Ural Oil and Gas Province

    Science.gov (United States)

    Nosova, Fidania F.; Pronin, Nikita V.; Plotnikova, Irina N.; Nosova, Julia G.

    2014-05-01

    This report contains the results of the studies of shale hydrocarbons from carbonate-siliceous rocks on the territory of South-Tatar arch of Volga-Ural oil and gas province of the East European Platform. The assessment of the prospects of shale hydrocarbon in Tatarstan primarily involves finding of low permeable, poor-porous shale strata that would be rich in organic matter. Basing on the analysis of the geological structure of the sedimentary cover, we can distinguish three main objects that can be considered as promising targets for the study from the point of the possible presence of shale hydrocarbons: sedimentary deposits Riphean- Vendian; Domanicoid high-carbon rocks of Devonian time; sedimentary strata in central and side areas of Kama-Kinel deflection system. The main object of this study is Domanicoid high-carbon rocks of Devonian time. They are mainly represented by dark gray, almost black bituminous limestones that are interbedded with calcareous siliceous shales and cherts. Complex studies include the following: extraction of bitumen from the rock, determination of organic carbon content, determination of the group and elemental composition of the bitumen, gas chromatographic studies of the alkanoic lube fractions of bitumoid and oil, gas chromato-mass spectrometry of the naphthenic lube fractions of bitumoid and oil, pyrolysis studies of the rock using the Rock -Eval method (before and after extraction), study of trace-element composition of the rocks and petrologen, comparison in terms of adsorbed gas and studying of the composition of adsorbed gases. Group and elemental analyses showed that hydrocarbons scattered in the samples contain mainly resinous- and asphaltene components, the share lube fraction is smaller. The terms sediment genesis changed from weakly to strongly reducing. According to the results of gas chromatography, no biodegradation processes were observed. According to biomarker indicators in the samples studied there is some certain

  20. Observing the Forces Involved in Static Friction under Static Situations

    Science.gov (United States)

    Kaplan, Daniel

    2013-01-01

    Static friction is an important concept in introductory physics. Later in the year students apply their understanding of static friction under more complex conditions of static equilibrium. Traditional lab demonstrations in this case involve exceeding of the maximum level of static friction, resulting in the "onset of motion." (Contains…

  1. Static Transition Compression

    DEFF Research Database (Denmark)

    Danvy, Olivier; Damian, Daniel

    2001-01-01

    Starting from an operational specification of a translation from a structured to an unstructured imperative language, we point out how a compositional and context-insensitive translation gives rise to static chains of jumps. Taking an inspiration from the notion of continuation, we state a new...... compositional and context-sensitive specification that provably gives rise to no static chains of jumps, no redundant labels, and no unused labels. It is defined with one inference rule per syntactic construct and operates in linear time and space on the size of the source program (indeed it operates in one...

  2. Energy conversion statics

    CERN Document Server

    Messerle, H K; Declaris, Nicholas

    2013-01-01

    Energy Conversion Statics deals with equilibrium situations and processes linking equilibrium states. A development of the basic theory of energy conversion statics and its applications is presented. In the applications the emphasis is on processes involving electrical energy. The text commences by introducing the general concept of energy with a survey of primary and secondary energy forms, their availability, and use. The second chapter presents the basic laws of energy conversion. Four postulates defining the overall range of applicability of the general theory are set out, demonstrating th

  3. Paleoecological crisis in the steppes of the Lower Volga region in the Middle of the Bronze Age (III-II centuries BC)

    Science.gov (United States)

    Demkina, T. S.; Borisov, A. V.; Demkin, V. A.; Khomutova, T. E.; Kuznetsova, T. V.; El'tsov, M. V.; Udal'tsov, S. N.

    2017-07-01

    Diagnostic features of a catastrophic aridization of climate, desertification, and paleoecological crisis in steppes of the Lower Volga region have been identified on the basis of data on the morphological, chemical, and microbiological properties of paleosols under archeological monuments (burial mounds) of the Middle Bronze Age. These processes resulted in a certain convergence of the soil cover with transformation of zonal chestnut (Kastanozems) paleosols and paleosolonetzes (Solonetz Humic) into specific chestnut-like eroded saline calcareous paleosols analogous to the modern brown desert-steppe soils (Calcisols Haplic) that predominated in this region 4300-3800 years ago.1 In the second millennium BC, humidization of the climate led to the divergence of the soil cover with secondary formation of the complexes of chestnut soils and solonetzes. This paleoecological crisis had a significant effect on the economy of the tribes in the Late Catacomb and Post-Catacomb time stipulating their higher mobility and transition to the nomadic cattle breeding.

  4. Explosions and static electricity

    DEFF Research Database (Denmark)

    Jonassen, Niels M

    1995-01-01

    The paper deals with the problem of electrostatic discharges as causes of ignition of vapor/gas and dust/gas mixtures. A series of examples of static-caused explosions will be discussed. The concepts of explosion limits, the incendiveness of various discharge types and safe voltages are explained...

  5. Why Static Clings

    Science.gov (United States)

    Naab, Laurie; Henry, David

    2009-01-01

    Using Wiggins and McTighe's (1998) concept of Big Ideas, the authors planned and designed an electricity investigation to address common student misconceptions about static electricity. With Styrofoam plates and transparent tape, elementary students investigated many properties of electrically charged and uncharged objects in a 5E learning cycle…

  6. Static Gravitational Global Monopoles

    CERN Document Server

    Liebling, S L

    2000-01-01

    Static solutions in spherical symmetry are found for gravitating global monopoles. Regular solutions lacking a horizon are found for $\\eta \\sqrt{3/8\\pi} \\approx 0.3455$ is consistent with findings that topological inflation begins at $\\eta \\approx 0.33$.

  7. Microprocessor controlled static converter

    Directory of Open Access Journals (Sweden)

    Stefan Szabo

    2005-10-01

    Full Text Available This paper wants to demonstrate a way of implementing a microcontroller into an DC motor speed control loop. The static power converter is a fully controlled rectifier bridge, using standard SCR's. The bridge's control signals are supplied by the microcontroller and are phase-angle or burst types. The automation loop contains a software PI-style regulator. All the experimental results shows that this aproach is flexibile enough to be used on a large scale.

  8. The Static Quantum Multiverse

    OpenAIRE

    Nomura, Yasunori

    2012-01-01

    We consider the multiverse in the intrinsically quantum mechanical framework recently proposed in Refs. [1,2]. By requiring that the principles of quantum mechanics are universally valid and that physical predictions do not depend on the reference frame one chooses to describe the multiverse, we find that the multiverse state must be static---in particular, the multiverse does not have a beginning or end. We argue that, despite its naive appearance, this does not contradict observation, inclu...

  9. Open static Chaplygin universe

    CERN Document Server

    Khalatnikov, I M

    2003-01-01

    We apply the qualitative theory of dynamical systems to the study of the Chaplygin gas cosmological model. In difference to earlier works devoted to this model we give up sign restrictions on the choice of the sign of the energy density and on the parameters characterising initial conditions for a cosmological evolution. It appears that exists a static stable open universe filled with the Chaplygin gas. Besides exist universes where the acoustic waves have a velocity exceeding that of light in the vacuum.

  10. “Little Cogs of the Huge State Machine”. Formation and Development of Nursery Care System in 1920-1930s (on the Materials of the Republic of Germans in the Volga Region

    Directory of Open Access Journals (Sweden)

    Lyudmila A. Falaleeva

    2017-06-01

    Full Text Available The article is devoted to insufficiently studied aspects of the history of the Volga Germans. On the basis of the documents kept in the State Historical Archives of the Volga Germans, the author reveals the peculiarities of formation and development of the nursery care system in the USSR of Volga Germans in 1920-1930s. In the article measures on preparing medical and pedagogical staff are reviewed. It was concluded that the establishment of nurseries led not only to improvement of children’s health, but also released labour force of peasant women for the national economy. The author found that the first information about the opening of nurseries in the German autonomy is related to 1921 – from that moment an active process of formation of the Soviet system of nursery facilities in the region had begun. Due to large-scale famine of the early 1920s, existence of nurseries was under threat, despite the active government policy on this issue. Only in 1925 the matter of protection of motherhood and childhood stabilized, and with active support of female population of Volga Germans started to rapidly gain the momentum. In the mid-1930s more than 5 000 children in ASSR NP became pupils of nurseries. All the year round a woman was able to break free from the hassle of taking care of children and the young generation from the first years of life was brought up under state control. The operation of nurseries caused both a need and an interest among German women, in contrast to many other social projects of the Soviet power against women. The author concludes that the mass distribution of nurseries in the territory of ASSR NP and their introduction into the social environment, allows considering them as significant administrative practices aimed at the destruction of traditional ways of life of women, effective even in the national autonomy.

  11. Synergistic streptococcal phage λSA2 and B30 endolysins kill streptococci in cow milk and in a mouse model of mastitis.

    Science.gov (United States)

    Schmelcher, Mathias; Powell, Anne M; Camp, Mary J; Pohl, Calvin S; Donovan, David M

    2015-10-01

    Bovine mastitis results in billion dollar losses annually in the USA alone. Streptococci are among the most relevant causative agents of this disease. Conventional antibiotic therapy is often unsuccessful and contributes to development of antibiotic resistance. Bacteriophage endolysins represent a new class of antimicrobials against these bacteria. In this work, we characterized the endolysins (lysins) of the streptococcal phages λSA2 and B30 and evaluated their potential as anti-mastitis agents. When tested in vitro against live streptococci, both enzymes exhibited near-optimum lytic activities at ionic strengths, pH, and Ca(2+) concentrations consistent with cow milk. When tested in combination in a checkerboard assay, the lysins were found to exhibit strong synergy. The λSA2 lysin displayed high activity in milk against Streptococcus dysgalactiae (reduction of CFU/ml by 3.5 log units at 100 μg/ml), Streptococcus agalactiae (2 log), and Streptococcus uberis (4 log), whereas the B30 lysin was less effective. In a mouse model of bovine mastitis, both enzymes significantly reduced intramammary concentrations of all three streptococcal species (except for B30 vs. S. dysgalactiae), and the effects on mammary gland wet weights and TNFα concentrations were consistent with these findings. Unexpectedly, the synergistic effect determined for the two enzymes in vitro was not observed in the mouse model. Overall, our results illustrate the potential of endolysins for treatment of Streptococcus-induced bovine mastitis.

  12. The Problem of the Golden Horde “Imperial Culture” Formation and its Role as an Area-Forming Factor for the Peoples of the Ural-Volga Region

    Directory of Open Access Journals (Sweden)

    Ivanov Vladimir A.

    2013-06-01

    Full Text Available The problem of formation and existence of a common imperial culture of the Golden Horde and the degree of influence of this state on the culture of neighboring peoples inhabiting the Urals and the Volga regions. The results of the comparison between the culture of the Golden Horde cities and the nomadic steppe population demonstrate significant differences and a very low degree of interpenetration of their traditions. In the material culture of the peoples of the Volga-Kama and the Cis-Urals regions, drawn into the Golden Horde sphere of influence (the Mari, the Udmurts, the Mordvinians, the Bashkirs, the local tradition was kept intact, items produced in the Golden Horde were as rarely met as imported ones, and did not affect the local production of weapons, jewelry, etc. All this makes it possible to conclude that the concept of "imperial culture of the Golden Horde" is an artificial one, and its influence on the cultures of the neighboring peoples of the Volga-Ural region cannot be traced on the basis of archaeological materials.

  13. Static analysis for blinding

    DEFF Research Database (Denmark)

    Nielsen, Christoffer Rosenkilde; Nielson, Hanne Riis

    2006-01-01

    operation blinding. In this paper we study the theoretical foundations for one of the successful approaches to validating cryptographic protocols and we extend it to handle the blinding primitive. Our static analysis approach is based on Flow Logic; this gives us a clean separation between the specification...... of the analysis and its realisation in an automatic tool. We concentrate on the former in the present paper and provide the semantic foundation for our analysis of protocols using blinding - also in the presence of malicious attackers....

  14. Static and dynamic stresses

    DEFF Research Database (Denmark)

    Tishin, A.M.; Spichkin, Yu.I.; Bohr, Jakob

    1999-01-01

    In this chapter we shall consider the properties of lanthanide metals, their alloys and compounds which can be studied using static and alternating mechanical stresses. The main attention will be paid to the effects related to magnetoelastic interactions. These interactions in magnetic materials...... to the appearance of anomalies in elastic constants, as well as to additional damping of sound oscillations in the lanthanide materials. The importance of understanding the nature of magnetoelastic interactions and related effects arises from the scientific desire to gather a better knowledge of magnetism, as well...

  15. Model Checking as Static Analysis

    DEFF Research Database (Denmark)

    Zhang, Fuyuan

    Both model checking and static analysis are prominent approaches to detecting software errors. Model Checking is a successful formal method for verifying properties specified in temporal logics with respect to transition systems. Static analysis is also a powerful method for validating program...... properties which can predict safe approximations to program behaviors. In this thesis, we have developed several static analysis based techniques to solve model checking problems, aiming at showing the link between static analysis and model checking. We focus on logical approaches to static analysis......-calculus can be encoded as the intended model of SFP. Our research results have strengthened the link between model checking and static analysis. This provides a theoretical foundation for developing a unied tool for both model checking and static analysis techniques....

  16. Analysis of genetic variants of class II cytokine and their receptor genes in psoriasis patients of two ethnic groups from the Volga-Ural region of Russia.

    Science.gov (United States)

    Galimova, Elvira; Akhmetova, Vita; Latipov, Boris; Kingo, Külli; Rätsep, Ranno; Traks, Tanel; Kõks, Sulev; Khusnutdinova, Elza

    2012-10-01

    The molecular basis of pathogenesis of psoriasis remains unclear, but one unifying hypothesis of disease aetiology is the cytokine network model. The class II cytokines (CF2) and their receptors (CRF2) are all involved in the inflammatory processes and single nucleotide polymorphisms (SNPs) in respective genes have been associated with psoriasis in a previous study of the Estonian population. We performed a replication study of 47 SNPs in CF2 and CRF2 genes in independent cohorts of psoriasis patients of two ethnic groups (Russians and Bashkirs) from the Volga-Ural region of Russia. DNA was obtained from 395 psoriasis patients of two ethnic groups from the Volga-Ural region of Russia and 476 ethnically matched controls. 47 SNPs in the loci of the genes encoding Class II cytokines and their receptors were selected by SNPbrowser version 3.5. Genotyping was performed using the SNPlex™ (Applied Biosystems) platform. The genetic variant rs30461 previously associated in original case-control study in Estonians, was also associated in Russians (corrected P-value (Pc=0.008, OR=0.44), but did not reach statistical significance in the Bashkir population. Additionally, the haplotype analysis provided that CC haplotype formed by the SNPs rs30461 and rs955155 had a protective effect in Russians (Pc=0.0024, OR=0.44), supporting the involvement of this locus in the protection against psoriasis. Combined meta-analysis of three populations, including 943 psoriasis patients and 812 healthy controls, showed that the IL29 rs30461 C-allele was not associated with decreased risk of psoriasis (P=0.165, OR=0.68). Moreover, stratification of studies by ethnicity revealed a significant association in the European cohort (P=9.506E-006, OR=0.53). Therefore, there is no overall evidence of association between psoriasis and SNP rs30461 of the IL29 gene, but there is some evidence to suggest that an association exists in Europeans. However, this current concept should be considered as

  17. Quantum singularities in static and conformally static space-times

    CERN Document Server

    Konkowski, D A; 10.1142/S0217751X11054334

    2011-01-01

    The definition of quantum singularity is extended from static space-times to conformally static space-times. After the usual definitions of classical and quantum singularities are reviewed, examples of quantum singularities in static space-times are given. These include asymptotically power-law space-times, space-times with diverging higher-order differential invariants, and a space-time with a 2-sphere singularity. The theory behind quantum singularities in conformally static space-times is followed by an example, a Friedmann-Robertson-Walker space-time with cosmic string. The paper concludes by discussing areas of future research.

  18. Static intervortex forces

    Science.gov (United States)

    Speight, J. M.

    1997-03-01

    A point particle approximation to the classical dynamics of well-separated vortices of the Abelian Higgs model is developed. A static vortex is asymptotically identical to a solution of the linearized field theory (a Klein-Gordon-Proca theory) in the presence of a singular point source at the vortex center. It is shown that this source is a composite scalar monopole and magnetic dipole, and the respective charges are determined numerically for various values of the coupling constant. The interaction potential of two well-separated vortices is computed by calculating the interaction Lagrangian of two such point sources in the linear theory. The potential is used to model type II vortex scattering.

  19. Folklore as historical and cultural legasy of the lower Volga region in the first third of the XXth century: B.S. Laschilin, A.M. Listopadov

    Directory of Open Access Journals (Sweden)

    Rodionova Olga Igorevna

    2013-11-01

    Full Text Available In the present article the question of the folklore phenomenon in the folk art of the Lower Volga Region in the first third of the 20th century is considered. In the course of research high emphasis was placed on the Cossack subject matter. The role of B.S. Laschilin and A.M. Listopadov in collecting and publishing folk art, the folklore of the Don Cossacks, is revealed. Boris Stepanovitch Laschilin’s work left a great impact in the artistic life of our region. In B.S. Laschilin’s books, that were published in Rostov-on-Don, Saratov, Stalingrad-Volgograd, contained tales, fairy tales, bylinas, legends, songs, ditties, proverbs, sayings, ancient dramas of the first Russian folk theatres, exorcisms. Boris Stepanovitch kept selecting songs and ditties, chastooshkas for Voronezh Folk Choir “Voronezh girls”, which are still in the repertoire of the Pyatnitsky Russian Folk Chorus. Folklorist and musician Alexander Mikhailovich Listopadov, who collected and studied folk songs from his youth up, and recorded them in the Don Region hamlets and Cossack villages, spent more than 50 years of his life on the research of the Don Cossack’s musical culture. Alexander Mikhailovich Listopadov’s heritage made an important contribution to the native musical folklore study. Folklore compositions is a unique source of knowledge of history, way of life, moral and other national concepts, which allows us to reconstitute a linguistic personality of a definite historical epoch.

  20. Structure and evolution of the Sura-Kama strike-slip zone in the Cenozoic (the Volga-Ural anteclise of the East European Platform)

    Science.gov (United States)

    Kolodyazhnyi, S. Yu.

    2015-07-01

    The Sura-Kama zone (SKZ) complicates the central area of the Volga-Ural anteclise and extends sublaterally from the Sura River basin towards the Kama River at a distance of 700-750 km. Based on the analysis of geological-geophysical data and structural studies, a model for the tectonic structure and the evolution of the SKZ is developed. This is a deep tectonic fault that shows the features of long-term polystage development. During the latest Cimmerian-Alpine period of tectonic reactivation, the SKZ represented a zone of strike-slip and consecutive manifestation of early transpressional right-lateral strike-slip dislocations that changed to left-lateral strike-slip displacements under transtension settings as a result of kinematic inversion. Features of the heterogeneous structure of the SKZ are revealed. The segments formed by the system of strike-slip duplexes are alternated along the strike by the principle of rotation-fold and "domino" structures. The particular models of evolution of these segments are proposed by the examples of the widely known Karlin, Tetyushin, and Lower Kama dislocations. It is assumed that kinematic inversion and compression-decompression phenomena on the flanks of the SKZ, as well as the tectonic environments in the area of its dynamic influence were highly important for the development of the processes of migration and redistribution of hydrocarbon components.

  1. MEDICAL AND DEMOGRAPHIC CONSEQUENCES OF CLIMATE CHANGE AND THE ASSESSMENT OF COMFORT LEVEL OF WEATHER-CLIMATIC CONDITIONS IN THE VOLGA FEDERAL DISTRICT

    Directory of Open Access Journals (Sweden)

    Yuri P. Perevedentsev

    2016-01-01

    Full Text Available The paper provides a brief analysis of research on the impact of global climate change on human health. Using Tatarstan as an example, the paper discusses medical and demographic consequences of the extreme heat wave of the summer of 2010. Assessment of the Volga Federal District (VFD bioclimate conducted with the help of certain biometeorological parameters allowed evaluating modern global and regional changes of weather-climatic conditions. The main emphasis was placed on spatial and temporal analysis of both the integral pathogenicity index (I and its individual components for the district territory. In VFD, aggravating weather conditions increase from southwest to northeast. Summer months are associated with comfort weather conditions. In winter, the air temperature pathogenicity index and interdiurnal temperature fluctuations contribute the greatest to I; in summer, the role of cloudiness and humidity pathogenicity indices increases. The contribution of wind speed and interdiurnal pressure fluctuations to I is insignificant in all seasons. Analysis of the frequency distribution of I showed that comfort weather conditions (over 50 % of cases occur in May–August, aggravating weather conditions occur in March-Appril, and harsh weather conditions in more than 50 % of cases occur in January–February and November–December. Calculation of biometeorological indices allows forecasting risk of thermal hazard under extreme meteorological conditions.

  2. Development of technology for washed minced fish production from low-profit objects of fishing in the Volga-Caspian Basin

    Directory of Open Access Journals (Sweden)

    Mukatova M. D.

    2016-09-01

    Full Text Available The objects of the study are as follows: rudd and goldfish, samples of food minced made of them without washing, after single and double washings. To study the organoleptic and physico-chemical parameters the conventional methods of the fishing industry have been used. At the LLC "Astrakhan fisheries" two experimental batches of minced rudd and goldfish with double washing by water using a food additive "Omfresh plus" have been made in the amount of 1.0 % by weight of the meat. The yield of washed minced food from rudd is 41.4 %, from silver carp – 41.0 %. Some decrease in water content, water-holding capacity and formalin-titratable nitrogen in minced fish after each washing step has been established. Studying the organoleptic characteristics has shown that the frozen minced briquettes are cuboids, have clean surface with the presence of minor irregularities, colour – light gray, dense texture. On physical and chemical parameters the food washed mince correspond to GOST R 55505–2013 "Frozen food fish forcemeat. Specifications". Water content is 79–82 %, sodium chloride – 0,17–0,35 %, and water-holding capacity – at over 50 %. The proven technology of manufacturing washed minced from goldfish and rudd can be put into production for the purpose of deep processing of unprofitable species of the Volga-Caspian Basin and getting washed minced food and culinary products based on it.

  3. Statics and Mechanics of Structures

    DEFF Research Database (Denmark)

    Krenk, Steen; Høgsberg, Jan Becker

    The statics and mechanics of structures form a core aspect of civil engineering. This book provides an introduction to the subject, starting from classic hand-calculation types of analysis and gradually advancing to a systematic form suitable for computer implementation. It starts with statically...

  4. Selección de condiciones óptimas de biodegradación de crudo pesado de petróleo de Sheremetyevo en la Cuenca del Río Volga por medio de consorcios bacterianos

    OpenAIRE

    Bautista Espinosa, Hugo

    2014-01-01

    El presente estudio propone medidas biocorrectivas o de biorremediación, las cuales consisten principalmente en el uso de los microorganismos naturales (bacterias) existentes en el medio para descomponer o degradar sustancias peligrosas (crudo pesado y sus derivados) en sustancias de carácter menos tóxico o bien inocuas para el medio ambiente y la salud humana. Las medidas biocorrectoras se emplearon a escala piloto en la descontaminación de aguas del Río Volga afectadas por derrames de crudo...

  5. Welfare and Social Security in the USSR in the Late 1950s – Early 1980s (on the Material of the Lower Volga Region

    Directory of Open Access Journals (Sweden)

    Gumenyuk Aleksey

    2014-12-01

    Full Text Available This paper is devoted to the analysis of the main directions of the social support for workers in the Lower Volga region in the late 1950s – early 1980s. The special attention is paid to creating the universal system of pension insurance for the Soviet people. The novelty of the study consists in the use of historical and anthropological approach allowing to trace the influence of the change in insurance bodies functioning on the life quality of pensioners and disabled people. The first part of the article is devoted to the period of 1953–1964, and it explores the ways of improving the quality of care of the disabled. The particular attention is paid to the study of the positive and negative results of social bodies’ work at the regional level. The ways of improving the quality of state social support for disabled people in 1965–1985 (the new stage of Soviet reforms is also investigated. The material in the article is organized according to the following scheme: firstly, the author analyzes the basic legislative acts of the State party in the field of social security, and, secondly, he describes the ways and the results of their implementation in the provinces. The author concludes that by Spring of 1985 the total social pension system was established in the country. The evidence proves that this system lacked the individual approach and the interests of some people were often not taken into account. This study is based on the vast set of factual materials from the archives, published sources and periodical press. The various aspects of this problem can be used in educational practice.

  6. Comparison of Toxicity of Sediments from Rivers with Different Levels of Anthropogenic Load (Middle Volga Region, Russia Based on Elutriate and Whole Sediment Tests

    Directory of Open Access Journals (Sweden)

    N.Yu. Stepanova

    2016-09-01

    Full Text Available Description of chemical characteristics and toxicity testing of whole sediment and elutri-ate have been performed with 35 samples taken during the monitoring of rivers in the Middle Volga region (Tatarstan, Russia in 2013. The locations analyzed are sites associated with agriculture, forestry, and petroleum hydrocarbons (oil production. The toxicity tests include: (1 Chlorella vulgaris (algal elutriate test, (2 Paramecium caudatum (ciliate elutriate test, (3 Daphnia magna (cladoceran whole sediment toxicity test, and (4 Heterocypris incongruens (ostracod whole sediment toxicity test. The concentrations of metals in 43% of sediment samples have been found to exceed probable effect concentration sediment quality guidelines (SQGs. However, the concentrations of polycyclic aromatic hydrocarbons (PAHs and organochlorine pesticides have turned out to be below SQGs in most sites. The correlation analysis has shown metal toxicity to daphnid reproduction and ostracod growth (R2 = 0.34–0.64 and ammonia (R2 = 0.49–0.54. A higher percentage of samples have shown toxicity in the whole sediment tests (86% compared to the elutriate tests (54%. A total of 91% of samples have demonstrated toxicity for at least one species. Toxicity has been most frequently observed for daphnid reproduction (83% of samples and ostracod growth (56% of samples compared to daphnid (23% survival, ostracod (11% survival, and ciliate reproduction (54% or algal growth (54%. The most polluted sediments have been registered in the area of oil production. The comparison of toxicity of the samples from different types of areas has indicated that 100% of samples from the oil production area, 94% of samples from the agricultural area, and 50% of samples from the forest area were toxic to at least one test organism.

  7. X-ray screening of the artificially deformed skulls from the Middle Bronze Age of the Low Volga region (paleopathology aspect

    Directory of Open Access Journals (Sweden)

    Pererva Evgenii Vladimirovich

    2013-11-01

    Full Text Available The impact of the deforming structure on the human skull is one of the most challenging and debated questions in modern archeology and anthropology related to artificial deformation of the skull. This is precisely why the present study attempts to study the pathological artificially deformed skulls of representatives of the Catacomb culture originating from burial mound in the Lower Volga region. The analysis of the bone material was carried out with the use of X-ray method of the frontal and lateral views. Thirteen radiographs of skulls with traces of deliberate artificial deformation were examined. The skull shapes, structure of the skull calvarial bones, state of the cranial sutures, signs of intracranial hypertension, and symptoms of vascular and endocrine pathologies were explored and evaluated. The study discovered that Catacomb culture bearers used a variety of methods of skull deformation. Front occipital, occipital ring strain and conventional acrocephaly deformation modes were revealed. The viability and compatibility with normal human activity of artificial skull deformation was observed. In the childhood and newborn periods, individuals have applied constrictive and restrictive devices, trusses andother appliancesfor a few years, their impact couldresultin the intracranial hypertension syndrome, as well as in problems with cranial sutures obliteration. It is very much likely that the use of strain could stimulate the development of the internal frontal hyperostosis (Morgagni's disease which contributed to the emergence of endocrine abnormities in humans. The increased trauma rate of skeleton bones was observed in population of the Middle Bronze Age, as well as ear diseases which makes us once again address the issue of social and cultural phenomenon of intentional artificial deformation of the head tradition.

  8. Static Validation of XSL Transformations

    DEFF Research Database (Denmark)

    Møller, Anders; Olesen, Mads Østerby; Schwartzbach, Michael Ignatieff

    2007-01-01

    no static guarantees that, under the assumption that the input is valid relative to the input schema, the output of the transformation is valid relative to the output schema. We present a validation technique for XSLT based on the XML graph formalism introduced in the static analysis of JWIG Web services...... and XACT XML transformations. Being able to provide static guarantees, we can detect a large class of errors in an XSLT stylesheet at the time it is written instead of later when it has been deployed, and thereby provide benefits similar to those of static type checkers for modern programming languages....... Our analysis takes a pragmatic approach that focuses its precision on the essential language features but still handles the entire XSLT language. We evaluate the analysis precision on a range of real stylesheets and demonstrate how it may be useful in practice....

  9. Statics and mechanics of structures

    CERN Document Server

    Krenk, Steen

    2013-01-01

    The statics and mechanics of structures form a core aspect of civil engineering. This book provides an introduction to the subject, starting from classic hand-calculation types of analysis and gradually advancing to a systematic form suitable for computer implementation. It starts with statically determinate structures in the form of trusses, beams and frames. Instability is discussed in the form of the column problem - both the ideal column and the imperfect column used in actual column design. The theory of statically indeterminate structures is then introduced, and the force and deformation methods are explained and illustrated. An important aspect of the book’s approach is the systematic development of the theory in a form suitable for computer implementation using finite elements. This development is supported by two small computer programs, MiniTruss and MiniFrame, which permit static analysis of trusses and frames, as well as linearized stability analysis. The book’s final section presents related ...

  10. The statics of cervical traction.

    Science.gov (United States)

    Pio, A; Rendina, M; Benazzo, F; Castelli, C; Paparella, F

    1994-08-01

    The statics of a sliding body was used to study the distribution of forces during the application of cervical traction in supine patients. This theoretical analysis was completed using a dynamometer to determine the static friction between bed surface and patient head. Therefore, we measured the head weight in 12 inpatients and the minimum force that causes impending motion of the head on the bed surface. The static friction coefficient was calculated from the ratio of the two quantities. The forces acting on the cervical spine were determined by inserting the former data into a specifically designed algorithm that forecasted a progressively increasing traction angle. The coefficient of static friction was 0.62, whereas the maximum available force acting on the cervical spine was obtained with a 35 degrees traction inclination. In contrast, the forces dissipated by the plane progressively decreased with larger angles.

  11. Statics of Historic Masonry Constructions

    CERN Document Server

    Como, Mario

    2013-01-01

    Masonry constructions are the great majority of the buildings in Europe’s historic centres and the most important monuments in its architectural heritage. Given the age of much of these constructions, the demand for safety assessments and restoration projects is pressing and constant. This book aims to help fill this demand presenting a comprehensive new statics of masonry constructions. The book, result of thirty years of research and professional experience, gives the fundamentals of statics of the masonry solid, then applied to the study of statics of arches, piers and vaults. Further, combining engineering and architecture and through an interdisciplinary approach, the book investigates the statical behaviour of many historic monuments, as the Pantheon, the Colosseum,  the domes of S. Maria del Fiore in Florence and of St. Peter in Rome, the Tower of Pisa, the Gothic Cathedrals and the Masonry Buildings under seismic actions.

  12. Static and Dynamic Traversable Wormholes

    Science.gov (United States)

    Adamiak, Jaroslaw P.

    2008-09-01

    The aim of this work is to discuss the effects found in static and dynamic wormholes that occur as a solution of Einstein equations in general relativity. The ground is prepared by presentation of faster than light effects, then the focus is narrowed to Morris-Thorne framework for a static spherically symmetric wormhole. Two types of dynamic worm-holes, evolving and rotating, are considered.

  13. Static Decoupling in fault detection

    DEFF Research Database (Denmark)

    Niemann, Hans Henrik

    1998-01-01

    An algebraic approach is given for a design of a static residual weighting factor in connection with fault detection. A complete parameterization is given of the weighting factor which will minimize a given performance index......An algebraic approach is given for a design of a static residual weighting factor in connection with fault detection. A complete parameterization is given of the weighting factor which will minimize a given performance index...

  14. Review of the book: Bogachev A.V., Frantsuzov D.A. Costume of the proto–Bulgars of the Middle Volga region: the end of the VII – the beginning of the X century (Samara, 2012, 350 p.

    Directory of Open Access Journals (Sweden)

    Liphanov Nikolay A.

    2014-06-01

    Full Text Available Methodological and source study aspects of the research devoted to the costume of early medieval cattle-breeding population of the Middle Volga region carried out in the monograph by A.V. Bogachev and D.A. Frantsuzov are examined in the review. This aspect of material culture is considered by the authors on the basis of written, visual and material data. However, it should be noted that the information from the written sources analyzed appeared insufficient to characterize the nomadic costume in general, lacking details regarding the clothing of the early medieval Bulgars of the Middle Volga region in particular. The visual sources are more informative, but the authors have not used them in total, ignoring a lot of important materials. Besides, the authors of the book have discarded a significant array of archaeological data, and the analysis of the materials used bears a rather superficial and careless character. The fact that the majority archaeological sites considered in the book have been attributed to the Proto-Bulgars (Bulgars attests to a subjective and badly-reasoned stance. The study is largely secondary: it is based upon previous works by A.V. Bogachev and repeats his mistakes and errors, which have already received a negative appraisal from experts. The author of the review concludes that the study by A.V. Bogachev and D.A. Frantsuzov has been carried out on a low methodological level, insufficient to consider the monograph under consideration a qualitative research

  15. Book review: Bogachev A.V., Frantsuzov D.A. Costume of the Proto-Bulgars of the Middle Volga region: late 7th – early 10th century (Samara: SGTU, 2012, 350 pp.

    Directory of Open Access Journals (Sweden)

    Liphanov Nikolay A.

    2014-06-01

    Full Text Available Methodological and source study aspects of the research devoted to the costume of early medieval cattle-breeding population of the Middle Volga region carried out in the monograph by A.V. Bogachev and D.A. Frantsuzov are examined in the review. This aspect of material culture is considered by the authors on the basis of written, visual and material data. However, it should be noted that the information from the written sources analyzed appeared insufficient to characterize the nomadic costume in general, lacking details regarding the clothing of the early medieval Bulgars of the Middle Volga region in particular. The visual sources are more informative, but the authors have not used them in total, ignoring a lot of important materials. Besides, the authors of the book have discarded a significant array of archaeological data, and the analysis of the materials used bears a rather superficial and careless character. The fact that the majority archaeological sites considered in the book have been attributed to the Proto-Bulgars (Bulgars attests to a subjective and badly-reasoned stance. The study is largely secondary: it is based upon previous works by A.V. Bogachev and repeats his mistakes and errors, which have already received a negative appraisal from experts. The author of the review concludes that the study by A.V. Bogachev and D.A. Frantsuzov has been carried out on a low methodological level, insufficient to consider the monograph under consideration a qualitative research.

  16. Static-static-light-light tetraquarks in lattice QCD

    CERN Document Server

    Wagner, Marc

    2011-01-01

    I report on a lattice computation of the energy of a system of two light quarks and two static antiquarks as a function of the separation of the static antiquarks. In terms of hadrons such a system corresponds to a pair of B mesons and its energy to the hadronic potential. I present selected results for different isospin, spin and parity combinations of the individual B mesons mainly focusing on those channels relevant to determine, whether two B mesons may form a bound tetraquark state.

  17. Static Filtered Sky Color Constancy

    Directory of Open Access Journals (Sweden)

    Ali Alkhalifah

    2016-05-01

    Full Text Available In Computer Vision, the sky color is used for lighting correction, image color enhancement, horizon alignment, image indexing, and outdoor image classification and in many other applications. In this article, for robust color based sky segmentation and detection, usage of lighting correction for sky color detection is investigated. As such, the impact of color constancy on sky color detection algorithms is evaluated and investigated. The color correction (constancy algorithms used includes Gray-Edge (GE, Gray-World (GW, Max-RGB (MRGB and Shades-of-Gray (SG. The algorithms GE, GW, MRGB, and SG, are tested on the static filtered sky modeling. The static filter is developed in the LAB color space. This evaluation and analysis is essential for detection scenarios, especially, color based object detection in outdoor scenes. From the results, it is concluded that the color constancy before sky color detection using LAB static filters has the potential of improving sky color detection performance. However, the application of the color constancy can impart adverse effects on the detection results. For images, the color constancy algorithms depict a compact and stable representative of the sky chroma loci, however, the sky color locus might have a shifting and deviation in a particular color representation. Since the sky static filters are using the static chromatic values, different results can be obtained by applying color constancy algorithms on various datasets.

  18. Statics of historic masonry constructions

    CERN Document Server

    Como, Mario

    2017-01-01

    Masonry constructions are the great majority of the buildings in Europe’s historic centres and the most important monuments of its architectural heritage. Given the age of these constructions, the demand for safety assessments and restoration projects is pressing and constant; still within the broad studies in the subject it is not yet recognised, in particular within the seismic area, a unitary approach to deal with Masonry structures. This successful book contributes to clarify the issues with a rigorous approach offering a comprehensive new Statics of Masonry Constructions. This third edition has been driven by some recent developments of the research in the field, and it gives the fundamentals of Statics with an original and rigorous mathematical formulation, further in-depth inquired in this new version. With many refinements and improvements, the book investigates the static behaviour of many historic monuments, such as the Gothic Cathedrals, the Mycenaean Tholoi, the Pantheon, the Colosseum, the dome...

  19. Static Correctness of Hierarchical Procedures

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff

    1990-01-01

    A system of hierarchical, fully recursive types in a truly imperative language allows program fragments written for small types to be reused for all larger types. To exploit this property to enable type-safe hierarchical procedures, it is necessary to impose a static requirement on procedure calls....... We introduce an example language and prove the existence of a sound requirement which preserves static correctness while allowing hierarchical procedures. This requirement is further shown to be optimal, in the sense that it imposes as few restrictions as possible. This establishes the theoretical...... basis for a general type hierarchy with static type checking, which enables first-order polymorphism combined with multiple inheritance and specialization in a language with assignments. We extend the results to include opaque types. An opaque version of a type is different from the original but has...

  20. Static-Fluid Black Holes

    CERN Document Server

    Cho, Inyong

    2016-01-01

    We investigate black holes formed by static perfect fluid with $p=-\\rho/3$. These represent the black holes in $S_3$ and $H_3$ spatial geometries. There are three classes of black-hole solutions, two $S_3$ types and one $H_3$ type. The interesting solution is the one of $S_3$ type which possesses two singularities. The one is at the north pole behind the horizon, and the other is naked at the south pole. The observers, however, are free from falling to the naked singularity. There are also nonstatic cosmological solutions in $S_3$ and $H_3$, and a singular static solution in $H_3$.

  1. Static Fourier transform infrared spectrometer.

    Science.gov (United States)

    Schardt, Michael; Murr, Patrik J; Rauscher, Markus S; Tremmel, Anton J; Wiesent, Benjamin R; Koch, Alexander W

    2016-04-01

    Fourier transform spectroscopy has established itself as the standard method for spectral analysis of infrared light. Here we present a robust and compact novel static Fourier transform spectrometer design without any moving parts. The design is well suited for measurements in the infrared as it works with extended light sources independent of their size. The design is experimentally evaluated in the mid-infrared wavelength region between 7.2 μm and 16 μm. Due to its large etendue, its low internal light loss, and its static design it enables high speed spectral analysis in the mid-infrared.

  2. Voltage Sensors Monitor Harmful Static

    Science.gov (United States)

    2009-01-01

    A tiny sensor, small enough to be worn on clothing, now monitors voltage changes near sensitive instruments after being created to alert Agency workers to dangerous static buildup near fuel operations and avionics. San Diego s Quasar Federal Systems received a Small Business Innovation Research (SBIR) contract from Kennedy Space Center to develop its remote voltage sensor (RVS), a dime-sized electrometer designed to measure triboelectric changes in the environment. One of the unique qualities of the RVS is that it can detect static at greater distances than previous devices, measuring voltage changes from a few centimeters to a few meters away, due to its much-improved sensitivity.

