WorldWideScience

Sample records for volatile sulfide avs

  1. Acid volatile sulfide (AVS)- a comment

    NARCIS (Netherlands)

    Meysman, F.J.R.; Middelburg, J.J.

    2005-01-01

    The review by Rickard and Morse (this volume) adequately summarizes our current understanding with respect to acid-volatile sulfides (AVS). At the same time, this review addresses some of the misunderstandings with regard to measurements and dynamics of this important sedimentary sulfur pool. In

  2. Bioavailability assessment of toxic metals using the technique "acid-volatile sulfide (AVS)-simultaneously extracted metals (SEM)" in marine sediments collected in Todos os Santos Bay, Brazil.

    Science.gov (United States)

    Silva, Jucelino B; Nascimento, Rodrigo A; de Oliva, Sergio T; de Oliveira, Olívia M C; Ferreira, Sergio L C

    2015-10-01

    This paper reports the bioavailability of the metals (cadmium, copper, zinc, lead, and nickel) in sediment samples collected in seven stations from the São Paulo Estuary, Todos os Santos Bay, Brazil. The bioavailability was determined by employing the technique "acid-volatile sulfide (AVS) and simultaneously extracted metal (SEM)". The elements cadmium, copper, lead, and zinc were determined using differential pulse anodic stripping voltammetry (DPASV), while nickel was quantified utilizing electrothermal atomic absorption spectrometry (ET AAS). The accuracy of these methods was confirmed using a certified reference material of estuarine sediment (NIST 1646). The sulfide was quantified using potentiometry with selective electrode and the organic matter determination employing an indirect volumetric method using potassium dichromate and iron(II) sulfate solutions. The bioavailability of the metals was estimated by relationship between the concentration of AVS and the sum of the concentrations of the simultaneously extracted metals (ΣSEM), considering a significant toxicity when (ΣSEM)/(AVS) is higher than 1. The bioavailability values in the seven stations studied varied from 0.93 to 1.31 (June, 2014) and from 0.34 to 0.58 (September, 2014). These results demonstrated a critical condition of toxicity (bioavailability >1) in six of the seven sediment samples collected during the rainy season (June, 2014). In the other period (September, 2014), the bioavailability was always lower than 1 for all sediment samples collected in the seven stations. The individual values of the concentrations of the five metals were compared with the parameters PEL (probable effects level) and TEL (threshold effects level), which are commonly employed for characterization of ecological risk in environmental systems. This comparison revealed that all metals have concentrations lower than the PEL and only zinc and lead in some stations have contents higher than the TEL. The

  3. Acid Volatile Sulfides (avs) and the Bioavailability of Trace Metals in the Channel of the SÃO Francisco River, Sepetiba Bay - de Janeiro-Brazil

    Science.gov (United States)

    Monte, Christiane; Rodrigues, Ana Paula; Marinho, Matheus; Quaresma, Tássia; Machado, Wilson

    2014-05-01

    Sepetiba Bay has 430 Km2 of internal and 2,500 Km2 area of the drainage basin (Lacerda et al., 2007), located 60 km west of the city of Rio de Janeiro. Sepetiba Bay has 430 Km2 of internal and 2,500 Km2 area of the drainage basin (Lacerda et al., 2007), located 60 km west of the city of Rio de Janeiro.The San Francisco channel comes from the Guandu River and empties into Sepetiba Bay and is the main contributor of freshwater to the estuarine system. The Guandu River system/channel of San Francisco receives contribution of domestic and industrial effluents, which go largely to Sepetiba Bay. This work aimed to evaluate the .This work aimed to evaluate the ratio SEM/AVS as a way of predicting bioavailability trace metals from industrial sewage, mainly, in the estuarine system of Sepetiba. This model is based on the property of some Divalent metal cations (Cd, Cu, Ni, Pb and Zn), by presenting a low solubility constant, are removed from the soluble fraction by precipitation, forming secondary metal sulfides. Were held four transects, made up of three points each, the coast line to the center of the Bay. The surface sediment was collected with a van Veen sampler type ,packed in glass jars and kept frozen until analysis.The determination of SEM/AVS followed the methodology described by Allen et al. (1991). The variation between sulfide 159.88 ± 0.05 µmol/g on 12 points. The metals that entered the sum of simultaneous extraction were: Cd, Cu, Ni, Pb and Zn ranging from: 6.47 ± 0.11 µmol/g on sum.The means (± standard deviation) ratio SEM/AVS per transect were: 1.04 ± 1.20 (transect 1); 0.48 ± 0.53 (transect 2); 1.26 ± 1.32 (transect 3) and 0.18 ± 0.14 (transect 4). Only transects 1 and 3 had higher results than 1 , meaning that there are more divalent metal sulfides in the environment. This means that only the sulfides would not be capable of complex and may reflect the potential bioavailability of these in the aquatic environment. There is no statistical