  3. The Images of the Volga River and the Neva River in Russian Poetry during the Napoleonic War%拿破仑战争时期俄国诗歌中的伏尔加河与涅瓦河形象

    Institute of Scientific and Technical Information of China (English)

    鸟山祐介; 贾茜

    2012-01-01

    In the Russian culture, the Volga River is usually regarded as the symbol of Russia and its people; but on the other hand, along the Volga have lived many ethnic groups for a long time, including non-Slavs and non-Christians. Correspondingly, in the 18th-century poetry, the image of the Volga was related to the ethnic groups, i.e. the Volga was not only a river of " Russia" whereas the Neva was treated as a symbol of Russia. After the Napoleonic War, the national consciousness has removed the alien features of the Volga in literary works and turned it into a " mother river". On the contrary, the Neva has gradually lost its function of representing the Russian nationality.%在俄罗斯文化中,伏尔加河常常被认作俄罗斯和俄罗斯人民的象征,但另一方面,伏尔加河沿岸多年以来就是个多民族地区,包括很多非斯拉夫人和非基督徒。相应地,在18世纪的诗歌中,伏尔加河的形象也往往与这些民族的存在联系在一起,即,她并不仅仅是"俄罗斯"的河。而涅瓦河则经常被作为俄罗斯的象征。拿破仑战争之后,民族意识使伏尔加河在文学的书写中渐渐被去异族化,变成"母亲河",而涅瓦河逐渐失去了指代俄罗斯民族的功能。

  4. Static Analysis for Systems Biology

    DEFF Research Database (Denmark)

    Nielson, Flemming; Nielson, Hanne Riis; Rosa, D. Schuch da

    2004-01-01

    This paper shows how static analysis techniques can help understanding biological systems. Based on a simple example we illustrate the outcome of performing three different analyses extracting information of increasing precision. We conclude by reporting on the potential impact and exploitation o...... of these techniques in systems biology....

  5. Static Analysis of Dynamic Languages

    DEFF Research Database (Denmark)

    Madsen, Magnus

    on the behaviour of these languages. A common theme is the reliance on static program analysis to over-approximate the behaviour of programs written in these languages. Specifically, the use of whole-program dataflow analysis. The research challenge of this line of work is the adaption of existing- and invention......Dynamic programming languages are highly popular and widely used. Java- Script is often called the lingua franca of the web and it is the de facto standard for client-side web programming. On the server-side the PHP, Python and Ruby languages are prevalent. What these languages have in common...... is an expressive power which is not easily captured by any static type system. These, and similar dynamic languages, are often praised for their ease-of-use and flexibility. Unfortunately, this dynamism comes at a great cost: The lack of a type system implies that most errors are not discovered until run...

  6. Static Behaviour of Bucket Foundations

    DEFF Research Database (Denmark)

    Larsen, Kim André

    . The monopod concept is investigated in this thesis, regarding the static behaviour from loads relevant to offshore wind turbines. The main issue in this concept is the rotational stiffness of the foundation and the combined capacity dominated by moments. The vertical bearing capacity of bucket foundations...... theory is proposed. The proposed expression applies to plane strain as well as axis-symmetric stress conditions for foundations with smooth or rough bases. A thorough experimental investigation of the static behaviour of bucket foundations subjected to combined loading is carried out. Laboratory tests...... as well as large-scale tests on bucket foundations subjected to low vertical load are performed during this work. Numerical simulations of the tests performed are carried out using the Mohr Coulomb material model and the commercial finite element code ABAQUS. Based on the present work, the finite element...

  7. Static behaviour of induced seismicity

    CERN Document Server

    Mignan, Arnaud

    2015-01-01

    The standard paradigm to describe seismicity induced by fluid injection is to apply nonlinear diffusion dynamics in a poroelastic medium. I show that the spatiotemporal behaviour and rate evolution of induced seismicity can, instead, be expressed by geometric operations on a static stress field produced by volume change at depth. I obtain laws similar in form to the ones derived from poroelasticity while requiring a lower description length. Although fluid flow is known to occur in the ground, it is not pertinent to the behaviour of induced seismicity. The proposed model is equivalent to the static stress model for tectonic foreshocks generated by the Non- Critical Precursory Accelerating Seismicity Theory. This study hence verifies the explanatory power of this theory outside of its original scope.

  8. Static Behaviour of Bucket Foundations

    DEFF Research Database (Denmark)

    Larsen, Kim André

    . The monopod concept is investigated in this thesis, regarding the static behaviour from loads relevant to offshore wind turbines. The main issue in this concept is the rotational stiffness of the foundation and the combined capacity dominated by moments. The vertical bearing capacity of bucket foundations...... theory is proposed. The proposed expression applies to plane strain as well as axis-symmetric stress conditions for foundations with smooth or rough bases. A thorough experimental investigation of the static behaviour of bucket foundations subjected to combined loading is carried out. Laboratory tests...... method is concluded to be a superior method in estimating the post peak behaviour as well as the combined capacity of bucket foundations in relation to the offshore wind turbine problem....

  9. Statics of historic masonry constructions

    CERN Document Server

    Como, Mario

    2016-01-01

    This successful book, which is now appearing in its second edition, presents a comprehensive new Statics of Masonry Constructions. Masonry constructions are the great majority of the buildings in Europe’s historic centres and the most important monuments in its architectural heritage. Given the age of these constructions, the demand for safety assessments and restoration projects is pressing and constant. The book you hold in hands contributes to fill this demand. The second edition integrates the original text of the first edition with new developments, widening and revisions, due to recent research studies achievements. The result is a book that gives a complete picture of the behaviour of the Masonry Constructions. First of all, it gives the fundamentals of its Statics, based on the no-tension assumption, and then it develops the Limit Analysis for the Masonry Constructions. In this framework, through an interdisciplinary approach combining Engineering and Architecture, the book also investigates the sta...

  10. Static Analysis of Mobile Programs

    Science.gov (United States)

    2017-02-01

    PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) Air...and then use static analysis to verify them. In the end we pursued this idea successfully for several differnet properties and developed novel...difficult to develop with enough precision. In [3], we establish a connection between compositional analyses and modular lattices, which require

  11. A Pedagogical Model of Static Friction

    CERN Document Server

    Pickett, Galen T

    2015-01-01

    While dry Coulombic friction is an elementary topic in any standard introductory course in mechanics, the critical distinction between the kinetic and static friction forces is something that is both hard to teach and to learn. In this paper, I describe a geometric model of static friction that may help introductory students to both understand and apply the Coulomb static friction approximation.

  12. 30 CFR 18.26 - Static electricity.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Static electricity. 18.26 Section 18.26 Mineral... § 18.26 Static electricity. Nonmetallic rotating parts, such as belts and fans, shall be provided with a means to prevent an accumulation of static electricity. ...

  13. In-Flight Pitot-Static Calibration

    Science.gov (United States)

    Foster, John V. (Inventor); Cunningham, Kevin (Inventor)

    2016-01-01

    A GPS-based pitot-static calibration system uses global output-error optimization. High data rate measurements of static and total pressure, ambient air conditions, and GPS-based ground speed measurements are used to compute pitot-static pressure errors over a range of airspeed. System identification methods rapidly compute optimal pressure error models with defined confidence intervals.

  14. Static Analysis Alert Audits: Lexicon and Rules

    Science.gov (United States)

    2016-11-04

    DISTRIBUTION STATEMENT A] This material has been approved for public release and unlimited distribution. REV-03.18.2016.0 Static Analysis Alert Audits...unlimited distribution. Background: Automatic Alert Classification Static Analysis Tool(s) Alerts Alert Consolidation (SCALe) Potential Rule...Automatic Alert Classification Static Analysis Tool(s) Alerts Alert Consolidation (SCALe) Potential Rule Violations Auditing Determinations ML

  15. Static Charge Development on Explosives .

    Directory of Open Access Journals (Sweden)

    K. Raha

    1991-01-01

    Full Text Available Static charge development character of some of the important explosive crystals have been predicted on the basis of their crystal class and symmetry. Among the important mechanism of charge development, the piezoelectric and pyroelectric characters have been considered. Ammonium trinitrate, ammonium nitrate, m-dinitro-benzene, trinitro-toluene, styphnic acid, beeta-lead styphnate, 4,4'dinitro-dipheny1, a-hexamethylenetetranitramine, nitroguanidine, picric acid, dimethylnitramine, a-lead azide and beeta-lead azide are pyroelectric in nature, whereas pentaerythritol tetranitrate, picryliodide, hexamethylenetranitramine, tetranitromethane and trinitroethane are piezoelectric in nature.

  16. Static Analysis for Dynamic XML

    DEFF Research Database (Denmark)

    Christensen, Aske Simon; Møller, Anders; Schwartzbach, Michael Ignatieff

    2002-01-01

    We describe the summary graph lattice for dataflow analysis of programs that dynamically construct XML documents. Summary graphs have successfully been used to provide static guarantees in the JWIG language for programming interactive Web services. In particular, the JWIG compiler is able to check...... validity of dynamically generated XHTML documents and to type check dynamic form data. In this paper we present summary graphs and indicate their applicability for various scenarios. We also show that the expressive power of summary graphs is similar to that of the regular expression types from XDuce......, but that the extra structure in summary graphs makes them more suitable for certain program analyses....

  17. Static Analysis for Dynamic XML

    DEFF Research Database (Denmark)

    Christensen, Aske Simon; Møller, Anders; Schwartzbach, Michael Ignatieff

    2002-01-01

    We describe the summary graph lattice for dataflow analysis of programs that dynamically construct XML documents. Summary graphs have successfully been used to provide static guarantees in the JWIG language for programming interactive Web services. In particular, the JWIG compiler is able to check...... validity of dynamically generated XHTML documents and to type check dynamic form data. In this paper we present summary graphs and indicate their applicability for various scenarios. We also show that the expressive power of summary graphs is similar to that of the regular expression types from XDuce...

  18. Static Validation of Security Protocols

    DEFF Research Database (Denmark)

    Bodei, Chiara; Buchholtz, Mikael; Degano, P.;

    2005-01-01

    We methodically expand protocol narrations into terms of a process algebra in order to specify some of the checks that need to be made in a protocol. We then apply static analysis technology to develop an automatic validation procedure for protocols. Finally, we demonstrate that these techniques ...... suffice to identify several authentication flaws in symmetric and asymmetric key protocols such as Needham-Schroeder symmetric key, Otway-Rees, Yahalom, Andrew secure RPC, Needham-Schroeder asymmetric key, and Beller-Chang-Yacobi MSR...

  19. Electrowetting -- from statics to dynamics.

    Science.gov (United States)

    Chen, Longquan; Bonaccurso, Elmar

    2014-08-01

    More than one century ago, Lippmann found that capillary forces can be effectively controlled by external electrostatic forces. As a simple example, by applying a voltage between a conducting liquid droplet and the surface it is sitting on we are able to adjust the wetting angle of the drop. Since Lippmann's findings, electrocapillary phenomena - or electrowetting - have developed into a series of tools for manipulating microdroplets on solid surfaces, or small amounts of liquids in capillaries for microfluidic applications. In this article, we briefly review some recent progress of fundamental understanding of electrowetting and address some still unsolved issues. Specifically, we focus on static and dynamic electrowetting. In static electrowetting, we discuss some basic phenomena found in DC and AC electrowetting, and some theories about the origin of contact angle saturation. In dynamic electrowetting, we introduce some studies about this rather recent area. At last, we address some other capillary phenomena governed by electrostatics and we give an outlook that might stimulate further investigations on electrowetting.

  20. The Predictive Validity of the Static-99, Static-99R, and Static-2002/R: Which One to Use?

    Science.gov (United States)

    Reeves, Sophie G; Ogloff, James R P; Simmons, Melanie

    2017-06-01

    The use of Static tools (Static-99, Static-99R, Static-2002, and Static-2002R) in risk decision making involving sexual offenders is widespread internationally. This study compared the predictive accuracy and incremental validity of four Static risk measures in a sample of 621 Australian sexual offenders. Results indicated that approximately 45% of the sample recidivated (with 18.8% committing sexual offenses). All of the Static measures investigated yielded moderate predictive validity for sexual recidivism, which was comparable with other Australian and overseas studies. Area under the curve (AUC) values for the four measures across the 5-, 10-, and 15-year intervals ranged from .67 to .69. All of the Static measures discriminated quite well between low-risk and high-risk sexual offenders but less well for the moderate risk categories. When pitted together, none of the tools accounted for additional variance in sexual recidivism, above and beyond what the other measures accounted for. The overall results provide support for the use of Static measures as a component of risk assessment and decision making with Australian sexual offending populations. The limitations of this study and recommendations for further research are also discussed.

  1. Ares I Static Tests Design

    Science.gov (United States)

    Carson, William; Lindemuth, Kathleen; Mich, John; White, K. Preston; Parker, Peter A.

    2009-01-01

    Probabilistic engineering design enhances safety and reduces costs by incorporating risk assessment directly into the design process. In this paper, we assess the format of the quantitative metrics for the vehicle which will replace the Space Shuttle, the Ares I rocket. Specifically, we address the metrics for in-flight measurement error in the vector position of the motor nozzle, dictated by limits on guidance, navigation, and control systems. Analyses include the propagation of error from measured to derived parameters, the time-series of dwell points for the duty cycle during static tests, and commanded versus achieved yaw angle during tests. Based on these analyses, we recommend a probabilistic template for specifying the maximum error in angular displacement and radial offset for the nozzle-position vector. Criteria for evaluating individual tests and risky decisions also are developed.

  2. Statics learning from engineering examples

    CERN Document Server

    Emri, Igor

    2016-01-01

    This textbook introduces and explains the basic concepts on which statics is based utilizing real engineering examples. The authors emphasize the learning process by showing a real problem, analyzing it, simplifying it, and developing a way to solve it. This feature teaches students intuitive thinking in solving real engineering problems using the fundamentals of Newton’s laws. This book also: · Stresses representation of physical reality in ways that allow students to solve problems and obtain meaningful results · Emphasizes identification of important features of the structure that should be included in a model and which features may be omitted · Facilitates students' understanding and mastery of the "flow of thinking" practiced by professional engineers.

  3. Static and non-static black holes with the Liouville mode

    Science.gov (United States)

    Moskalets, T. M.; Nurmagambetov, A. J.

    2017-03-01

    We present a new class of static and non-static quasi-spherical black hole solutions in four-dimensional Minkowski and Anti-de Sitter spaces and briefly discuss its employing in the Gauge/Gravity duality.

  4. Model Checking as Static Analysis: Revisited

    DEFF Research Database (Denmark)

    Zhang, Fuyuan; Nielson, Flemming; Nielson, Hanne Riis

    2012-01-01

    We show that the model checking problem of the μ-calculus can be viewed as an instance of static analysis. We propose Succinct Fixed Point Logic (SFP) within our logical approach to static analysis as an extension of Alternation-free Least Fixed Logic (ALFP). We generalize the notion...

  5. Static domain wall in braneworld gravity

    Energy Technology Data Exchange (ETDEWEB)

    Abdalla, M.C.B.; Carlesso, P.F. [UNESP, Universidade Estadual Paulista, Instituto de Fisica Teiorica, Rua Dr. Bento Teobaldo Ferraz 271, Bloco II, Barra-Funda, Caixa Postal 70532-2, Sao Paulo, SP (Brazil); Hoff da Silva, J.M. [UNESP, Universidade Estadual Paulista, Departamento de Fisica e Quimica, Guaratingueta, SP (Brazil)

    2014-01-15

    In this paper we consider a static domain wall inside a 3-brane. Different from the standard achievement obtained in General Relativity, the analysis performed here gives a consistency condition for the existence of static domain walls in a braneworld gravitational scenario. Also the behavior of the domain wall's gravitational field in the newtonian limit is shown. (orig.)

  6. Static Complexity Analysis of Higher Order Programs

    DEFF Research Database (Denmark)

    Avery, James Emil; Kristiansen, Lars; Moyen, Jean-Yves

    2009-01-01

    The overall goal of the research presented in this paper is to find^M automatic methods for static complexity analysis of higher order^M programs.......The overall goal of the research presented in this paper is to find^M automatic methods for static complexity analysis of higher order^M programs....

  7. Static balance and developmental coordination disorder

    NARCIS (Netherlands)

    Geuze, RH

    2003-01-01

    The development of static balance is a basic characteristic of normal motor development. Most of the developmental motor tests include a measure of static balance. Children with a developmental coordination disorder (DCD) often fail this item. Twenty-four children at risk for DCD with balance proble

  8. ENROLMENT MODEL STABILITY IN STATIC SIGNATURE VERIFICATION

    NARCIS (Netherlands)

    Allgrove, C.; Fairhurst, M.C.

    2004-01-01

    The stability of enrolment models used in a static verification system is assessed, in order to provide an enhanced chracterisation of signatures through the validation of the enrolment process. A number of static features are used to illustrate the effect of the variation in enrolment model size on

  9. Comparing Techniques for Certified Static Analysis

    Science.gov (United States)

    Cachera, David; Pichardie, David

    2009-01-01

    A certified static analysis is an analysis whose semantic validity has been formally proved correct with a proof assistant. The recent increasing interest in using proof assistants for mechanizing programming language metatheory has given rise to several approaches for certification of static analysis. We propose a panorama of these techniques and compare their respective strengths and weaknesses.

  10. Aftershocks halted by static stress shadows

    Science.gov (United States)

    Toda, Shinji; Stein, Ross S.; Beroza, Gregory C.; Marsan, David

    2012-06-01

    Earthquakes impart static and dynamic stress changes to the surrounding crust. Sudden fault slip causes small but permanent--static--stress changes, and passing seismic waves cause large, but brief and oscillatory--dynamic--stress changes. Because both static and dynamic stresses can trigger earthquakes within several rupture dimensions of a mainshock, it has proven difficult to disentangle their contributions to the triggering process. However, only dynamic stress can trigger earthquakes far from the source, and only static stress can create stress shadows, where the stress and thus the seismicity rate in the shadow area drops following an earthquake. Here we calculate the stress imparted by the magnitude 6.1 Joshua Tree and nearby magnitude 7.3 Landers earthquakes that occurred in California in April and June 1992, respectively, and measure seismicity through time. We show that, where the aftershock zone of the first earthquake was subjected to a static stress increase from the second, the seismicity rate jumped. In contrast, where the aftershock zone of the first earthquake fell under the stress shadow of the second and static stress dropped, seismicity shut down. The arrest of seismicity implies that static stress is a requisite element of spatial clustering of large earthquakes and should be a constituent of hazard assessment.

  11. Martian Atmospheric Pressure Static Charge Elimination Tool

    Science.gov (United States)

    Johansen, Michael R.

    2014-01-01

    A Martian pressure static charge elimination tool is currently in development in the Electrostatics and Surface Physics Laboratory (ESPL) at NASA's Kennedy Space Center. In standard Earth atmosphere conditions, static charge can be neutralized from an insulating surface using air ionizers. These air ionizers generate ions through corona breakdown. The Martian atmosphere is 7 Torr of mostly carbon dioxide, which makes it inherently difficult to use similar methods as those used for standard atmosphere static elimination tools. An initial prototype has been developed to show feasibility of static charge elimination at low pressure, using corona discharge. A needle point and thin wire loop are used as the corona generating electrodes. A photo of the test apparatus is shown below. Positive and negative high voltage pulses are sent to the needle point. This creates positive and negative ions that can be used for static charge neutralization. In a preliminary test, a floating metal plate was charged to approximately 600 volts under Martian atmospheric conditions. The static elimination tool was enabled and the voltage on the metal plate dropped rapidly to -100 volts. This test data is displayed below. Optimization is necessary to improve the electrostatic balance of the static elimination tool.

  12. Pheromone Static Routing Strategy for Complex Networks

    CERN Document Server

    Ling, Xiang; Jiang, Rui; Hu, Mao-Bin

    2011-01-01

    In this paper, we adopt the concept of pheromone to generate a set of static paths that can reach the performance of global dynamic routing strategy [Phys. Rev. E 81, 016113(2010)]. In the test stage, pheromone is dropped to the nodes by packets forwarded by the global dynamic routing strategy. After that, static paths are generated according to the density of pheromone. The output paths can greatly improve traffic systems' overall capacity on different network structures, including scale-free networks, small-world networks and random graphs. Because the paths are static, the system needs much less computational resource than the global dynamic routing strategy.

  13. Analytic three-loop static potential

    Science.gov (United States)

    Lee, Roman N.; Smirnov, Alexander V.; Smirnov, Vladimir A.; Steinhauser, Matthias

    2016-09-01

    We present analytic results for the three-loop static potential of two heavy quarks. The analytic calculation of the missing ingredients is outlined, and results for the singlet and octet potential are provided.

  14. Static Stress Analysis of Security Injection Tank

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The static structural analysis of the security injection tank is made to make sure whether the tank can withstand concerned loads or not on all conditions conforming to concerned code prescripts and design requirements. The tanks

  15. Static Water Vapor Feed Electrolyzer Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Development of a static vapor feed electrolyzer utilizing an advanced bipolar plate that produces sub-saturated H2 and O2 is proposed. This novel bipolar design can...

  16. Static Water Vapor Feed Electrolyzer Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Development of a static vapor feed electrolyzer utilizing an advanced bipolar plate that produces sub-saturated H2 and O2 is proposed. This novel bipolar design can...

  17. On static equilibrium and balance puzzler

    CERN Document Server

    Dey, Samrat; Saikia, Dipankar; Kalita, Deepjyoti; Debbarma, Anamika; Wahab, Shaheen Akhtar; Sarma, Saurabh

    2012-01-01

    The principles of static equilibrium are of special interest to civil engineers. For a rigid body to be in static equilibrium the condition is that net force and net torque acting on the body should be zero. That clearly signifies that if equal weights are placed on either sides of a balance, the balance should be in equilibrium, even if its beam is not horizontal (we have considered the beam to be straight and have no thickness, an ideal case). Thus, although the weights are equal, they will appear different which is puzzling. This also shows that the concept of equilibrium is confusing, especially neutral equilibrium is confused to be stable equilibrium. The study not only throws more light on the concept of static equilibrium, but also clarifies that a structure need not be firm and steady even if it is in static equilibrium.

  18. Statics formulas and problems : engineering mechanics 1

    CERN Document Server

    Gross, Dietmar; Wriggers, Peter; Schröder, Jörg; Müller, Ralf

    2017-01-01

    This book contains the most important formulas and more than 160 completely solved problems from Statics. It provides engineering students material to improve their skills and helps to gain experience in solving engineering problems. Particular emphasis is placed on finding the solution path and formulating the basic equations. Topics include: - Equilibrium - Center of Gravity, Center of Mass, Centroids - Support Reactions - Trusses - Beams, Frames, Arches - Cables - Work and Potential Energy - Static and Kinetic Friction - Moments of Inertia.

  19. Typification of Statice dichotoma Cav. (Plumbaginaceae

    Directory of Open Access Journals (Sweden)

    Ferrer-Gallego, P. Pablo

    2013-12-01

    Full Text Available A lectotype and an epitype are here designated for Statice dichotoma Cav. (Plumbaginaceae, an endemic taxon from the central part of the Iberian Peninsula, which is currently named Limonium dichotomum (Cav. KuntzeSe designan un lectótipo y un epítipo para Statice dichotoma Cav. (Plumbaginaceae, un taxon endémico del centro de la península Ibérica, actualmente denominado Limonium dichotomum (Cav. Kuntze.

  20. Static Validation of a Voting Protocol

    DEFF Research Database (Denmark)

    Nielsen, Christoffer Rosenkilde; Andersen, Esben Heltoft; Nielson, Hanne Riis

    2005-01-01

    The desired security properties of electronic voting protocols include verifiability, accuracy, democracy and fairness. In this paper we use a static program analysis tool to validate these properties for one of the classical voting protocols under appropriate assumptions. The protocol is formali......The desired security properties of electronic voting protocols include verifiability, accuracy, democracy and fairness. In this paper we use a static program analysis tool to validate these properties for one of the classical voting protocols under appropriate assumptions. The protocol...

  1. Static analysis of function calls in Erlang

    Directory of Open Access Journals (Sweden)

    Dániel Horpácsi

    2013-06-01

    Full Text Available Functions and their relations can affect numerous properties and metrics of a functional program. To identify and represent the functions and their calling connections, software analysers commonly apply semantic function analysis, which derives the static call graph of the program, based on its source code. Function calls however may be dynamic and complex, making it difficult to statically identify the callee. Dynamic calls are determined just at run-time, static analysis therefore cannot be expected to fully identify every call. Nevertheless, by utilising the results of a properly performed data-flow analysis as well as taking ambiguous references into account, numerous dynamic calls are discoverable and representable. We consider cases where the identifiers of the callee are statically determined, but they flow into the call expression from a different program point, and also, we manage to handle function calls whose identifiers are not fully identifiable at compile-time. By utilising the improved reference analysis, we extend the static call graph with various information about dynamic function calls. We investigate such a function call analysis in the programming language Erlang.

  2. From Flow Logic to Static Type Systems in Coordination Languages

    DEFF Research Database (Denmark)

    De Nicola, Rocco; Gorla, Daniele; Hansen, René Rydhof;

    2008-01-01

    ; therefore, the correctness properties cannot be statically enforced. By contrast, static analysis approaches based on Flow Logic usually guarantee properties statically. In this paper we show how to combine these two approaches to obtain a static type system for describing secure access to tuple spaces...

  3. 30 CFR 57.6602 - Static electricity dissipation during loading.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Static electricity dissipation during loading... MINES Explosives Extraneous Electricity-Surface and Underground § 57.6602 Static electricity dissipation... generates a static electricity hazard— (a) An evaluation of the potential static electricity hazard shall be...

  4. Investigating Static and Dynamic Light Scattering

    CERN Document Server

    Sun, Yong

    2011-01-01

    A new size, static radii $R_{s}$, can be measured accurately using Static Light Scattering (SLS) technique when the Rayleigh-Gans-Debye approximation is valid for dilute homogenous spherical particles in dispersion. The method proposed in this work not only can measures the particle size distribution and average molar mass accurately but also enables us to explore Dynamic Light Scattering (DLS) technique further. Detailed investigation of the normalized time auto-correlation function of the scattered light intensity $g^{2)}(\\tau)$ shows that the measurements of DLS can be expected accurately and the static and hydrodynamic radii of nanoparticles are different. Only at some special conditions, the Z-average hydrodynamic radius can be measured accurately at a given scattering angle. The fact that the values of average hydrodynamic radius measured at different scattering angles are consistent or the values of polydispersity index are small does not mean the particle size distribution is narrow or monodisperse.

  5. Static Analysis for JavaScript

    DEFF Research Database (Denmark)

    Jensen, Simon Holm

    Web applications present unique challenges to designers of static analysis tools. One of these challenges is the language JavaScript used for client side scripting in the browser. JavaScript is a complex language with many pitfalls and poor tool support compared to other languages....... This dissertation describes the design and implementation of a static analysis for JavaScript that can assist programmers in finding bugs in code during development. We describe the design of a static analysis tool for JavaScript, built using the monotone framework. This analysis infers detailed type information...... about programs. This information can be used to detect bugs such as null pointer dereferences and unintended type coercions. The analysis is sound, enabling it to prove the absence of certain program errors. JavaScript is usually run within the context of the browser and the DOM API. The major...

  6. Pheromone Static Routing Strategy for Complex Networks

    Science.gov (United States)

    Hu, Mao-Bin; Henry, Y. K. Lau; Ling, Xiang; Jiang, Rui

    2012-12-01

    We adopt the concept of using pheromones to generate a set of static paths that can reach the performance of global dynamic routing strategy [Phys. Rev. E 81 (2010) 016113]. The path generation method consists of two stages. In the first stage, a pheromone is dropped to the nodes by packets forwarded according to the global dynamic routing strategy. In the second stage, pheromone static paths are generated according to the pheromone density. The output paths can greatly improve traffic systems' overall capacity on different network structures, including scale-free networks, small-world networks and random graphs. Because the paths are static, the system needs much less computational resources than the global dynamic routing strategy.

  7. Statics and rotational dynamics of composite beams

    CERN Document Server

    Ghorashi, Mehrdaad

    2016-01-01

    This book presents a comprehensive study of the nonlinear statics and dynamics of composite beams and consists of solutions with and without active elements embedded in the beams. The static solution provides the initial conditions for the dynamic analysis. The dynamic problems considered include the analyses of clamped (hingeless) and articulated (hinged) accelerating rotating beams. Two independent numerical solutions for the steady state and the transient responses are presented. The author illustrates that the transient solution of the nonlinear formulation of accelerating rotating beam converges to the steady state solution obtained by the shooting method. Other key areas considered include calculation of the effect of perturbing the steady state solution, coupled nonlinear flap-lag dynamics of a rotating articulated beam with hinge offset and aerodynamic damping, and static and dynamic responses of nonlinear composite beams with embedded anisotropic piezo-composite actuators. The book is intended as a t...

  8. Extending and Enhancing SAS (Static Analysis Suite)

    CERN Document Server

    Ho, David

    2016-01-01

    The Static Analysis Suite (SAS) is an open-source software package used to perform static analysis on C and C++ code, helping to ensure safety, readability and maintainability. In this Summer Student project, SAS was enhanced to improve ease of use and user customisation. A straightforward method of integrating static analysis into a project at compilation time was provided using the automated build tool CMake. The process of adding checkers to the suite was streamlined and simplied by developing an automatic code generator. To make SAS more suitable for continuous integration, a reporting mechanism summarising results was added. This suitability has been demonstrated by inclusion of SAS in the Future Circular Collider Software nightly build system. Scalability of the improved package was demonstrated by using the tool to analyse the ROOT code base.

  9. Static multiplicities in heterogeneous azeotropic distillation sequences

    DEFF Research Database (Denmark)

    Esbjerg, Klavs; Andersen, Torben Ravn; Jørgensen, Sten Bay

    1998-01-01

    In this paper the results of a bifurcation analysis on heterogeneous azeotropic distillation sequences are given. Two sequences suitable for ethanol dehydration are compared: The 'direct' and the 'indirect' sequence. It is shown, that the two sequences, despite their similarities, exhibit very...... different static behavior. The method of Petlyuk and Avet'yan (1971), Bekiaris et al. (1993), which assumes infinite reflux and infinite number of stages, is extended to and applied on heterogeneous azeotropic distillation sequences. The predictions are substantiated through simulations. The static sequence...

  10. Static cylindrical symmetry and conformal flatness

    CERN Document Server

    Herrera, L; Marcilhacy, G; Santos, N O

    2004-01-01

    We present the whole set of equations with regularity and matching conditions required for the description of physically meaningful static cylindrically symmmetric distributions of matter, smoothly matched to Levi-Civita vacuum spacetime. It is shown that the conformally flat solution with equal principal stresses represents an incompressible fluid. It is also proved that any conformally flat cylindrically symmetric static source cannot be matched through Darmois conditions to the Levi-Civita spacetime. Further evidence is given that when the Newtonian mass per unit length reaches 1/2 the spacetime has plane symmetry.

  11. QuickChecking Static Analysis Properties

    DEFF Research Database (Denmark)

    Midtgaard, Jan; Møller, Anders

    2015-01-01

    A static analysis can check programs for potential errors. A natural question that arises is therefore: who checks the checker? Researchers have given this question varying attention, ranging from basic testing techniques, informal monotonicity arguments, thorough pen-and-paper soundness proofs......, to verified fixed point checking. In this paper we demonstrate how quickchecking can be useful for testing a range of static analysis properties with limited effort. We show how to check a range of algebraic lattice properties, to help ensure that an implementation follows the formal specification...

  12. MEMS linear and nonlinear statics and dynamics

    CERN Document Server

    Younis, Mohammad I

    2011-01-01

    MEMS Linear and Nonlinear Statics and Dynamics presents the necessary analytical and computational tools for MEMS designers to model and simulate most known MEMS devices, structures, and phenomena. This book also provides an in-depth analysis and treatment of the most common static and dynamic phenomena in MEMS that are encountered by engineers. Coverage also includes nonlinear modeling approaches to modeling various MEMS phenomena of a nonlinear nature, such as those due to electrostatic forces, squeeze-film damping, and large deflection of structures. The book also: Includes examples of nume

  13. Static and dynamic properties of Fibonacci multilayers

    Science.gov (United States)

    Machado, L. D.; Bezerra, C. G.; Correa, M. A.; Chesman, C.; Pearson, J. E.; Hoffmann, A.

    2013-05-01

    We theoretically investigate static and dynamic properties of quasiperiodic magnetic multilayers. We considered identical ferromagnetic layers separated by non-magnetic spacers with two different thicknesses chosen based on the Fibonacci sequence. Using parameters for Fe/Cr, the minimum energy was determined and the equilibrium magnetization directions found were used to calculate magnetoresistance curves. Regarding dynamic behavior, ferromagnetic resonance (FMR) curves were calculated using an approximation known from the literature. Our numerical results illustrate the effects of quasiperiodicity on the static and dynamic properties of these structures.

  14. Static compensators (STATCOMs) in power systems

    CERN Document Server

    Shahnia, Farhad; Ghosh, Arindam

    2014-01-01

    A static compensator (STATCOM), also known as static synchronous compensator, is a member of the flexible alternating current transmission system (FACTS) devices. It is a power-electronics based regulating device which is composed of a voltage source converter (VSC) and is shunt-connected to alternating current electricity transmission and distribution networks. The voltage source is created from a DC capacitor and the STATCOM can exchange reactive power with the network. It can also supply some active power to the network, if a DC source of power is connected across the capacitor. A STATCOM

  15. Static Theory for Planar Ferromagnets and Antiferromagnets

    Institute of Scientific and Technical Information of China (English)

    Feng Bo HANG; Fang Hua LIN

    2001-01-01

    Here we generalize the "BBH"-asymptotic analysis to a simplified mathematical model for the planar ferromagnets and antiferromagncts. To develop such a static theory is a necessary step for a rigorous mathematical justification of dynamical laws for the magnetic vortices formally derived in [1] and [2].

  16. Structural Encoding of Static Single Assignment Form

    DEFF Research Database (Denmark)

    Gal, Andreas; Probst, Christian; Franz, Michael

    2005-01-01

    Static Single Assignment (SSA) form is often used as an intermediate representation during code optimization in Java Virtual Machines. Recently, SSA has successfully been used for bytecode verification. However, constructing SSA at the code consumer is costly. SSAbased mobile code transport formats...

  17. Monotone Comparative Statics for the Industry Composition

    DEFF Research Database (Denmark)

    Laugesen, Anders Rosenstand

    2015-01-01

    We let heterogeneous firms face decisions on a number of complementary activities in a monopolistically-competitive industry. The endogenous level of competition and selection regarding entry and exit of firms introduces a wedge between monotone comparative statics (MCS) at the firm level and MCS...

  18. Static Validation of a Voting Protocol

    DEFF Research Database (Denmark)

    Nielsen, Christoffer Rosenkilde; Andersen, Esben Heltoft; Nielson, Hanne Riis

    2005-01-01

    The desired security properties of electronic voting protocols include verifiability, accuracy, democracy and fairness. In this paper we use a static program analysis tool to validate these properties for one of the classical voting protocols under appropriate assumptions. The protocol is formali...

  19. Static Typing for Object-Oriented Programming

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    1994-01-01

    We develop a theory of statically typed object-oriented languages. It represents classes as labeled, regular trees, types as finit sets of classes , and sub-classing as a partial order on trees. We show that our sub-classing order strictly generalizes inheritance, and that a novel genericity...

  20. The longitudinal static stability of tailless aircraft

    OpenAIRE

    de Castro, Helena V.

    2001-01-01

    This paper describes the development of a simple theory of the longitudinal controls fixed static stability of tailless aeroplanes. The classical theory, as developed for the conventional aircraft, is modified to accommodate the particular features of the tailless aeroplanes. The theory was then applied to a particular blended-wing-body tailless civil transport aircraft, BWB-98. Cranfield University

  1. A Logical Characterisation of Static Equivalence

    DEFF Research Database (Denmark)

    Hüttel, Hans; Pedersen, Michael D.

    2007-01-01

    The work of Abadi and Fournet introduces the notion of a frame to describe the knowledge of the environment of a cryptographic protocol. Frames are lists of terms; two frames are indistinguishable under the notion of static equivalence if they satisfy the same equations on terms. We present a first...

  2. Static shapes of levitated viscous drops

    Science.gov (United States)

    Duchemin, L.; Lister, J. R.; Lange, U.

    2005-06-01

    We consider the levitation of a drop of molten glass above a spherical porous mould, through which air is injected with constant velocity. The glass is assumed to be sufficiently viscous compared to air that motion in the drop is negligible. Thus static equilibrium shapes are determined by the coupling between the lubricating pressure in the supporting air cushion and the Young-Laplace equation. The upper surface of the drop is under constant atmospheric pressure; the static shape of the lower surface of the drop is computed using lubrication theory for the thin air film. Matching of the sessile curvature of the upper surface to the curvature of the mould gives rise to a series of capillary "brim" waves near the edge of the drop which scale with powers of a modified capillary number. Several branches of static solutions are found, such that there are multiple solutions for some drop volumes, but no physically reasonable solutions for other drop volumes. Comparison with experiments and full Navier-Stokes calculations suggests that the stability of the process can be predicted from the solution branches for the static shapes, and related to the persistence of brim waves to the centre of the drop. This suggestion remains to be confirmed by a formal stability analysis.

  3. Effects of insoles contact on static balance.

    Science.gov (United States)

    Shin, Ju Yong; Ryu, Young Uk; Yi, Chae Woo

    2016-04-01

    [Purpose] This study examined the effect of the degree of the contact area between the insoles and soles on static balance. [Subjects and Methods] Thirteen healthy male and female adults voluntarily participated. All of the subjects wore three different types of insoles (no orthotic insole, partial contact, full contact) in the present experiment. The subjects were instructed to place both feet parallel to each other and maintain static balance for 30 seconds. Center of pressure parameters (range, total distance, and mean velocity) were analyzed. [Results] The results show that the anteroposterior range and mediolateral (ML) total distance and velocity decreased when orthotic insoles with partial contact or full contact were used in comparison to when a flat insole (no orthotic insole) was used. Also, the ML range and total distance were lower with full contact than in the other two conditions. These results indicate that static balance improves as the degree of contact between the soles and insoles increases. [Conclusion] The results of this study suggests that using insoles with increased sole contact area would improve static balance ability.

  4. Hall effect accompanying a static skin effect

    Energy Technology Data Exchange (ETDEWEB)

    Volkenshtein, N.V.; Marchenkov, V.V.; Startsev, V.E.; Cherepanov, A.N.; Glin' skii, M.

    1985-05-10

    The Hall effect and the magnetoresistance of tungsten single crystals with rho/sub 293K//rho/sub 4.2K/ = 80 000 have been measured at 4.2 K in magnetic fields up to 150 kOe. The results reveal that a static skin effect gives rise to an anomalously pronounced increase in the Hall coefficient.

  5. The atomic and molecular reaction statics

    Institute of Scientific and Technical Information of China (English)

    ZHU; ZhengHe

    2007-01-01

    This work presents a new science called atomic and molecular reaction statics (AMRS). There are four parts for AMRS, i.e. the group theoretical derivation of molecular electronic states, the principle of microscopic reversibility, the principle of microscopic transitivity and the optimum energy process rule. AMRS has been developed for about twenty years.

  6. Static Analysis for Java Servlets and JSP

    DEFF Research Database (Denmark)

    Kirkegaard, Christian; Møller, Anders

    2006-01-01

    We present an approach for statically reasoning about the behavior of Web applications that are developed using Java Servlets and JSP. Specifically, we attack the problems of guaranteeing that all output is well-formed and valid XML and ensuring consistency of XHTML form fields and session state...

  7. Energy consumption in static muscle contraction

    NARCIS (Netherlands)

    Koerhuis, CL; Hof, AL; van der Heide, F.M.

    2003-01-01

    Energy consumption during static contraction of the human triceps surae muscles was studied in 11 healthy subjects. The subjects had to stand intermittently on the left and then right foot at different frequencies (for periods of 15 s, 10 s or 5 s), first on the whole foot and then on the forefoot.

  8. Forces between static-light mesons

    CERN Document Server

    Wagner, Marc

    2010-01-01

    The isospin, spin and parity dependent potential of a pair of static-light mesons is computed using Wilson twisted mass lattice QCD with two flavors of degenerate dynamical quarks. From the results a simple rule can be deduced stating, which isospin, spin and parity combinations correspond to attractive and which to repulsive forces.

  9. Automatic incrementalization of Prolog based static analyses

    DEFF Research Database (Denmark)

    Eichberg, Michael; Kahl, Matthias; Saha, Diptikalyan;

    2007-01-01

    Modem development environments integrate various static analyses into the build process. Analyses that analyze the whole project whenever the project changes are impractical in this context. We present an approach to automatic incrementalization of analyses that are specified as tabled logic prog...

  10. Energy consumption in static muscle contraction

    NARCIS (Netherlands)

    Koerhuis, CL; Hof, AL; van der Heide, F.M.

    Energy consumption during static contraction of the human triceps surae muscles was studied in 11 healthy subjects. The subjects had to stand intermittently on the left and then right foot at different frequencies (for periods of 15 s, 10 s or 5 s), first on the whole foot and then on the forefoot.