  4. Interlaboratory comparison of measurements of acid-volatile sulfide and simultaneously extracted nickel in spiked sediments

    Science.gov (United States)

    Brumbaugh, William G.; Hammerschmidt, Chad R.; Zanella, Luciana; Rogevich, Emily; Salata, Gregory; Bolek, Radoslaw

    2011-01-01

    An interlaboratory comparison of acid-volatile sulfide (AVS) and simultaneously extracted nickel (SEM_Ni) measurements of sediments was conducted among five independent laboratories. Relative standard deviations for the seven test samples ranged from 5.6 to 71% (mean?=?25%) for AVS and from 5.5 to 15% (mean?=?10%) for SEM_Ni. These results are in stark contrast to a recently published study that indicated AVS and SEM analyses were highly variable among laboratories.

  5. A kinetic approach to evaluate the association of acid volatile sulfide and simultaneously extracted metals in aquatic sediments

    NARCIS (Netherlands)

    Poot, A.; Meerman, E.; Gillissen, F.; Koelmans, A.A.

    2009-01-01

    The acid volatile sulfide (AVS) and simultaneously extracted metals (¿SEM) method is widely used for evaluating potential bioavailability of heavy metals in soil and sediment. It is also criticized, because the requirement that AVS and SEM metals (i.e., Cd, Cu, Ni, Pb, and Zn) are associated in the

  6. 城市污染河道沉积物中AVS 与 Cr 的生物积累研究%Acid Volatile Sulfide and Bioaccumulation of Cr in Sediments from a Municipal Polluted River

    Institute of Scientific and Technical Information of China (English)

    利锋; 温琰茂; 朱娉婷; 金辉; 宋巍巍; 戴睿志

    2009-01-01

    研究区域为珠江三角洲一条典型城市污染河道,采集了13个站位沉积物、上覆水、间隙水及底栖动物样品进行分析.阐述了酸挥发性硫化物(acid volatile sulfide, AVS)与沉积物、上覆水、间隙水中的Cr(Ⅲ)和Cr(Ⅵ),以及寡毛纲底栖动物水丝蚓(Limnodrilus sp.)体内Cr含量的关系;围绕"Cr假设",探讨了城市重污染河道AVS与Cr的生物有效性的关系,以拓宽AVS作为沉积重金属生物毒性判据的应用范围.各站位沉积物总Cr均值为329.57 mg/kg,是背景值的9.4 倍,显示研究区域属于重度Cr污染区;沉积物及上覆水Cr(Ⅵ)均较低,表明其中的铬大部分为Cr(Ⅲ).研究区域AVS较高(均值为650.38 mg/kg),间隙水总Cr含量较低(均值为68.42 μg/L).除了Z1站位外,间隙水Cr(Ⅵ)均低于检出限,表明在AVS值较高的站位间隙水Cr(Ⅵ)很低.各站位水丝蚓体内总Cr含量(以DW计)为12.46~38.99 mg/kg,均值为25.85 mg/kg,高于类似研究的结果,证明水丝蚓体内Cr的积累较明显.进一步分析发现水丝蚓体内Cr含量与间隙水总Cr显著相关(r=0.614, p<0.05),因间隙水总Cr主要组分为Cr(Ⅲ),故在Cr污染严重的城市河流中,间隙水中的Cr(Ⅲ)对生物体的毒害作用不能忽视.