  11. Onthe static and spherically symmetric gravitational field

    Science.gov (United States)

    Gottlieb, Ioan; Maftei, Gheorghe; Mociutchi, Cleopatra

    Starting from a generalization of Einstein 's theory of gravitation, proposed by one of the authors (Cleopatra Mociutchi), the authors study a particular spherical symmetric case. Among other one obtain the compatibility conditions for the existence of the static and spherically symmetruic gravitational filed in the case of extended Einstein equation.

  12. New schemes of static mass spectrometers

    Energy Technology Data Exchange (ETDEWEB)

    Baisanov, O.A. [Military Institute of Air Defense Forces, Aktobe (Kazakhstan); Doskeyev, G.A. [Aktobe State University named after K. Zhubanov, Aktobe (Kazakhstan); Spivak-Lavrov, I.F., E-mail: baisanov@mail.ru [Aktobe State University named after K. Zhubanov, Aktobe (Kazakhstan)

    2011-07-21

    Different possibilities to increase the 'quality', or Q-quantity, of static mass spectrometers by expanding the ion beam before it enters the magnetic field are analyzed. The design of mass spectrometers using a cone-shaped achromatic prism is discussed. Different variants of achromatic mass spectrometers using electrostatic prisms and sector magnetic fields are also considered.

  13. Static, Lightweight Includes Resolution for PHP

    NARCIS (Netherlands)

    Hills, M.A.; Klint, P.; Vinju, J.J.

    2014-01-01

    Dynamic languages include a number of features that are challenging to model properly in static analysis tools. In PHP, one of these features is the include expression, where an arbitrary expression provides the path of the file to include at runtime. In this paper we present two complementary analy

  14. Static and Dynamic Analysis of a Pump Impeller with a Balancing Device Part I: Static Analysis

    Directory of Open Access Journals (Sweden)

    Kundera C.

    2014-08-01

    Full Text Available This part of the work presents the design and static analysis of an impeller for a single-stage pump. The impeller is directly connected with a balancing device. The impeller needs to have a properly designed system of longitudinal and lateral clearances on both sides. With the simplifying assumptions concerning the flow and distribution of pressure in the longitudinal and lateral clearances, the static analysis involved deriving relationships between the impeller geometry and the basic performance parameters of the pump. A numerical example was used to show the calculation procedure of static characteristics for the predetermined parameters

  15. 49 CFR Appendix H to Part 229 - Static Noise Test Protocols-In-Cab Static

    Science.gov (United States)

    2010-10-01

    ... for the in-cab static measurements of locomotives. I. Measurement Instrumentation The instrumentation... electronic form. (1) Name(s) of persons conducting the test, and the date of the test. (2) Description...

  16. Static Checking of Interrupt-driven Software

    DEFF Research Database (Denmark)

    Brylow, Dennis; Damgaard, Niels; Palsberg, Jens

    2001-01-01

    in a few seconds on a standard PC. Our tool is one of the first to give an efficient and useful static analysis of assembly code. It enables increased confidence in correctness, significantly reduced testing requirements, and support for maintenance throughout the system life-cycle....... require extensive brute-force testing, making development and maintenance costly. This is particularly true for system components that are written in assembly language. Static checking has the potential of alleviating these problems, but until now there has been little tool support for programming...... fundamental safety and liveness properties. Our approach is based on a known algorithm for model checking of pushdown systems, and produces a control-flow graph annotated with information about time, space, safety, and liveness. Each benchmark is approximately 1000 lines of code, and the checking is done...

  17. Perturbative static four-quark potentials

    CERN Document Server

    Lang, J; Green, A M

    1995-01-01

    A first attempt to understand hadron dynamics at low energies in terms of the fundamental quark and gluon degrees of freedom incorporates the effects of the gluonic field into a potential depending only on the spatial positions of the quarks, which are considered in the infinite mass limit. A suitable framework for calculating such potentials between static quarks, i.e.\\ a generalization of the Wilson loop will be discussed. Making a connection with recent Monte Carlo lattice simulations for the lowest two energies of a system of two quarks and two antiquarks, the static qq\\bar{q}\\bar{q}-potential will be calculated in perturbation theory to fourth order. The result will be shown to be exactly equal to the prediction of a straightforward two-body approach, which in Monte Carlo lattice simulations has been found to be a reasonable approximation for very small interquark distances.

  18. Static inelastic analysis of RC shear walls

    Science.gov (United States)

    Chen, Qin; Qian, Jiaru

    2002-06-01

    A macro-model of a reinforced concrete (RC) shear wall is developed for static inelastic analysis. The model is composed of RC column elements and RC membrane elements. The column elements are used to model the boundary zone and the membrane elements are used to model the wall panel. Various types of constitutive relationships of concrete could be adopted for the two kinds of elements. To perform analysis, the wall is divided into layers along its height. Two adjacent layers are connected with a rigid beam. There are only three unknown displacement components for each layer. A method called single degree of freedom compensation is adopted to solve the peak value of the capacity curve. The post-peak stage analysis is performed using a forced iteration approach. The macro-model developed in the study and the complete process analysis methodology are verified by the experimental and static inelastic analytical results of four RC shear wall specimens.

  19. Power analysis of static VAr compensators

    Energy Technology Data Exchange (ETDEWEB)

    Quintela, F.R.; Arevalo, J.M.G.; Redondo, R.C. [Escuela Tecnica Superior de Ingenieria Industrial, Universidad de Salamanca, 37700 Bejar (Spain)

    2008-07-15

    Analysis of three-phase loads usually assume them to be three impedances in a star or triangle connection. This is the reason why obtained results can only be considered valid for passive loads, strictly speaking. Analysis leading to the proposal of some static compensators is usually performed in this way, which induces to believe that this compensators are only valid for passive loads. An analysis procedure, which uses only powers to describe loads, is expounded in this paper. If applied to the analysis of static compensators, it reveals unequivocally their usefulness with active and passive three-phase loads. Therefore, this method is more general and, as it will be seen, easier. (author)

  20. Observational evidence favours a static universe

    CERN Document Server

    Crawford, David F

    2010-01-01

    The common attribute of all Big Bang cosmologies is that they are based on the assumption that the universe is expanding. However examination of the evidence for this expansion clearly favours a static universe. The major topics considered are: Tolman surface brightness, angular size, type 1a supernovae, gamma ray bursts, galaxy distributions, quasar distributions, X-ray background radiation, cosmic microwave background radiation, radio source counts, quasar variability and the Butcher--Oemler effect. An analysis of the best raw data for these topics shows that they are consistent with expansion only if there is evolution that cancels the effects of expansion. An alternate cosmology, curvature cosmology, is in full agreement with the raw data. This tired-light cosmology predicts a well defined static and stable universe and is fully described. It not only predicts accurate values for the Hubble constant and the temperature of cosmic microwave background radiation but shows excellent agreement with most of the...

  1. Optimal Static Range Reporting in One Dimension

    DEFF Research Database (Denmark)

    Alstrup, Stephen; Brodal, Gerth Stølting; Rauhe, Theis

    2001-01-01

    We consider static one dimensional range searching problems. These problems are to build static data structures for an integer set S \\subseteq U, where U = \\{0,1,\\dots,2^w-1\\}, which support various queries for integer intervals of U. For the query of reporting all integers in S contained within...... a query interval, we present an optimal data structure with linear space cost and with query time linear in the number of integers reported. This result holds in the unit cost RAM model with word size w and a standard instruction set. We also present a linear space data structure for approximate range...... counting. A range counting query for an interval returns the number of integers in S contained within the interval. For any constant &egr;>0, our range counting data structure returns in constant time an approximate answer which is within a factor of at most 1+&egr; of the correct answer....

  2. Static inelastic analysis of RC shear walls

    Institute of Scientific and Technical Information of China (English)

    陈勤; 钱稼茹

    2002-01-01

    A macro-model of a reinforced concrete (RC) shear wall is developed for static inelastic analysis. The model iscomposed of RC column elements and RC membrane elements. The column elements are used to model the boundary zone andthe membrane elements are used to model the wall panel. Various types of constitutive relationships of concrete could beadopted for the two kinds of elements. To perform analysis, the wall is divided into layers along its height. Two adjacent layersare connected with a rigid beam. There are only three unknown displacement components for each layer. A method called singledegree of freedom compensation is adopted to solve the peak value of the capacity curve. The post-peak stage analysis isperformed using a forced iteration approach. The macro-model developed in the study and the complete process analysismethodology are verified by the experimental and static inelastic analytical results of four RC shear wall specimens.

  3. Variational approach for static mirror structures

    Energy Technology Data Exchange (ETDEWEB)

    Kuznetsov, E. A. [P.N. Lebedev Physical Institute RAS, 53 Leninsky Ave., 119991 Moscow (Russian Federation); Space Research Institute RAS, 84/32 Profsoyuznaya str., 117997 Moscow (Russian Federation); L.D. Landau Institute for Theoretical Physics RAS, 2 Kosygin str., 119334 Moscow (Russian Federation); Passot, T.; Sulem, P. L. [UNS, CNRS, Observatoire de la Côte d' Azur, CS 34229, 06304 Nice Cedex 4 (France); Ruban, V. P. [L.D. Landau Institute for Theoretical Physics RAS, 2 Kosygin str., 119334 Moscow (Russian Federation)

    2015-04-15

    Anisotropic static plasma equilibria where the parallel and perpendicular pressures are only functions of the amplitude of the local magnetic field are shown to be amenable to a variational principle with a free energy density given by the parallel tension. This approach is used to demonstrate that two-dimensional small-amplitude static magnetic holes constructed from a Grad-Shafranov type equation slightly below the (subcritical) mirror instability threshold identify with lump solitons of KPII equation, but turn out to be unstable. Differently, large-amplitude magnetic structures, which are stable as they realize a minimum of the free energy, are computed using a gradient method within two-dimensional numerical simulations where the regularizing effect of finite Larmor radius corrections is retained. Interestingly, these structures transform from stripes to bubbles when the angle of the magnetic field with the coordinate plane is increased.

  4. Quasi-Static Electric Field Generator

    Science.gov (United States)

    Generazio, Edward R. (Inventor)

    2017-01-01

    A generator for producing an electric field for with an inspection technology system is provided. The generator provides the required variable magnitude quasi-static electric fields for the "illumination" of objects, areas and volumes to be inspected by the system, and produces human-safe electric fields that are only visible to the system. The generator includes a casing, a driven, non-conducting and triboelectrically neutral rotation shaft mounted therein, an ungrounded electrostatic dipole element which works in the quasi-static range, and a non-conducting support for mounting the dipole element to the shaft. The dipole element has a wireless motor system and a charging system which are wholly contained within the dipole element and the support that uses an electrostatic approach to charge the dipole element.

  5. Static spherically symmetric wormholes with isotropic pressure

    CERN Document Server

    Cataldo, Mauricio; Rodríguez, Pablo

    2016-01-01

    In this paper we study static spherically symmetric wormhole solutions sustained by matter sources with isotropic pressure. We show that such spherical wormholes do not exist in the framework of zero-tidal-force wormholes. On the other hand, it is shown that for the often used power-law shape function there is no spherically symmetric traversable wormholes sustained by sources with a linear equation of state $p=\\omega \\rho$ for the isotropic pressure, independently of the form of the redshift function $\\phi(r)$. We consider a solution obtained by Tolman at 1939 for describing static spheres of isotropic fluids, and show that it also may describe wormhole spacetimes with a power-law redshift function, which leads to a polynomial shape function, generalizing a power-law shape function, and inducing a solid angle deficit.

  6. The effect of deforestation and land-use changes on CO2 and H2O exchange between land surface and the atmosphere in the Upper Volga area in Russia

    Science.gov (United States)

    Olchev, Alexander; Kurbatova, Juliya; Mukhartova, Juliya; Molchanov, Alexander; Konstantinov, Pavel; Levashova, Natalia; Avilov, Vitaliy; Sandlersky, Robert; Belotelov, Nikolay; Novenko, Elena

    2016-04-01

    The main goal of the study to describe the possible impact of deforestation (or/and afforestation) and land-use changes in the Upper Volga area in European Russia on regional fluxes of sensible heat, H2O and CO2 between a land surface and the atmosphere as well as on regional climate conditions. This is experimental and modeling study that integrates intensive field campaigns to derive the spatial and temporal variability of H2O and CO2 fluxes at the local ecosystem scale, analysis and interpretation of remote sensing data, development and application of local scale process-based 2D and 3D turbulent transfer models to quantify atmospheric fluxes, analysis of paleogeographical data to reconstruct vegetation dynamics in past epochs and its interaction with climatic conditions, application of mesoscale models to derive the possible influence of deforestation and land-use changes on regional climate under present and projected future climate conditions. To describe the difference in the H2O and CO2 exchange between anthropogenically changed (e.g. a clear-cut area) and undisturbed forest the eddy covariance measurements was applied. The spatial heterogeneity of soil respiration within the clear-cut area and surrounding forest the chamber method was used. In particular it was shown during the field measurements that the soil CO2 emission from clear-cut plots is significantly exceed CO2 emission rate from control plots within surrounding forest. For all plots it was shown a well manifested seasonal course of soil respiration and quite small amplitude of its diurnal variability. It was revealed a close dependence of soil CO2 emission from temperature and moisture of the upper soil horizon. It was found that the plots with various damage degrees of the upper soil horizon, and non-damaged soil covered with a litter and felling remains are characterized by different respiration rates and different dependences on environmental factors. To assess the influence of clear cuttings

  7. Geodesics in the static Mallett spacetime

    CERN Document Server

    Olum, Ken D

    2010-01-01

    Mallett has exhibited a cylindrically symmetric spacetime containing closed timelike curves produced by a light beam circulating around a line singularity. I analyze the static version of this spacetime obtained by setting the intensity of the light to zero. Some null geodesics can escape to infinity, but all timelike geodesics in this spacetime originate and terminate at the singularity. Freely falling matter originally at rest quickly attains relativistic velocity inward and is destroyed at the singularity.

  8. Static Gauge Potential from Noncritical Strings

    CERN Document Server

    Alvarez, Enrique; Alvarez, Enrique; Manjarin, Juan Jose

    2001-01-01

    The static gauge potential between heavy sources is computed from a recently introduced non-critical bosonic string background. When the sources are located at the infinity of the holographic coordinate, the linear dilaton behavior is recovered, which means that the potential is exactly linear in the separation between the sources. When the sources are moved towards the origin, a competing overconfining cubic branch appears, which is however disfavored energetically.

  9. Non-self-dual static gauge fields

    Science.gov (United States)

    Oh, C. H.; Teh, Rosy

    1980-01-01

    We exhibit exact non-self-dual static solutions to the SU(2) Yang-Mills field equations by solving the equation ∇2V+λV3=0 using cylindrical and spherical coordinates. The resulting gauge fields are complex and have singularities. For the cylindrically symmetric solution, we convert it into a real gauge field coupled to the Higgs field in the limit in which the self-interaction potential of the Higgs field vanishes.

  10. Comparing numerically exact and modelled static friction

    Directory of Open Access Journals (Sweden)

    Krengel Dominik

    2017-01-01

    Full Text Available Currently there exists no mechanically consistent “numerically exact” implementation of static and dynamic Coulomb friction for general soft particle simulations with arbitrary contact situations in two or three dimension, but only along one dimension. We outline a differential-algebraic equation approach for a “numerically exact” computation of friction in two dimensions and compare its application to the Cundall-Strack model in some test cases.

  11. numerical and numerical and experimental modeling of the static ...

    African Journals Online (AJOL)

    eobe

    flange width on the static response of these type of structural elements under service load ... walled reinforced concrete box girder bridges under .... [15] carried out a static live-load test of a ... accurately predicts the exterior girder distribution.

  12. Static Consistency Checking of Web Applications with WebDSL

    NARCIS (Netherlands)

    Hemel, Z.; Groenewegen, D.M.; Kats, L.C.L.; Visser, E.

    2010-01-01

    Modern web application development frameworks provide web application developers with highlevel abstractions to improve their productivity. However, their support for static verification of applications is limited. Inconsistencies in an application are often not detected statically, but appear as

  13. Static Consistency Checking of Web Applications with WebDSL

    NARCIS (Netherlands)

    Hemel, Z.; Groenewegen, D.M.; Kats, L.C.L.; Visser, E.

    2010-01-01

    Modern web application development frameworks provide web application developers with highlevel abstractions to improve their productivity. However, their support for static verification of applications is limited. Inconsistencies in an application are often not detected statically, but appear as er

  14. Static Versus Dynamic Stretching Effect on Agility Performance

    OpenAIRE

    Troumbley, Patrick

    2010-01-01

    The purpose of this study was to compare effects of static and dynamic stretching on explosive agility movements, and to examine the effect of the interaction of dynamic and static stretching prior to explosive agility movements. Fourteen men and 10 women performed the different warm-up protocols, including no warm-up (NWU), static stretching (SS), dynamic stretching (DS), and dynamic stretching with static stretching (DS+SS). The T-Drill was used to assess agility. The results indicated n...

  15. Person Identification System using Static-dynamic signatures fusion

    OpenAIRE

    S.A Daramola; T.S Ibiyemi

    2010-01-01

    Off-line signature verification systems rely on static image of signature for person identification. Imposter can easily imitate the static image of signature of the genuine user due to lack of dynamic features. This paper proposes person identity verification system using fused static-dynamic signature features. Computational efficient technique is developed to extract and fuse static and dynamic features extracted from offline and online signatures of the same person. The training stage use...

  16. 14 CFR 33.64 - Pressurized engine static parts.

    Science.gov (United States)

    2010-01-01

    ... engine static parts. (a) Strength. The applicant must establish by test, validated analysis, or a combination of both, that all static parts subject to significant gas or liquid pressure loads for a... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Pressurized engine static parts....

  17. 14 CFR 25.1325 - Static pressure systems.

    Science.gov (United States)

    2010-01-01

    ... pressure systems. (a) Each instrument with static air case connections must be vented to the outside... or other foreign matter, and that the correlation between air pressure in the static pressure system... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Static pressure systems. 25.1325 Section 25...

  18. 14 CFR 27.1325 - Static pressure systems.

    Science.gov (United States)

    2010-01-01

    ... pressure systems. (a) Each instrument with static air case connections must be vented so that the influence... located in such manner that the correlation between air pressure in the static pressure system and true... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Static pressure systems. 27.1325 Section 27...

  19. 14 CFR 27.610 - Lightning and static electricity protection.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Lightning and static electricity protection....610 Lightning and static electricity protection. (a) The rotorcraft must be protected against... static electricity must— (1) Minimize the accumulation of electrostatic charge; (2) Minimize the risk of...

  20. 30 CFR 56.6602 - Static electricity dissipation during loading.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Static electricity dissipation during loading... Explosives Extraneous Electricity § 56.6602 Static electricity dissipation during loading. When explosive material is loaded pneumatically into a blasthole in a manner that generates a static electricity hazard...

  1. 49 CFR 238.203 - Static end strength.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Static end strength. 238.203 Section 238.203... Equipment § 238.203 Static end strength. (a)(1) Except as further specified in this paragraph or in.... (2) For a passenger car or a locomotive, the static end strength of unoccupied volumes may be...

  2. The Static Ladder Problem with Two Sources of Friction

    Science.gov (United States)

    Bennett, Jonathan; Mauney, Alex

    2011-01-01

    The problem of a ladder leaning against a wall in static equilibrium is a classic example encountered in introductory mechanics texts. Most discussions of this problem assume that the static frictional force between the ladder and wall can be ignored. A few authors consider the case where the static friction coefficients between ladder/wall…

  3. The Static Ladder Problem with Two Sources of Friction

    Science.gov (United States)

    Bennett, Jonathan; Mauney, Alex

    2011-01-01

    The problem of a ladder leaning against a wall in static equilibrium is a classic example encountered in introductory mechanics texts. Most discussions of this problem assume that the static frictional force between the ladder and wall can be ignored. A few authors consider the case where the static friction coefficients between ladder/wall…

  4. Static Enforcement of Static Separation-of-Duty Policies in Usage Control Authorization Models

    Science.gov (United States)

    Lu, Jianfeng; Li, Ruixuan; Hu, Jinwei; Xu, Dewu

    Separation-of-Duty (SoD) is a fundamental security principle for prevention of fraud and errors in computer security. It has been studied extensively in traditional access control models. However, the research of SoD policy in the recently proposed usage control (UCON) model has not been well studied. This paper formulates and studies the fundamental problem of static enforcement of static SoD (SSoD) policies in the context of UCONA, a sub-model of UCON only considering authorizations. Firstly, we define a set-based specification of SSoD policies, and the safety checking problem for SSoD in UCONA. Secondly, we study the problem of determining whether an SSoD policy is enforceable. Thirdly, we show that it is intractable (coNP-complete) to direct statically enforce SSoD policies in UCONA, while checking whether a UCONA state satisfies a set of static mutually exclusive attribute (SMEA) constraints is efficient, which provides a justification for using SMEA constraints to enforce SSoD policies. Finally, we introduce a indirect static enforcement for SSoD policies in UCONA. We show how to generate the least restrictive SMEA constraints for enforcing SSoD policies in UCONA, by using the attribute-level SSoD requirement as an intermediate step. The results are fundamental to understanding SSoD policies in UCON.

  5. Assessing Static Performance of the Dashengguan Yangtze Bridge by Monitoring the Correlation between Temperature Field and Its Static Strains

    OpenAIRE

    Gao-Xin Wang; You-Liang Ding; Peng Sun; Lai-Li Wu; Qing Yue

    2015-01-01

    Taking advantage of the structural health monitoring system installed on the steel truss arch girder of Dashengguan Yangtze Bridge, the temperature field data and static strain data are collected and analyzed for the static performance assessment of the bridge. Through analysis, it is found that the static strain changes are mainly caused by temperature field (temperature and temperature difference) and train. After the train-induced static strains are removed, the correlation between the rem...

  6. Monotone Comparative Statics for the Industry Composition

    DEFF Research Database (Denmark)

    Bache, Peter Arendorf; Laugesen, Anders

    for the industry composition. The latter phenomenon is dened as rst-order stochastic dominance shifts in the equilibrium distributions of all activities across active rms. We provide sucient conditions for MCS at both levels of analysis and show that we may have either type of MCS without the other....... It is therefore possible that rm-level complementarities manifest themselves more clearly at the industry level than at the rm level during comparative statics. This turns out to be the case for a large number of models and shocks considered in the recent trade literature for which we provide strong, novel...

  7. Does Acute Static Stretching Reduce Muscle Power?

    Directory of Open Access Journals (Sweden)

    Francis M. Kozub

    2012-12-01

    Full Text Available Context: Stretching is commonly used as a technique for injury prevention in the training and clinical setting. Recently, stretching in the warm-up has been shown to decrease several muscular performance variables, but the dose-response of this effect is unknown and moreover these stretching bouts are not representative of athletes during warm up procedures, as they are usually time consuming. Our findings may improve the understanding of the neuromuscular responses to stretching and help sportsmen, coaches, physiotherapist and clinicians make decisions for integrating stretching as a part of warm up or rehabilitation treatment plan.Purpose: The aim of the present study was to examine whether acute static stretching is responsible for losses in isokinetic peak torque production and if it does, than which time of stretching effect muscle peak torque?Design: Randomized, counterbalanced, within-subjects experimental design.Setting: A university human project laboratory.Methods: Twenty (n=20 light to moderate young exercisers, male and female, from University of Limerick community, with an average age of 22.1±3.6 years, height of 175.6±5 cm, and weight of 73.1±9.9 kg, were randomly selected to take part in the study. Prior to the main study, volunteers attended the lab on two occasions to be familiarized with the knee extension protocol on the Con - trex isokinetic system and with the static stretching protocol. All participants than performed five additional static stretching protocols randomly, in non-consecutive training session. The stretching protocols were 0, 60,120, 180 and 180 with alternative pattern.Results: The results of the statistical analysis (P > 0.05 indicated that peak torque remained unchanged following the static stretching for 0-180 sec at 60 & 180° s−1 angular velocities.Conclusion: The findings suggest that an athletic stretching (shorter duration ranging from 0-180 sec does not produce decreases in peak torque. Athletes

  8. Cancer progression modeling using static sample data.

    Science.gov (United States)

    Sun, Yijun; Yao, Jin; Nowak, Norma J; Goodison, Steve

    2014-01-01

    As molecular profiling data continues to accumulate, the design of integrative computational analyses that can provide insights into the dynamic aspects of cancer progression becomes feasible. Here, we present a novel computational method for the construction of cancer progression models based on the analysis of static tumor samples. We demonstrate the reliability of the method with simulated data, and describe the application to breast cancer data. Our findings support a linear, branching model for breast cancer progression. An interactive model facilitates the identification of key molecular events in the advance of disease to malignancy.

  9. Static aeroelastic analysis for generic configuration wing

    Science.gov (United States)

    Lee, IN; Miura, Hirokazu; Chargin, Mladen K.

    1991-01-01

    A static aeroelastic analysis capability that calculates flexible air loads for generic configuration wings was developed. It was made possible by integrating a finite element structural analysis code (MSC/NASTRAN) and a panel code of aerodynamic analysis based on linear potential flow theory. The framework already built in MSC/NASTRAN was used, and the aerodynamic influence coefficient matrix was computed externally and inserted in the NASTRAN by means of a DMAP program. It was shown that deformation and flexible air loads of an oblique wing configuration including asymmetric wings can be calculated reliably by this code both in subsonic and supersonic speeds.

  10. Compiler-assisted static checkpoint insertion

    Science.gov (United States)

    Long, Junsheng; Fuchs, W. K.; Abraham, Jacob A.

    1992-01-01

    This paper describes a compiler-assisted approach for static checkpoint insertion. Instead of fixing the checkpoint location before program execution, a compiler enhanced polling mechanism is utilized to maintain both the desired checkpoint intervals and reproducible checkpoint 1ocations. The technique has been implemented in a GNU CC compiler for Sun 3 and Sun 4 (Sparc) processors. Experiments demonstrate that the approach provides for stable checkpoint intervals and reproducible checkpoint placements with performance overhead comparable to a previously presented compiler assisted dynamic scheme (CATCH) utilizing the system clock.

  11. Static Analysis for Java Servlets and JSP

    DEFF Research Database (Denmark)

    Kirkegaard, Christian; Møller, Anders

    2006-01-01

    We present an approach for statically reasoning about the behavior of Web applications that are developed using Java Servlets and JSP. Specifically, we attack the problems of guaranteeing that all output is well-formed and valid XML and ensuring consistency of XHTML form fields and session state....... Our approach builds on a collection of program analysis techniques developed earlier in the JWIG and Xact projects, combined with work on balanced context-free grammars. Together, this provides the necessary foundation concerning reasoning about output streams and application control flow....

  12. Relativistic Static Thin Disks of Polarized Matter

    Science.gov (United States)

    Navarro, Anamaria; Lora-Clavijo, F. D.; González, Guillermo A.

    2017-03-01

    An infinite family of exact solutions of the electrovacuum Einstein-Maxwell equations is presented. The family is static, axially symmetric and describe thin disks composed by electrically polarized material in a conformastatic spacetime. The form of the conformastatic metric allows us to write down the metric functions and the electromagnetic potentials in terms of a solution of the Laplace equation. We find a general expression for the surface energy density of the disk, the pressure, the polarization vector, the electromagnetic fields and the velocity rotation for circular orbits. As an example, we present the first model of the family and show the behavior of the different physical variables.

  13. Static Model of Cement Rotary Kiln

    Directory of Open Access Journals (Sweden)

    Omar D. Hernández-Arboleda

    2013-11-01

    Full Text Available In this paper, a static model of cement rotary kilns is proposed. The system model is obtained through polynomial series. The proposed model is contrasted with data of a real plant, where optimal results are obtained. Expected results are measured with respect to the clinker production and the combustible consumption is measured in relation with the consumption calorific. The expected result of the approach is the increase of the profitability of the factory through the decrease of the consumption of the combustible.

  14. QuickChecking Static Analysis Properties

    DEFF Research Database (Denmark)

    Midtgaard, Jan; Møller, Anders

    2015-01-01

    , to verified fixed point checking. In this paper we demonstrate how quickchecking can be useful for testing a range of static analysis properties with limited effort. We show how to check a range of algebraic lattice properties, to help ensure that an implementation follows the formal specification...... of a lattice. Moreover, we offer a number of generic, type-safe combinators to check transfer functions and operators on lattices, to help ensure that these are, e.g., monotone, strict, or invariant. We substantiate our claims by quickchecking a type analysis for the Lua programming language...

  15. Static analysis of software the abstract interpretation

    CERN Document Server

    Boulanger, Jean-Louis

    2013-01-01

    The existing literature currently available to students and researchers is very general, covering only the formal techniques of static analysis. This book presents real examples of the formal techniques called ""abstract interpretation"" currently being used in various industrial fields: railway, aeronautics, space, automotive, etc. The purpose of this book is to present students and researchers, in a single book, with the wealth of experience of people who are intrinsically involved in the realization and evaluation of software-based safety critical systems. As the authors are people curr

  16. Statics and dynamics of fluids in nanotubes

    CERN Document Server

    Gouin, Henri

    2013-01-01

    The purpose of this article is to study the statics and dynamics of nanotubes by using the methods of continuum mechanics. The nanotube can be filled with only a liquid or a vapour phase according to the physicochemical characteristics of the wall and to the disjoining pressure associated with the liquid and vapour mother bulks of the fluid, regardless of the nature of the external mother bulk. In dynamics, flows through nanotubes can be much more important than classical Poiseuille flows. When the external mother bulk is of vapour, the flow can be a million times larger than the classical flows when slippage on wall does not exist.

  17. Management of Statically Modifiable Prolog Code

    Institute of Scientific and Technical Information of China (English)

    张晨曦; 慈云桂

    1989-01-01

    The Warren Abstract Machine is an efficient execution model for Prolog,which has become the basis of many high performance Prolog systems.However.little support for the implementation of the non-logical components of Prolog is provided in the WAM.The original Warren code is not modifiable.In this paper,we show how static modifications of Warren code can be achieved by adding a few instructions and a little extra information to the code.The implementation of the code manager is discussed.Algorithms for some basic operations are given.

  18. STATIC AND DYNAMIC THEORIES OF LIQUID CRYSTALS

    Institute of Scientific and Technical Information of China (English)

    林芳华; 刘春

    2001-01-01

    The study of liquid crystals givesrise to many fascinating but difficult mathematical problems. The purpose of this paper is to briefly summarize some recent advances, as well as to describe the present state of art of the theory of liquid crystals.For the static theory, we emphasis on the theory of defects and the theory of Smectic A materials. We will also study the Ericksen-Leslie theory for the liquid crystal flow.The well-posedness as well as the motion of the defects will be discussed.

  19. Static validation of licence conformance policies

    DEFF Research Database (Denmark)

    Hansen, Rene Rydhof; Nielson, Flemming; Nielson, Hanne Riis

    2008-01-01

    Policy conformance is a security property gaining importance due to commercial interest like Digital Rights Management. It is well known that static analysis can be used to validate a number of more classical security policies, such as discretionary and mandatory access control policies, as well...... as communication protocols using symmetric and asymmetric cryptography. In this work we show how to develop a Flow Logic for validating the conformance of client software with respect to a licence conformance policy. Our approach is sufficiently flexible that it extends to fully open systems that can admit new...

  20. Cross-ocean GPS long distance rapid static positioning methods

    Directory of Open Access Journals (Sweden)

    Zhang Jie

    2013-02-01

    Full Text Available The method of cross-ocean GPS long distance rapid static positioning has become one of the main technical means of GPS static positioning away from the mainland. The key technology had been analyzed including data preprocessing and quality control, long distance integer ambiguity resolution and static Kalman filter parameter estimation. Effective data processing method of cross-ocean GPS long baseline rapid static positioning had been proposed. Through the analysis of practical examples of coastal and ocean, the feasibility of cross-ocean GPS long distance rapid static positioning based on the method is testified and verified. The results show that the accuracy of one-hour single baseline static positioning for the 500–600 km distance can be better than 10 cm in the three-dimensional coordinates, which can suffice static positioning accuracy in the special ocean environment.

  1. Nepticulidae from the Volga and Ural region

    NARCIS (Netherlands)

    Nieukerken, van E.J.; Zolotuhin, V.V.; Mistchenko, A.

    2004-01-01

    Abstract. The Nepticulidae of the Russian provinces (oblasts) Ul’yanovsk, Samara, Saratov, Volgograd, Astrakhan and Chelyabinsk and the Kalmyk Republic are listed. We record 60 species, including two only previously recorded, 28 species only on the basis of leafmines (indicated with an *). Seventeen

  2. Robot-Crawler: Statically Balanced Gaits

    Directory of Open Access Journals (Sweden)

    S. Parasuraman

    2012-12-01

    Full Text Available This paper presents a new statically balanced walking technique for a robot‐crawler. The gait design and the control of the robot crawler aim to achieve stability while walking. This statically balanced gait has to be designed in a different fashion to a wheeled robot, as there are discrete changes in the support of the robot when its legs are lifted or placed on the ground. The stability of the robot depends on how the legs are positioned relative to the body and also on the sequence and timing with which the legs are lifted and placed. In order to reduce the risk of stability loss while walking, a measure for the robot stability (so‐called stability margin is typically used in the gait and motion planning. In this paper different biological behaviours of four‐legged animals are studied and mapped on a quad-legrobot‐crawler. Experiments were carried out on the forward walking gaits of lizards and horses. Based on these results, the stability margins of different gaits are discussed and compared.

  3. Static Code Analysis with Gitlab-CI

    CERN Document Server

    Datko, Szymon Tomasz

    2016-01-01

    Static Code Analysis is a simple but efficient way to ensure that application’s source code is free from known flaws and security vulnerabilities. Although such analysis tools are often coming with more advanced code editors, there are a lot of people who prefer less complicated environments. The easiest solution would involve education – where to get and how to use the aforementioned tools. However, counting on the manual usage of such tools still does not guarantee their actual usage. On the other hand, reducing the required effort, according to the idea “setup once, use anytime without sweat” seems like a more promising approach. In this paper, the approach to automate code scanning, within the existing CERN’s Gitlab installation, is described. For realization of that project, the Gitlab-CI service (the “CI” stands for "Continuous Integration"), with Docker assistance, was employed to provide a variety of static code analysers for different programming languages. This document covers the gene...

  4. On static Poincar\\'e-Einstein metrics

    CERN Document Server

    Galloway, Gregory J

    2015-01-01

    The classification of solutions of the static vacuum Einstein equations, on a given closed manifold or an asymptotically flat one, is a long-standing and much-studied problem. Solutions are characterized by a complete Riemannian $n$-manifold $(M,g)$ and a positive function $N$, called the lapse. We study this problem on Asymptotically Poincar\\'e-Einstein $n$-manifolds, $n\\ge 3$, when the conformal boundary-at-infinity is either a round sphere, a flat torus or smooth quotient thereof, or a compact hyperbolic manifold. Such manifolds have well-defined Wang mass, and are time-symmetric slices of static, vacuum, asymptotically anti-de Sitter spacetimes. By integrating a mildly generalized form of an identity first found by Wang, we give a mass formula for such manifolds. There are no solutions with positive mass. In consequence, we observe that either the lapse is trivial and $(M,g)$ is Poincar\\'e-Einstein or the Wang mass is negative, as in the case of time symmetric slices of the AdS soliton. As an application,...

  5. Static non-reciprocity in mechanical metamaterials

    Science.gov (United States)

    Coulais, Corentin; Sounas, Dimitrios; Alù, Andrea

    2017-02-01

    Reciprocity is a general, fundamental principle governing various physical systems, which ensures that the transfer function—the transmission of a physical quantity, say light intensity—between any two points in space is identical, regardless of geometrical or material asymmetries. Breaking this transmission symmetry offers enhanced control over signal transport, isolation and source protection. So far, devices that break reciprocity (and therefore show non-reciprocity) have been mostly considered in dynamic systems involving electromagnetic, acoustic and mechanical wave propagation associated with fields varying in space and time. Here we show that it is possible to break reciprocity in static systems, realizing mechanical metamaterials that exhibit vastly different output displacements under excitation from different sides, as well as one-way displacement amplification. This is achieved by combining large nonlinearities with suitable geometrical asymmetries and/or topological features. In addition to extending non-reciprocity and isolation to statics, our work sheds light on energy propagation in nonlinear materials with asymmetric crystalline structures and topological properties. We anticipate that breaking reciprocity will open avenues for energy absorption, conversion and harvesting, soft robotics, prosthetics and optomechanics.

  6. Plate shell structures - statics and stability

    DEFF Research Database (Denmark)

    Almegaard, Henrik

    2008-01-01

    This paper describes the basic structural system, statics and spatial stability of plate shells. The structural system can be considered as a single layer of planar elements, where each element only transfers in-plane (membrane) forces to its neighbouring elements. External out-of-plane loads...... are carried into the structure as in-plane forces by plate action in each element. These in-plane forces are then carried through the plate structure to the supports as in-plane forces by membrane action. The consequence is that the spatial stability of the structure can be simply analysed by considering...... the plate system as only subject to in-plane loads. The stability of such systems is based on the fact that each plane element is held fixed in space by three fixed support lines and that these support lines can be provided by three plane neighbour elements. This means that the spatial stability of a plate...

  7. Network Completion for Static Gene Expression Data

    Directory of Open Access Journals (Sweden)

    Natsu Nakajima

    2014-01-01

    Full Text Available We tackle the problem of completing and inferring genetic networks under stationary conditions from static data, where network completion is to make the minimum amount of modifications to an initial network so that the completed network is most consistent with the expression data in which addition of edges and deletion of edges are basic modification operations. For this problem, we present a new method for network completion using dynamic programming and least-squares fitting. This method can find an optimal solution in polynomial time if the maximum indegree of the network is bounded by a constant. We evaluate the effectiveness of our method through computational experiments using synthetic data. Furthermore, we demonstrate that our proposed method can distinguish the differences between two types of genetic networks under stationary conditions from lung cancer and normal gene expression data.

  8. Static aeroelastic analysis of composite wing

    Science.gov (United States)

    Lee, IN; Hong, Chang Sun; Miura, Hirokazu; Kim, Seung KO

    1990-01-01

    A static aeroelastic analysis capability that can predict aerodynamic loads for the deformed shape of the composite wing has been developed. The finite element method (FEM) was used for composite plate structural analysis, and the linear vortex lattice method (VLM) was used for steady aerodynamic analysis. The final deformed shape of the wing due to applied forces is determined by iterative manner using FEM and VLM. FEM and VLM analysis are related by a surface spline interpolation procedure. The wing with Gr/Ep composite material has been investigated to see the wing deformation effect. Aerodynamic load change due to wing flexibility has been investigated. Also, the effect of fiber orientation and sweep angle on the deformation pattern and aerodynamic coefficients are examined. For a certain fiber orientation, the deflection and aerodynamic loading of the composite wing is very much reduced. The swept forward wing has more significant effect of wing flexibility on aerodynamic coefficient than the swept back wing does.

  9. Static aeroelastic analysis for generic configuration aircraft

    Science.gov (United States)

    Lee, IN; Miura, Hirokazu; Chargin, Mladen K.

    1987-01-01

    A static aeroelastic analysis capability that can calculate flexible air loads for generic configuration aircraft was developed. It was made possible by integrating a finite element structural analysis code (MSC/NASTRAN) and a panel code of aerodynamic analysis based on linear potential flow theory. The framework already built in MSC/NASTRAN was used and the aerodynamic influence coefficient matrix is computed externally and inserted in the NASTRAN by means of a DMAP program. It was shown that deformation and flexible airloads of an oblique wing aircraft can be calculated reliably by this code both in subsonic and supersonic speeds. Preliminary results indicating importance of flexibility in calculating air loads for this type of aircraft are presented.

  10. Distributed static linear Gaussian models using consensus.

    Science.gov (United States)

    Belanovic, Pavle; Valcarcel Macua, Sergio; Zazo, Santiago

    2012-10-01

    Algorithms for distributed agreement are a powerful means for formulating distributed versions of existing centralized algorithms. We present a toolkit for this task and show how it can be used systematically to design fully distributed algorithms for static linear Gaussian models, including principal component analysis, factor analysis, and probabilistic principal component analysis. These algorithms do not rely on a fusion center, require only low-volume local (1-hop neighborhood) communications, and are thus efficient, scalable, and robust. We show how they are also guaranteed to asymptotically converge to the same solution as the corresponding existing centralized algorithms. Finally, we illustrate the functioning of our algorithms on two examples, and examine the inherent cost-performance trade-off.

  11. The Spectrum of Static Subtracted Geometries

    CERN Document Server

    Andrade, Tomas; Cohen-Maldonado, Diego

    2016-01-01

    Subtracted geometries are black hole solutions of the four dimensional STU model with rather interesting ties to asymptotically flat black holes. In addition, a peculiar feature is that the solutions to the Klein-Gordon equation on this subtracted background can be organized according to representations of the conformal group $SO(2,2)$. We test if this behavior persists for the linearized fluctuations of gravitational and matter fields on static, electrically charged backgrounds of this kind. We find that there is a subsector of the modes that do display conformal symmetry, while some modes do not. We also discuss two different effective actions that describe these subtracted geometries and how the spectrum of quasinormal modes is dramatically different depending upon the action used.

  12. Construction of STACY (Static Experiment Critical Facility)

    Energy Technology Data Exchange (ETDEWEB)

    Murakami, Kiyonobu; Onodera, Seiji; Hirose, Hideyuki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment] [and others

    1998-08-01

    Two critical assemblies, STACY (Static Experiment Critical Facility) and TRACY (Transient Experiment Critical Facility), were constructed in NUCEF (Nuclear Fuel Cycle Safety Engineering Research Facility) to promote researches on the criticality safety at a reprocessing facility. STACY aims at providing critical data of uranium nitrate solution, plutonium nitrate solution and their mixture while varying concentration of solution fuel, core tank shape and size and neutron reflecting condition. STACY achieved first criticality in February 1995, and passed the licensing inspection by STA (Science and Technology Agency of Japan) in May. After that a series of critical experiments commenced with 10 w/o enriched uranium solution. This report describes the outline of STACY at the end of FY 1996. (author)

  13. Electrovacuum Static Counterrotating Relativistic Dust Disks

    CERN Document Server

    García-Reyes, Gonzalo

    2004-01-01

    A detailed study is presented of the counterrotating model (CRM) for generic electrovacuum static axially symmetric relativistic thin disks without radial pressure. We find a general constraint over the counterrotating tangential velocities needed to cast the surface energy-momentum tensor of the disk as the superposition of two counterrotating charged dust fluids. We also find explicit expressions for the energy densities, charge densities and velocities of the counterrotating fluids. We then show that this constraint can be satisfied if we take the two counterrotating streams as circulating along electro-geodesics. However, we show that, in general, it is not possible to take the two counterrotating fluids as circulating along electro-geodesics nor take the two counterrotating tangential velocities as equal and opposite. Four simple families of models of counterrotating charged disks based on Chazy-Curzon-like, Zipoy-Voorhees-like, Bonnor-Sackfield-like and Kerr-like electrovacuum solutions are considered w...

  14. Static analysis of an office desk construction

    Directory of Open Access Journals (Sweden)

    Milan Novotný

    2011-01-01

    Full Text Available The objective of the paper is a static analysis of a desk construction and the determination of its probable mechanical behaviour using Finite Element Method. The construction was modelled and numerically analysed in Autocad Inventor 2011 and the stability of the entire desk was calculated with the size and placement of the loading force based on the standards and cited literature. Possible locations and directions of the deformation were analysed and a solution for its prevention was proposed and the stability of the desk as well as the extreme position of the stand were calculated. The verification of the obtained results in an accredited furniture testing lab is planned using a prototype of the office desk.

  15. Multipoint vibrometry with dynamic and static holograms

    Energy Technology Data Exchange (ETDEWEB)

    Haist, T.; Lingel, C.; Osten, W. [Institut für Technische Optik, Stuttgart Research Center of Photonic Engineering (SCOPE), University of Stuttgart, D-70569 Stuttgart (Germany); Winter, M.; Giesen, M.; Ritter, F.; Sandfort, K.; Rembe, C. [Polytec GmbH, Polytec-Platz 1-7, D-76337 Waldbronn (Germany); Bendel, K. [Corporate Sector Research and Advanced Engineering, Robert Bosch GmbH, Gerlingen (Germany)

    2013-12-15

    We report on two multipoint vibrometers with user-adjustable position of the measurement spots. Both systems are using holograms for beam deflection. The measurement is based on heterodyne interferometry with a frequency difference of 5 MHz between reference and object beam. One of the systems uses programmable positioning of the spots in the object volume but is limited concerning the light efficiency. The other system is based on static holograms in combination with mechanical adjustment of the measurement spots and does not have such a general efficiency restriction. Design considerations are given and we show measurement results for both systems. In addition, we analyze the sensitivity of the systems which is a major limitation compared to single point scanning systems.

  16. Static Load Distribution in Ball Bearings

    Science.gov (United States)

    Ricci, Mario

    2010-01-01

    A numerical procedure for computing the internal loading distribution in statically loaded, single-row, angular-contact ball bearings when subjected to a known combined radial and thrust load is presented. The combined radial and thrust load must be applied in order to avoid tilting between inner and outer rings. The numerical procedure requires the iterative solution of Z + 2 simultaneous nonlinear equations - where Z is the number of the balls - to yield an exact solution for axial and radial deflections, and contact angles. Numerical results for a 218 angular-contact ball bearing have been compared with those from the literature and show significant differences in the magnitudes of the ball loads, contact angles, and the extent of the loading zone.

  17. Static and dynamic friction of hierarchical surfaces

    Science.gov (United States)

    Costagliola, Gianluca; Bosia, Federico; Pugno, Nicola M.

    2016-12-01

    Hierarchical structures are very common in nature, but only recently have they been systematically studied in materials science, in order to understand the specific effects they can have on the mechanical properties of various systems. Structural hierarchy provides a way to tune and optimize macroscopic mechanical properties starting from simple base constituents and new materials are nowadays designed exploiting this possibility. This can be true also in the field of tribology. In this paper we study the effect of hierarchical patterned surfaces on the static and dynamic friction coefficients of an elastic material. Our results are obtained by means of numerical simulations using a one-dimensional spring-block model, which has previously been used to investigate various aspects of friction. Despite the simplicity of the model, we highlight some possible mechanisms that explain how hierarchical structures can significantly modify the friction coefficients of a material, providing a means to achieve tunability.

  18. Static impedance behavior of programmable metallization cells

    Science.gov (United States)

    Rajabi, S.; Saremi, M.; Barnaby, H. J.; Edwards, A.; Kozicki, M. N.; Mitkova, M.; Mahalanabis, D.; Gonzalez-Velo, Y.; Mahmud, A.

    2015-04-01

    Programmable metallization cell (PMC) devices work by growing and dissolving a conducting metallic bridge across a chalcogenide glass (ChG) solid electrolyte, which changes the resistance of the cell. PMC operation relies on the incorporation of metal ions in the ChG films via photo-doping to lower the off-state resistance and stabilize resistive switching, and subsequent transport of these ions by electric fields induced from an externally applied bias. In this paper, the static on- and off-state resistance of a PMC device composed of a layered (Ag-rich/Ag-poor) Ge30Se70 ChG film with active Ag and inert Ni electrodes is characterized and modeled using three dimensional simulation code. Calibrating the model to experimental data enables the extraction of device parameters such as material bandgaps, workfunctions, density of states, carrier mobilities, dielectric constants, and affinities.

  19. Landau problem in the static schwarzschild universe

    Directory of Open Access Journals (Sweden)

    A Jafari

    2013-09-01

    Full Text Available  This paper considers the Landau problem in an elected static space time and the are erased levels shifts which are erased as a metric deviation from the Minkowski space time. This research is based on the Weber’s method. We try to rewrite the equation of motion of particles in the presence of the gravitational effects and consider the regions limited with the tangent spaces conditions. I t would be reasonable to assume the nonrelativistic particles with low speed. We show that due to the Weber’s method, the tangent space is always available. Another assumption of this article is time independent tangent space of Schwarzschild universe and use of Riemann’s normal coordinates.

  20. Distributed parameter statics of magnetic catheters.

    Science.gov (United States)

    Tunay, Ilker

    2011-01-01

    We discuss how to use special Cosserat rod theory for deriving distributed-parameter static equilibrium equations of magnetic catheters. These medical devices are used for minimally-invasive diagnostic and therapeutic procedures and can be operated remotely or controlled by automated algorithms. The magnetic material can be lumped in rigid segments or distributed in flexible segments. The position vector of the cross-section centroid and quaternion representation of an orthonormal triad are selected as DOF. The strain energy for transversely isotropic, hyperelastic rods is augmented with the mechanical potential energy of the magnetic field and a penalty term to enforce the quaternion unity constraint. Numerical solution is found by 1D finite elements. Material properties of polymer tubes in extension, bending and twist are determined by mechanical and magnetic experiments. Software experiments with commercial FEM software indicate that the computational effort with the proposed method is at least one order of magnitude less than standard 3D FEM.

  1. Anisotropy in Quasi-Static Magnetohydrodynamic Turbulence

    Science.gov (United States)

    Verma, Mahendra K.

    2017-08-01

    In this review we summarise the current status of the quasi-static magnetohydrodynamic turbulence. The energy spectrum is steeper than Kolmogorov’s k -5/3 spectrum due to the decrease of the kinetic energy flux with wavenumber k as a result of Joule dissipation. The spectral index decreases with the increase of interaction parameter. The flow is quasi two-dimensional with strong {{\\mathbf{U}}\\bot} at small k and weak {{U}\\parallel} at large k, where {{\\mathbf{U}}\\bot} and {{U}\\parallel} are the perpendicular and parallel components of velocity relative to the external magnetic field. For small k, the energy flux of {{\\mathbf{U}}\\bot} is negative, but for large k, the energy flux of {{U}\\parallel} is positive. Pressure mediates the energy transfer from {{\\mathbf{U}}\\bot} to {{U}\\parallel} .

  2. VIRTEX-4 VQ static SEU Characterization Summary

    Science.gov (United States)

    Allen, Gregory; Swift, Gary; Carmichael, Carl

    2008-01-01

    This report is the result of the combined efforts of members within the Xilinx Radiation Test Consortium (XRTC), sometimes known as the Xilinx SEE Test Consortium. The XRTC is a voluntary association of aerospace entities, including leading aerospace companies, universities and national laboratories, combining resources to characterize reconfigurable FPGAs for aerospace applications. Previous publications of Virtex-4 radiation results are for commercial (non-epitaxial) devices; see, for example, Refs. 1-4. A notable exception is Ref. 5, which presents XRTC upset measurements of storage elements in the PowerPC405s in the XQR4VFX60. This report of upset susceptibility to heavy ions and protons of the static memory elements in the Virtex-4QV family is a direct parallel to the XRTC report on the thin epitaxial devices in the Virtex-2 family released four years ago.

  3. Static hand gesture recognition from a video

    Science.gov (United States)

    Rokade, Rajeshree S.; Doye, Dharmpal

    2011-10-01

    A sign language (also signed language) is a language which, instead of acoustically conveyed sound patterns, uses visually transmitted sign patterns to convey meaning- "simultaneously combining hand shapes, orientation and movement of the hands". Sign languages commonly develop in deaf communities, which can include interpreters, friends and families of deaf people as well as people who are deaf or hard of hearing themselves. In this paper, we proposed a novel system for recognition of static hand gestures from a video, based on Kohonen neural network. We proposed algorithm to separate out key frames, which include correct gestures from a video sequence. We segment, hand images from complex and non uniform background. Features are extracted by applying Kohonen on key frames and recognition is done.

  4. Assessing Static Performance of the Dashengguan Yangtze Bridge by Monitoring the Correlation between Temperature Field and Its Static Strains

    Directory of Open Access Journals (Sweden)

    Gao-Xin Wang

    2015-01-01

    Full Text Available Taking advantage of the structural health monitoring system installed on the steel truss arch girder of Dashengguan Yangtze Bridge, the temperature field data and static strain data are collected and analyzed for the static performance assessment of the bridge. Through analysis, it is found that the static strain changes are mainly caused by temperature field (temperature and temperature difference and train. After the train-induced static strains are removed, the correlation between the remaining static strains and the temperature field shows apparent linear characteristics, which can be mathematically modeled for the description of static performance. Therefore, multivariate linear regression function combined with principal component analysis is introduced to mathematically model the correlation. Furthermore, the residual static strains of mathematical model are adopted as assessment indicator and three kinds of degradation regulations of static performance are obtained after simulation of the residual static strains. Finally, it is concluded that the static performance of Dashengguan Yangtze Bridge was in a good condition during that period.

  5. Static gravitational equations of general relativity and "the fifth force"

    Science.gov (United States)

    Das, A.

    2015-10-01

    Einstein's static field equations are investigated in various coordinate charts. After comparing Newtonian gravitational theory (in a curvilinear coordinate chart) with various charts of Einstein's static gravitational equations, the most appropriate choice of the coordinate chart for Einstein's static field equations is made. As a consequence, Einstein's equations imply the non-linear potential equation instead of the usual Poisson's equation of the Newtonian theory. Investigating the non-linear potential equation above in the spherically symmetric cases, the corresponding potentials yield scenarios comparable to "the fifth force". Next, static gravitational and electric fields generated by an incoherent charged dust are investigated. The corresponding non-linear potential equation is derived. Finally, the static Einstein-Maxwell-Klein-Gordon equations are explored and again, the corresponding non-linear potential equation is obtained. This potential resembles the static Higgs boson field.

  6. Effects of static magnetic fields on plants.

    Science.gov (United States)

    Kuznetsov, O.

    In our recent experiment on STS-107 (MFA-Biotube) we took advantage of the magnetic heterogeneity of the gravity receptor cells of flax roots, namely stronger diamagnetism of starch-filled amyloplasts compared to cytoplasm (Δ ≊ HGMF, grad(H2/2) up to 109-1010 Oe2/cm) of the experimental chambers (MFCs) repelled amyloplasts from the zones of stronger field thus providing a directional stimulus for plant gravisensing system in microgravity, and causing the roots to react. Such reaction was observed in the video downlink pictures. Unfortunately, the ``Columbia'' tragedy caused loss of the plant material and most of the images, thus preventing us from detailed studies of the results. Currently we are looking for a possibility to repeat this experiment. Therefore, it is very important to understand, what other effects (besides displacing amyloplasts) static magnetic fields with intensities 0 to 2.5104 Oe, and with the size of the area of non-uniformity 10-3 to 1 cm. These effects were estimated theoretically and tested experimentally. No statistically significant differences in growth rates or rates of gravicurvature were observed in experiments with Linum, Arabidopsis, Hordeum, Avena, Ceratodon and Chara between the plants grown in uniform magnetic fields of various intensities (102 to 2.5104 Oe) and those grown in the Earth's magnetic field. Microscopic studies also did not detect any structural differences between test and control plants. The magnitudes of possible effects of static magnetic fields on plant cells and organs (including effects on ion currents, magneto-hydrodynamic effects in moving cytoplasm, ponderomotive forces on other cellular structures, effects on some biochemical reactions and biomolecules) were estimated theoretically. The estimations have shown, that these effects are small compared to the thermodynamic noise and thus are insignificant. Both theoretical estimations and control experiments confirm, that intracellular magnetophoresis of

  7. Static model for a 3-DOF underactuated finger

    Directory of Open Access Journals (Sweden)

    F. Guay

    2011-02-01

    Full Text Available This paper introduces a static model of a three-degree-of-freedom underactuated finger. The model includes all static forces, namely actuation forces, return forces and gravity. All geometric and static parameters can be freely changed (pulley radius, member's mass, etc.. Hence, the model allows complete static simulations to be performed and it can also be used for numerical optimization.

    This paper was presented at the IFToMM/ASME International Workshop on Underactuated Grasping (UG2010, 19 August 2010, Montréal, Canada.

  8. Static magnets: what are they and what do they do?

    Directory of Open Access Journals (Sweden)

    L Laakso

    Full Text Available INTRODUCTION: Therapeutic static magnets have gained wide community acceptance for neuromusculoskeletal pain relief in many countries yet, apart from strong anecdotal reports of benefit, there is a paucity of scientific evidence for their use. OBJECTIVES: In this review we describe the physical characteristics of traditional and commonplace unipolar and bipolar static magnets as well as newer quadripolar magnetic arrays; discuss what is known of the physiological effects of static magnets and the strength of the literature; and make suggestions for targeted future research for static magnets in the management of neuromusculoskeletal pain conditions.

  9. Latent Constructs of the Static-99R and Static-2002R: A Three-Factor Solution.

    Science.gov (United States)

    Brouillette-Alarie, Sébastien; Babchishin, Kelly M; Hanson, R Karl; Helmus, Leslie-Maaike

    2016-02-01

    The most commonly used risk assessment tools for predicting sexual violence focus almost exclusively on static, historical factors (e.g., characteristics of prior offences). Consequently, they are assumed to be unable to directly inform the selection of treatment targets or evaluate change. In this article, we argue that this limitation can be mitigated by using latent variable models as a framework to link historical risk factors to the psychological characteristics of offenders. Accordingly, we conducted a factor analysis of the 13 nonredundant items from the two most commonly used risk tools for sexual offenders (Static-99R and Static-2002R) to identify the psychological information contained in these tools. Three factors were identified: (a) persistence/paraphilia, a construct related to sexual criminality, especially of the pedophilic type; (b) youthful stranger aggression, a construct centered on young age and offence seriousness; and (c) general criminality, a construct that reflected the diversity and magnitude of criminal careers. These constructs predicted sexual recidivism with similar accuracy, but only youthful stranger aggression and general criminality predicted nonsexual recidivism. These results indicate that risk tools for sexual violence are multidimensional, and support a shift from a focus on atheoretical risk markers to the assessment of psychologically meaningful constructs.

  10. Instructional Animation versus Static Pictures: A Meta-Analysis

    Science.gov (United States)

    Hoffler, Tim N.; Leutner, Detlev

    2007-01-01

    A meta-analysis of 26 primary studies, yielding 76 pair-wise comparisons of dynamic and static visualizations, reveals a medium-sized overall advantage of instructional animations over static pictures. The mean weighted effect size on learning outcome is d = 0.37 (95% CI 0.25-0.49). Moderator analyses indicate even more substantial effect sizes…

  11. Static and Transient Cavitation Threshold Measurements for Mercury

    Energy Technology Data Exchange (ETDEWEB)

    Moraga, F.; Taleyarkhan, R.P.

    1999-11-14

    Transient and static cavitation thresholds for mercury as a function of the cover gas (helium or air), and pressure are reported. Both static and transient cavitation onset pressure thresholds increase linearly with cover gas pressure. Additionally, the cavitation thresholds as a function of dissolved gases were also measured and are reported.

  12. Theory of static and dynamic properties of Gd

    DEFF Research Database (Denmark)

    Lindgård, Per-Anker

    1986-01-01

    Gadolinium is a Heisenberg magnet intermediate between the localized EuO and the itinerant Fe and Ni. The authors develop a correlation theory for Gd and calculate self-consistently both static and dynamic properties. One finds that the high frequency spin waves persist for T>Tc. The static...

  13. 14 CFR 29.610 - Lightning and static electricity protection.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Lightning and static electricity protection... § 29.610 Lightning and static electricity protection. (a) The rotorcraft structure must be protected... electricity must— (1) Minimize the accumulation of electrostatic charge; (2) Minimize the risk of electric...

  14. All Charged Up!--Experimenting with Static Electricity

    Science.gov (United States)

    Roman, Harry T.

    2011-01-01

    Build-up of static electricity happens readily when the air is cold and dry and is a common part of life. There are lots of ways to make students aware of static electricity--and many things one can teach them about its applications in today's industry. In this article, the author describes examples and experiments that will bring static…

  15. CONTINUOUS PRODUCTION OF HYDROXYPROPYL STARCH IN A STATIC MIXER REACTOR

    NARCIS (Netherlands)

    LAMMERS, G; STAMHUIS, EJ; BEENACKERS, AACM

    1993-01-01

    A novel type of reactor for the chemical derivatization of starch pastes is presented. The design is based on the application of static mixers. The reactor shows excellent plug flow behaviour with a Peclet number of about 100. The viscosity behaviour of concentrated starch pastes in the static mixer

  16. Static energy meter errors caused by conducted electromagnetic interference

    NARCIS (Netherlands)

    Leferink, Frank Bernardus Johannes; Keyer, Cornelis H.A.; Melentjev, Anton

    2017-01-01

    Static, or electronic, energy meters are replacing the conventional electromechanical meters. Consumers are some-times complaining about higher energy readings and billing after the change to a static meter, but there is not a clear common or root cause at present. Electromagnetic interference has

  17. 49 CFR 238.405 - Longitudinal static compressive strength.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Longitudinal static compressive strength. 238.405 Section 238.405 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... II Passenger Equipment § 238.405 Longitudinal static compressive strength. (a) To form an...

  18. All Charged Up!--Experimenting with Static Electricity

    Science.gov (United States)

    Roman, Harry T.

    2011-01-01

    Build-up of static electricity happens readily when the air is cold and dry and is a common part of life. There are lots of ways to make students aware of static electricity--and many things one can teach them about its applications in today's industry. In this article, the author describes examples and experiments that will bring static…

  19. Static energy meter errors caused by conducted electromagnetic interference

    NARCIS (Netherlands)

    Leferink, Frank; Keyer, Cees; Melentjev, Anton

    2017-01-01

    Static, or electronic, energy meters are replacing the conventional electromechanical meters. Consumers are some-times complaining about higher energy readings and billing after the change to a static meter, but there is not a clear common or root cause at present. Electromagnetic interference has b

  20. 14 CFR 23.681 - Limit load static tests.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit load static tests. 23.681 Section 23.681 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... Control Systems § 23.681 Limit load static tests. (a) Compliance with the limit load requirements of this...

  1. 14 CFR 25.681 - Limit load static tests.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit load static tests. 25.681 Section 25.681 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... load static tests. (a) Compliance with the limit load requirements of this Part must be shown by tests...

  2. 14 CFR 29.681 - Limit load static tests.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit load static tests. 29.681 Section 29.681 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... load static tests. (a) Compliance with the limit load requirements of this part must be shown by tests...

  3. 14 CFR 27.681 - Limit load static tests.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit load static tests. 27.681 Section 27.681 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... static tests. (a) Compliance with the limit load requirements of this part must be shown by tests in...

  4. The Active-Static Nature of Amuzgo (Otomanguean).

    Science.gov (United States)

    Stark, Thomas C. Smith; Garcia, Fermin Tapia

    An analysis of Amuzgo, a language within the Otomanguean family of Mexico, suggests that it is an active-static language with patterns similar but not parallel to those of Chocho. In the report, data on the characteristics of Chocho are summarized, theory and research on active-static languages is reviewed, and the data on Amuzgo are presented.…

  5. Non-static vacuum strings: exterior and interior solutions

    Energy Technology Data Exchange (ETDEWEB)

    Stein-Schabes, J.A.

    1986-01-01

    New non-static cylindrically symmetric solutions of Einsteins's equations are presented. Some of these solutions represent string-like objects. An exterior vacuum solution is matched to a non-vacuum interior solution for different forms of the energy-momentum tensor. They generalize the standard static string. 12 refs.

  6. Integrable cases of gravitating static isothermal fluid spheres

    CERN Document Server

    Ivanov, B V

    2002-01-01

    It is shown that different approaches towards the solution of the Einstein equations for a static spherically symmetric perfect fluid with a gamma-law equation of state lead to an Abel differential equation of the second kind. Its only integrable cases at present are flat spacetime, de Sitter solution and its Buchdahl transform, Einstein static universe and the Klein-Tolman solution.

  7. Observation of static gestures influences speech production.

    Science.gov (United States)

    Jarick, Michelle; Jones, Jeffery A

    2008-08-01

    Research investigating 'mirror neurons' has demonstrated the presence of an observation-execution matching system in humans. One hypothesized role for this system might be to aid in action understanding by encoding the underlying intentions of the actor. To investigate this hypothesis, we asked participants to observe photographs of an actor making orofacial gestures (implying verbal or non-verbal acts), and to produce syllables that were compatible or incompatible with the gesture they observed. We predicted that if mirror neurons encode the intentions of an actor, then the pictures implying verbal gestures would affect speech production, whereas the non-verbal gestures would not. Our results showed that the observation of compatible verbal gestures facilitated verbal responses, while incompatible verbal gestures caused interference. Although this compatibility effect did not reach statistical significance when the photographs implied a non-verbal act, responses were faster on average when the gesture implied the use of similar articulators as those involved with the production of the target syllable. Altogether, these behavioral findings compliment previous neuroimaging studies indicating that static pictures portraying gestures activate brain regions associated with an observation-execution matching system.

  8. Preservation of Laboratory Instruments in Static Storage

    Energy Technology Data Exchange (ETDEWEB)

    Gregg, J. L.; Shackelford, M. A.

    1950-02-22

    It is desirable to place laboratory instruments in static storage so that they may be put into operation with only normal servicing. Such instruments may be subject to many forms of deterioration. There may be deterioration of metal parts due to chemical and electrolytic corrosion and the effects of moisture, excessive dryness, and microorganisms, i.e., mildew on organic parts. To preserve such instruments without disassembly or troublesome surface coatings, requires methods that will remove the major cause of deterioration - that is, excessive humidity, by reducing and maintaining the relative humidity of the air surrounding the item at 30 per cent or less. It is also necessary to eliminate or separate hygroscopic materials from the item since they will cause corrosion, by surface adsorption and condensation, even though a dry atmosphere is maintained. The methods and materials used must not only be efficient and economical but also require a minimun of maintenance, Protection against physical damage and temperature extremes is dependent upon the storage site and is not considered in this report.

  9. Review of Static Compensation of Autonomous Systems

    Directory of Open Access Journals (Sweden)

    Ambarnath Banerji

    2012-01-01

    Full Text Available Abstract Deregulation of the electric power energy market has thrown open opportunities for tapping the large number of small pockets of renewable energy sources with the asynchronous generators. Whether the power is supplied by asynchronous generator or by the grid at the remote location, its quality has become an important aspect for consumers of electricity. Efforts have been made to improve the power quality using passive filters, active filters and the new concept of Custom Power. Use of Custom power devices ensures that a load do not pollute the power supply of the other loads. One such custom power device is the DSTATCOM (Distribution Static Compensator which is connected in shunt at the load end. The heart of the DSTATCOM is an inverter. The focus on the autonomous generation has increased in the recent years. The paper presents a comprehensive review of the DSTATCOM used for autonomous generation. It is aimed at providing a broad perspective on the status of DSTATCOM, used with Asynchronous generators, vis-à-vis its working principle, topology, solid state switching devices and technology, supply system, control methodologies and approaches, technical and economic considerations, etc. to researchers and application engineers dealing with power quality aspects of Autonomous Systems. Classified manner in which the references are presented in this paper will serve them as quick and useful reference.

  10. Liquid methanol under a static electric field

    Energy Technology Data Exchange (ETDEWEB)

    Cassone, Giuseppe, E-mail: giuseppe.cassone@impmc.upmc.fr [Sorbonne Universités, UPMC Univ Paris 06, UMR 7590, IMPMC, F-75005 Paris (France); CNRS, UMR 7590, IMPMC, F-75005 Paris (France); Università degli Studi di Messina, Dipartimento di Fisica e di Scienze della Terra, Contrada Papardo, 98166 Messina (Italy); CNR-IPCF, Viale Ferdinando Stagno d’Alcontres 37, 98158 Messina (Italy); Giaquinta, Paolo V., E-mail: paolo.giaquinta@unime.it [Università degli Studi di Messina, Dipartimento di Fisica e di Scienze della Terra, Contrada Papardo, 98166 Messina (Italy); Saija, Franz, E-mail: saija@ipcf.cnr.it [CNR-IPCF, Viale Ferdinando Stagno d’Alcontres 37, 98158 Messina (Italy); Saitta, A. Marco, E-mail: marco.saitta@impmc.upmc.fr [Sorbonne Universités, UPMC Univ Paris 06, UMR 7590, IMPMC, F-75005 Paris (France); CNRS, UMR 7590, IMPMC, F-75005 Paris (France)

    2015-02-07

    We report on an ab initio molecular dynamics study of liquid methanol under the effect of a static electric field. We found that the hydrogen-bond structure of methanol is more robust and persistent for field intensities below the molecular dissociation threshold whose value (≈0.31 V/Å) turns out to be moderately larger than the corresponding estimate obtained for liquid water. A sustained ionic current, with ohmic current-voltage behavior, flows in this material for field intensities above 0.36 V/Å, as is also the case of water, but the resulting ionic conductivity (≈0.40 S cm{sup −1}) is at least one order of magnitude lower than that of water, a circumstance that evidences a lower efficiency of proton transfer processes. We surmise that this study may be relevant for the understanding of the properties and functioning of technological materials which exploit ionic conduction, such as direct-methanol fuel cells and Nafion membranes.

  11. Non static cosmic strings in Lyra geometry

    CERN Document Server

    Rahaman, Farook

    2007-01-01

    The gravitational field of both local and global non static cosmic strings in the context of Lyra geometry are investigated. Local strings are characterized by having an energy momentum tensor whose only non null components are $T_{tt} = T_{zz}$ . As linearized Einstein equations are formally analogous to the Maxwell equations, the exterior solution does not depend on the radial distribution of the source and hence a Dirac d function was used to approximate the radial distribution of the energy momentum tensor for a local cosmic string along the z-axis: $T_{ab} = \\delta(x) \\delta(y)diag (\\sigma, 0, 0, \\sigma) $, $\\sigma $being the energy density of the string [A.Vilenkin. Phys.Rep.(1985)121,263]. For a global string, the energy momentum tensor components are calculated from the action density for a complex scalar field y along with a Maxican hat potential. The gravitational field of the global string is shown to be attractive in nature.

  12. The influence of music on static posturography.

    Science.gov (United States)

    Forti, Stella; Filipponi, Eliana; Di Berardino, Federica; Barozzi, Stefania; Cesarani, Antonio

    2010-01-01

    It is well known that high intensity sounds modify balance by activating the saccule, which is sensitive to both vestibular and acoustic stimuli. Few studies have examined the effects of music on the postural responses in healthy subjects. The aim of this study was to evaluate the influence of different types of music (Mozart, Köhler, Köhler with a carrier of 12 KHz and subjects' favourite music) on twelve healthy subjects standing on a stabilometric platform. With each type of music, all subjects underwent static posturography with eyes opened and eyes closed, and with and without foam pads. We evaluated the length and the surface of body sway and the correlation between them, and we analyzed the visual, vestibular and somatosensory sub-components. Listening to different types of music did not significantly change the stabilometric variables, with the exception of listening to Mozart's Jupiter, which caused a significant reduction in the visual component with a consequent increase in both the vestibular and somatosensory inputs. Further studies are needed to determine the effect of Mozart's music in modifying the sensory strategy in the rehabilitation of patients with vestibular impairments.

  13. A multinuclear static NMR study of geopolymerisation

    Energy Technology Data Exchange (ETDEWEB)

    Favier, Aurélie, E-mail: aurelie.favier@epfl.ch [Univ Paris-Est, IFSTTAR, Materials Department, 14-20 bd Newton, F-77447 Marne la Vallée Cedex 2 (France); Habert, Guillaume [Institute for Construction and Infrastructure Management, ETH Zurich, CH-8093 Zurich (Switzerland); Roussel, Nicolas [Univ Paris-Est, IFSTTAR, Materials Department, 14-20 bd Newton, F-77447 Marne la Vallée Cedex 2 (France); D' Espinose de Lacaillerie, Jean-Baptiste [Ecole Supérieure de Physique et de Chimie Indusrtrielles de la Ville de Paris (ESPCI), ParisTech, PSL Research University, Soft Matter Sciences and Engineering Laboratory SIMM, CNRS UMR 7615, 10 rue Vauquelin, F-75005 Paris (France)

    2015-09-15

    Geopolymers are inorganic binders obtained by alkali activation of aluminosilicates. While the structure of geopolymers is now well understood, the details of the geopolymerisation reaction and their impact on the rheology of the paste remain uncertain. In this work, we follow the elastic properties of a paste made with metakaolin and sodium silicate solution. After the first sharp increase of elastic modulus occurring a few hundred of seconds after mixing and related to the heterogeneous formation of an alumina–silicate gel with a molar ratio Si/Al < 4 located at the grains boundaries, we focus on the progressive increase in elastic modulus on a period of few hours during the setting of the geopolymer. In this study, we combine the study of rheological properties of the paste with {sup 23}Na, {sup 27}Al and {sup 29}Si static NMR measurement in order to better understand the origin of this second increase in elastic modulus. Our results show that, after a few hours, Al and Na evolution in the liquid phase are concomitant. This suggests the precipitation of an aluminosilicate phase where Al is in tetrahedral position and Na compensates the charge. Furthermore, Si speciation confirms this result and allows us to identify the precipitation of a product, which has a chemical composition close to the final composition of geopolymer. This study provides strong evidence for a heterogeneous formation of an aluminosilicate glass directly from the first gel and the silicate solution without the need for a reorganisation of Gel 1 into Gel 2.

  14. Comparative statics of games between relatives.

    Science.gov (United States)

    Milchtaich, Igal

    2006-03-01

    According to Hamilton's theory of kin selection, species tend to evolve behavior such that each organism appears to be attempting to maximize its inclusive fitness. In particular, two neighbors are likely to help each other if the cost of doing so is less than the benefit multiplied by r, their coefficient of relatedness. Since the latter is less than unity, mutual altruism benefits both neighbors. However, is it theoretically possible that acting so as to maximize the inclusive, rather than personal, fitness may harm both parties. This may occur in strategic symmetric pairwise interactions (more specifically, nxn games), in which the outcome depends on both sides' actions. In this case, the equilibrium outcome may be less favorable to the interactants' personal fitness than if each of them acted so as to maximize the latter. This paper shows, however, that such negative effect of relatedness on fitness is incompatible with evolutionary stability. If the symmetric equilibrium strategies are evolutionarily stable, a higher coefficient of relatedness can only entail higher personal fitness for the two neighbors. This suggests that negative comparative statics as above are not likely to occur in nature.

  15. Scalar Static Polarizabilities of Lanthanides and Actinides

    CERN Document Server

    Dzuba, V A; Flambaum, V V

    2014-01-01

    We calculate scalar static polarizabilities for lanthanides and actinides, the atoms with open $4f$ or $5f$ subshell. We show that polarizabilities of the low states are approximately the same for all states of given configuration and present a way of calculating them reducing valence space to just two or three valence electrons occupying $6s$ and $5d$ states for lanthanides or $7s$ and $6d$ states for actinides while $4f$ and $5f$ states are considered to be in the core. Configuration interaction technique is used to calculate polarizabilities of lanthanides and actinides for all states of the $4f^n6s^2$ and $4f^{n-1}6s^25d$ configurations of lanthanides and all states of the $5f^{n}7s^2$ and $5f^{n-1}7s^26d$ configurations of actinides. Polarizability of the electron core (including f-orbitals) has been calculated in the RPA approximation.

  16. Intracellular Biopotentials During Static Extracellular Stimulation

    Science.gov (United States)

    Klee, Maurice

    1973-01-01

    Two properties of the intracellular potentials and electric fields resulting from static extracellular stimulation are obtained for arbitrarily shaped cells. First, the values of intracellular potential are shown to be bounded by the maximum and minimum values of extracellular potential on the surface of the cell. Second, the volume average of the magnitude of intracellular electric field is shown to have an upper bound given by the ratio of the magnitude of the largest extracellular potential difference on the surface of the cell to a generalized length constant λ = [σintraVcell/(σmemb Acell)]1/2, where Vcell and Acell are the volume and surface area of the cell, σintra is the intracellular conductivity (reciprocal ohms per centimeter), and σmemb is the membrane conductivity (reciprocal ohms per square centimeter). The use of the upper bound on the volume average of the magnitude of intracellular electric field as an estimate for intracellular isopotentiality is discussed and the use of the generalized length constant for electrically describing arbitrary cells is illustrated for cylindrical- and spheroidal-shaped cells. PMID:4726882

  17. Contagion processes on the static and activity driven coupling networks

    CERN Document Server

    Lei, Yanjun; Guo, Quantong; Ma, Yifang; Li, Meng; Zheng, Zhiming

    2015-01-01

    The evolution of network structure and the spreading of epidemic are common coexistent dynamical processes. In most cases, network structure is treated either static or time-varying, supposing the whole network is observed in a same time window. In this paper, we consider the epidemic spreading on a network consisting of both static and time-varying structures. At meanwhile, the time-varying part and the epidemic spreading are supposed to be of the same time scale. We introduce a static and activity driven coupling (SADC) network model to characterize the coupling between static (strong) structure and dynamic (weak) structure. Epidemic thresholds of SIS and SIR model are studied on SADC both analytically and numerically with various coupling strategies, where the strong structure is of homogeneous or heterogeneous degree distribution. Theoretical thresholds obtained from SADC model can both recover and generalize the classical results in static and time-varying networks. It is demonstrated that weak structure...

  18. Static and flicker perimetry in age-related macular degeneration.

    Science.gov (United States)

    Luu, Chi D; Dimitrov, Peter N; Wu, Zhichao; Ayton, Lauren N; Makeyeva, Galina; Aung, Khin-Zaw; Varsamidis, Mary; Robman, Luba; Vingrys, Algis J; Guymer, Robyn H

    2013-05-01

    The relationship between clinical severity of age-related macular degeneration (AMD) and macular function has not been well established. In this study, we investigated the correlation between clinical severity and functional deficits as detected by static and flicker perimetry. This cross-sectional study consisted of 279 AMD subjects and 24 control participants. AMD subjects were allocated into 1 of 10 AMD severity groups depending on the status of the designated study eye and the fellow eye, as assessed by color fundus photographs. Visual acuity, and static and flicker perimetry were tested on one eye during the same session. The geometric means, SDs, and percentage of abnormal eyes of static and flicker sensitivity of each AMD severity group were determined and compared. The pattern of change in sensitivity and percentage of abnormal eyes for static perimetry across all AMD severity groups were similar to flicker perimetry. Eyes with drusen > 125 μm (P[static] = 0.018, P[flicker] = 0.024), drusenoid epithelial detachment (P[static and flicker] static and flicker] static and flicker sensitivities compared to normal eyes. Static (β-coefficient -1.59, 95% confidence interval [CI] -4.78-1.60) and flicker (β-coefficient -1.29, 95% CI -4.66-2.08) sensitivities declined at a similar rate in eyes that showed clinical signs of progression. Static and flicker perimetry were affected similarly across the spectrum of AMD severity, and methods appeared to be valid techniques for assessing retinal sensitivity in AMD once drusen > 125 μm are present, but before the development of late AMD.

  19. Literature review Quasi-static and Dynamic pile load tests: Primarily report on non-static pile load tests

    NARCIS (Netherlands)

    Huy, N.Q.

    2010-01-01

    Pile testing, which plays an importance role in the field of deep foundation design, is performed by static and non-static methods to provide information about the following issues: (Poulos, 1998) - The ultimate capacity of a single pile. - The load-displacement behavior of a pile. - The performance

  20. Literature review Quasi-static and Dynamic pile load tests: Primarily report on non-static pile load tests

    NARCIS (Netherlands)

    Huy, N.Q.

    2010-01-01

    Pile testing, which plays an importance role in the field of deep foundation design, is performed by static and non-static methods to provide information about the following issues: (Poulos, 1998) - The ultimate capacity of a single pile. - The load-displacement behavior of a pile. - The performance

  1. Compact static stars in minimal dilatonic gravity

    Science.gov (United States)

    Fiziev, Plamen P.

    2017-09-01

    In the version1 of this paper we presented for the first time the basic equations and relations for relativistic static spherically symmetric stars (SSSS) in the model of minimal dilatonic gravity (MDG). This model is locally equivalent to the f(R) theory of gravity and gives an alternative description of the effects of dark matter and dark energy using the Brans-Dicke dilaton Φ. To outline the basic properties of the MDG model of SSSS and to compare them with general relativistic results, in this paper we use the relativistic equation of state (EOS) of neutron matter as an ideal Fermi neutron gas at zero temperature. We overcome the well-known difficulties of the physics of SSSS in the f(R) theories of gravity2,3 applying novel highly nontrivial nonlinear boundary conditions, which depend on the global properties of the solution and on the EOS. We also introduce two pairs of new notions: cosmological-energy-pressure densities and dilaton-energy-pressure densities, as well as two new EOSs for them: cosmological EOS (CEOS) and dilaton EOS (DEOS). Special attention is paid to the dilatonic sphere (in brief — disphere) of SSSS, introduced in this paper for the first time. Using several realistic EOS for neutron star (NS): SLy, BSk19, BSk20 and BSk21, and current observational two-solar-masses-limit, we derive an estimate for scalar-field-mass mΦ ˜ 10‑13eV/c2 ÷ 4 × 10‑11eV/c2. Thus, the present version of the paper reflects some of the recent developments of the topic.