  7. 湛江湾沉积物中酸可挥发性硫和重金属含量分布及重金属生态风险评价%Distribution of acid-volatile sulfide(AVS)and heavy metal contents in sediment of Zhanjiang Bay and ecological risk assessment of heavy metals

    Institute of Scientific and Technical Information of China (English)

    施玉珍; 张际标; 李雪英; 柯盛; 孙省利; 陈春亮

    2012-01-01

    The acid volatile sulfides ( AVS) , heavy metals ( SEM) , total organic carbon ( TOC) and Eh were investigated simultaneously in 20 surface sediment samples collected from Zhanjiang Bay, the plane distribution of AVS and SEM content as well as the relationships among AVS, SEM, TOC and Eh were analyzed. The results indicated that AVS content in the surface sediment ranged from 0. 004 to 0. 547 μmol/g with the mean of 0. 155 μmol/g, SEM cotent in the surface sediment ranged from 2. 10 to 4. 27 μmol/g with the mean of 3. 32 μmol/g, which revealed a feature of low AVS and high SEM in Zhanjiang Bay relative to other sea area. AVS and SEM distributed quite similarly, showing high content at the bay top with the mean of 0. 361 μMol/g and 3. 52 μmol/g, respectively, and they decreased gradually from the south of Techen Island to bay mouth. AVS were positively related to TOC and negatively to Eh, which suggested that the sediment environment with high organic substance content and low oxidation-reduction potential was propitious to AVS production. The differences of CSEM5 - CAVS at 20 sample stations were 0 < ( CSEM5 - CAVS ) < 5 , which suggested that there was a moderate ecological risk of heavy metals in Zhanjiang Bay.%测定了湛江湾海域20个站位表层沉积物中的酸可挥发性硫(AVS)、同步浸提重金属(SEM)、TOC含量和Eh值,对AVS、SEM含量的平面分布及AVS与SEM、TOC含量、Eh值的相互关系进行了分析.结果表明:该海域表层沉积物中AVS含量范围为0.004~0.547 μmol/g,平均值为0.155μmoL/g,SEM含量范围为2.10~ 4.27 μmol/g,平均值为3.32 μmol/g,相对其他海域湛江湾海域沉积物表现出AVS含量较低,SEM含量较高的特征.AVS与SEM含量平面分布较一致,湾顶的含量都较高,含量均值分别为0.361和3.52 μmol/g,特呈岛以南到湾口呈逐渐减小的明显趋势.调查海域沉积物AVS与TOC含量呈显著正相关,与Eh值呈显著负相关,说明高有机质含量、低

  8. Influence of acid volatile sulfide and metal concentrations on metal bioavailability to marine invertebrates in contaminated sediments

    Science.gov (United States)

    Lee, B.-G.; Lee, J.-S.; Luoma, S.N.; Choi, H.J.; Koh, C.-H.