  2. High temperature static strain gage development

    Science.gov (United States)

    Hulse, C. O.; Bailey, R. S.; Grant, H. P.; Anderson, W. L.; Przybyszewski, J. S.

    1991-01-01

    Final results are presented from a program to develop a thin film static strain gage for use on the blades and vanes of running, test stand gas turbine engines with goals of an 3 x 3 mm gage area and total errors of less than 10 pct. of + or - 2,000 microstrain after 50 hrs at 1250 K. Pd containing 13 Wt. pct. Cr was previously identified as a new strain sensor alloy that appeared to be potentially usable to 1250 K. Subsequently, it was discovered, in contrast with its behavior in bulk, that Pd-13Cr suffered from oxidation attack when prepared as a 4.5 micron thick thin film. Continuing problems with electrical leakage to the substrate and the inability of sputtered alumina overcoats to prevent oxidation led to the discovery that sputtered alumina contains appreciable amounts of entrapped argon. After the argon has been exsolved by heating to elevated temperatures, the alumina films undergo a linear shrinkage of about 2 pct. resulting in formation of cracks. These problems can be largely overcome by sputtering the alumina with the substrate heated to 870 K. With 2 micron thick hot sputtered alumina insulation and overcoat films, total 50 hr drifts of about 100 microstrain (2 tests) and about 500 microstrain (1 test) were observed at 1000 and 1100 K, respectively. Results of tests on complete strain gage systems on constant moment bend bars with Pd temperature compensation grids revealed that oxidation of the Pd grid was a major problem even when the grid was overcoated with a hot or cold sputtered alumina overcoat.

  3. 14 CFR 29.1325 - Static pressure and pressure altimeter systems.

    Science.gov (United States)

    2010-01-01

    ...: Installation § 29.1325 Static pressure and pressure altimeter systems. (a) Each instrument with static air case... between air pressure in the static pressure system and true ambient atmospheric static pressure is not..., when on the alternate static pressure system, differs from the reading of altimeter when on the primary...

  4. ROPS performance during field upset and static testing.

    Science.gov (United States)

    Harris, J R; McKenzie, E A; Etherton, J R; Cantis, D M; Ronaghi, M

    2010-01-01

    Agriculture remains one of the most hazardous occupations in the U.S. By conservative estimates, tractor overturns alone claim 120 lives annually. A rollover protective structure (ROPS) and a seatbelt are a highly effective engineering safety control that can prevent many of these fatalities and reduce the severity of injuries associated with tractor overturn. SAE J2194 is a consensus performance standard established for agricultural ROPS. According to this standard, satisfactory ROPS performance can be demonstrated through static testing, field upset testing, or impact testing. A previous modeling study suggested that static testing may underpredict the strain induced in a ROPS during afield upset. In the current study, field upset testing and laboratory static testing results were compared. Field upset testing included six rear and six side upset tests performed according to SAE J2194 guidelines. Additionally, static testing was performed on a ROPS of the same model. The results support findings from the modeling study. Near the lowest sections of the ROPS, the plastic strain resulting from rear upset testing exceeded the plastic strain from static testing for 18 of 24 data points. Conversely, the ROPS plastic strain from side upset testing was typically less than plastic strain from laboratory static testing. However, data indicate that the side upset test may not be very repeatable. This study suggests that the longitudinal loading energy criterion for static testing might not be a conservative predictor of rear upset ROPS response.

  5. Effects of static magnetic field on mutagenesis in in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Ikehata, M; Yoshie, S; Hayakawa, T [Railway Technical Research Institute, Kokubunji, Tokyo 185-8540 (Japan); Hirota, N [Nano Materials Center, National Institute for Materials Science, Tsukuba, Ibaraki 277-8561 (Japan)], E-mail: ikehata@rtri.or.jp

    2009-03-01

    Effects of static magnetic field up to 13 T were estimated in Escherichia coli and Saccharomyces cerevisiae. We observed that exposure to a 5 T static magnetic field resulted in a slight but significant increase in gene recombination frequency while frequency of reverse point mutation was not altered in S. cerevisiae. This mutagenic effect showed a dose response relationship as J-shape. To investigate an involvement of reactive oxygen species in possible mutagenic effect of static magnetic field, SOD deficient E. coli QC774 was used in thymine synthesis-based mutation assay. The result shows that static magnetic field up to 13 T did not indicate mutagenicity. Thus, it is suggested that frequency of point mutation does not changed under static magnetic field regardless of its susceptibility to superoxide. These results suggest that strong static magnetic field would have small but detectable mutagenic potential. Although mechanism of the mutagenic effect of static magnetic field has not been elucidated yet, the extent of this effect is estimated extremely small by comparison with other mutagens such as ultraviolet irradiation.

  6. Pre-exposure to moving form enhances static form sensitivity.

    Directory of Open Access Journals (Sweden)

    Thomas S A Wallis

    Full Text Available BACKGROUND: Motion-defined form can seem to persist briefly after motion ceases, before seeming to gradually disappear into the background. Here we investigate if this subjective persistence reflects a signal capable of improving objective measures of sensitivity to static form. METHODOLOGY/PRINCIPAL FINDINGS: We presented a sinusoidal modulation of luminance, masked by a background noise pattern. The sinusoidal luminance modulation was usually subjectively invisible when static, but visible when moving. We found that drifting then stopping the waveform resulted in a transient subjective persistence of the waveform in the static display. Observers' objective sensitivity to the position of the static waveform was also improved after viewing moving waveforms, compared to viewing static waveforms for a matched duration. This facilitation did not occur simply because movement provided more perspectives of the waveform, since performance following pre-exposure to scrambled animations did not match that following pre-exposure to smooth motion. Observers did not simply remember waveform positions at motion offset, since removing the waveform before testing reduced performance. CONCLUSIONS/SIGNIFICANCE: Motion processing therefore interacts with subsequent static visual inputs in a way that can improve performance in objective sensitivity measures. We suggest that the brief subjective persistence of motion-defined forms that can occur after motion offsets is a consequence of the decay of a static form signal that has been transiently enhanced by motion processing.

  7. An eigen theory of static electromagnetic field for anisotropic media

    Institute of Scientific and Technical Information of China (English)

    Shao-hua GUO

    2009-01-01

    Static electromagnetic fields are studied based on standard spaces of the physical presentation,and the modal equations of static electromagnetic fields for anisotropic media are derived. By introducing a new set of first-order potential functions,several novel theoretical results are obtained. It is found that,for isotropic media,electric or magnetic potentials are scalar; while for anisotropic media,they are vectors. Magnitude and direction of the vector potentials are related to the anisotropic subspaces. Based on these results,we discuss the laws of static electromagnetic fields for anisotropic media.

  8. Another look at Statics and Dynamics of Switching Power Converters

    Science.gov (United States)

    Sasaki, Seigo; Watanabe, Haruo

    Three types of switching power supply, which are buck, boost, buck/boost converter, are statically and dynamically analysed. A framework of large signal analysis presents characteristics of converters which vary with operating points, and discusses a relationship between statics and dynamics. It is shown that boost and buck/boost converters substantially change their characteristics. There exists the operating points where for low frequencies the phases become -90° or -180° and the gains fall off to low values. The phenomenon is characterized by a zero of transfer function of the converter and also by the statics.

  9. Axisymmetric Natural Frequencies of Statically Loaded Annular Plates

    Directory of Open Access Journals (Sweden)

    Eihab M. Abdel-Rahman

    2003-01-01

    Full Text Available We present a numerical procedure to solve the axisymmetric vibration problem of statically loaded annular plates. We use the von Kármán nonlinear plate model to account for large deformations and study the effect of static deflections on the natural frequencies and mode shapes for six combinations of boundary conditions. The shooting method is used to solve the resulting eigenvalue problem. Our results show that static deformations have a significant effect on the natural frequencies and small effect on the mode shapes of the plate. Further, the results show that the presence of in-plane stresses has a significant effect on the natural frequencies.

  10. Complete classification of spherically symmetric static spacetimes via Noether symmetries

    CERN Document Server

    Ali, Farhad; Ali, Sajid

    2013-01-01

    In this paper we give a complete classification of spherically symmetric static space-times by their Noether symmetries. The determining equations for Noether symmetries are obtained by using the usual Lagrangian of a general spherically symmetric static spacetime which are integrated for each case. In particular we observe that spherically symmetric static spacetimes are categorized into six distinct classes corresponding to Noether algebra of dimensions 5, 6, 7, 9, 11 and 17. Using Noether`s theorem we also write down the first integrals for each class of such spacetimes corresponding to their Noether symmetries.

  11. Static sensitivity calculation of a novel fiber optic biosensor

    Institute of Scientific and Technical Information of China (English)

    Zhongchen Bai; Shuijie Qin; Jing Li; Dashun Huang; Xin Zhang

    2008-01-01

    A novel structure of fiber optic biosensor and its principle are introduced. The sample is detected in microchannels of several microns diameter in fiber optic biosensors. The relation between the optic fiber tapered angle and the fluorescence incident angle is calculated in signal receiving part. As the sensor is a zero-order system, calculating formula of the static sensitivity is derived. When ZnSe nano-crystalline cluster is used for marking the molecules, the static sensitivity for fiber optic biosensors is calculated. At the same time, the relation between the static sensitivity and the ratio of exciting wavelength to fluorescence wavelength is presented.

  12. Characterization of Acryl amide Resins Using Static Light Scattering

    Science.gov (United States)

    Libi, Sumit; Norwood, David

    2012-02-01

    Our research is based on the use of light scattering technique for the characterization of known and unknown particles within a liquid. The research focused specifically on the detection of resin polymer that may be present in the given samples using static light scattering. The sample was delivered into a high performance liquid chromatography system with static light scattering, refractive index and viscosity detectors. Static Light scattering measures the intensity of the light scattered as the function of scattering angle and polymer sample concentration. Based on these results the molecular weight and radius of gyration of the given sample can be calculated.

  13. OPTIMASI KINERJA PROTOKOL AODV DENGAN STATIC INTERSECTION NODE

    Directory of Open Access Journals (Sweden)

    Johan Ericka Wahyu Prakasa

    2016-07-01

    Full Text Available VANET adalah sebuah pengembangan teknologi yang memungkinkan komunikasi antar kendaraan meskipun tidak terdapat koneksi secara langsung antara kendaraan yang berkomunikasi. Untuk meningkatkan performa protokol routing, maka pada penelitian ini akan ditambahkan SIN (Static Intersection Node. Static Intersection Node adalah RSU (Road Side Unit yang diletakkan di persimpangan jalan (intersection. Fungsi dari Static Intersection Node pada penelitian ini adalah sebagai repeater untuk membantu mengirimkan paket data ke kendaraan lain yang berada disekitarnya sehingga dapat meningkatkan Packet Delivery Ratio serta meminimalkan Packet Loss dan End to End Delay.

  14. QUASI-STATIC ANALYSIS FOR VISCOELASTIC TIMOSHENKO BEAMS WITH DAMAGE

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Based on convolution-type constitutive equations for linear viscoelastic materials with damage and the hypotheses of Timoshenko beams, the equations governing quasi-static and dynamical behavior of Timoshenko beams with damage were first derived. The quasi-static behavior of the viscoelastic Timoshenko beam under step loading was analyzed and the analytical solution was obtained in the Laplace transformation domain. The deflection and damage curves at different time were obtained by using the numerical inverse transform and the influences of material parameters on the quasi-static behavior of the beam were investigated in detail.

  15. Static sampling of dynamic processes - a paradox?

    Science.gov (United States)

    Mälicke, Mirko; Neuper, Malte; Jackisch, Conrad; Hassler, Sibylle; Zehe, Erwin

    2017-04-01

    Environmental systems monitoring aims at its core at the detection of spatio-temporal patterns of processes and system states, which is a pre-requisite for understanding and explaining their baffling heterogeneity. Most observation networks rely on distributed point sampling of states and fluxes of interest, which is combined with proxy-variables from either remote sensing or near surface geophysics. The cardinal question on the appropriate experimental design of such a monitoring network has up to now been answered in many different ways. Suggested approaches range from sampling in a dense regular grid using for the so-called green machine, transects along typical catenas, clustering of several observations sensors in presumed functional units or HRUs, arrangements of those cluster along presumed lateral flow paths to last not least a nested, randomized stratified arrangement of sensors or samples. Common to all these approaches is that they provide a rather static spatial sampling, while state variables and their spatial covariance structure dynamically change in time. It is hence of key interest how much of our still incomplete understanding stems from inappropriate sampling and how much needs to be attributed to an inappropriate analysis of spatial data sets. We suggest that it is much more promising to analyze the spatial variability of processes, for instance changes in soil moisture values, than to investigate the spatial variability of soil moisture states themselves. This is because wetting of the soil, reflected in a soil moisture increase, is causes by a totally different meteorological driver - rainfall - than drying of the soil. We hence propose that the rising and the falling limbs of soil moisture time series belong essentially to different ensembles, as they are influenced by different drivers. Positive and negative temporal changes in soil moisture need, hence, to be analyzed separately. We test this idea using the CAOS data set as a benchmark

  16. A Transformational Approach to Parametric Accumulated-Cost Static Profiling

    DEFF Research Database (Denmark)

    Haemmerlé, Rémy; López García, Pedro; Liqat, Umer

    2016-01-01

    Traditional static resource analyses estimate the total resource usage of a program, without executing it. In this paper we present a novel resource analysis whose aim is instead the static profiling of accumulated cost, i.e., to discover, for selected parts of the program, an estimate or bound...... of the resource usage accumulated in each of those parts. Traditional resource analyses are parametric in the sense that the results can be functions on input data sizes. Our static profiling is also parametric, i.e., our accumulated cost estimates are also parameterized by input data sizes. Our proposal is based...... on the concept of cost centers and a program transformation that allows the static inference of functions that return bounds on these accumulated costs depending on input data sizes, for each cost center of interest. Such information is much more useful to the software developer than the traditional resource...

  17. Fast static field CIPT mapping of unpatterned MRAM film stacks

    Science.gov (United States)

    Kjaer, Daniel; Hansen, Ole; Hartmann Henrichsen, Henrik; Chenchen, Jacob Wang; Noergaard, Kristian; Folmer Nielsen, Peter; Hjorth Petersen, Dirch

    2015-04-01

    While investigating uniformity of magnetic tunnel junction (MTJ) stacks we find experimentally and analytically that variation in the resistance area product (RA) is more important to monitor as compared to the tunnel magnetoresistance (TMR), which is less sensitive to MTJ variability. The standard Current In-Plane Tunneling (CIPT) method measures both RA and TMR, but the usefulness for uniformity mapping, e.g. for tool optimization, is limited by excessive measurement time. Thus, we develop and demonstrate a fast complementary static magnetic field method focused only on measurement of RA. We compare the static field method to the standard CIPT method and find perfect agreement between the extracted RA values and measurement repeatability while the static field method is several times faster. The static field CIPT method is demonstrated for 200 mm wafer mapping showing radial as well as asymmetrical variations related to the MTJ deposition conditions.

  18. Effects of Static Stretching and Playing Soccer on Knee Laxity

    NARCIS (Netherlands)

    Baumgart, Christian; Gokeler, Alli; Donath, Lars; Hoppe, Matthias W.; Freiwald, Juergen

    2015-01-01

    Objective: This study investigated exercise-induced effects of static stretching and playing soccer on anterior tibial translation (ATT) of the knee joint. Design: Randomized controlled trial. Setting: University biomechanics laboratory. Participants: Thirty-one athletes were randomly assigned into

  19. Static and Dynamic Views of Culture and Intercultural Language Acquisition.

    Science.gov (United States)

    Liddicoat, Anthony J.

    2002-01-01

    Discusses the importance of teaching culture in the second language classroom. Examines the difference between teaching the static or dynamic view of culture. Focuses on intercultural language teaching and developing intercultural competence. (Author/VWL)

  20. Separation distance and static transmission error of involute spur gears

    Science.gov (United States)

    Tse, David K.; Lin, Hsiang H.

    1992-01-01

    The effects of separation distance and deflection of gear teeth on the static transmission error of involute spur gears are investigated. In this paper, only low-contact-ratio gears with true involute profile are studied. Gear ratio and tooth addendum are varied to examine their effects on the separation distance and static transmission error. Results obtained from the investigation shows that the contact ratio and static transmission error are affected significantly if considering the separation distance. In general, the magnitude of contact ratio has been increased and the variation of static transmission error has been smoothed. The most significant change occurs for a gear pair with a theoretical contact ratio close to 1.95.

  1. Separation distance and static transmission error of involute spur gears

    Science.gov (United States)

    Tse, David K.; Lin, Hsiang H.

    1992-07-01

    The effects of separation distance and deflection of gear teeth on the static transmission error of involute spur gears are investigated. In this paper, only low-contact-ratio gears with true involute profile are studied. Gear ratio and tooth addendum are varied to examine their effects on the separation distance and static transmission error. Results obtained from the investigation shows that the contact ratio and static transmission error are affected significantly if considering the separation distance. In general, the magnitude of contact ratio has been increased and the variation of static transmission error has been smoothed. The most significant change occurs for a gear pair with a theoretical contact ratio close to 1.95.

  2. Person Identification System using Static-dynamic signatures fusion

    Directory of Open Access Journals (Sweden)

    S.A Daramola

    2010-09-01

    Full Text Available Off-line signature verification systems rely on static image of signature for person identification. Imposter can easily imitate the static image of signature of the genuine user due to lack of dynamic features. This paper proposes person identity verification system using fused static-dynamic signature features. Computational efficient technique is developed to extract and fuse static and dynamic features extracted from offline and online signatures of the same person. The training stage used the fused features to generate couple reference data and classification stage compared the couple test signatures with the reference data based on the set threshold values. The system performance is encouraging against imposter attacker in comparison with previous single sensor offline signature identification systems.

  3. Effects of Static Stretching and Playing Soccer on Knee Laxity

    NARCIS (Netherlands)

    Baumgart, Christian; Gokeler, Alli; Donath, Lars; Hoppe, Matthias W.; Freiwald, Juergen

    2015-01-01

    Objective: This study investigated exercise-induced effects of static stretching and playing soccer on anterior tibial translation (ATT) of the knee joint. Design: Randomized controlled trial. Setting: University biomechanics laboratory. Participants: Thirty-one athletes were randomly assigned into

  4. Supporting secure programming in web applications through interactive static analysis

    National Research Council Canada - National Science Library

    Zhu, Jun; Xie, Jing; Lipford, Heather Richter; Chu, Bill

    2014-01-01

    .... Static analysis tools have been used to detect software vulnerabilities. However, their wide usage by developers is limited by the special training required to write rules customized to application-specific logic...

  5. HIRENASD Experimental Data, Static Cp Plots and Data files

    Data.gov (United States)

    National Aeronautics and Space Administration — Tecplot (ascii) and matlab files are posted here for the Static pressure coefficient data sets. To download all of the data in either tecplot format or matlab...

  6. Thévenin equivalent based static contingency assessment

    DEFF Research Database (Denmark)

    2015-01-01

    The present invention relates to a method for static security assessment of a power system and a real time static security assessment system for assessing a power system, the power system having a plurality of generators, the plurality of generators being represented in the network by a plurality...... of voltage controlled nodes, wherein the method for static security assessment of the power system comprises receiving information of a present state of the power system, determining a Thevenin equivalent for each voltage controlled node, determining for each voltage controlled node on basis......, and evaluating the voltage angles to determine whether the network having at least one contingency admit a steady state. Also a method of providing information on a real time static security assessment of a power system is disclosed....

  7. Passive Elimination of Static Electricity in Oil Industry

    Directory of Open Access Journals (Sweden)

    Mićo Gaćanović

    2015-04-01

    Full Text Available This study explains the existing and real conditions of a possible passive elimination of static electricity when loading oil and oil derivatives. We are considering the formation and survival of gas bubbles both in the volume of oil in its depth, but also at the surface of oil and oil derivatives of the partly filled reservoir, and formation of both volume and surface electric charge in oil and oil derivatives. The study presents the research of formation and survival of static electricity in both reservoirs and tank trucks of different geometric shapes partly filled with oil and oil derivatives. We are proposing a new original possibility of passive elimination of static electricity when loading oil and oil derivatives in reservoirs and tank trucks. The proposed passive device for elimination of static electricity is protected at the international level in the domain of intellectual property (with a patent, model and distinctive mark.

  8. Passive elimination of static electricity in oil industry

    Directory of Open Access Journals (Sweden)

    Gaćanović Mićo

    2014-01-01

    Full Text Available This study explains the existing and real conditions of a possible passive elimination of static electricity when loading oil and oil derivatives. We are considering the formation and survival of gas bubbles both in the volume of oil in its depth, but also at the surface of oil and oil derivatives of the partly filled reservoir, and formation of both volume and surface electric charge in oil and oil derivatives. The study presents the research of formation and survival of static electricity in both reservoirs and tank trucks of different geometric shapes partly filled with oil and oil derivatives. We are proposing a new original possibility of passive elimination of static electricity when loading oil and oil derivatives in reservoirs and tank trucks. The proposed passive device for elimination of static electricity is protected at the international level in the domain of intellectual property (with a patent, model and distinctive mark.

  9. Interaction mechanisms and biological effects of static magnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Tenforde, T.S.

    1994-06-01

    Mechanisms through which static magnetic fields interact with living systems are described and illustrated by selected experimental observations. These mechanisms include electrodynamic interactions with moving, ionic charges (blood flow and nerve impulse conduction), magnetomechanical interactions (orientation and translation of molecules structures and magnetic particles), and interactions with electronic spin states in charge transfer reactions (photo-induced electron transfer in photosynthesis). A general summary is also presented of the biological effects of static magnetic fields. There is convincing experimental evidence for magnetoreception mechanisms in several classes of lower organisms, including bacteria and marine organisms. However, in more highly evolved species of animals, there is no evidence that the interactions of static magnetic fields with flux densities up to 2 Tesla (1 Tesla [T] = 10{sup 4} Gauss) produce either behavioral or physiolocical alterations. These results, based on controlled studies with laboratory animals, are consistent with the outcome of recent epidemiological surveys on human populations exposed occupationally to static magnetic fields.

  10. Einstein's conversion from his static to an expanding universe

    CERN Document Server

    Nussbaumer, Harry

    2013-01-01

    In 1917 Einstein initiated modern cosmology by postulating, based on general relativity, a homogeneous, static, spatially curved universe. To counteract gravitational contraction he introduced the cosmological constant. In 1922 Alexander Friedman showed that Einstein's fundamental equation also allowed dynamical worlds, and in 1927 Geroges Lemaitre, backed by observational evidence, concluded that our universe was expanding. Einstein impetuously rejected Friedman's as well as Lemaitre's findings. However, in 1931 he retracted his former static model in favour of a dynamic solution. This investigation follows Einstein on his hesitating path from a static to the expanding universe. Contrary to an often repeated belief the primary motive for his switch was not observational evidence, but the realisation that his static model was unstable.

  11. Static and kinematic formulation of planar reciprocal assemblies

    DEFF Research Database (Denmark)

    Parigi, Dario; Sassone, Mario; Kirkegaard, Poul Henning

    2014-01-01

    Planar reciprocal frames are two dimensional structures formed by elements joined together according to the principle of structural reciprocity. In this paper a rigorous formulation of the static and kinematic problem is proposed and developed extending the theory of pin-jointed assemblies....... This formulation is used to evaluate the static and kinematic determinacy of reciprocal assemblies from the properties of their equilibrium and kinematic matrices...

  12. Static Facial Slings: Approaches to Rehabilitation of the Paralyzed Face.

    Science.gov (United States)

    Langille, Morgan; Singh, Prabhjyot

    2016-02-01

    Facial paralysis results from a variety of different causes. Patients with facial paralysis have cosmetic and functional defects that significantly affect quality of life. Surgical intervention has the potential to help improve cosmetic and functional outcomes. The 2 main categories of surgical rehabilitation are static and dynamic surgical procedures. Static rehabilitation of the midface is typically performed using autologous tissue grafts, allografts, synthetic grafts, permanent suspension sutures, and a novel technique using percutaneous suture-based slings.

  13. Static Standing Balance in Adolescents with Down Syndrome

    Science.gov (United States)

    Villarroya, M. Adoracion; Gonzalez-Aguero, Alejandro; Moros-Garcia, Teresa; de la Flor Marin, Mario; Moreno, Luis A.; Casajus, Jose A.

    2012-01-01

    Aim: To analyse static-standing-balance of adolescents with Down syndrome (DS). Methods: Thirty-two adolescents with DS aged 10-19 years (DSG); 33 adolescents, age/sex-matched, without DS (CG). Static-standing-balance under four conditions (C1: open-eyes/fixed-foot-support; C2: closed-eyes/fixed-foot-support; C3: open-eyes/compliant-foot-support;…

  14. Problem Handling and Improvement of Imported SCR Static Excitation System

    Institute of Scientific and Technical Information of China (English)

    Hao Shanwu; Li Weimin; Liang Jianfen; Chu Xue

    2006-01-01

    @@ Static self-excitation system has been more and more widely used for large turbogenerator units in China and achieved very good results in recent years. However, new problems have arisen along with the development of high-power thyristor technology, etc. In view of the actual operating condition of SEE900/5000 SCR static excitation system imported from Siemens, Germany, some technical renovations were carried out.

  15. New Sufficient LMI Conditions for Static Output Stabilization

    DEFF Research Database (Denmark)

    Adegas, Fabiano Daher

    2014-01-01

    This paper presents new linear matrix inequality conditions to the static output feedback stabilization problem. Although the conditions are only sufficient, numerical experiments show excellent success rates in finding a stabilizing controller.......This paper presents new linear matrix inequality conditions to the static output feedback stabilization problem. Although the conditions are only sufficient, numerical experiments show excellent success rates in finding a stabilizing controller....

  16. Extending Graphic Statics for User-Controlled Structural Morphogenesis

    OpenAIRE

    Fivet, Corentin; Zastavni, Denis; Cap, Jean-François; Structural Morphology Group International Seminar 2011

    2011-01-01

    The first geometrical definitions of any structure are of primary importance when considering pertinence and efficiency in structural design processes. Engineering history has taught us how graphic statics can be a very powerful tool since it allows the designer to take shapes and forces into account simultaneously. However, current and past graphic statics methods are more suitable for analysis than structural morphogenesis. This contribution introduces new graphical methods that can supp...

  17. Static power dissipation in adder circuits: the UDSM domain

    Science.gov (United States)

    Cayouette, Steve; Al-Khalili, Dhamin

    2009-05-01

    This paper presents adder circuits of various architectures aimed at reducing static power dissipation. Circuit topologies for basic building blocks were evaluated for fabrication technologies of 65nm down to 32nm, and simulation results are presented. This work has lead to the development of various low power adder circuits and provides comparative analysis leading to the recommendation that a variable size block carry select adder is the best performer, taking into consideration both static and dynamic power dissipation.

  18. Static and rotating solutions for vector-Galileon theories

    Science.gov (United States)

    Cisterna, Adolfo; Hassaine, Mokhtar; Oliva, Julio; Rinaldi, Massimiliano

    2016-11-01

    We consider a particular truncation of the generalized Proca field theory in four dimensions for which we construct static and axisymmetric rotating black hole "stealth solutions," namely solutions with (anti) de Sitter or Kerr metric but nontrivial vector field. The static configuration is promoted to a backreacting black hole with asymptotic (anti) de Sitter behavior by turning on a nonlinear electrodynamic source given as a fixed power of the Maxwell invariant. Finally we extend our solutions to arbitrary dimensions.

  19. Static and rotating solutions for Vector-Galileon theories

    CERN Document Server

    Cisterna, Adolfo; Oliva, Julio; Rinaldi, Massimiliano

    2016-01-01

    We consider a particular truncation of the generalized Proca field theory in four dimensions for which we construct a static and axisymmetric rotating black hole "stealth solutions", namely solutions with (Anti) de Sitter or Kerr metric but non-trivial vector field. The static configuration is promoted to a backreacting black hole with asymptotic (Anti) de Sitter behavior by turning on a nonlinear electrodynamic source given as a fixed power of the Maxwell invariant. Finally we extend our solutions to arbitrary dimensions.

  20. New static spheroidal solution in Jordan-Brands-Dicke theory

    CERN Document Server

    Kozyrev, S M

    2010-01-01

    The static spheroidal solutions of Jordan-Brands-Dicke theory (JBD) are studied. We consider the effect of the anisotropic stresses of scalar field on the shape of JBD self-graviting objects. It is shown that scalar fields can have significant effect on the structure and properties of self-graviting objects. In contrast with general relativity in JBD theory there are nonflat static spheroidal solutions.

  1. Global test of seismic static stress triggering model

    Institute of Scientific and Technical Information of China (English)

    万永革; 吴忠良; 周公威; 黄静; 秦立新

    2002-01-01

    Seismic static stress triggering model is tested using Harvard centroid moment tensor (CMT) solution catalogue of 1976~2000 and concept of (earthquake doublet(. Result shows that seismic static stress triggering effect does exist in the view of global earthquakes, but the effect is very weak. Dividing the earthquakes into thrust focal mechanism, normal focal mechanism, strike-slip focal mechanism, we find that non-strike-slip focal mechanism earthquakes have significant triggering effect, whereas, the triggering effect in strike-slip focal mechanism earthquakes is not obvious. Divided the subsequent events delay time of (earthquake doublet( into 5 classes of t(1, t<1, t(10, t<10, 1(t(10 (t is in unit of d), then seismic static stress triggering effect does not change with delay time in short time period after earthquakes. The research on seismic static stress triggering in different regions of the world indicates that triggering effect is significant in subduction belts. Seismic static stress triggering model is tested by using (earthquake doublets( in China and its adjacent region. The result indicates that seismic static stress triggering effect cannot be observed easily in China and its adjacent region due to the seismic focal mechanism type (most of the earthquakes are strike-slip earthquakes).

  2. Characteristics of enzyme hydrolysis of cellulose under static condition.

    Science.gov (United States)

    Taneda, Daisuke; Ueno, Yoshiki; Ikeo, Makoto; Okino, Shohei

    2012-10-01

    The effect of enzyme loading under static and agitated conditions was investigated. Enzymatic hydrolysis of 10 w/v% de-lignified cellulose slurry such as filter paper, avicel and pulp was conducted under agitated (120 rpm) and static condition, and the enzyme loading ranging from 1.2 to 120 mg-protein/g-dry substrate. Under the agitated condition, the final sugar concentration decreased with the decreasing enzyme loading. Under the static condition, the final sugar concentration was maintained even if the enzyme loading was decreased. The above phenomenon was caused by a rapid precipitation of cellobiohydrolase 2 (CBH2) under the agitated condition, which was not observed under the static condition. The hydrolysis experiments using enzymes containing different ratios of cellobiohydrolase 1 (CBH1) and CBH2 under the static condition suggested that preservation of CBH2 and its synergism with CBH1 is essential for static condition's characteristics, and for efficient hydrolysis of cellulose. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. Static and dynamic balance deficiencies in chronic low back pain.

    Science.gov (United States)

    Tsigkanos, Christos; Gaskell, Lynne; Smirniotou, Athanasia; Tsigkanos, Georgios

    2016-11-21

    According to previously conducted studies, people with Low Back Pain (LBP) present with static balance deficiencies. The aim of the present study was to compare static, as well as dynamic balance ability between Chronic Low Back Pain (CLBP) and healthy subjects. The CLBP group comprised 17 subjects and the control group of 16 subjects, matched for age, BMI and gender. The protocol applied compared the balance ability when performing the Star Excursion Balance Test (SEBT) and the static 1-leg stance position. The innovation introduced in the protocol was that the participants performed not only the static 1-leg stance, but also the dynamic SEBT on a force plate which recorded the target sway (TS), i.e. the Center of Pressure (CoP) excursion. The CLBP group had significantly reduced performance in SEBT, coupled with greater static and dynamic TS values. Age and especially BMI also bear a significant effect on SEBT execution. The inclusion of SEBT and TS derived scores in a stepwise logistic regression equation lead to the correct classification of 85% of the subjects. Dynamic and static balance ability provide supplementary information for the identification of the presence of CLBP, with dynamic balance being more instrumental.

  4. The Estimation and Inversion of Magnetotelluric Data with Static Shift

    Science.gov (United States)

    Wang, X.; Zhou, J.; Zhang, J.; Min, G.; Xia, S.

    2015-12-01

    IntroductionIn magnetotelluric sounding data processing, the static shift correction is one of the most important steps. Due to the complexity of near-surface inhomogeneous bodies distribution, it is difficult to estimate the static shift of measured data. For this problem, we put forward on the basis of the inversion model for static shift estimation, and reconstructed the initial model with using the original data for 2D or 3D inversion. Estimation and Inversion methodThe magnetotelluric impedance phase has the characteristics of not influenced by the static shift in Two-dimensional electrical structure. The objective function for static shift estimation can be constructed based on impedance phase data. On the basis of normal inversion, utilizing one-dimensional linear search algorithm, combined with the forward modeling, the MT static shift can be estimated.Using estimation results for translation of anomaly measured curve. According to the inversion(1-D) of these translated curve, the initial model for two-dimensional or two-dimensional inversion can be reconstructed. On this basis, we do inversion for the original data, which not only can effectively eliminate the influence of static shift on the deep structure of inversion model, but also can get the right shallow electrical structure in the inversionConclusionThe estimation value of static shift based on impedance phase can be close to the true value. This estimation results can be used to modify the initial model, which makes the deep electric structure of the model more reasonable. On this basis, the inversion of the original data can ensure the correctness of the final inversion results (including shallow and deep).Acknowledgement This paper is supported by National Natural Science Foundation (41274078) and National 863 High Technology Research and Development Program (2014AA06A612).Reference[1] deGroot-Hedlin C. Removal of static shift in two dimensions by regularized inversion[J]. Geophysics, 1991, 56

  5. STATIC{sub T}EMP: a useful computer code for calculating static formation temperatures in geothermal wells

    Energy Technology Data Exchange (ETDEWEB)

    Santoyo, E. [Universidad Nacional Autonoma de Mexico, Centro de Investigacion en Energia, Temixco (Mexico); Garcia, A.; Santoyo, S. [Unidad Geotermia, Inst. de Investigaciones Electricas, Temixco (Mexico); Espinosa, G. [Universidad Autonoma Metropolitana, Co. Vicentina (Mexico); Hernandez, I. [ITESM, Centro de Sistemas de Manufactura, Monterrey (Mexico)

    2000-07-01

    The development and application of the computer code STATIC{sub T}EMP, a useful tool for calculating static formation temperatures from actual bottomhole temperature data logged in geothermal wells is described. STATIC{sub T}EMP is based on five analytical methods which are the most frequently used in the geothermal industry. Conductive and convective heat flow models (radial, spherical/radial and cylindrical/radial) were selected. The computer code is a useful tool that can be reliably used in situ to determine static formation temperatures before or during the completion stages of geothermal wells (drilling and cementing). Shut-in time and bottomhole temperature measurements logged during well completion activities are required as input data. Output results can include up to seven computations of the static formation temperature by each wellbore temperature data set analysed. STATIC{sub T}EMP was written in Fortran-77 Microsoft language for MS-DOS environment using structured programming techniques. It runs on most IBM compatible personal computers. The source code and its computational architecture as well as the input and output files are described in detail. Validation and application examples on the use of this computer code with wellbore temperature data (obtained from specialised literature) and with actual bottomhole temperature data (taken from completion operations of some geothermal wells) are also presented. (Author)

  6. How Static Is the Statics Classroom? An Investigation into How Innovations, Specifically Research-Based Instructional Strategies, Are Adopted into the Statics Classroom

    Science.gov (United States)

    Cutler, Stephanie Leigh

    2013-01-01

    The purpose of this dissertation is to investigate how educational research, specifically Research-Based Instructional Strategies (RBIS), is adopted by education practice, specifically within the engineering Statics classroom. Using a systematic approach, changes in classroom teaching practices were investigated from the instructors' perspective.…

  7. Thermal stabilization of static single-mirror Fourier transform spectrometers

    Science.gov (United States)

    Schardt, Michael; Schwaller, Christian; Tremmel, Anton J.; Koch, Alexander W.

    2017-05-01

    Fourier transform spectroscopy has become a standard method for spectral analysis of infrared light. With this method, an interferogram is created by two beam interference which is subsequently Fourier-transformed. Most Fourier transform spectrometers used today provide the interferogram in the temporal domain. In contrast, static Fourier transform spectrometers generate interferograms in the spatial domain. One example of this type of spectrometer is the static single-mirror Fourier transform spectrometer which offers a high etendue in combination with a simple, miniaturized optics design. As no moving parts are required, it also features a high vibration resistance and high measurement rates. However, it is susceptible to temperature variations. In this paper, we therefore discuss the main sources for temperature-induced errors in static single-mirror Fourier transform spectrometers: changes in the refractive index of the optical components used, variations of the detector sensitivity, and thermal expansion of the housing. As these errors manifest themselves in temperature-dependent wavenumber shifts and intensity shifts, they prevent static single-mirror Fourier transform spectrometers from delivering long-term stable spectra. To eliminate these shifts, we additionally present a work concept for the thermal stabilization of the spectrometer. With this stabilization, static single-mirror Fourier transform spectrometers are made suitable for infrared process spectroscopy under harsh thermal environmental conditions. As the static single-mirror Fourier transform spectrometer uses the so-called source-doubling principle, many of the mentioned findings are transferable to other designs of static Fourier transform spectrometers based on the same principle.

  8. Comparison of static and dynamic properties in a shale rock

    Science.gov (United States)

    Bonnelye, Audrey; Pimienta, Lucas; Schubnel, Alexandre; David, Christian

    2017-04-01

    When trying to understand the elastic properties of rocks in order to ultimately compare laboratory and field data, two opposite measuring techniques can be used: the "static" and "dynamic" measurement techniques. The "static" measurement technique consists in characterising the medium by its strain response to an applied stress. The strain rate is generally low enough that the measurement can be addressed as static. Using ultrasonic wave velocity, the "dynamic" measurements are obtained. Those allow obtaining accurately the full set of elastic constants characterising the medium. However, such measuring procedure is at high frequency, implying the risk for dispersion and attenuation effects to occur. When comparing the "static" and "dynamic" measurements, and investigating their differences, the effect of the measuring frequency is often the parameter considered. However, it is not the only parameter that may play a role. Indeed, often, "static" measurements rely on strain amplitudes above 10-4. On the other hand, "dynamic" measurements rely on strain amplitudes below 10-6. Such difference may play an important role in comparing measurements in weak materials such as shales. For this particular rock, the effect of strain amplitude on the "static" measurements is investigated by decreasing the amplitude of stress variations. Moreover, due to both multiscale and sedimentary nature, shale materials can exhibit strong anisotropic properties, usually described as transversly isotropic. In this study we propose to compare the different ways of measuring elastic moduli of Tournemire shale (IRSN underground laboratory, Aveyron, Southern France). In a first part, static moduli were calculated on three sets of samples with different bedding orientations (90°, 0°, 45°) deformed under deviatoric pressure at different confining pressures (2.5, 5, 10, 20, 40, 80MPa). During these deformation experiments, elastic wave velocities were continuously measured along different

  9. Are static and dynamic kinematics comparable after total knee arthroplasty?

    Science.gov (United States)

    Saevarsson, Stefan K; Romeo, Carolina I; Anglin, Carolyn

    2013-04-05

    Knee kinematics provide information about how the femoral, tibial and patellar bones or prosthetic components move relative to each other. Accurate knowledge of kinematics is valuable for implant design, comparisons between designs or surgical techniques, and to identify differences between patients with good and poor outcomes. Both static and dynamic imaging techniques have been used to evaluate kinematics. In general, static imaging is used to capture better quality images or to capture views that cannot be acquired by dynamic imaging, whereas dynamic imaging is used to capture real-life movements. How well static kinematics represent dynamic kinematics is subject to frequent debate and has not been adequately addressed, especially after total knee arthroplasty (TKA). We compared the static and dynamic weightbearing kinematics of 10 female subjects after TKA. Using the same clinical scanner for both methods, static images were taken using our standard protocol, sequential-biplane radiographs at multiple flexion angles, as well as with dynamic video fluoroscopy during a step up activity. The static method can reliably measure all 12 degrees of freedom (DOF) after TKA, however only seven were compared due to the poorer out-of-plane reliability in the single-plane dynamic imaging. No differences were found between the static and dynamic kinematics for nine out of ten subjects. For one subject, however, a difference of 5-8° in internal/external tibial rotation was found. The research question, study purpose and the advantages and disadvantages of each method need to be considered when determining which imaging method to use.

  10. Static and Dynamic Handgrip Strength Endurance: Test-Retest Reproducibility.

    Science.gov (United States)

    Gerodimos, Vassilis; Karatrantou, Konstantina; Psychou, Dimitra; Vasilopoulou, Theodora; Zafeiridis, Andreas

    2017-03-01

    This study investigated the reliability of static and dynamic handgrip strength endurance using different protocols and indicators for the assessment of strength endurance. Forty young, healthy men and women (age, 18-22 years) performed 2 handgrip strength endurance protocols: a static protocol (sustained submaximal contraction at 50% of maximal voluntary contraction) and a dynamic one (8, 10, and 12 maximal repetitions). The participants executed each protocol twice to assess the test-retest reproducibility. Total work and total time were used as indicators of strength endurance in the static protocol; the strength recorded at each maximal repetition, the percentage change, and fatigue index were used as indicators of strength endurance in the dynamic protocol. The static protocol showed high reliability irrespective of sex and hand for total time and work. The 12-repetition dynamic protocol exhibited moderate-high reliability for repeated maximal repetitions and percentage change; the 8- and 10-repetition protocols demonstrated lower reliability irrespective of sex and hand. The fatigue index was not a reliable indicator for the assessment of dynamic handgrip endurance. Static handgrip endurance can be measured reliably using the total time and total work as indicators of strength endurance. For the evaluation of dynamic handgrip endurance, the 12-repetition protocol is recommended, using the repeated maximal repetitions and percentage change as indicators of strength endurance. Practitioners should consider the static (50% maximal voluntary contraction) and dynamic (12 repeated maximal repetitions) protocols as reliable for the assessment of handgrip strength endurance. The evaluation of static endurance in conjunction with dynamic endurance would provide more complete information about hand function. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  11. An Eigenstructure Assignment for a Static Synchronous Compensator

    Directory of Open Access Journals (Sweden)

    Ahmad N. Al-Husban

    2009-01-01

    Full Text Available Problem statement: Power flow through an AC transmission line is influenced by three basic electrical parameters, which are line impedance, magnitudes and phase-shift angle between the sending and receiving voltages. Therefore, the change in any of the three basic parameters means a change in the power flow through the transmission line. The aims of this research paper are: increase the power transfer capability of transmission systems, minimize the transmission losses, support a good voltage profile and retain system stability under large disturbances. Study the use of eigenstructure techniques for state feedback control of the power system static compensator. Therefore, the mathematical analysis was performed for eigenvector assignment, power flow transmission line and for the static compensator analysis based on the transformation of the three-phase into d-q frame. Approach: A novel control method for regulating the power system in case of abnormal conditions was carried out. The system considered is a static synchronous compensator. The study includes a detailed mathematical analysis of the impact of the shunt compensator on the power flow; investigation of the system constraints and their effects on the static compensator control; in addition simulation of static compensator to control a transmitted active power flow on the transmission line. The conducted method provides a way of constructing the state feedback gain matrix to satisfy a certain prescribed performance. Results: The solutions of the obtained equation were conducted using the computer simulation method for both open-loop and static compensator techniques. The result shows fast tracking of the power flow transient response when using the static compensator technique comparing with open-loop technique. However, the same trend of the behavior was observed for all cases. Conclusion: A new method for developing a parameterized feedback matrix that assigns a closed-loop prespecified

  12. Design and Analysis of AN Static Aeroelastic Experiment

    Science.gov (United States)

    Hou, Ying-Yu; Yuan, Kai-Hua; Lv, Ji-Nan; Liu, Zi-Qiang

    2016-06-01

    Static aeroelastic experiments are very common in the United States and Russia. The objective of static aeroelastic experiments is to investigate deformation and loads of elastic structure in flow field. Generally speaking, prerequisite of this experiment is that the stiffness distribution of structure is known. This paper describes a method for designing experimental models, in the case where the stiffness distribution and boundary condition of a real aircraft are both uncertain. The stiffness distribution form of the structure can be calculated via finite element modeling and simulation calculation and F141 steels and rigid foam are used to make elastic model. In this paper, the design and manufacturing process of static aeroelastic models is presented and a set of experiment model was designed to simulate the stiffness of the designed wings, a set of experiments was designed to check the results. The test results show that the experimental method can effectively complete the design work of elastic model. This paper introduces the whole process of the static aeroelastic experiment, and the experimental results are analyzed. This paper developed a static aeroelasticity experiment technique and established an experiment model targeting at the swept wing of a certain kind of large aspect ratio aircraft.

  13. Static friction between silicon nanowires and elastomeric substrates.

    Science.gov (United States)

    Qin, Qingquan; Zhu, Yong

    2011-09-27

    This paper reports the first direct measurements of static friction force and interfacial shear strength between silicon (Si) nanowires (NWs) and poly(dimethylsiloxane) (PDMS). A micromanipulator is used to manipulate and deform the NWs under a high-magnification optical microscope in real time. The static friction force is measured based on "the most-bent state" of the NWs. The static friction and interface shear strength are found to depend on the ultraviolet/ozone (UVO) treatment of PDMS. The shear strength starts at 0.30 MPa without UVO treatment, increases rapidly up to 10.57 MPa at 60 min of treatment and decreases for longer treatment. Water contact angle measurements suggest that the UVO-induced hydrophobic-to-hydrophilic conversion of PDMS surface is responsible for the increase in the static friction, while the hydrophobic recovery effect contributes to the decrease. The static friction between NWs and PDMS is of critical relevance to many device applications of NWs including NW-based flexible/stretchable electronics, NW assembly and nanocomposites (e.g., supercapacitors). Our results will enable quantitative interface design and control for such applications.

  14. REQUIREMENTS AND CONSTRUCTIVE DIFFERENCES OF A STATIC CONVERTER

    Directory of Open Access Journals (Sweden)

    Uskov A. E.

    2015-03-01

    Full Text Available In this article technical requirements to static converters are examined. We can treat as the basic parameters: efficiency and quality of a target voltage. Weight-dimensional parameters, reliability, maintainability are basic operational parameters, as well as target capacity, size of an starting and target voltage belong to key parameters of static converters. As a rule designing of converters is a uniform constructive complex. As at designing, time of an operating time until first failure is taken into account, time of guaranteed work of the separate elements included in the static converter, are determined on the statistical data. Failure of separate elements of parts of converters are possible because of internal (time of guaranteed work and external (short circuits, overloads factors. In the article we have offered the ways of reduction of influence of external factors (for example, we used high-speed automatic switches or iterative static converters in which parts of a power circuit were included in parallel. Using universal static converters allows raising some parameters of efficiency simultaneously. In the article we have also considered a scheme of the iterative converter with variable structure which allows (depending on start and target conditions or requirements forming an output capacity of the required level and quality without constructive change

  15. A systematic review on dynamic versus static distal tibiofibular fixation.

    Science.gov (United States)

    Inge, S Y; Pull Ter Gunne, A F; Aarts, C A M; Bemelman, M

    2016-12-01

    In the last couple of years dynamic fixation for syndesmosis injuries, using a suture-button technique, raised more interest due to its advantages over the static fixation. In the current systematic review suture-button fixation is compared to the traditionally applied static fixation in unstable ankle fractures accompanied with distal tibiofibular syndesmosis injury, including the functional outcome, post-operative complications, reoperation rate, recurrent diastasis and financial aspects. A computerized literature search using PubMed/MEDLINE and EMBASE was conducted in search of suitable articles between January 2006 and February 2016. A total of 4 suture-button studies, 5 suture-button vs. static fixation studies and 1 study discussing the financial aspects were identified. The AOFAS of 104 patients treated with the suture-button device was 91.08 points with an average study-follow up of 24.85 months. The AOFAS of 106 patients treated with a static fixation device was 87.95 with an average follow-up of 24.78 months. Removal of the suture-button device was reported in 10.5% of 229 patients and removal of the screws in 38.5%. Dynamic fixation demonstrated to be a viable alternative to the static fixation device, with lower reoperation rates and less complications. They can accurately stabilize the ruptured syndesmosis without device breakage or loss of reduction. 1A economic/decision. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Integrated dynamic and static tactile sensor: focus on static force sensing

    Science.gov (United States)

    Wettels, Nicholas; Pletner, Baruch

    2012-04-01

    Object grasping by robotic hands in unstructured environments demands a sensor that is durable, compliant, and responsive to static and dynamic force conditions. In order for a tactile sensor to be useful for grasp control in these, it should have the following properties: tri-axial force sensing (two shear plus normal component), dynamic event sensing across slip frequencies, compliant surface for grip, wide dynamic range (depending on application), insensitivity to environmental conditions, ability to withstand abuse and good sensing behavior (e.g. low hysteresis, high repeatability). These features can be combined in a novel multimodal tactile sensor. This sensor combines commercial-off-the-shelf MEMS technology with two proprietary force sensors: a high bandwidth device based on PZT technology and low bandwidth device based on elastomers and optics. In this study, we focus on the latter transduction mechanism and the proposed architecture of the completed device. In this study, an embedded LED was utilized to produce a constant light source throughout a layer of silicon rubber which covered a plastic mandrel containing a set of sensitive phototransistors. Features about the contacted object such as center of pressure and force vectors can be extracted from the information in the changing patterns of light. The voltage versus force relationship obtained with this molded humanlike finger had a wide dynamic range that coincided with forces relevant for most human grip tasks.

  17. How Static is the Statics Classroom? An investigation into how innovations, specifically Research-Based Instructional Strategies, are adopted into the Statics Classroom

    Science.gov (United States)

    Cutler, Stephanie Leigh

    The purpose of this dissertation is to investigate how educational research, specifically Research-Based Instructional Strategies (RBIS), is adopted by education practice, specifically within the engineering Statics classroom. Using a systematic approach, changes in classroom teaching practices were investigated from the instructors' perspective. Both researchers and practitioners are included in the process, combining efforts to improve student learning, which is a critical goal for engineering education. The study is divided into 3 stages and each is discussed in an individual manuscript. Manuscript 1 provides an assessment of current teaching practices; Manuscript 2 explores RBIS use by Statics instructors and perceived barriers of adoption; and Manuscript 3 evaluates adoption using Fidelity of Implementation. A common set of concurrent mixed methods was used for each stage of this study. A quantitative national survey of Statics instructors (n =166) and 18 qualitative interviews were conducted to examine activities used in the Statics classroom and familiarity with nine RBIS. The results of this study show that lecturing is the most common activity throughout Statics classrooms, but is not the only activity. Other common activities included working examples and students working on problems individually and in groups. As discussed by the interview participants, each of Rogers' characteristics influenced adoption for different reasons. For example, Complexity (level of difficulty with implementation of an RBIS) was most commonly identified as a barrier. His study also evaluated the Fidelity of Implementation for each RBIS and found it to be higher for RBIS that were less complex (in terms of the number of critical components). Many of the critical components (i.e. activities required for implementation, as described in the literature) were found to statistically distinguish RBIS users and non-users. This dissertation offers four contributions: (1) an

  18. On the stability of Einstein static universe in massive bigravity

    CERN Document Server

    Mousavi, M

    2016-01-01

    We study the static cosmological solutions and their stability in the framework of massive bigravity theory with Friedmann-Robertson-Walker (FRW) metrics. By the modification proposed in the cosmological equations subject to a perfect fluid we obtain new solutions interpreted as the Einstein static universe. It turns out that the non-vanishing size of initial scale factor of Einstein static universe depends on the non-vanishing three-dimensional spatial curvature of FRW metrics and also the graviton's mass. By dynamical system approach and numerical analysis, we find that the extracted solutions for closed an open universes can be stable for some ranges of equation of state parameter and the values of fraction of two scale factors.

  19. Black hole stereotyping: induced gravito-static polarization

    Science.gov (United States)

    Kol, Barak; Smolkin, Michael

    2012-02-01

    We discuss the black hole effective action and define its static subsector. We determine the induced gravito-static polarization constants (electric Love numbers) of static black holes (Schwarzschild) in an arbitrary dimension, namely the induced mass multipole as a result of an external gravitational field. We demonstrate that in 4d these constants vanish thereby settling a disagreement in the literature. Yet in higher dimensions these constants are non-vanishing, thereby disproving (at least in d > 4) speculations that black holes have no effective couplings beyond the point particle action. In particular, when l/( d-3) is half integral these constants demonstrate a (classical) renormalization flow consistent with the divergences of the effective field theory. In some other cases the constants are negative indicating a novel non-spherical instability. The theory of hypergeometric functions plays a central role.

  20. Determinacy in Static Analysis of jQuery

    DEFF Research Database (Denmark)

    Andreasen, Esben; Møller, Anders

    2014-01-01

    Static analysis for JavaScript can potentially help programmers find errors early during development. Although much progress has been made on analysis techniques, a major obstacle is the prevalence of libraries, in particular jQuery, which apply programming patterns that have detrimental conseque......Static analysis for JavaScript can potentially help programmers find errors early during development. Although much progress has been made on analysis techniques, a major obstacle is the prevalence of libraries, in particular jQuery, which apply programming patterns that have detrimental...... present a static dataflow analysis for JavaScript that infers and exploits determinacy information on-the-fly, to enable analysis of some of the most complex parts of jQuery. The techniques are implemented in the TAJS analysis tool and evaluated on a collection of small programs that use jQuery. Our...

  1. Static and Dynamic Sensory Comfort of Knit Underwear

    Institute of Scientific and Technical Information of China (English)

    MENG Xiang-ling; FANG Fang; ZHANG Wei-yuan

    2006-01-01

    In this paper relationships have been investigated between overall comfort estimate and five main factors on nine knit underwear at (29±2)℃ and relative humidity, (85±2)% .The values of thermal and moisture comfort rise obviously,yet the values of roughness, softness and tightness are near the static values after finishing movement. The analysis shows that the overall estimation has the negative correlation with the thermal and moisture comfort and the positive correlation with the roughness and softness under static state. After movement the effects on overall estimate of thermal and moisture increase. Oppositely, the effects of roughness and softness decrease. Overall estimation has positive correlation with tightness at static. But it has no evident effect on overall comfort after movement and 5-minute-rest according to this experiment. The relationships between tightness and thermal, moisture, roughness,softness were also discussed in this paper.

  2. Technology advancement of the static feed water electrolysis process

    Science.gov (United States)

    Schubert, F. H.; Wynveen, R. A.

    1977-01-01

    A program to advance the technology of oxygen- and hydrogen-generating subsystems based on water electrolysis was studied. Major emphasis was placed on static feed water electrolysis, a concept characterized by low power consumption and high intrinsic reliability. The static feed based oxygen generation subsystem consists basically of three subassemblies: (1) a combined water electrolysis and product gas dehumidifier module; (2) a product gas pressure controller and; (3) a cyclically filled water feed tank. Development activities were completed at the subsystem as well as at the component level. An extensive test program including single cell, subsystem and integrated system testing was completed with the required test support accessories designed, fabricated, and assembled. Mini-product assurance activities were included throughout all phases of program activities. An extensive number of supporting technology studies were conducted to advance the technology base of the static feed water electrolysis process and to resolve problems.

  3. Chloride permeability of concrete under static and repeated compressive loading

    Energy Technology Data Exchange (ETDEWEB)

    Saito, Mitsuru; Ishimori, Hiroshi [Kanazawa Inst. of Technology, Ishikawa (Japan)

    1995-05-01

    The chloride permeability of normal weight concrete subjected to static and repeated compressive loading was evaluated by using the AASHTO T277 test method. The results of concrete under static loading showed that the application of loads up to 90% of the ultimate strength had little effect on the chloride permeability. It was found from the results of concrete under repeated loading that load repetitions at the maximum stress levels of 60% or more caused the chloride permeability to increase significantly. The test results also indicated that the chloride permeability of concrete subjected to static and repeated loading increased at an increasing rate with its residual strain. The relation between the chloride permeability obtained and the cracking behavior of concrete previously reported was discussed.

  4. A New Static and Fatigue Compression Test Method for Composites

    DEFF Research Database (Denmark)

    Bech, Jakob Ilsted; Goutianos, Stergios; Løgstrup Andersen, Tom;

    2011-01-01

    the test through a mechanical mechanism, which automatically maintains the gripping pressure. The combined loading method has proven very efficient in static loading and is used in the new fixture which is specially designed for fatigue testing. Optimum gripping (shear loading) and alignment of the test......A new test method to determine the compressive properties of composite materials under both static and fatigue loading was developed. The novel fixture is based on the concept of transmitting the load by a fixed ratio of end-to-shear loading. The end-to-shear load ratio is kept fixed during...... coupon are achieved throughout the fatigue life. The fatigue strength obtained is more reliable because bending of the specimen due to poor gripping and alignment is minimised. The application of the new fixture to static and fatigue compression is demonstrated by using unidirectional carbon...

  5. The effect of static pressure on the inertial cavitation threshold.

    Science.gov (United States)

    Bader, Kenneth B; Raymond, Jason L; Mobley, Joel; Church, Charles C; Felipe Gaitan, D

    2012-08-01

    The amplitude of the acoustic pressure required to nucleate a gas or vapor bubble in a fluid, and to have that bubble undergo an inertial collapse, is termed the inertial cavitation threshold. The magnitude of the inertial cavitation threshold is typically limited by mechanisms other than homogeneous nucleation such that the theoretical maximum is never achieved. However, the onset of inertial cavitation can be suppressed by increasing the static pressure of the fluid. The inertial cavitation threshold was measured in ultrapure water at static pressures up to 30 MPa (300 bars) by exciting a radially symmetric standing wave field in a spherical resonator driven at a resonant frequency of 25.5 kHz. The threshold was found to increase linearly with the static pressure; an exponentially decaying temperature dependence was also found. The nature and properties of the nucleating mechanisms were investigated by comparing the measured thresholds to an independent analysis of the particulate content and available models for nucleation.

  6. Black hole stereotyping: Induced gravito-static polarization

    CERN Document Server

    Kol, Barak

    2011-01-01

    We discuss the black hole effective action and define its static subsector. We determine the induced gravito-static polarization constants (electric Love numbers) of static black holes (Schwarzschild) in an arbitrary dimension, namely the induced mass multipole as a result of an external gravitational field. We demonstrate that in 4d these constants vanish thereby settling a disagreement in the literature. Yet in higher dimensions these constants are non-vanishing, thereby disproving (at least in d>4) speculations that black holes have no effective couplings beyond the point particle action. In particular, when l/(d-3) is half integral these constants demonstrate a (classical) renormalization flow consistent with the divergences of the effective field theory. In some other cases the constants are negative indicating a novel non-spherical instability. The theory of hypergeometric functions plays a central role.

  7. Determinacy in Static Analysis of jQuery

    DEFF Research Database (Denmark)

    Andreasen, Esben; Møller, Anders

    2014-01-01

    Static analysis for JavaScript can potentially help programmers find errors early during development. Although much progress has been made on analysis techniques, a major obstacle is the prevalence of libraries, in particular jQuery, which apply programming patterns that have detrimental...... present a static dataflow analysis for JavaScript that infers and exploits determinacy information on-the-fly, to enable analysis of some of the most complex parts of jQuery. The techniques are implemented in the TAJS analysis tool and evaluated on a collection of small programs that use jQuery. Our...... consequences on the analysis precision and performance. Previous work on dynamic determinacy analysis has demonstrated how information about program expressions that always resolve to a fixed value in some call context may lead to significant scalability improvements of static analysis for such code. We...

  8. Static dipole polarizabilities of Scn (n≤15) clusters

    Institute of Scientific and Technical Information of China (English)

    Li Xi-Bo; Wang Hong-Yan; Luo Jiang-Shan; Guo Yun-Dong; Wu Wei-Dong; Tang Yong-Jian

    2009-01-01

    The static dipole polarizabilities of scandium clusters with up to 15 atoms are determined by using the numerically finite field method in the framework of density functional theory. The electronic effects on the polarizabilities are investigated for the scandium clusters.We examine a large highest occupied molecular orbital-the lowest occupied molecular orbital (HOMO-LUMO) gap of a scandium cluster usually corresponds to a large dipole moment.The static polarizability per atom decreases slowly and exhibits local minimum with increasing cluster size.The polarizability anisotropy and the ratio of mean static polarizability to the HOMO-LUMO gap can also reflect the cluster stability.The polarizability of the scandium cluster is partially related to the HOMO-LUMO gap and is also dependent on geometrical characteristics.A strong correlation between the polarizability and ionization energy is observed.

  9. Non-local means filter for trim statics

    KAUST Repository

    Huang, Yunsong

    2014-08-05

    Structures will be mispositioned across prestack migration gathers in the presence of inaccuracies in the velocity model. Stacking these misaligned gathers runs the risk of destroying important structures in the stacked migration image. To mitigate this problem, we propose a trim statics inspired by the non-local means algorithm originally developed for image denoising. This method differs from the conventional one in two fundamental respects. First, the trim statics are computed by comparing image patches instead of individual image traces. Second, no global pilot trace is needed because only two migration images at a time participate in trim statics and are stacked into one image. A multitude of migration images are stacked recursively in this two-to-one fashion. Tests with a Gulf of Mexico dataset show a noticeable improvement in the feature coherency of the stacked migration image.

  10. Static spherically symmetric metrics and their cosmological interpretation

    CERN Document Server

    Velez, Camilo Santa

    2016-01-01

    We find the transformation between static coordinates and the Newton gauge for the Schwarzschild-De-Sitter (SDS) solution, confirming it coincides with the weak field limit of the McVittie solution. We then consider different generalized classes of static spherically symmetric (SSS) metrics and using the same method we transform them to the Newton gauge, which could be used to test these modifications of the SDS solution using physical observables which are more conveniently computed within the framework of cosmological perturbation theory. Using the gauge invariance of the Bardeen potentials we then obtain a gauge invariant definition of the turn around radius, checking it is consistent with the result obtained in static coordinates for the SDS metric and for other SSS metrics.

  11. Static and dynamic critical behavior of thin magnetic Ising films

    Science.gov (United States)

    Sabogal-Suárez, D.; Alzate-Cardona, J. D.; Restrepo-Parra, E.

    2015-09-01

    This work presents a study of the effect of film thickness on the static and dynamic critical behavior of thin magnetic Ising films. Monte Carlo simulations using the Wolff algorithm were performed to determine the static and dynamic critical exponents of the films. A dimensionality crossover from 2D to 3D (due to the finiteness of the films) in the static and dynamic critical behavior was observed as the film thickness increases. In addition, a slight increase in the effective dimension deff and a considerable increase in the critical temperature Tc(∞) were found. Small values for the dynamic critical exponents were obtained, indicating that the Wolff algorithm is a very efficient method for these magnetic systems.

  12. AGENT based structural static and dynamic collaborative optimization

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A static and dynamic collaborative optimization mode for complex machine system and itsontology project relationship are put forward, on which an agent-based structural static and dynamiccollaborative optimization system is constructed as two agent colonies: optimization agent colony andfinite element analysis colony. And a two-level solving strategy as well as the necessity and possibilityfor handing with finite element analysis model in multi-level mode is discussed. Furthermore, the coop-eration of all FEA agents for optimal design of complicated structural is studied in detail. Structural stat-ic and dynamic collaborative optimization of hydraulic excavator working equimpent is taken as an ex-ample to show that the system is reliable.

  13. Static- and Stationary-complete Spacetimes: Algebraic and Causal Structures

    CERN Document Server

    Harris, Steven G

    2014-01-01

    This is intended as an analysis of the global properties of static and stationary spacetimes with complete (timelike) Killing field, with particular attention to quotients by group actions. This is presented in terms of algebraic structures which are fairly simple for the static case and more involved for the stationary case; the most important tool, the fundamental cocycle, is a cohomological class for static spacetimes but of somewhat looser structure in the stationary case. In particular: (1) A new measurement, similar to the spacetime interval in Minkowski space, is devised for detecting whether two points are causally related in a stationary spacetime; this proves very useful for analysis. (2) All stationary spacetimes are categorized by how they behave with respect to the fundamental cocycle; this enables a complete characterization of global causality properties. (3) It is shown how these tools determine whether global hyperbolicity of a stationary spacetime is inherited by its quotients. (4) Examples ...

  14. Static Enforcement of Timing Policies Using Code Certification

    Science.gov (United States)

    2006-08-07

    to suggest that that would be a bad idea, but it is not how TALT works. 22 CHAPTER 2. TALT BACKGROUND Kinds K ::= T | Ti | TD | N | k1 → k2 Static...Terms c, τ, x ::= α | nsi | B0 | Bi | τ1 × τ2 | τ ↑ x | box(τ) | mbox(τ) | sptr(τ) | Γ → 0 | set=(x) | set<(x) | set>(x) | ∀α:K.τ | ∃α:K.τ | τ1 ∧ τ2 | τ1...second level, which we call static terms. The class of static terms is comprised of the types (of kinds Ti, TD and T) and the number terms (of kind N). By

  15. Static and dynamic buckling of thin-walled plate structures

    CERN Document Server

    Kubiak, Tomasz

    2013-01-01

    This monograph deals with buckling and postbuckling behavior of thin plates and thin-walled structures with flat wall subjected to static and dynamic load. The investigations are carried out in elastic range. The basic assumption here is the  thin plate theory. This method is used to determination the buckling load and postbuckling analysis of thin-walled structures subjected to static and dynamic load. The book introduces two methods for static and dynamic buckling investigation which allow for a wider understanding of the phenomenon. Two different methods also can allow uncoupling of the phenomena occurring at the same time and attempt to estimate their impact on the final result. A general mathematical model, adopted in proposed analytical-numerical method, enables the consideration of all types of stability loss i.e.local, global and interactive forms of buckling. The applied numerical-numerical method includes adjacent of walls, shear-lag phenomenon and a deplanation of cross-sections.

  16. Fiber loop ring down for static ice pressure detection

    Science.gov (United States)

    Yang, Yi; Yang, Lingzhen; Zhang, Zongwei; Yang, Jianjun; Wang, Juanfen; Zhang, Li; Deng, Xiao; Zhang, Zhaoxia

    2017-07-01

    We studied static ice pressure detection of hydraulic structures based on fiber loop ring down technology. Our detection system consists of a mode-locked laser, two 2 × 1 optical fiber couplers, a piece of single-mode fiber, the on-line micro-bend fiber sensor and a photo-detector. The static ice pressure was monitored based on measuring the change of the ring down time induced by external ice pressure on on-line micro-bend fiber sensor. We monitored the static ice pressure during ice growth and melting from -10 °C to 6 °C. The detection sensitivity is 0.00998/(μs·kPa). The proposed pressure sensing method has many advantages such as free from the fluctuation of the light power, simple structure, fast response and high sensitivity.

  17. Android Application Protection against Static Reverse Engineering based on Multidexing

    Directory of Open Access Journals (Sweden)

    Nak Young Kim

    2016-11-01

    Full Text Available DEX files are executable files of Android applications. Since DEX files are in the format of Java bytecodes, their Java source codes can be easily obtained using static reverse engineering tools. This results in numerous Android application thefts. There are some tools (e.g. bangcle, ijiami, liapp that protect Android applications against static reverse engineering utilizing dynamic code loading. These tools usually encrypt classes.dex in an APK file. When the application is launched, the encrypted classes.dex file is decrypted and dynamically loaded. However, these tools fail to protect multidex APKs, which include more than one DEX files (classes2.dex, classes3.dex, ... to accommodate large-sized execution codes. In this paper, we propose a technique that protects multidex Android applications against static reverse engineering. The technique can encrypt/decrypt multiple DEX files in APK files and dynamically load them. The experimental results show that the proposed technique can effiectively protect multidex APKs.

  18. Quantifying hypoxia in human cancers using static PET imaging

    Science.gov (United States)

    Taylor, Edward; Yeung, Ivan; Keller, Harald; Wouters, Bradley G.; Milosevic, Michael; Hedley, David W.; Jaffray, David A.

    2016-11-01

    Compared to FDG, the signal of 18F-labelled hypoxia-sensitive tracers in tumours is low. This means that in addition to the presence of hypoxic cells, transport properties contribute significantly to the uptake signal in static PET images. This sensitivity to transport must be minimized in order for static PET to provide a reliable standard for hypoxia quantification. A dynamic compartmental model based on a reaction-diffusion formalism was developed to interpret tracer pharmacokinetics and applied to static images of FAZA in twenty patients with pancreatic cancer. We use our model to identify tumour properties—well-perfused without substantial necrosis or partitioning—for which static PET images can reliably quantify hypoxia. Normalizing the measured activity in a tumour voxel by the value in blood leads to a reduction in the sensitivity to variations in ‘inter-corporal’ transport properties—blood volume and clearance rate—as well as imaging study protocols. Normalization thus enhances the correlation between static PET images and the FAZA binding rate K 3, a quantity which quantifies hypoxia in a biologically significant way. The ratio of FAZA uptake in spinal muscle and blood can vary substantially across patients due to long muscle equilibration times. Normalized static PET images of hypoxia-sensitive tracers can reliably quantify hypoxia for homogeneously well-perfused tumours with minimal tissue partitioning. The ideal normalizing reference tissue is blood, either drawn from the patient before PET scanning or imaged using PET. If blood is not available, uniform, homogeneously well-perfused muscle can be used. For tumours that are not homogeneously well-perfused or for which partitioning is significant, only an analysis of dynamic PET scans can reliably quantify hypoxia.

  19. Static cerebrovascular pressure autoregulation remains intact during deep hypothermia.

    Science.gov (United States)

    Goswami, Dheeraj; McLeod, Katherine; Leonard, Samantha; Kibler, Kathleen; Easley, Ronald Blaine; Fraser, Charles D; Andropoulos, Dean; Brady, Ken

    2017-09-01

    Clinical studies measuring cerebral blood flow in infants during deep hypothermia have demonstrated diminished cerebrovascular pressure autoregulation. The coexistence of hypotension in these cohorts confounds the conclusion that deep hypothermia impairs cerebrovascular pressure autoregulation. We sought to compare the lower limit of autoregulation and the static rate of autoregulation between normothermic and hypothermic piglets. Twenty anesthetized neonatal piglets (5-7 days old; 10 normothermic and 10 hypothermic to 20°C) had continuous measurements of cortical red cell flux using laser Doppler flowmetry, while hemorrhagic hypotension was induced without cardiopulmonary bypass. Lower limit of autoregulation was determined for each subject using piecewise regression and SRoR was determined above and below each lower limit of autoregulation as (%change cerebrovascular resistance/%change cerebral perfusion pressure). The estimated difference in lower limit of autoregulation was 1.4 mm Hg (lower in the hypothermic piglets; 95% C.I. -10 to 14 mm Hg; P=0.6). The median lower limit of autoregulation in the normothermic group was 39 mm Hg [IQR 38-51] vs 35 mm Hg [31-50] in the hypothermic group. Intact steady-state pressure autoregulation was defined as static rate of autoregulation >0.5 and was demonstrated in all normothermic subjects (static rate of autoregulation=0.72 [0.65-0.87]) and in 9/10 of the hypothermic subjects (static rate of autoregulation=0.65 [0.52-0.87]). This difference in static rate of autoregulation of 0.06 (95% C.I. -0.3 to 0.1) was not significant (P=0.4). Intact steady-state cerebrovascular pressure autoregulation is demonstrated in a swine model of profound hypothermia. Lower limit of autoregulation and static rate of autoregulation were similar in hypothermic and normothermic subjects. © 2017 John Wiley & Sons Ltd.

  20. Static or dynamic intramedullary nailing of femur and tibia.

    Science.gov (United States)

    Omerovic, Djemil; Lazovic, Faruk; Hadzimehmedagic, Amel

    2015-04-01

    The basic principle of non-surgical fracture treatment is to restore the original anatomical position of fractured fragments by different techniques, without direct access to the bone and without further traumatizing of tissues. Intramedullary nailing is synthesis and consolidation of fracture fragments with the main goal to gain strength and permanent placement of the implants. Two techniques of intramedullary osteosynthesis are used: with dynamic or with static intramedullary nail. Dynamization include conversion of static nail by removing screws from the longest fragment. The aim of this study is to determine whether there is a difference in the speed and quality of healing of the type A and B fractures of the femur and tibia treated by static or dynamic intramedullary nails and to compare the results. The study was conducted at the Clinic for Orthopaedics and Traumatology, Clinical Center University Sarajevo from January 2004 to June 2009. The study was retrospective-prospective, manipulative, controlled and it was conducted on a total of 129 patients with closed fractures of the diaphysis of the femur and tibia type A and type B, with different segments of bone, regardless of sex and age structure, with the exception of children under 14 years of age. Precisely there were 47 patients with femoral fractures and 82 patients with tibial fractures. The average number of weeks of healing femoral and tibial fractures was slightly in advantage of static intramedullary osteosynthesis, it was 17.08 weeks (SD=3.382). The average number of weeks of healing in 23 patients with fractures of the femur, treated by dynamic intramedullary osteosynthesis was 17.83 (SD=2.978). We can conclude that static intramedullary nailing osteosynthesis unable movements between fragments which directly stimulates bone formation and formation of minimal callus. Static intramedullary osteosynthesis resolve the problem of stabilizing the fracture, limb shortening and rotation of fragments.

  1. Quantifying hypoxia in human cancers using static PET imaging.

    Science.gov (United States)

    Taylor, Edward; Yeung, Ivan; Keller, Harald; Wouters, Bradley G; Milosevic, Michael; Hedley, David W; Jaffray, David A

    2016-11-21

    Compared to FDG, the signal of (18)F-labelled hypoxia-sensitive tracers in tumours is low. This means that in addition to the presence of hypoxic cells, transport properties contribute significantly to the uptake signal in static PET images. This sensitivity to transport must be minimized in order for static PET to provide a reliable standard for hypoxia quantification. A dynamic compartmental model based on a reaction-diffusion formalism was developed to interpret tracer pharmacokinetics and applied to static images of FAZA in twenty patients with pancreatic cancer. We use our model to identify tumour properties-well-perfused without substantial necrosis or partitioning-for which static PET images can reliably quantify hypoxia. Normalizing the measured activity in a tumour voxel by the value in blood leads to a reduction in the sensitivity to variations in 'inter-corporal' transport properties-blood volume and clearance rate-as well as imaging study protocols. Normalization thus enhances the correlation between static PET images and the FAZA binding rate K 3, a quantity which quantifies hypoxia in a biologically significant way. The ratio of FAZA uptake in spinal muscle and blood can vary substantially across patients due to long muscle equilibration times. Normalized static PET images of hypoxia-sensitive tracers can reliably quantify hypoxia for homogeneously well-perfused tumours with minimal tissue partitioning. The ideal normalizing reference tissue is blood, either drawn from the patient before PET scanning or imaged using PET. If blood is not available, uniform, homogeneously well-perfused muscle can be used. For tumours that are not homogeneously well-perfused or for which partitioning is significant, only an analysis of dynamic PET scans can reliably quantify hypoxia.

  2. Measurement and evaluation of static characteristics of rotary hydraulic motor

    Directory of Open Access Journals (Sweden)

    Hružík Lumír

    2014-03-01

    Full Text Available The paper describes experimental equipment for measurement of static characteristics of rotary hydraulic motor. It is possible to measure flow, pressure, temperature, speed and torque by means of this equipment. It deals with measurement of static characteristics of a gear rotary hydraulic motor. Mineral oil is used as hydraulic liquid in this case. Flow, torque and speed characteristics are evaluated from measured parameters. Measured mechanical-hydraulic, flow and total efficiencies of the rotary hydraulic motor are adduced in the paper. It is possible to diagnose technical conditions of the hydraulic motor (eventually to recommend its exchange from the experimental measurements.

  3. Static shape control of a flat shell structure

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The eight-node and forty-DOF piezoelectric shell element were applied to shape control of a flat shell structure. By the direct and converse effects, a distributed piezoelectric sensor layer was used to monitor the shape deformation and a distributed actuator layer was used to suppresse the deflection. A finite element model was for static response of laminated shell with piezoelectric sensors/actuators was derived. The model was verified by calculating piezoelectric polymeric PVDF bimorph beam. The results are in good agreement with those obtained by theoretical analysis of Tzou[1] and Hwang[2]. A case study of the static shape control of a flat shell structure is presented.

  4. A HYBRID POLYMER GEL AND ITS STATIC NONERGODICIT

    Institute of Scientific and Technical Information of China (English)

    Yue Zhao; Chi Wu

    2002-01-01

    We used a thermally reversible hybrid gel made of billions of physically jam-packed swollen thermally sensitive poly(N-isopropyl-acrylamide) chemical microgels. Laser light scattering study on a series of such hybrid gels formed at different gelling rates and temperatures revealed that the position-dependence of the scattering speckle pattern (static nonergodicity) came from large voids formed during the sol-gel transition. With a proper preparation, such a nonergodicity could be completely removed, indicating that the static nonergodicity generally observed in a gel is not intrinsic, but comes from the clustering "island" structure formed during the gelation process.

  5. Recovering map static nonlinearities from chaotic data using dynamical models

    Science.gov (United States)

    Aguirre, Luis Antonio

    1997-02-01

    This paper is concerned with the estimation from chaotic data of maps with static nonlinearities. A number of issues concerning model construction such as structure selection, over-parametrization and model validation are discussed in the light of the shape of the static non-linearities reproduced by the estimated maps. A new interpretation of term clusters and cluster coefficients of polynomial models is provided based on this approach. The paper discusses model limitations and some useful principles to select the structure of nonlinear maps. Some of the ideas have been tested using several nonlinear systems including a boost voltage regulator map and a set of real data from a chaotic circuit.

  6. Quasi-static Deployment Simulation for Deployable Space Truss Structures

    Institute of Scientific and Technical Information of China (English)

    陈务军; 付功义; 何艳丽; 董石麟

    2004-01-01

    A new method was proposed for quasi-static deployment analysis of deployable space truss structures. The structure is assumed a rigid assembly, whose constraints are classified as three categories:rigid member constraint, joint-attached kinematic constraint and boundary constraint. And their geometric constraint equations and derivative matrices are formulated. The basis of the null space and M-P inverse of the geometric constraint matrix are employed to determine the solution for quasi-static deployment analysis. The influence introduced by higher terms of constraints is evaluated subsequently. The numerical tests show that the new method is efficient.

  7. Structural testing for static failure, flutter and other scary things

    Science.gov (United States)

    Ricketts, R. H.

    1983-01-01

    Ground test and flight test methods are described that may be used to highlight potential structural problems that occur on aircraft. Primary interest is focused on light-weight general aviation airplanes. The structural problems described include static strength failure, aileron reversal, static divergence, and flutter. An example of each of the problems is discussed to illustrate how the data acquired during the tests may be used to predict the occurrence of the structural problem. While some rules of thumb for the prediction of structural problems are given the report is not intended to be used explicitly as a structural analysis handbook.

  8. Human body capacitance: static or dynamic concept? [ESD

    DEFF Research Database (Denmark)

    Jonassen, Niels M

    1998-01-01

    A standing human body insulated from ground by footwear and/or floor covering is in principle an insulated conductor and has, as such, a capacitance, i.e. the ability to store a charge and possibly discharge the stored energy in a spark discharge. In the human body, the human body capacitance (HBC...... when a substantial part of the flux extends itself through badly defined stray fields. Since the concept of human body capacitance is normally used in a static (electric) context, it is suggested that the HBC be determined by a static method. No theoretical explanation of the observed differences...

  9. Static stability of collapsible tube conveying non-Newtonian fluid

    CERN Document Server

    Yushutin, V S

    2014-01-01

    The global static stability of a Starling Resistor conveying non-Newtonian fluid is considered. The Starling Resistor consists of two rigid circular tubes and axisymmetric collapsible tube mounted between them. Upstream and downstream pressures are the boundary condition as well as external to the collapsible tube pressure. Quasi one-dimensional model has been proposed and a boundary value problem in terms of nondimensional parameters obtained. Nonuniqueness of the boundary value problem is regarded as static instability. The analytical condition of instability which defines a surface in parameter space has been studied numerically. The influence of fluid rheology on stability of collapsible tube is established.

  10. Static critical fluctuations on the freeze-out surface

    CERN Document Server

    Jiang, Lijia; Song, Huichao

    2016-01-01

    In this proceeding, we summarize the main results of our recent paper, which introduces a freeze-out scheme to the dynamical models near the QCD critical point. Within such framework of static critical fluctuations, the Beam Energy Scan (BES) data of $C_4$ and $\\kappa \\sigma^2$ for net protons within different $p_T$ ranges can be roughly described. Besides, the momentum acceptance dependence of higher cumulants at lower collision energies can also be qualitatively described. However, $C_2$ and $C_3$ are always over-predicted due to the positive static critical fluctuations.

  11. The acceleration of a neutron in a static electric field

    Science.gov (United States)

    Cappelletti, R. L.