    2000-01-01

    An 18-day microcosm study was conducted to evaluate the influence of acid volatile sulfides (AVS) and metal additions on bioaccumulation from sediments of Cd, Ni, and Zn in two clams (Macoma balthica and Potamocorbula amurensis) and three marine polychaetes (Neanthes arenaceodentata, Heteromastus filiformis, and Spiophanes missionensis). Manipulation of AVS by oxidation of naturally anoxic sediments allowed use of metal concentrations typical of nature and evaluation of processes important to chronic metal exposure. A vertical sediment column similar to that often found in nature was used to facilitate realistic biological behavior. Results showed that AVS or porewater (PW) metals controlled bioaccumulation in only 2 of 15 metal-animal combinations. Bioaccumulation of all three metals by the bivalves was related significantly to metal concentrations extracted from sediments (SEM) but not to [SEM - AVS] or PW metals. SEM predominantly influenced bioaccumulation of Ni and Zn in N. arenaceodentata, but Cd bioaccumulation followed PW Cd concentrations. SEM controlled tissue concentrations of all three metals in H. filiformis and S. missionensis, with minor influences from metal-sulfide chemistry. Significant bioaccumulation occurred when SEM was only a small fraction of AVS in several treatments. Three factors appeared to contribute to the differences between these bioaccumulation results and the results from toxicity tests reported previously: differences in experimental design, dietary uptake, and biological attributes of the species, including mode and depth of feeding.An 18-day microcosm study was conducted to evaluate the influence of acid volatile sulfides (AVS) and metal additions on bioaccumulation from sediments of Cd, Ni, and Zn in two clams (Macoma balthica and Potamocorbula amurensis) and three marine polychaetes (Neanthes arenaceodentata, Heteromastus filiformis, and Spiophanes missionensis). Manipulation of AVS by oxidation of naturally anoxic sediments

  9. Relation of asid-volatile sulfide and clay content of sediment to the bioavailability of zinc and cadmium: laboratory plus field experiment

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Organic matter and iron and maganese oxides have been considered as the major affecting factors for metals in anoxic or oxidized sediment. In recent research, clay and sulfide are found as major factors in oxic or oxidized sediments that might affect bioavailability of metals. To test this hypothesis, the influence of sulfide, measured as acid-volatile sulfide (AVS), and clay content on the bioavailability of zinc and cadmium in sediments was examined. Laboratory simulative experiment and field verification experiment were conducted,showing that the bioavailability of zinc and cadmium is strongly correlated to AVS and clay content in sediments. Taking into account both AVS and clay parameters in sediments together can better indicate the bioavailability of zinc and cadmium rather than considering one of them alone.

  10. Measurement and biological significance of the volatile sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices.

    NARCIS (Netherlands)

    Tangerman, A.

    2009-01-01

    This review deals with the measurement of the volatile sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices of rats and humans (blood, serum, tissues, urine, breath, feces and flatus). Hydrogen sulfide and methanethiol both contain the active thiol (-SH

  11. Measurement and biological significance of the volatile sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices

    NARCIS (Netherlands)

    Tangerman, Albert

    2009-01-01

    This review deals with the measurement of the volatile Sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices of rats and humans (blood, serum, tissues, urine, breath, feces and flatus). Hydrogen sulfide and methanethiol both contain the active thiol (-SH

  12. Measurement and biological significance of the volatile sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices

    NARCIS (Netherlands)

    Tangerman, Albert

    2009-01-01

    This review deals with the measurement of the volatile Sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices of rats and humans (blood, serum, tissues, urine, breath, feces and flatus). Hydrogen sulfide and methanethiol both contain the active thiol

  13. Measurement and biological significance of the volatile sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices.

    NARCIS (Netherlands)

    Tangerman, A.

    2009-01-01

    This review deals with the measurement of the volatile sulfur compounds hydrogen sulfide, methanethiol and dimethyl sulfide in various biological matrices of rats and humans (blood, serum, tissues, urine, breath, feces and flatus). Hydrogen sulfide and methanethiol both contain the active thiol

  14. Volatilization of hydrogen sulfide from a quiescent surface.

    Science.gov (United States)

    de Cassia Feroni, Rita; Santos, Jane Meri; Reis, Neyval Costa

    2012-01-01

    Air-water mass transfer of hydrogen sulfide from a shallow tank with a quiescent surface under the influence of weak wind stress on the water surface was studied numerically using a two-dimensional model. The flow field in the tank was investigated using a computational code based on a finite volume, which is used to numerically solve momentum, mass and continuity conservation equations. The results show that water phase flow field is strongly dependent on the wind-induced surface velocity and the aspect ratio of the tank. Based on the numerical study, the liquid-side mass transfer coefficient is correlated with Reynolds number (R(e)), tank aspect ratio (AR) and Schmidt number (S(c)). Overall mass transfer coefficient (K(L)) values extend further downstream as the R(e) number increases.

  15. Emissions of volatile hydrocarbons (VOC) during drying of sawdust; Utslaepp av laettflyktiga kolvaeten vid torkning av biobraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Granstroem, Karin

    2001-08-01

    In the project 'Emissions of volatile hydrocarbons (VOC) during drying of sawdust' the identity, amount and composition of monoterpenes found in the drying medium of a fluidized bed drier drying sawdust from Norwegian spruce and Scotch pine has been determined. The energy efficiency of the drier has also been measured. The aim of this project was to reduce both emissions and energy required for drying, to minimize environmental and health hazards, and make drying more competitive. This would help our primary target group - small scale saw mills - to make use of the sawdust produced as a by- product by making pellets and briquettes. If the VOC remains in the sawdust its energy content will improve and therefore also its value as a fuel. The sawdust was dried to different moisture levels in a spouted bed drier at atmospheric pressure, using either recirculating or not recirculating drying medium with temperatures 140, 170 or 200 deg C. The emissions of VOC were measured using a flame ionization detector (FID) and the nature of the emissions analyzed with a gas chromatograph with mass spectrometric detector (GC-MS). The GC-MS data is reported as emitted substance per oven dry weight (odw). Experiments show that terpenes do not leave the sawdust in great amounts until it is dried to a moisture content (water/total weight) below 10%. When sawdust is dried to a predetermined moisture level, the terpene emissions increase when warmer incoming drying medium is used. The monoterpenes found in greatest amount are a-pinene, b-pinene, 3-carene, limonene and myrcene. y-terpinene was detected in emissions from pine but not from spruce. The relative amounts of different monoterpenes did not vary significantly with post-drying moisture content, but drying medium of higher temperature caused an increase in the relative amount of less volatile monoterpenes. The FID data is reported as concentration of VOC in the drying medium, and as weight VOC per odw. The concentration

  16. Acid Volatile Sulfide (AVS) als instrument bij de risicobeoordeling van waterbodems

    NARCIS (Netherlands)

    Hoop MAGT van den; Peijnenburg WJGM; Sijm DTHM; Berg GA van den; Heijdt LM van der; Zwolsman JJG; Rijksinstituut voor Integraal; LAC; ECO; CSR

    2000-01-01

    Risk assessment of sediments is primarily based on the determination of total content of polluted components. Analysis of sediment composition in the Netherlands, both at present and expected in the future, shows that heavy metals, especially Zn, Cu and Ni, appear to be the main compounds determinin

  17. Trace metals in floodplain lake sediments : SEM/AVS as indicator of bioavailability and ecological effects

    NARCIS (Netherlands)

    Griethuysen, van C.

    2006-01-01

    This thesis addresses the geochemical aspects of AVS (Acid Volatile Sulfide) and SEM (Simultaneously Extracted Metals) in floodplain lake sediment, its spatial distribution in floodplain lakes and dynamics over time, the link with effects on single species (bioassays), as well as the impact of

  18. O papel dos sulfetos volatilizados por acidificação no controle do potencial de biodisponibilidade de metais em sedimentos contaminados de um estuário tropical, no sudeste do Brasil The role of acid volatile sulfide in the control of potential metal bioavailability in contaminated sediments from a tropical estuary, southeast Brazil

    Directory of Open Access Journals (Sweden)

    Érico Casare Nizoli

    2009-01-01

    Full Text Available Measurements of acid volatile sulfide (AVS and simultaneously extracted metals (SEM were combined in order to verify the ecological hazard of contaminated sediments from the Santos-Cubatão Estuarine System (SE Brazil, which is located in one of the most industrialized areas in the Latin America. Intertidal sediments from the Morrão River estuary were collected seasonally in short cores. The redox conditions, organic matter contents and grain-size were the main controlling factors on SEM distribution. However, clear relationships among these variables and AVS were not observed. The molar SEM/AVS ratios were frequently > 1 especially in the summer, suggesting major metal bioavailability hazard in this humid hot season.