    2012-06-01

    We show that when a non-relativistic neutron travels in a static electric field, the acceleration vector operator is perpendicular to the velocity operator. Kinetic energy is conserved. A spin-dependent field term in the canonical momentum gives rise to a non-dispersive contribution to the quantum mechanical (Aharonov-Casher) phase. This motion differs from that in a static magnetic field which has no field term in the canonical momentum and no conservation of kinetic energy. For the geometry of the Aharonov-Casher effect, there is no acceleration, while in Mott-Schwinger scattering, the acceleration causes a spin-dependent change in neutron direction.

  12. Counterrotating perfect fluid discs as sources of electrovacuum static spacetimes

    CERN Document Server

    García-Reyes, Gonzalo

    2008-01-01

    The interpretation of some electrovacuum spacetimes in terms of counterrotating perfect fluid discs is presented. The interpretation is mades by means of an "inverse problem" approach used to obtain disc sources of known static solutions of the Einstein-Maxwell equations. In order to do such interpretation, a detailed study is presented of the counterrotating model (CRM) for generic electrovacuum static axially symmetric relativistic thin discs with nonzero radial pressure. Four simple families of models of counterrotating charged discs based on Chazy-Curzon-type, Zipoy-Voorhees-type, Bonnor-Sackfield-type, and charged and magnetized Darmois electrovacuum metrics are considered where we obtain some discs with a CRM well behaved.

  13. Quasilocal Energy for Static Charged Black Holes in String Theory

    Institute of Scientific and Technical Information of China (English)

    WANG Shi-Liang; JING Ji-Liang; WANG Yong-Jiu

    2001-01-01

    The Brown-York quasilocal energies of some static charged dilaton black holes are calculated, and then the validity of Martinez's conjecture is explored in string theory. It is shown that the energy is positive and monotonically decreases to the ADM mass at spatial infinity, and the conjecture that the Brown-York quasilocal energy at the outer horizon of black hole reduces to twice of its irreducible mass is still applicable for the static charged black holes in string theory. The result is different from Bose-Naing's one.``

  14. Dynamic Inheritance and Static Analysis can be Reconciled

    DEFF Research Database (Denmark)

    Ernst, Erik

    1998-01-01

    In the area of object-orientation there is a long-standingschism between the rigid but safe statically typed languages, and theexpressive and exible but less safe \\typeless" languages. Many e ortshave aimed at combining the best of both. This paper presents a lan-guage mechanism which enhances....... With dynamic inheritance, pre-methoding becomesmore expressive, supporting control structures as rst class values whichmay be constructed and combined dynamically. Even though the conceptof pre-methoding is missing from most other languages, the basic ideacould be applied to any statically typed object-oriented...

  15. Adaptive financial networks with static and dynamic thresholds

    CERN Document Server

    Qiu, Tian; Chen, Guang

    2010-01-01

    Based on the daily data of American and Chinese stock markets, the dynamic behavior of a financial network with static and dynamic thresholds is investigated. Compared with the static threshold, the dynamic threshold suppresses the large fluctuation induced by the cross-correlation of individual stock prices, and leads to a stable topological structure in the dynamic evolution. Long-range time-correlations are revealed for the average clustering coefficient, average degree and cross-correlation of degrees. The dynamic network shows a two-peak behavior in the degree distribution.

  16. High-codimensional static bifurcations of strongly nonlinear oscillator

    Institute of Scientific and Technical Information of China (English)

    Zhang Qi-Chang; Wang Wei; Liu Fu-Hao

    2008-01-01

    The static bifurcation of the parametrically excited strongly nonlinear oscillator is studied.We consider the averaged equations of a system subject to Duffing-van der Pol and quintic strong nonlinearity by introducing the undetermined fundamental frequency into the computation in the complex normal form.To discuss the static bifurcation,the bifurcation problem is described as a 3-codimensional unfolding with Z2 symmetry on the basis of singularity theory.The transition set and bifurcation diagrams for the singularity are presented,while the stability of the zero solution is studied by using the eigenvalues in various parameter regions.

  17. Induced static magnetic field by a cellular phone

    Science.gov (United States)

    Einat, M.; Yahalom, A.

    2011-08-01

    Recent claims regarding the safety of cellular phones suggest that weak static magnetic fields are induced around the phone, and this field and its gradients may pose a health risk to the user. An experiment was conducted to measure the induced static magnetic field around a cellular phone. 65 μT variations and 18 μT/cm gradients were measured in the magnetic field at 6 cm from the phone. An analytical model is derived to explain the results. The influence that the measured magnetic fields may have on the user is beyond the scope of this research.

  18. Static and quasi-static analysis of lobed-pumpkin balloon

    Science.gov (United States)

    Nakashino, Kyoichi; Sasaki, Makoto; Hashimoto, Satoshi; Saito, Yoshitaka; Izutsu, Naoki

    The present study is motivated by the need to improve design methodology for super pressure balloon with 3D gore design concept, currently being developed at the Scientific Balloon Center of ISAS/JAXA. The distinctive feature of the 3-D gore design is that the balloon film has excess materials not only in the circumferential direction but also in the meridional direction; the meridional excess is gained by attaching the film boundaries to the corresponding tendons of a shorter length with a controlled shortening rate. The resulting balloon shape is a pumpkin-like shape with large bulges formed between adjacent tendons. The balloon film, when fully inflated, develops wrinkles in the circumferential direction over its entire region, so that the stresses in the film are limited to a small amount of uniaxial tension in the circumferential direction while the high meridional loads are carried by re-enforced tendons. Naturally, the amount of wrinkling in the film is dominated by the shortening rate between the film boundaries and the tendon curve. In the 3-D gore design, as a consequence, the shortening rate becomes a fundamental design parameter along with the geometric parameters of the gore. In view of this, we have carried out a series of numerical study of the lobed-pumpkin balloon with varying gore geometry as well as with varying shortening rate. The numerical simula-tions were carried out with a nonlinear finite element code incorporating the wrinkling effect. Numerical results show that there is a threshold value for the shortening rate beyond which the stresses in the balloon film increases disproportionately. We have also carried out quasi-static simulations of the inflation process of the lobed-pumpkin balloon, and have obtained asymmetric deformations when the balloon films are in uniaxial tension state.

  19. Bone Response to Static Compressive Stress at Bone-Implant Interface: A Pilot Study of Critical Static Compressive Stress.

    Science.gov (United States)

    Ikumi, Noriharu; Suzawa, Tetsuo; Yoshimura, Kentaro; Kamijo, Ryutaro

    2015-01-01

    Mechanical imbalance caused by mechanical overload or poor bone quality around a dental implant can result in osseointegration failure. To avoid that, it is important to identify an appropriate safety stress margin (critical stress level). For this study, a novel device was developed to generate a quantitative amount of static compressive stress under an aseptic closed condition. The aim was to clarify the amount of critical stress produced on the cortical bone when static compression is applied to the osseointegrated bone-implant interface. Small parts for bone sustaining, load generation, and load transmittance were developed to generate quantitative static compressive stress at the bone-implant interface and implanted inside the tibial cortical bone in adult beagle dogs. Each tibia in two dogs received bone-sustaining parts, then after 2 months, the load-transmitting parts were placed into the bone-sustaining parts. After another 2 months, various magnitudes of static compressive stress (0-180 MPa) were generated by tightening the load-generating part to the osseointegrated bone-implant interface. After 7 days, the animals were euthanized, and dissected blocks were prepared for histomorphometric analyses. There were no obvious signs of bone resorption or loss of osseointegration in any of the dogs. The change in shape of osteon was not influenced by the amount of static compressive stress. However, periosteal reactions were observed under the cortical bone on the opposite side. These results indicate that osseointegrated bone-implant interfaces show minimal response based on the magnitude of static compressive stress, even when such stress is greater than 120 MPa.

  20. Research on new software compensation method of static and quasi-static errors for precision motion controller

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    To reduce mechanical vibrations induced by big errors compensation, a new software compensation method based on an improved digital differential analyzer (DDA) interpolator for static and quasi-static errors of machine tools is proposed. Based on principle of traditional DDA interpolator, a DDA interpolator is divided into command generator and command analyzer. There are three types of errors, considering the difference of positions between compensation points and interpolation segments. According to the classification, errors are distributed evenly in data processing and compensated to certain interpolation segments in machining. On-line implementation results show that the proposed approach greatly improves positioning accuracy of computer numerical control (CNC) machine tools.

  1. Supporting secure programming in web applications through interactive static analysis.

    Science.gov (United States)

    Zhu, Jun; Xie, Jing; Lipford, Heather Richter; Chu, Bill

    2014-07-01

    Many security incidents are caused by software developers' failure to adhere to secure programming practices. Static analysis tools have been used to detect software vulnerabilities. However, their wide usage by developers is limited by the special training required to write rules customized to application-specific logic. Our approach is interactive static analysis, to integrate static analysis into Integrated Development Environment (IDE) and provide in-situ secure programming support to help developers prevent vulnerabilities during code construction. No additional training is required nor are there any assumptions on ways programs are built. Our work is motivated in part by the observation that many vulnerabilities are introduced due to failure to practice secure programming by knowledgeable developers. We implemented a prototype interactive static analysis tool as a plug-in for Java in Eclipse. Our technical evaluation of our prototype detected multiple zero-day vulnerabilities in a large open source project. Our evaluations also suggest that false positives may be limited to a very small class of use cases.

  2. An Economical Method for Static Headspace Enrichment for Arson Analysis

    Science.gov (United States)

    Olesen, Bjorn

    2010-01-01

    Static headspace analysis of accelerants from suspected arsons is accomplished by placing an arson sample in a sealed container with a carbon strip suspended above the sample. The sample is heated, cooled to room temperature, and then the organic components are extracted from the carbon strip with carbon disulfide followed by gas chromatography…

  3. Static analysis of a piping system with elbows

    Energy Technology Data Exchange (ETDEWEB)

    Bryan, B.J.

    1994-03-01

    Vibration tests of elbows to failure were performed in Japan in the early 1970s. The piping system included two elbows and an eccentric mass. Tests were run both pressurized and unpressurized. This report documents a static analysis of the piping system in which the elbows are subjected to out of plane bending. The effects of internal pressure and material plasticity are investigated.

  4. Java bytecode verification via static single assignment form

    DEFF Research Database (Denmark)

    Gal, Andreas; Probst, Christian W.; Franz, Michael

    2008-01-01

    that transforms JVM bytecode into Static Single Assignment Form (SSA) and thereby propagates definitions directly to uses. Type checking at control flow merge points can then be performed in a single pass. Our prototype implementation of the new algorithm is faster than the standard JVM bytecode verifier. It has...

  5. Static and dynamic through thickness lamina properties of thick laminates

    NARCIS (Netherlands)

    Lahuerta, F.; Nijssen, R.P.L.; Van der Meer, F.P.; Sluys, L.J.

    2015-01-01

    Thick laminates are increasingly present in large composites structures such as wind turbine blades. Different factors are suspected to be involved in the decreased static and dynamic performance of thick laminates. These include the effect of self-heating, the scaling effect, and the manufacturing

  6. Supporting secure programming in web applications through interactive static analysis

    Directory of Open Access Journals (Sweden)

    Jun Zhu

    2014-07-01

    Full Text Available Many security incidents are caused by software developers’ failure to adhere to secure programming practices. Static analysis tools have been used to detect software vulnerabilities. However, their wide usage by developers is limited by the special training required to write rules customized to application-specific logic. Our approach is interactive static analysis, to integrate static analysis into Integrated Development Environment (IDE and provide in-situ secure programming support to help developers prevent vulnerabilities during code construction. No additional training is required nor are there any assumptions on ways programs are built. Our work is motivated in part by the observation that many vulnerabilities are introduced due to failure to practice secure programming by knowledgeable developers. We implemented a prototype interactive static analysis tool as a plug-in for Java in Eclipse. Our technical evaluation of our prototype detected multiple zero-day vulnerabilities in a large open source project. Our evaluations also suggest that false positives may be limited to a very small class of use cases.

  7. Quorum sensing via static coupling demonstrated by Chua's circuits

    Science.gov (United States)

    Singh, Harpartap; Parmananda, P.

    2013-10-01

    Dynamical quorum sensing, the population based phenomenon, is believed to occur when the elements of a system interact via dynamic coupling. In the present work, we demonstrate an alternate scenario, involving static coupling, that could also lead to quorum sensing behavior. These static and dynamic coupling terms have already been employed by Konishi [Int. J. Bifurcation Chaos Appl. Sci. Eng.IJBEE40218-127410.1142/S0218127407018750 17, 2781 (2007)]. In our context, the coupling is defined as static or dynamic, on the basis of the relative time scales at which the surrounding dynamics and the elements' dynamics evolve. According to this, if the variation in the surrounding dynamics happens on a much larger (fast) time scale than that at which the elements' dynamics are varying (such as seconds and μs), then the coupling is considered to be static, otherwise it is considered to be dynamic. A series of experiments have been performed starting from a system of three Chua's circuits to a system of 20 Chua's circuits to study two types of quorum transitions: the emergence and the extinction of global oscillations (period-1). The numerics involving up to 100 Chua's circuits validate the experimental observations.

  8. Hybrid static-runtime information flow and declassification enforcement

    NARCIS (Netherlands)

    Rocha, Bruno P.S.; Conti, Mauro; Etalle, Sandro; Crispo, Bruno

    There are different paradigms for enforcing information flow and declassification policies. These approaches can be divided into static analyzers and runtime enforcers. Each class has its own strengths and weaknesses, each being able to enforce a different set of policies. In this paper, we

  9. Costs and effects of chlamydial screening : Dynamic versus static modeling

    NARCIS (Netherlands)

    Welte, R; Postma, M; Leidl, R; Kretzschmar, M

    2005-01-01

    Objective: The objective of this study was to assess the impact of modeling type on the economic evaluation of screening programs for asymptomatic Chlamydia trachomatis infections. Study: We compared a stochastic network simulation model (dynamic model) with a decision analysis model (static model)

  10. Static analysis of a Model of the LDL degradation pathway

    DEFF Research Database (Denmark)

    Pilegaard, Henrik; Nielson, Flemming; Nielson, Hanne Riis

    2005-01-01

    BioAmbients is a derivative of mobile ambients that has shown promise of describing interesting features of the behaviour of biological systems. As for other ambient calculi static program analysis can be used to compute safe approximations of the behavior of modelled systems. We use these tools ...

  11. Static axisymmetric rings in general relativity: How diverse they are

    Science.gov (United States)

    Semerák, O.

    2016-11-01

    Three static and axially symmetric (Weyl-type) ring singularities—the Majumdar-Papapetrou-type (extremally charged) ring, the Bach-Weyl ring, and the Appell ring—are studied in general relativity in order to show how remarkably the geometries in their vicinity differ from each other. This is demonstrated on basic measures of the rings and on invariant characteristics given by the metric and by its first and second derivatives (lapse, gravitational acceleration, and curvature), and also on geodesic motion. The results are also compared against the Kerr space-time which possesses a ring singularity too. The Kerr solution is only stationary, not static, but in spite of the consequent complication by dragging, its ring appears to be simpler than the static rings. We show that this mainly applies to the Bach-Weyl ring, although this straightforward counterpart of the Newtonian homogeneous circular ring is by default being taken as the simplest ring solution, and although the other two static ring sources may seem more "artificial." The weird, directional deformation around the Bach-Weyl ring probably indicates that a more adequate coordinate representation and interpretation of this source should exist.

  12. Ischemic Preconditioning of One Forearm Enhances Static and Dynamic Apnea

    DEFF Research Database (Denmark)

    Kjeld, Thomas; Rasmussen, Mads Reinholdt; Jattu, Timo

    2014-01-01

    served as control because the warm-up for rowing regularly encompasses intense exercise and therefore reduced muscle oxygenation. METHODS: Six divers performed a dry static breath hold, 11 divers swam underwater in an indoor pool, and 14 oarsmen rowed "1000 m" on an ergometer. RESULTS: Ischemic...

  13. Another Approach to Solving Problems in Rotational Statics.

    Science.gov (United States)

    Fineman, Morton A.; Burnett, Carl, Jr.

    1985-01-01

    Presents a technique which aids students in solving static problems involving three or more torques about a given axis. The method is longer and equivalent to the standard method, but students experience success with this new way to treat the more complicated equilibrium problems. (DH)

  14. Static Tension Tests on Axially Loaded Pile Segments in Sand

    DEFF Research Database (Denmark)

    Thomassen, Kristina; Andersen, Lars Vabbersgaard; Ibsen, Lars Bo

    This paper provides laboratory test results of static axially loaded piles in sand. With a newly developed test setup, the pile-soil interface friction was investigated by using an open-ended steel pile segment with a diameter of 0.5 m. Use of a pile length of 1 m enabled the pile-soil interface...

  15. Static and dynamic aspects of an air gap capacitor

    NARCIS (Netherlands)

    IJntema, D.J.; IJntema, Dominicus J.; Tilmans, Harrie A.C.; Tilmans, H.A.C.

    1992-01-01

    This paper deals with the theory of an air-gap capacitor used as a micromechanical resonator. Both static and dynamic aspects are discussed. A single-element approach for the electrostatic excitation and capacitive detection of the vibrational motion of the resonators is described. The non-linear

  16. 14 CFR 105.47 - Use of static lines.

    Science.gov (United States)

    2010-01-01

    ... unless that person is a certificated parachute rigger or that person makes the next parachute jump with... AND GENERAL OPERATING RULES PARACHUTE OPERATIONS Parachute Equipment and Packing § 105.47 Use of static lines. (a) Except as provided in paragraph (c) of this section, no person may conduct a...

  17. Hybrid static-runtime information flow and declassification enforcement

    NARCIS (Netherlands)

    Rocha, Bruno P.S.; Conti, Mauro; Etalle, Sandro; Crispo, Bruno

    2013-01-01

    There are different paradigms for enforcing information flow and declassification policies. These approaches can be divided into static analyzers and runtime enforcers. Each class has its own strengths and weaknesses, each being able to enforce a different set of policies. In this paper, we introduc

  18. A Static Burst Test for Composite Flywheel Rotors

    Science.gov (United States)

    Hartl, Stefan; Schulz, Alexander; Sima, Harald; Koch, Thomas; Kaltenbacher, Manfred

    2016-06-01

    High efficient and safe flywheels are an interesting technology for decentralized energy storage. To ensure all safety aspects, a static test method for a controlled initiation of a burst event for composite flywheel rotors is presented with nearly the same stress distribution as in the dynamic case, rotating with maximum speed. In addition to failure prediction using different maximum stress criteria and a safety factor, a set of tensile and compressive tests is carried out to identify the parameters of the used carbon fiber reinforced plastics (CFRP) material. The static finite element (FE) simulation results of the flywheel static burst test (FSBT) compare well to the quasistatic FE-simulation results of the flywheel rotor using inertia loads. Furthermore, it is demonstrated that the presented method is a very good controllable and observable possibility to test a high speed flywheel energy storage system (FESS) rotor in a static way. Thereby, a much more expensive and dangerous dynamic spin up test with possible uncertainties can be substituted.

  19. Static Scaling on an Interacting Magnetic Nanoparticle System

    DEFF Research Database (Denmark)

    Jonsson, T.; Svedlindh, P.; Hansen, Mikkel Fougt

    1998-01-01

    The field dependence of the ac susceptibility of a concentrated frozen ferrofluid containing ultrafine Fe-C particles of monodisperse nature has been analyzed using static scaling. For the first time, a divergent behavior of the nonlinear susceptibility of a dipole-dipole interacting system...

  20. Statics and kinematics of discrete Cosserat-type granular materials

    NARCIS (Netherlands)

    Kruyt, N.P.

    2003-01-01

    A theoretical framework is presented for the statics and kinematics of discrete Cosserat-type granular materials. In analogy to the force and moment equilibrium equations for particles, compatibility equations for closed loops are formulated in the two-dimensional case for relative displacements and

  1. Normal Wave Propagation Velocity in a Static Web.

    Science.gov (United States)

    1986-12-01

    34 " " ’ . " . " . " " . " , " " . " -" " " " . " " . " " " " . " * . - " " " , 4 . " . " . " " " . " " "." "-" "." " . . . . . " " " " -w A- INah . . . . . . - - 1 NORMAL WAVE PROPAGATION VELOCITY IN A STATIC WEB By

  2. Einstein Static Universe in Exponential $f(T)$ Gravity

    CERN Document Server

    Li, Jung-Tsung; Geng, Chao-Qiang

    2013-01-01

    We analyze the stability of the Einstein static closed and open universe in two types of exponential $f(T)$ gravity theories. We show that the stable solutions exist in these two models. In particular, we find that large regions of parameter space in equation of state $w=p/\\rho$ for the stable universe are allowed in the $f(T)$ theories.

  3. Einstein static universe in exponential f(T) gravity

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jung-Tsung; Lee, Chung-Chi; Geng, Chao-Qiang [National Tsing Hua University, Department of Physics, Hsinchu (China); National Center for Theoretical Sciences, Physics Division, Hsinchu (China)

    2013-02-15

    We analyze the stability of the Einstein static closed and open universe in two types of exponential f(T) gravity theory. We show that stable solutions exist in these two models. In particular, we find that large regions of parameter space in equation of state w=p/{rho} for the stable universe are allowed in the f(T) theories. (orig.)

  4. A Synthesis Method for Static Anti-Windup Compensators

    OpenAIRE

    Solyom, Stefan

    2003-01-01

    Synthesis of static anti-windup compensators is considered. LMIconditions are established for stability and performance analysis of the closedloop system. The performance criterion describes the servo problem forthe resulting closed-loop piecewise linear system. The synthesisof the anti-windup compensators will be given by some bilinear matrix inequalities.

  5. Static and dynamic aspects of an air gap capacitor

    NARCIS (Netherlands)

    IJntema, Dominicus J.; Tilmans, Harrie A.C.

    1992-01-01

    This paper deals with the theory of an air-gap capacitor used as a micromechanical resonator. Both static and dynamic aspects are discussed. A single-element approach for the electrostatic excitation and capacitive detection of the vibrational motion of the resonators is described. The non-linear ch

  6. A Minimum Leakage Quasi-Static RAM Bitcell

    Directory of Open Access Journals (Sweden)

    Adam Teman

    2011-05-01

    Full Text Available As SRAMs continue to grow and comprise larger percentages of the area and power consumption in advanced systems, the need to minimize static currents becomes essential. This brief presents a novel 9T Quasi-Static RAM Bitcell that provides aggressive leakage reduction and high write margins. The quasi-static operation method of this cell, based on internal feedback and leakage ratios, minimizes static power while maintaining sufficient, albeit depleted, noise margins. This paper presents the concept of the novel cell, and discusses the stability of the cell under hold, read and write operations. The cell was implemented in a low-power 40 nm TSMC process, showing as much as a 12× reduction in leakage current at typical conditions, as compared to a standard 6T or 8T bitcell at the same supply voltage. The implemented cell showed full functionality under global and local process variations at nominal and low voltages, as low as 300 mV.

  7. Integrating and scheduling an open set of static analyses

    DEFF Research Database (Denmark)

    Eichberg, Michael; Mezini, Mira; Kloppenburg, Sven

    2006-01-01

    To improve the productivity of the development process, more and more tools for static software analysis are tightly integrated into the incremental build process of an IDE. If multiple interdependent analyses are used simultaneously, the coordination between the analyses becomes a major obstacle...

  8. Longitudinal static-field model for HD lasers

    Science.gov (United States)

    Baets, R.; Lagasse, P. E.

    1984-01-01

    A new static model for double-heterostructure lasers is presented which can take into account longitudinal effects in the cavity. The model makes use of the beam-propagation method to calculate the field propagation through the lasing waveguide structure.

  9. Detection of static and dynamic activities using uniaxial accelerometers

    NARCIS (Netherlands)

    Veltink, Petrus H.; Bussmann, Hans B.J.; de Vries, Wiebe; de Vries, W.; Martens, Wim L.J.; van Lummel, Rob C.

    1996-01-01

    Rehabilitation treatment may be improved by objective analysis of activities of daily living. For this reason, the feasibility of distinguishing several static and dynamic activities (standing, sitting, lying, walking, ascending stairs, descending stairs, cycling) using a small set of two or three

  10. Emotion attribution to basic parametric static and dynamic stimuli

    NARCIS (Netherlands)

    Visch, V.; Goudbeek, M.B.; Cohn, J.; Nijholt, A.; Pantic, P.

    2009-01-01

    The following research investigates the effect of basic visual stimuli on the attribution of basic emotions by the viewer. In an empirical study (N = 33) we used two groups of visually minimal expressive stimuli: dynamic and static. The dynamic stimuli consisted of an animated circle moving

  11. Emotion attribution to basic parametric static and dynamic stimuli

    NARCIS (Netherlands)

    Visch, V.; Goudbeek, M.B.; Cohn, J.; Nijholt, A.; Pantic, P.

    2009-01-01

    The following research investigates the effect of basic visual stimuli on the attribution of basic emotions by the viewer. In an empirical study (N = 33) we used two groups of visually minimal expressive stimuli: dynamic and static. The dynamic stimuli consisted of an animated circle moving accordin

  12. Static field dependence of the Raman polarizability, demonstrated in polystyrene

    Science.gov (United States)

    Aussenegg, Franz R.; Lippitsch, Max E.; Möller, Reinhard

    1982-01-01

    The nonlinearity of the Raman polarizability of polystyrene is revealed by applying a static electric field of ≈ 1 MV/cm to the sample while measuring the Raman intensity. A special experimental technique allows registration of relative intensity variations of 10 -3. The results can be understood using a simple theoretical model.

  13. Static and dynamic quenching of luminescent species in polymer media.

    Science.gov (United States)

    Hartmann, P; Leiner, M J; Lippitsch, M E

    1994-12-01

    A method developed for quantitative determination of static and dynamic contributions to luminescence quenching is applied to Ru(II) complexes in polymer matrices (silica gel and polystyrene), quenched by oxygen. This method is based on both intensity and lifetime quenching experiments. The curvature of intensity Stern-Volmer plots is related to the results.

  14. A Micro Dynamically Tuned Gyroscope with Adjustable Static Capacitance

    Directory of Open Access Journals (Sweden)

    Lun Kong

    2013-02-01

    Full Text Available This paper presents a novel micro dynamically tuned gyroscope (MDTG with adjustable static capacitance. First, the principle of MDTG is theoretically analyzed. Next, some simulations under the optimized structure parameters are given as a reference for the mask design of the rotor wafer and electrode plates. As two key components, the process flows of the rotor wafer and electrode plates are described in detail. All the scanning electron microscopy (SEM photos show that the fabrication process is effective and optimized. Then, an assembly model is designed for the static capacitance adjustable MDTG, whose static capacitance can be changed by rotating the lower electrode plate support and substituting gasket rings of different thicknesses. Thus, the scale factor is easily changeable. Afterwards, the digitalized closed-loop measurement circuit is simulated. The discrete correction and decoupling modules are designed to make the closed-loop stable and cross-coupling effect small. The dual axis closed-loop system bandwidths can reach more than 60 Hz and the dual axis scale factors are completely symmetrical. All the simulation results demonstrate the proposed fabrication of the MDTG can meet the application requirements. Finally, the paper presents the test results of static and dynamic capacitance values which are consistent with the simulation values.

  15. A micro dynamically tuned gyroscope with adjustable static capacitance.

    Science.gov (United States)

    Xia, Dunzhu; Yu, Cheng; Kong, Lun

    2013-02-06

    This paper presents a novel micro dynamically tuned gyroscope (MDTG) with adjustable static capacitance. First, the principle of MDTG is theoretically analyzed. Next, some simulations under the optimized structure parameters are given as a reference for the mask design of the rotor wafer and electrode plates. As two key components, the process flows of the rotor wafer and electrode plates are described in detail. All the scanning electron microscopy (SEM) photos show that the fabrication process is effective and optimized. Then, an assembly model is designed for the static capacitance adjustable MDTG, whose static capacitance can be changed by rotating the lower electrode plate support and substituting gasket rings of different thicknesses. Thus, the scale factor is easily changeable. Afterwards, the digitalized closed-loop measurement circuit is simulated. The discrete correction and decoupling modules are designed to make the closed-loop stable and cross-coupling effect small. The dual axis closed-loop system bandwidths can reach more than 60 Hz and the dual axis scale factors are completely symmetrical. All the simulation results demonstrate the proposed fabrication of the MDTG can meet the application requirements. Finally, the paper presents the test results of static and dynamic capacitance values which are consistent with the simulation values.

  16. Glacial isostatic adjustment in the static gravity field of Fennoscandia

    NARCIS (Netherlands)

    Root, B.C.; Van der Wal, W.; Novak, P.; Ebbing, J.; Vermeersen, L.L.A.

    2015-01-01

    In the central part of Fennoscandia, the crust is currently rising, because of the delayed response of the viscous mantle to melting of the Late Pleistocene ice sheet. This process, called Glacial Isostatic Adjustment (GIA), causes a negative anomaly in the present-day static gravity field as isosta

  17. Two-dimensional static black holes with pointlike sources

    CERN Document Server

    Melis, M

    2004-01-01

    We study the static black hole solutions of generalized two-dimensional dilaton-gravity theories generated by pointlike mass sources, in the hypothesis that the matter is conformally coupled. We also discuss the motion of test particles. Due to conformal coupling, these follow the geodesics of a metric obtained by rescaling the canonical metric with the dilaton.

  18. Static Generalized Brans-Dicke Universe and Gravitational Waves Amplification

    CERN Document Server

    Berman, M S; Berman, Marcelo S.; Trevisan, Luis A.

    2001-01-01

    We find a static solution for the scale-factor in a Brans-Dicke generalized theory where the scalar field and the coupling constant vary with time. We find also that in the early Universe there may be amplification of gravitational waves.

  19. Static and Dynamic Moduli of Malm Carbonate: A Poroelastic Correlation

    Science.gov (United States)

    Hassanzadegan, Alireza; Guérizec, Romain; Reinsch, Thomas; Blöcher, Guido; Zimmermann, Günter; Milsch, Harald

    2016-08-01

    The static and poroelastic moduli of a porous rock, e.g., the drained bulk modulus, can be derived from stress-strain curves in rock mechanical tests, and the dynamic moduli, e.g., dynamic Poisson's ratio, can be determined by acoustic velocity and bulk density measurements. As static and dynamic elastic moduli are different, a correlation is often required to populate geomechanical models. A novel poroelastic approach is introduced to correlate static and dynamic bulk moduli of outcrop analogues samples, representative of Upper-Malm reservoir rock in the Molasse basin, southwestern Germany. Drained and unjacketed poroelastic experiments were performed at two different temperature levels (30 and 60°C). For correlating the static and dynamic elastic moduli, a drained acoustic velocity ratio is introduced, corresponding to the drained Poisson's ratio in poroelasticity. The strength of poroelastic coupling, i.e., the product of Biot and Skempton coefficients here, was the key parameter. The value of this parameter decreased with increasing effective pressure by about 56 ~% from 0.51 at 3 MPa to 0.22 at 73 MPa. In contrast, the maximum change in P- and S-wave velocities was only 3 % in this pressure range. This correlation approach can be used in characterizing underground reservoirs, and can be employed to relate seismicity and geomechanics (seismo-mechanics).

  20. The longitudinal controls fixed static stability of tailless aircraft

    OpenAIRE

    de Castro, Helena V.

    2000-01-01

    This paper describes the development of a simple theory of the longitudinal controls fixed static stability of tailless aeroplanes. The classical theory, as developed for the conventional aircraft, is modified to accommodate the particular features of the tailless aeroplanes. The theory was then applied to a particular blended-wing-body tailless civil transport aircraft, BWB-98. Cranfield University

  1. An overview of representation theorems for static risk measures

    Institute of Scientific and Technical Information of China (English)

    SONG YongSheng; YAN JiaAn

    2009-01-01

    In this paper, we give an overview of representation theorems for various static risk measures: coherent or convex risk measures, risk measures with comonotonic subadditivity or convexity, law-invariant coherent or convex risk measures, risk measures with comonotonic subadditivity or convexity and respecting stochastic orders.

  2. Implementation of the quasi-static method for neutron transport

    Energy Technology Data Exchange (ETDEWEB)

    Alcaro, Fabio; Dulla, Sandra; Ravetto, Piero, E-mail: fabio.alcaro@polito.it, E-mail: sandra.dulla@polito.it, E-mail: piero.ravetto@polito.it [Dipartimento di Energetica, Politecnico di Torino (Italy); Le Tellier, Romain; Suteau, Christophe, E-mail: romain.le-tellier@cea.fr, E-mail: christophe.suteau@cea.fr [CEA, DEN, DER/SPRC/LEPh, Cadarache, Saint Paul-lez-Durance (France)

    2011-07-01

    The study of the dynamic behavior of next generation nuclear reactors is a fundamental aspect for safety and reliability assessments. Despite the growing performances of modern computers, the full solution of the neutron Boltzmann equation in the time domain is still an impracticable task, thus several approximate dynamic models have been proposed for the simulation of nuclear reactor transients; the quasi-static method represents the standard tool currently adopted for the space-time solution of neutron transport problems. All the practical applications of this method that have been proposed contain a major limit, consisting in the use of isotropic quantities, such as scalar fluxes and isotropic external neutron sources, being the only data structures available in most deterministic transport codes. The loss of the angular information produces both inaccuracies in the solution of the kinetic model and the inconsistency of the quasi-static method itself. The present paper is devoted to the implementation of a consistent quasi-static method. The computational platform developed by CEA in Cadarache has been used for the creation of a kinetic package to be coupled with the existing SNATCH solver, a discrete-ordinate multi-dimensional neutron transport solver, employed for the solution of the steady-state Boltzmann equation. The work aims at highlighting the effects of the angular treatment of the neutron flux on the transient analysis, comparing the results with those produced by the previous implementations of the quasi-static method. (author)

  3. Recognition of Moving and Static Faces by Young Infants

    Science.gov (United States)

    Otsuka, Yumiko; Konishi, Yukuo; Kanazawa, So; Yamaguchi, Masami K.; Abdi, Herve; O'Toole, Alice J.

    2009-01-01

    This study compared 3- to 4-month-olds' recognition of previously unfamiliar faces learned in a moving or a static condition. Infants in the moving condition showed successful recognition with only 30 s familiarization, even when different images of a face were used in the familiarization and test phase (Experiment 1). In contrast, infants in the…

  4. From Static to Dynamic Mathematics: Historical and Representational Perspectives

    Science.gov (United States)

    Moreno-Armella, Luis; Hegedus, Stephen J.; Kaput, James J.

    2008-01-01

    The nature of mathematical reference fields has substantially evolved with the advent of new types of digital technologies enabling students greater access to understanding the use and application of mathematical ideas and procedures. We analyze the evolution of symbolic thinking over time, from static notations to dynamic inscriptions in new…

  5. The acceleration of a neutron in a static electric field

    Energy Technology Data Exchange (ETDEWEB)

    Cappelletti, R.L., E-mail: ron.cappelletti@nist.gov [NIST Center for Neutron Research, Gaithersburg, MD 20899 (United States)

    2012-06-18

    We show that when a non-relativistic neutron travels in a static electric field, the acceleration vector operator is perpendicular to the velocity operator. Kinetic energy is conserved. A spin-dependent field term in the canonical momentum gives rise to a non-dispersive contribution to the quantum mechanical (Aharonov–Casher) phase. This motion differs from that in a static magnetic field which has no field term in the canonical momentum and no conservation of kinetic energy. For the geometry of the Aharonov–Casher effect, there is no acceleration, while in Mott–Schwinger scattering, the acceleration causes a spin-dependent change in neutron direction. -- Highlights: ► Acceleration of a neutron in an E field is orthogonal to velocity. KE is conserved. ► For the Aharonov–Casher (AC) effect, acceleration is 0. ► The AC phase arises from the field term in the canonical momentum. ► In a static B field there is no field term in the canonical momentum. ► In a static B field KE is exchanged with Zeeman energy to conserve energy.

  6. Static Solutions of Einstein's Equations with Cylindrical Symmetry

    Science.gov (United States)

    Trendafilova, C. S.; Fulling, S. A.

    2011-01-01

    In analogy with the standard derivation of the Schwarzschild solution, we find all static, cylindrically symmetric solutions of the Einstein field equations for vacuum. These include not only the well-known cone solution, which is locally flat, but others in which the metric coefficients are powers of the radial coordinate and the spacetime is…

  7. Neuron firing frequency dependence on the static magnetic field intensity

    Science.gov (United States)

    Azanza, M. J.; del Moral, A.

    1995-02-01

    The effects of static magnetic field (SMF) of B intensity ( B = 0.003-0.72 T) on neurons are studied. The firing frequency f decreases exponentially with B2 and a threshold field B0 (≈ 0.57 T), where f abruptly drops to zero, is observed. A suitable model is developed where SMF's liberate membrane bounded Ca 2+ ions.

  8. Three-way flexible cantilever probes for static contact

    DEFF Research Database (Denmark)

    Wang, Fei; Petersen, Dirch Hjorth; Jensen, Helle Vendelbo;

    2011-01-01

    In micro four-point probe measurements, three-way flexible L-shaped cantilever probes show significant advantages over conventional straight cantilever probes. The L-shaped cantilever allows static contact to the sample surface which reduces the frictional wear of the cantilever tips. We analyze...

  9. Static electric dipole polarizability of lithium atoms in Debye plasmas

    Institute of Scientific and Technical Information of China (English)

    Ning Li-Na; Qi Yue-Ying

    2012-01-01

    The static electric dipole polarizabilities of the ground state and n ≤ 3 excited states of a lithium atom embedded in a weekly coupled plasma environment are investigated as a function of the plasma screening radium.The plasma screening of the Coulomb interaction is described by the Debye-Hückel potential and the interaction between the valence electron and the atomic core is described by a model potential.The electron energies and wave functions for both the bound and continuum states are calculated by solving the Schr(o)dinger equation numerically using the symplectic integrator.The oscillator strengths,partial-wave,and total static dipole polarizabilities of the ground state and n ≤ 3 excited states of the lithium atom are calculated.Comparison of present results with thosc of other authors,when available,is made.The results for the 2s ground state demonstrated that the oscillator strengths and the static dipole polarizabilities from np orbitals do not always increase or decrease with the plasma screening effect increasing,unlike that for hydrogen-like ions,especially for 2s→3p transition there is a zero value for both the oscillator strength and the static dipole polarizability for screening length D =10.3106a0,which is associated with the Cooper minima.

  10. Model Checking Is Static Analysis of Modal Logic

    DEFF Research Database (Denmark)

    Nielson, Flemming; Nielson, Hanne Riis

    2010-01-01

    Flow Logic is an approach to the static analysis of programs that has been developed for functional, imperative and object-oriented programming languages and for concurrent, distributed, mobile and cryptographic process calculi. In this paper we extend it; to deal with modal logics and prove...

  11. Relationship between static foot posture and foot mobility

    Directory of Open Access Journals (Sweden)

    McPoil Thomas G

    2011-01-01

    Full Text Available Abstract Background It is not uncommon for a person's foot posture and/or mobility to be assessed during a clinical examination. The exact relationship, however, between static posture and mobility is not known. Objective The purpose of this study was to determine the degree of association between static foot posture and mobility. Method The static foot posture and foot mobility of 203 healthy individuals was assessed and then analyzed to determine if low arched or "pronated" feet are more mobile than high arched or "supinated" feet. Results The study demonstrated that those individuals with a lower standing dorsal arch height and/or a wider standing midfoot width had greater mobility in their foot. In addition, those individuals with higher Foot Posture Index (FPI values demonstrated greater mobility and those with lower FPI values demonstrated less mobility. Finally, the amount of foot mobility that an individual has can be predicted reasonably well using either a 3 or 4 variable linear regression model. Conclusions Because of the relationship between static foot posture and mobility, it is recommended that both be assessed as part of a comprehensive evaluation of a individual with foot problems.

  12. An overview of representation theorems for static risk measures

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    In this paper,we give an overview of representation theorems for various static risk measures:coherent or convex risk measures, risk measures with comonotonic subadditivity or convexity, law-invariant coherent or convex risk measures, risk measures with comonotonic subadditivity or convexity and respecting stochastic orders.

  13. Low Redundancy in Static Dictionaries with Constant Query Time

    DEFF Research Database (Denmark)

    Pagh, Rasmus

    2001-01-01

    A static dictionary is a data structure for storing subsets of a finite universe U, so that membership queries can be answered efficiently. We study this problem in a unit cost RAM model with word size Ω(log |U|), and show that for n-element subsets, constant worst case query time can be obtained...

  14. Cardiovascular responses to voluntary and nonvoluntary static exercise in humans.

    Science.gov (United States)

    Friedman, D B; Peel, C; Mitchell, J H

    1992-11-01

    We have measured the cardiovascular responses during voluntary and nonvoluntary (electrically induced) one-leg static exercise in humans. Eight normal subjects were studied at rest and during 5 min of static leg extension at 20% of maximal voluntary contraction performed voluntarily and nonvoluntarily in random order. Heart rate (HR), mean arterial pressure (MAP), and cardiac output (CO) were determined, and peripheral vascular resistance (PVR) and stroke volume (SV) were calculated. HR increased from approximately 65 +/- 3 beats/min at rest to 80 +/- 4 and 78 +/- 6 beats/min (P voluntary and nonvoluntary contractions, respectively. CO increased from 5.1 +/- 0.7 to 6.0 +/- 0.8 and 6.2 +/- 0.8 l/min (P voluntary and nonvoluntary contractions, respectively. PVR and SV did not change significantly during voluntary or nonvoluntary contractions. Thus the cardiovascular responses were not different between voluntary and electrically induced contractions. These results suggest that the increases in CO, HR, SV, MAP, and PVR during 5 min of static contractions can be elicited without any contribution from a central neural mechanism (central command). However, central command could still have an important role during voluntary static exercise.

  15. Maxwell-Higgs equation on higher dimensional static curved spacetimes

    Science.gov (United States)

    Mulyanto, Akbar, Fiki Taufik; Gunara, Bobby Eka

    2015-09-01

    In this paper we consider a class of solutions of Maxwell-Higgs equation in higher dimensional static curved spacetimes called Schwarzchild de-Sitter spacetimes. We obtain the general form of the electric fields and magnetic fields in background Schwarzchild de-Sitter spacetimes. However, determining the interaction between photons with the Higgs scalar fields is needed further studies.

  16. Static And Kinematic Formulation Of Planar Reciprocal Assemblies

    DEFF Research Database (Denmark)

    Parigi, Dario; Kirkegaard, Poul Henning

    2013-01-01

    Planar reciprocal frames are two dimensional structures formed by elements joined together according to the principle of structural reciprocity. In this paper a rigorous formulation of the static and kinematic problem is proposed and developed by extending the work on pin-jointed assemblies by Pe...

  17. Maxwell-Higgs equation on higher dimensional static curved spacetimes

    Energy Technology Data Exchange (ETDEWEB)

    Mulyanto, E-mail: mulyanto37@gmail.com [Theoretical Physics Laboratory, Theoretical High Energy Physics and Instrumentation Research Group, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10 Bandung 40132 (Indonesia); Akbar, Fiki Taufik, E-mail: ftakbar@fi.itb.ac.id; Gunara, Bobby Eka, E-mail: bobby@fi.itb.ac.id [Theoretical Physics Laboratory, Theoretical High Energy Physics and Instrumentation Research Group, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10 Bandung 40132 (Indonesia); Indonesia Center for Theoretical and Mathematical Physics (ICTMP) (Indonesia)

    2015-09-30

    In this paper we consider a class of solutions of Maxwell-Higgs equation in higher dimensional static curved spacetimes called Schwarzchild de-Sitter spacetimes. We obtain the general form of the electric fields and magnetic fields in background Schwarzchild de-Sitter spacetimes. However, determining the interaction between photons with the Higgs scalar fields is needed further studies.

  18. Test chambers for cell culture in static magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Glinka, Marek, E-mail: mag@iq.pl [Research and Development Centre of Electrical Machines. 188 Rozdzienskiego Street, 40-203 Katowice (Poland); Gawron, Stanisław, E-mail: s.gawron@komel.katowice.pl [Research and Development Centre of Electrical Machines. 188 Rozdzienskiego Street, 40-203 Katowice (Poland); Sieroń, Aleksander, E-mail: sieron1@tlen.pl [Department of Internal Diseases, Angiology and Physical Medicine in Bytom. Medical University of Silesia in Katowice. 15 Batorego Street, 41-902 Bytom (Poland); Pawłowska–Góral, Katarzyna, E-mail: kgoral@sum.edu.pl [Department of Food and Nutrition in Sosnowiec. Medical University of Silesia in Katowice. 8 Jednosci Street, 41-200 Sosnowiec (Poland); Cieślar, Grzegorz, E-mail: cieslar1@tlen.pl [Department of Internal Diseases, Angiology and Physical Medicine in Bytom. Medical University of Silesia in Katowice. 15 Batorego Street, 41-902 Bytom (Poland); Sieroń–Stołtny, Karolina [Department of Internal Diseases, Angiology and Physical Medicine in Bytom. Medical University of Silesia in Katowice. 15 Batorego Street, 41-902 Bytom (Poland)

    2013-04-15

    Article presents a test chamber intended to be used for in vitro cell culture in homogenous constant magnetic field with parametrically variable magnitude. We constructed test chambers with constant parameters of control homeostasis of cell culture for the different parameters of static magnetic field. The next step was the computer calculation of 2D and 3D simulation of the static magnetic field distribution in the chamber. The analysis of 2D and 3D calculations of magnetic induction in the cells' exposition plane reveals, in comparison to the detection results, the greater accuracy of 2D calculations (Figs. 9 and 10). The divergence in 2D method was 2–4% and 8 to 10% in 3D method (reaching 10% only out of the cells′ cultures margins). -- Highlights: ► We present test chamber to be used for in vitro cell culture in static magnetic field. ► The technical data of the chamber construction was presented. ► 2D versus 3D simulation of static magnetic field distribution in chamber was reported. ► We report the accuracy of 2D calculation than 3D.

  19. No hair theorems for a static and stationary reflecting star

    Science.gov (United States)

    Bhattacharjee, Srijit; Sarkar, Sudipta

    2017-04-01

    We prove the nonexistence of massive scalar, vector and tensor hairs outside the surface of a static and stationary compact reflecting star. Our result is the extension of the no-hair theorem for black holes to horizonless compact configurations with reflecting boundary condition at the surface. We also generalize the proof for spacetimes with a positive cosmological constant.

  20. Modified lattice-statics approach to dislocation calculations. I - Formalism

    Science.gov (United States)

    Esterling, D. M.

    1978-01-01

    A modified lattice-statics method to calculate the atomic displacements associated with a screw dislocation is outlined. The model incorporates an anharmonic region wherein the forces are derived from a pair potential. Appropriate energy and force expressions are derived. The modifications necessary for the implementation of the conjugate-gradient function minimization method are also derived.

  1. Static and Dynamic Modeling of a Solar Active Region

    Science.gov (United States)

    Warren, Harry P.; Winebarger, Amy R.

    2007-09-01

    Recent hydrostatic simulations of solar active regions have shown that it is possible to reproduce both the total intensity and the general morphology of the high-temperature emission observed at soft X-ray wavelengths using static heating models. These static models, however, cannot account for the lower temperature emission. In addition, there is ample observational evidence that the solar corona is highly variable, indicating a significant role for dynamical processes in coronal heating. Because they are computationally demanding, full hydrodynamic simulations of solar active regions have not been considered previously. In this paper we make first application of an impulsive heating model to the simulation of an entire active region, AR 8156 observed on 1998 February 16. We model this region by coupling potential field extrapolations to full solutions of the time-dependent hydrodynamic loop equations. To make the problem more tractable we begin with a static heating model that reproduces the emission observed in four different Yohkoh Soft X-Ray Telescope (SXT) filters and consider impulsive heating scenarios that yield time-averaged SXT intensities that are consistent with the static case. We find that it is possible to reproduce the total observed soft X-ray emission in all of the SXT filters with a dynamical heating model, indicating that nanoflare heating is consistent with the observational properties of the high-temperature solar corona. At EUV wavelengths the simulated emission shows more coronal loops, but the agreement between the simulation and the observation is still not acceptable.

  2. CPV System with Static Linear Fresnel Lenses in a Greenhouse

    NARCIS (Netherlands)

    Sonneveld, Piet; Zahn, H.; Swinkels, Gert-Jan

    2010-01-01

    A new CPV system with a static linear Fresnel lens, silicon PV module suitable for concentrated radiation and an innovative tracking system is integrated in a greenhouse covering. The basic idea of this horticultural application is to develop a greenhouse for pot plants (typical shadow plants) which

  3. Static-light meson masses from twisted mass lattice QCD

    CERN Document Server

    Jansen, K; Shindler, A; Wagner, M

    2008-01-01

    We compute the static-light meson spectrum using two-flavor Wilson twisted mass lattice QCD. We have considered five different values for the light quark mass corresponding to 300 MeV < m_PS < 600 MeV. We have extrapolated our results, to make predictions regarding the spectrum of B and B_s mesons.

  4. Static friction in elastic adhesive MEMS contacts, models and experiment

    NARCIS (Netherlands)

    Tas, Niels Roelof; Gui, C.; Elwenspoek, Michael Curt

    2000-01-01

    Static friction in shearing mode can be expressed as the product of the shear strength of the interface and the real contact area. The influence of roughness on friction in elastic adhesive contact is analyzed. Special attention is paid to low loading conditions, in which the number of contact

  5. Model Checking Is Static Analysis of Modal Logic

    DEFF Research Database (Denmark)

    Nielson, Flemming; Nielson, Hanne Riis

    2010-01-01

    Flow Logic is an approach to the static analysis of programs that has been developed for functional, imperative and object-oriented programming languages and for concurrent, distributed, mobile and cryptographic process calculi. In this paper we extend it; to deal with modal logics and prove...

  6. Costs and effects of chlamydial screening : Dynamic versus static modeling

    NARCIS (Netherlands)

    Welte, R; Postma, M; Leidl, R; Kretzschmar, M

    2005-01-01

    Objective: The objective of this study was to assess the impact of modeling type on the economic evaluation of screening programs for asymptomatic Chlamydia trachomatis infections. Study: We compared a stochastic network simulation model (dynamic model) with a decision analysis model (static model)

  7. A Light-Weight Statically Scheduled Network-on-Chip

    DEFF Research Database (Denmark)

    Sørensen, Rasmus Bo; Schoeberl, Martin; Sparsø, Jens

    2012-01-01

    This paper investigates how a light-weight, statically scheduled network-on-chip (NoC) for real-time systems can be designed and implemented. The NoC provides communication channels between all cores with equal bandwidth and latency. The design is FPGA-friendly and consumes a minimum of resources...

  8. Static context model for context aware E-Learning

    Directory of Open Access Journals (Sweden)

    Minu. M. Das

    2010-06-01

    Full Text Available Context aware E-Learning systems provide learning content according to a learner’s context. In order to determine a learner’s context, the parameters that constitute the context and the values of these parameters in the current learner’s situation have to be found. There are several existing context aware E-Learning systems and each of these are taking care of some of the context parameters - like learning styles, learner preferences etc. But, a standardized static context model that helps to capture a learner’s context in its ntirety is not available. This paper proposes a static context model that helps to capture a learner’s context. The static context model is developed by consolidating the various context parameters used in the existing context aware E-Learning systems and organizing them into an appropriate structure. The structure of the static context model along with the parameters that constitute the context is explained in the paper

  9. Static axisymmetric rings in general relativity: How diverse they are

    CERN Document Server

    Semerák, O

    2016-01-01

    Three static and axially symmetric (Weyl-type) ring singularities -- the Majumdar-Papapetrou--type (extremally charged) ring, the Bach-Weyl ring and the Appell ring -- are studied in general relativity in order to show how remarkably the geometries in their vicinity differ from each other. This is demonstrated on basic measures of the rings and on invariant characteristics given by the metric and by its first and second derivatives (lapse, gravitational acceleration and curvature), and also on geodesic motion. The results are also compared against the Kerr space-time which possesses a ring singularity too. The Kerr solution is only stationary, not static, but in spite of the consequent complication by dragging, its ring appears to be simpler than the static rings. We show that this mainly applies to the Bach-Weyl ring, although this straightforward counter-part of the Newtonian homogeneous circular ring is by default being taken as the simplest ring solution, and although the other two static ring sources may...

  10. A New Approach for Magneto-Static Hysteresis Behavioral Modeling

    DEFF Research Database (Denmark)

    Astorino, Antonio; Swaminathan, Madhavan; Antonini, Giulio

    2016-01-01

    In this paper, a new behavioral modeling approach for magneto-static hysteresis is presented. Many accurate models are currently available, but none of them seems to be able to correctly reproduce all the possible B-H paths with low computational cost. By contrast, the approach proposed...... achieved when comparing the measured and simulated results....

  11. 40 CFR 53.64 - Test procedure: Static fractionator test.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Test procedure: Static fractionator test. 53.64 Section 53.64 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Performance Characteristics of Class II Equivalent Methods for PM2.5 § 53.64 Test procedure:...

  12. Static analysis of topology-dependent broadcast networks

    DEFF Research Database (Denmark)

    Nanz, Sebastian; Nielson, Flemming; Nielson, Hanne Riis

    2010-01-01

    changing network topology is a crucial ingredient. In this paper, we develop a static analysis that automatically constructs an abstract transition system, labelled by actions and connectivity information, to yield a mobility-preserving finite abstraction of the behaviour of a network expressed...

  13. Theory of multisource crosstalk reduction by phase-encoded statics

    KAUST Repository

    Schuster, Gerard T.

    2011-03-01

    Formulas are derived that relate the strength of the crosstalk noise in supergather migration images to the variance of time, amplitude and polarity shifts in encoding functions. A supergather migration image is computed by migrating an encoded supergather, where the supergather is formed by stacking a large number of encoded shot gathers. Analysis reveals that for temporal source static shifts in each shot gather, the crosstalk noise is exponentially reduced with increasing variance of the static shift and the square of source frequency. This is not too surprising because larger time shifts lead to less correlation between traces in different shot gathers, and so should tend to reduce the crosstalk noise. Analysis also reveals that combining both polarity and time statics is a superior encoding strategy compared to using either polarity statics or time statics alone. Signal-to-noise (SNR) estimates show that for a standard migration image and for an image computed by migrating a phase-encoded supergather; here, G is the number of traces in a shot gather, I is the number of stacking iterations in the supergather and S is the number of encoded/blended shot gathers that comprise the supergather. If the supergather can be uniformly divided up into Q unique sub-supergathers, then the resulting SNR of the final image is, which means that we can enhance image quality but at the expense of Q times more cost. The importance of these formulas is that they provide a precise understanding between different phase encoding strategies and image quality. Finally, we show that iterative migration of phase-encoded supergathers is a special case of passive seismic interferometry. We suggest that the crosstalk noise formulas can be helpful in designing optimal strategies for passive seismic interferometry and efficient extraction of Green\\'s functions from simulated supergathers. © 2011 The Authors Geophysical Journal International © 2011 RAS.

  14. Vrancea slab earthquakes triggered by static stress transfer

    Directory of Open Access Journals (Sweden)

    A. Ganas

    2010-12-01

    Full Text Available The purpose of this paper is to study the interaction of the Vrancea seismic activity (Romania in space as result of Coulomb, static stress transfer during M=7+ events. In this area, three large events occurred in 1977, 1986 and 1990 at mid-lower, lithospheric depths and with similar focal mechanisms. Assuming elastic rheology for the deforming rocks it is suggested that frictional sliding on pre-existing fault produced the 1986 M=7.1 event (depth 131 km, that was possibly triggered by the 1977 M=7.4 event (depth 94 km. We calculated a static stress transfer of 0.52–0.78 bar to the hypocentre of the 1986 event. On the contrary, the occurrence of the 1990 event is uncertain: it is located inside the relaxed (shadow zone of the combined 1977 and 1986 static stress field considering an azimuth for maximum compression of N307° E. It follows that, the 1990 earthquake most likely represents an unbroken patch (asperity of the 1977 rupture plane that failed due to loading. However, if a different compression azimuth is assumed (N323° E then the 1990 event was also possibly triggered by static stress transfer of the 1977 and 1986 events (combined. Our modeling is a first-order approximation of the kind of earthquake interaction we might expect at intermediate lithospheric depths (80–90 to 130–140 km. It is also suggested that static stress transfer may explain the clustering of Vrancea earthquakes in space by the rupturing of two (possibly three NW-dipping major zones of weakness (faults which accommodate the extension (vertical elongation of the slab.

  15. Spatial Distributions of Foreshocks and Aftershocks: Static or Dynamic Triggering

    Science.gov (United States)

    Werner, M. J.; Rubin, A. M.

    2012-04-01

    In recent years, the spatial distributions of foreshocks and aftershocks have been scrutinized for evidence supporting either triggering by static stress changes induced by the permanent deformation from prior earthquakes or triggering by the dynamic stresses from seismic waves. Felzer & Brodsky (2006) identified small (mbeyond the zone traditionally thought to be affected by static stress changes. On this basis, they argued that dynamic stresses are responsible for triggering earthquakes. Richards-Dinger et al. (2010) and other studies, however, have presented several lines of evidence that suggest otherwise. One crucial question is whether the stacked distances of pairs of earthquakes, representing either mainshock-aftershock or foreshock-mainshock pairs, are in fact correctly identified and not misattributed, unrelated earthquakes. This question is especially important in the critical distance range of several to tens of earthquake radii, over which static stresses are thought to be too small to affect seismicity. If earthquake pairs in this range are not causally related, then the histogram of foreshock-mainshock and mainshock-aftershock pairs should be identical, and the difference between the two histograms can be used to identify remote triggering. Results based on southern Californian seismicity suggest that (1) the existence of a single power-law with a particular exponent may not be a robust observation, (2) geothermal regions seem to play an important role over the relevant distances, (3) remote triggering seems to exist beyond the classical static stress influence zone (perhaps out to 15 km after mainshocks with magnitudes between 3 and 4), (4) simple ETAS model simulations cannot reproduce all observations, and (5) at most one-third of the remote aftershocks had received significant static Coulomb stress change from much earlier but nearby large (m>5) quakes, suggesting that a misattribution of aftershocks statically triggered by large quakes as

  16. Prediction of formation of abrasion and landslide hazardshores of the volga reservoirs ПРОГНОЗИРОВАНИЕ АБРАЗИОННОЙ И ОПОЛЗНЕВОЙ ОПАСНОСТИ ПОБЕРЕЖИЙ ВОЛЖСКИХ ВОДОХРАНИЛИЩ

    Directory of Open Access Journals (Sweden)

    Koposov Eugeniy Vasil’evich

    2013-06-01

    Full Text Available The coastline of reservoirs of Volga Сascade has a total length of more than 11,000 km. According to various estimates about 37—48 % of total length of the banks are the banks, breaking down due to abrasion. The length of coastline of reservoirs of Volga Сascade within the boundaries of settlements is 985 km, including those in the major cities 442 km. The greatest evolutionary destruction banks are exposed to is avalanche- crumbling the shore of abrasion. The most dangerous of unpredictable behavior is land- slide coast. The Gorky reservoir in the forthcoming decade is expected to be subjected to reformation abrasion in his lake part with the average intensity of 0.47—0.10 m/year. For the period of exploitation Cheboksary reservoir from 1981 to 2011 averages of observed speed retreat edge of the abrasion shores amounted to 1.2—0.2 m/year. Large landslides on the Volga River confined to the high slopes of the right bank, folded Upper, Upper Jurassic, Lower Cretaceous deposits, are most common in the Gorky, Cheboksary, Kuibyshev, Saratov, Volgograd reservoir. Development of landslide Sursko-Volga slope in Vasil’sursk is going on from the beginning of observations (1523. In the twentieth century significant increase in landslides observed appeared in 1913—1914, 1946—1948,1979—1981 (1981 is the year when Cheboksary reservoir had been filled to the level of63.0 meters. Research method of fractal analysis of landslide activity on the right bank of the Volga River in connection with the periods of solar activity have shown that the period 2008—2019 should be characterized by a reduced number of developing land- slides, although in 2012 and 2017—2019 were perhaps the years with mean rates. This is confirmed by the data for 2012 for the city of Nizhny Novgorod. Landslides does not reveal the general tendency to decay with time. The problem of protection from destruction sites and sliding abrasion shores existing reservoirs does

  17. Comparative Study of Static Task Scheduling Algorithms for Heterogeneous Systems

    Directory of Open Access Journals (Sweden)

    Miss. Kalpana A. Manudhane

    2013-03-01

    Full Text Available On the distributed or parallel heterogeneous computing systems, an application is usually decomposed into several interdependent sets of co-operating subtasks and assigned to a set of available processors for execution. Task scheduling is in general NP-compete problem. Static task scheduling algorithms are categorized as Heuristic based and Guided random search based scheduling algorithms. Heuristic algorithms guaranteed to find near optimal solution in less than polynomial time. Heuristic based list scheduling algorithms are Heterogeneous Earliest Finish Time (HEFT and Critical-Path-On- -Processor (CPOP. Whereas, Guided random search based scheduling algorithms have shown robust performance on verity of schedulingproblems. Typical examples are Multiple Priority Queueing Genetic Algorithm (MPQGA, Tabu Search(TS, Ant Colony System (ACS. This paper gives comparative study of all these static task scheduling algorithms and compares them on the basis of average makespan, schedule length ratio (SLR and speedup and running time of algorithm.

  18. Consistent Static Models of Local Thermospheric Composition Profiles

    CERN Document Server

    Picone, J M; Drob, D P

    2016-01-01

    The authors investigate the ideal, nondriven multifluid equations of motion to identify consistent (i.e., truly stationary), mechanically static models for composition profiles within the thermosphere. These physically faithful functions are necessary to define the parametric core of future empirical atmospheric models and climatologies. Based on the strength of interspecies coupling, the thermosphere has three altitude regions: (1) the lower thermosphere (herein z ~200 km), in which the species flows are approximately uncoupled; and (3) a transition region in between, where the effective species particle mass and the effective species vertical flow interpolate between the solutions for the upper and lower thermosphere. We place this view in the context of current terminology within the community, i.e., a fully mixed (lower) region and an upper region in diffusive equilibrium (DE). The latter condition, DE, currently used in empirical composition models, does not represent a truly static composition profile ...

  19. Static Corrosion Test of Porous Iron Material with Polymer Coating

    Science.gov (United States)

    Markušová-Bučková, Lucia; Oriňaková, Renáta; Oriňak, Andrej; Gorejová, Radka; Kupková, Miriam; Hrubovčáková, Monika; Baláž, Matej; Kováľ, Karol

    2016-12-01

    At present biodegradable implants received increased attention due to their use in various fields of medicine. This work is dedicated to testing of biodegradable materials which could be used as bone implants. The samples were prepared from the carbonyl iron powder by replication method and surface polymer film was produced through sol-gel process. Corrosion testing was carried out under static conditions during 12 weeks in Hank's solution. The quantity of corrosion products increased with prolonging time of static test as it can be concluded from the results of EDX analysis. The degradation of open cell materials with polyethylene glycol coating layer was faster compared to uncoated Fe sample. Also the mass losses were higher for samples with PEG coating. The polymer coating brought about the desired increase in degradation rate of porous iron material.

  20. Matter under Extreme Conditions: Advances Based on Static Compression

    Science.gov (United States)

    Hemley, Russell

    2008-04-01

    Current technological advances make it possible to perform experiments on materials at static or sustained conditions to multimegabar pressures (several hundred GPa) and several thousand degree (˜1 eV) temperatures. Densities of condensed matter can now be increased over an order of magnitude, causing novel transformations and new physical and chemical phenomena to occur. Growth in this area has been made possible by advances in diamond-anvil cell methods coupled with a wide range of probes, including x-ray diffraction, spectroscopy, inelastic scattering, radiography, and infrared spectroscopy using synchrotron radiation. Examples include investigations of dense hydrogen; transformations in molecular materials; novel ceramics; new types of superconductors, electronic, and magnetic materials; and liquids and amorphous materials. Particularly exciting are new developments in time resolved methods and coupling of static and dynamic compression techniques made possible by the creation of new large-scale facilities and novel technologies.

  1. Neuromuscular disorders associated with static lumbar flexion: a feline model.

    Science.gov (United States)

    Solomonow, M; Zhou, B; Baratta, R V; Zhu, M; Lu, Y

    2002-04-01

    Static flexion of the lumbar spine with constant load applied to the viscoelastic structures for 20 minutes and for 50 minutes resulted in development of spasms and inhibition in the multifidus muscles (e.g., deep erector spinae) and in creep of the supraspinous ligament in the feline model. The development of spasms and inhibition was not dependent on load magnitude. It is suggested that occupational and sports activities which require prolonged static lumbar flexion within the physiological range can cause a "sprain"-like injury to the ligaments, which in turn reflexively induce spasms and inhibition in some erector spinae muscles. Such disorder may take a long time to recover, in the order of days to weeks, depending on the level of creep developed in the tissues.

  2. On the twin paradox in static spacetimes: I. Schwarzschild metric

    CERN Document Server

    Sokolowski, Leszek M

    2012-01-01

    Motivated by a conjecture put forward by Abramowicz and Bajtlik we reconsider the twin paradox in static spacetimes. According to a well known theorem in Lorentzian geometry the longest timelike worldline between two given points is the unique geodesic line without points conjugate to the initial point on the segment joining the two points. We calculate the proper times for static twins, for twins moving on a circular orbit (if it is a geodesic) around a centre of symmetry and for twins travelling on outgoing and ingoing radial timelike geodesics. We show that the twins on the radial geodesic worldlines are always the oldest ones and we explicitly find the conjugate points (if they exist) outside the relevant segments. As it is of its own mathematical interest, we find general Jacobi vector fields on the geodesic lines under consideration. In the first part of the work we investigate Schwarzschild geometry.

  3. A Succinct Approach to Static Analysis and Model Checking

    DEFF Research Database (Denmark)

    Filipiuk, Piotr

    In a number of areas software correctness is crucial, therefore it is often desirable to formally verify the presence of various properties or the absence of errors. This thesis presents a framework for concisely expressing static analysis and model checking problems. The framework facilitates...... in the classical formulation of ALFP logic. Finally, we show that the logics and the associated solvers can be used for rapid prototyping. We illustrate that by a variety of case studies from static analysis and model checking....... rapid prototyping of new analyses and consists of variants of ALFP logic and associated solvers. First, we present a Lattice based Least Fixed Point Logic (LLFP) that allows interpretations over complete lattices satisfying Ascending Chain Condition. We establish a Moore Family result for LLFP...

  4. Structural analysis with the finite element method linear statics

    CERN Document Server

    Oñate, Eugenio

    2013-01-01

    STRUCTURAL ANALYSIS WITH THE FINITE ELEMENT METHOD Linear Statics Volume 1 : The Basis and Solids Eugenio Oñate The two volumes of this book cover most of the theoretical and computational aspects of the linear static analysis of structures with the Finite Element Method (FEM). The content of the book is based on the lecture notes of a basic course on Structural Analysis with the FEM taught by the author at the Technical University of Catalonia (UPC) in Barcelona, Spain for the last 30 years. Volume1 presents the basis of the FEM for structural analysis and a detailed description of the finite element formulation for axially loaded bars, plane elasticity problems, axisymmetric solids and general three dimensional solids. Each chapter describes the background theory for each structural model considered, details of the finite element formulation and guidelines for the application to structural engineering problems. The book includes a chapter on miscellaneous topics such as treatment of inclined supports, elas...

  5. Static analysis of worst-case stack cache behavior

    DEFF Research Database (Denmark)

    Jordan, Alexander; Brandner, Florian; Schoeberl, Martin

    2013-01-01

    Utilizing a stack cache in a real-time system can aid predictability by avoiding interference that heap memory traffic causes on the data cache. While loads and stores are guaranteed cache hits, explicit operations are responsible for managing the stack cache. The behavior of these operations can...... be analyzed statically. We present algorithms that derive worst-case bounds on the latency-inducing operations of the stack cache. Their results can be used by a static WCET tool. By breaking the analysis down into subproblems that solve intra-procedural data-flow analysis and path searches on the call......-graph, the worst-case bounds can be efficiently yet precisely determined. Our evaluation using the MiBench benchmark suite shows that only 37% and 21% of potential stack cache operations actually store to and load from memory, respectively. Analysis times are modest, on average running between 0.46s and 1.30s per...

  6. Evolution of Primordial Protostellar Clouds Quasi-Static Analysis

    CERN Document Server

    Omukai, K; Uehara, H; Susa, H; Omukai, Kazuyuki; Nishi, Ryoichi; Uehara, Hideya; Susa, Hajime

    1998-01-01

    The contraction processes of metal-free molecular clouds of starlike mass (or cloud cores) are investigated. We calculate radiative transfer of the H_2 lines and examine quasi-static contraction with radiative cooling. Comparing two time-scales, the free-fall time t_ff and the time-scale of quasi-static contraction t_qsc (nearly equal to t_cool, the cooling time) of these cores, we find that the ratio of the two time-scales t_ff/t_qsc, i.e., the efficiency of cooling, becomes larger with contraction even under the existence of cold and opaque envelopes. In particular, for fragments of primordial filamentary clouds, for which t_ff is nearly equal to t_qsc at the fragmentation epoch, they collapse dynamically in the free-fall time-scale. This efficiency of cooling is unique to line cooling.

  7. Alcohol and marijuana effects on static visual acuity.

    Science.gov (United States)

    Adams, A J; Brown, B; Flom, M C; Jones, R T; Jampolsky, A

    1975-11-01

    Static visual acuity was measured at two contrast levels (12 and 49%) in ten subjects in a double blind experiment involving five drug conditions of alcohol and marijuana (0.5 ml and 1.0 ml/kg body weight of 95% ethanol, 8 and 15 mg delta-9-tetrahydrocannabinol (THC), and a placebo). We found no statistically significant change in static visual acuity for any of the dose levels at any of the measurement time up to six hours following drug ingestion; this is sharply contrasted with the marked decrements in acuity which were found in the same subjects under the same drug conditions when the targets were in motion and required corrdinated eye movements for their resolution.

  8. Epidemiologically optimal static networks from temporal network data

    CERN Document Server

    Holme, Petter

    2013-01-01

    Network epidemiology's most important assumption is that the contact structure over which infectious diseases propagate can be represented as a static network. However, contacts are highly dynamic, changing at many time scales. In this paper, we investigate conceptually simple methods to construct static graphs for network epidemiology from temporal contact data. We evaluate these methods on empirical and synthetic model data. For almost all our cases, the network representation that captures most relevant information is a so-called exponential-threshold network. In these, each contact contributes with a weight decreasing exponentially with time, and there is an edge between a pair of vertices if the weight between them exceeds a threshold. Networks of aggregated contacts over an optimally chosen time window perform almost as good as the exponential-threshold networks. On the other hand, networks of accumulated contacts over the entire sampling time, and networks of concurrent partnerships, perform worse. We ...

  9. Eye gaze during observation of static faces in deaf people.

    Directory of Open Access Journals (Sweden)

    Katsumi Watanabe

    Full Text Available Knowing where people look when viewing faces provides an objective measure into the part of information entering the visual system as well as into the cognitive strategy involved in facial perception. In the present study, we recorded the eye movements of 20 congenitally deaf (10 male and 10 female and 23 (11 male and 12 female normal-hearing Japanese participants while they evaluated the emotional valence of static face stimuli. While no difference was found in the evaluation scores, the eye movements during facial observations differed among participant groups. The deaf group looked at the eyes more frequently and for longer duration than the nose whereas the hearing group focused on the nose (or the central region of face more than the eyes. These results suggest that the strategy employed to extract visual information when viewing static faces may differ between deaf and hearing people.

  10. Static Var Compensator Project for the SPS Electrical Network

    CERN Document Server

    Kahle, K

    2000-01-01

    This paper gives a progress report on the Static Var Compensator project BEF2 for the SPS electrical network. Following a market survey and a call for tenders, a contract has been awarded to ABB Sweden and the project is now in the phase of detailed performance studies, system design and ordering of the main electrical components. This progress report describes the electrical design, summarises the results of the harmonic filter design studies, discusses the interfacing of the control- and communication system and explains the mechanical layout of the Static Var Compensator and as well as the project co-ordination with the feeding BE substation renovation project. Finally, the project planning is presented and critical paths are evaluated.

  11. Reduced arterial diameter during static exercise in humans

    DEFF Research Database (Denmark)

    Olesen, H L; Mitchell, J H; Friedman, D B

    1995-01-01

    of another limb. Static exercise increased heart rate and mean arterial pressure, which were largest during one-leg knee extension. After exercise heart rate and mean arterial pressure returned to the resting level. No changes were recorded in arterial carbon dioxide tension, and the rate of perceived......In eight subjects luminal diameter of the resting limb radial and dorsalis pedis arteries was determined by high-resolution ultrasound (20 MHz). This measurement was followed during rest and during 2 min of static handgrip or of one-leg knee extension at 30% of maximal voluntary contraction...... exertion was approximately 15 units after both types of exercise. The dorsalis pedis arterial diameter was 1.50 +/- 0.20 mm (mean and SE) and the radial AD 2.45 +/- 0.12 mm. During both types of contractions the luminal diameters decreased approximately 3.5% within the first 30 s (P

  12. Design, Static Analysis And Fabrication Of Composite Joints

    Science.gov (United States)

    Mathiselvan, G.; Gobinath, R.; Yuvaraja, S.; Raja, T.

    2017-05-01

    The Bonded joints will be having one of the important issues in the composite technology is the repairing of aging in aircraft applications. In these applications and also for joining various composite material parts together, the composite materials fastened together either using adhesives or mechanical fasteners. In this paper, we have carried out design, static analysis of 3-D models and fabrication of the composite joints (bonded, riveted and hybrid). The 3-D model of the composite structure will be fabricated by using the materials such as epoxy resin, glass fibre material and aluminium rivet for preparing the joints. The static analysis was carried out with different joint by using ANSYS software. After fabrication, parametric study was also conducted to compare the performance of the hybrid joint with varying adherent width, adhesive thickness and overlap length. Different joint and its materials tensile test result have compared.

  13. Interferometric methods for mapping static electric and magnetic fields

    DEFF Research Database (Denmark)

    Pozzi, Giulio; Beleggia, Marco; Kasama, Takeshi;

    2014-01-01

    The mapping of static electric and magnetic fields using electron probes with a resolution and sensitivity that are sufficient to reveal nanoscale features in materials requires the use of phase-sensitive methods such as the shadow technique, coherent Foucault imaging and the Transport of Intensi......) the model-independent determination of the locations and magnitudes of field sources (electric charges and magnetic dipoles) directly from electron holographic data.......The mapping of static electric and magnetic fields using electron probes with a resolution and sensitivity that are sufficient to reveal nanoscale features in materials requires the use of phase-sensitive methods such as the shadow technique, coherent Foucault imaging and the Transport of Intensity...... on theoretical models that form the basis of the quantitative interpretation of electron holographic data. We review the application of electron holography to a variety of samples (including electric fields associated with p–n junctions in semiconductors, quantized magnetic flux in superconductors...

  14. Self-forces on static bodies in arbitrary dimensions

    CERN Document Server

    Harte, Abraham I; Taylor, Peter

    2016-01-01

    We derive exact expressions for the scalar and electromagnetic self-forces and self-torques acting on arbitrary static extended bodies in arbitrary static spacetimes with any number of dimensions. Non-perturbatively, our results are identical in all dimensions. Meaningful point particle limits are quite different in different dimensions, however. These limits are defined and evaluated, resulting in simple "regularization algorithms" which can be used in concrete calculations. In these limits, self-interaction is shown to be progressively less important in higher numbers of dimensions; it generically competes in magnitude with increasingly high-order extended-body effects. Conversely, we show that self-interaction effects can be relatively large in $1+1$ and $2+1$ dimensions. Our motivations for this work are twofold: First, no previous derivation of the self-force has been provided in arbitrary dimensions, and heuristic arguments presented by different authors have resulted in conflicting conclusions. Second,...

  15. Test-Data Generation Guided by Static Defect Detection

    Institute of Scientific and Technical Information of China (English)

    Dan Hao; Lu Zhang; Ming-Hao Liu; He Li; Jia-Su Sun

    2009-01-01

    Software testing is an important technique to assure the quality of software systems, especially high-confidence systems. To automate the process of software testing, many automatic test-data generation techniques have been proposed.To generate effective test data, we propose a test-data generation technique guided by static defect detection in this paper.Using static defect detection analysis, our approach first identifies a set of suspicious statements which are likely to contain faults, then generates test data to cover these suspicious statements by converting the problem of test-data generation to the constraint satisfaction problem. We performed a case study to validate the effectiveness of our approach, and made a simple comparison with another test-data generation on-line tool, JUnit Factory. The results show that, compared with JUnit Factory, our approach generates fewer test data that are competitive on fault detection.

  16. Matlab Stability and Control Toolbox: Trim and Static Stability Module

    Science.gov (United States)

    Crespo, Luis G.; Kenny, Sean P.

    2006-01-01

    This paper presents the technical background of the Trim and Static module of the Matlab Stability and Control Toolbox. This module performs a low-fidelity stability and control assessment of an aircraft model for a set of flight critical conditions. This is attained by determining if the control authority available for trim is sufficient and if the static stability characteristics are adequate. These conditions can be selected from a prescribed set or can be specified to meet particular requirements. The prescribed set of conditions includes horizontal flight, take-off rotation, landing flare, steady roll, steady turn and pull-up/ push-over flight, for which several operating conditions can be specified. A mathematical model was developed allowing for six-dimensional trim, adjustable inertial properties, asymmetric vehicle layouts, arbitrary number of engines, multi-axial thrust vectoring, engine(s)-out conditions, crosswind and gyroscopic effects.

  17. On several static cylindrically symmetric solutions of the Einstein equations

    Science.gov (United States)

    Grigoryev, Sergey; Leonov, Arkadiy

    2016-04-01

    We study the Einstein equations in the static cylindrically symmetric case with the stress-energy tensor of the form T νμ = diag{μ,-αμ,-βμ,-γμ}, where μ is an unknown function and α, β, γ are arbitrary real constants (α is assumed to be nonzero). The stress-energy tensor of this form includes as special cases several well-known solutions, such as the perfect fluid solution with the barotropic equation of state, the solution with the static electric field and the solution with the massless scalar field. We solve the Einstein equations with this stress-energy tensor and study some properties of the obtained metric.

  18. HST Super Lightweight Interchangeable Carrier (SLIC) Static Test

    Science.gov (United States)

    Chambers, William V.

    2008-01-01

    The HST Super Light Weight Interchangeable Carrier Static Test program calls for a total of 15 load cases with an average of 9 simultaneous push/pull locations per load case. This testing program represents the most complex static test ever attempted at Goddard Space Flight Center. Many unique multi-pull fixtures were designed to apply the simultaneous loading. Additionally, a total of 600 channels of data required processing for each loadcase. A total of 1100 separate strain gages were installed on SLIC. A team of 15 trained technicians were needed to apply test loads via mechanical hand pumps for several load cases. All 15 load cases were successfully conducted within 15 weeks. The ManTech team successfully tested all SLIC 1200 interface clips to the required testing loads. Several unique designs were needed to address testing challenges as loadline interference, Payload Safety, payload flexibility and opposing load applications.

  19. INTERVAL ARITHMETIC AND STATIC INTERVAL FINITE ELEMENT METHOD

    Institute of Scientific and Technical Information of China (English)

    郭书祥; 吕震宙

    2001-01-01

    When the uncertainties of structures may be bounded in intervals, through some suitable discretization, interval finite element method can be constructed by combining the interval analysis with the traditional finite element method(FEM). The two parameters,median and deviation, were used to represent the uncertainties of interval variables. Based on the arithmetic rules of intervals, some properties and arithmetic rules of interval variables were demonstrated. Combining the procedure of interval analysis with FEM, a static linear interval finite element method was presented to solve the non-random uncertain structures. The solving of the characteristic parameters of n-freedom uncertain displacement field of the static governing equation was transformed into 2 n-order linear equations. It is shown by a numerical example that the proposed method is practical and effective.

  20. Field theory of bicritical and tetracritical points. I. Statics.

    Science.gov (United States)

    Folk, R; Holovatch, Yu; Moser, G

    2008-10-01

    We calculate the static critical behavior of systems of O(n_||)(plus sign in circle)O(n_perpendicular) symmetry by the renormalization group method within the minimal subtraction scheme in two-loop order. Summation methods lead to fixed points describing multicritical behavior. Their stability border lines in the space of the order parameter components n_|| and n_perpendicular and spatial dimension d are calculated. The essential features obtained already in two-loop order for the interesting case of an antiferromagnet in a magnetic field ( n_|| =1, n_perpendicular =2 ) are the stability of the biconical fixed point and the neighborhood of the stability border lines to the other fixed points, leading to very small transient exponents. We are also able to calculate the flow of static couplings, which allows us to consider the attraction region. Depending on the nonuniversal background parameters, the existence of different multicritical behavior (bicritical or tetracritical) is possible, including a triple point.