  19. Use of hydrochloric acid for determinining solid-phase arsenic partitioning in sulfidic sediments.

    Science.gov (United States)

    Wilkin, Richard T; Ford, Robert G

    2002-11-15

    We examined the use of room-temperature hydrochloric acid (1-6 M) and salt solutions of magnesium chloride, sodium carbonate, and sodium sulfide for the removal of arsenic from synthetic iron monosulfides and contaminated sediments containing acid-volatile sulfides (AVS). Results indicate that acid-soluble arsenic reacts with H2S released from AVS phases and precipitates at low pH as disordered orpiment or alacranite. Arsenic sulfide precipitation is consistent with geochemical modeling in that conditions during acid extraction are predicted to be oversaturated with respect to orpiment, realgar, or both. Binding of arsenic with sulfide at low pH is sufficiently strong that 6 M HCl will not keep spiked arsenic in the dissolved fraction. Over a wide range of AVS concentrations and molar [As]/[AVS] ratios, acid extraction of arsenic from sulfide-bearing sediments will give biased results that overestimate the stability or underestimate the bioavailability of sediment-bound arsenic. Alkaline solutions of sodium sulfide and sodium carbonate are efficient in removing arsenic from arsenic sulfides and mixed iron-arsenic sulfides because of the high solubility of arsenic at alkaline pH, the formation of stable arsenic complexes with sulfide or carbonate, or both.

  20. In situ solvothermal growth of metal-organic framework-5 supported on porous copper foam for noninvasive sampling of plant volatile sulfides.

    Science.gov (United States)

    Hu, Yuling; Lian, Haixian; Zhou, Langjun; Li, Gongke

    2015-01-06

    The present study reported on an in situ solvothermal growth method for immobilization of metal-organic framework MOF-5 on porous copper foam support for enrichment of plant volatile sulfides. The porous copper support impregnated with mother liquor of MOF-5 anchors the nucleation and growth of MOF crystallites at its surface, and its architecture of the three-dimensional channel enables accommodation of the MOF-5 crystallite seed. A continuous and well-intergrown MOF-5 layer, evidenced from scanning electron microscope imaging and X-ray diffraction, was successfully immobilized on the porous metal bar with good adhesion and high stability. Results show that the resultant MOF-5 coating was thermally stable up to 420 °C and robust enough for replicate extraction for at least 200 times. The MOF-5 bar was then applied to the headspace sorptive extraction of the volatile organic sulfur compounds in Chinese chive and garlic sprout in combination with thermal desorption-gas chromatography/mass spectrometry. It showed high extraction sensitivity and good selectivity to these plant volatile sulfides owing to the extraordinary porosity of the metal-organic framework as well as the interaction between the S-donor sites and the surface cations at the crystal edges. Several primary sulfur volatiles containing allyl methyl sulfide, dimethyl disulfide, diallyl sulfide, methyl allyl disulfide, and diallyl disulfide were quantified. Their limits of detection were found to be in the range of 0.2-1.7 μg/L. The organic sulfides were detected in the range of 6.0-23.8 μg/g with recoveries of 76.6-100.2% in Chinese chive and 11.4-54.6 μg/g with recoveries of 77.1-99.8% in garlic sprout. The results indicate the immobilization of MOF-5 on copper foam provides an efficient enrichment formats for noninvasive sampling of plant volatiles.

  1. Assessment of sediment quality based on acid-volatile sulfide and simultaneously extracted metals in heavily industrialized area of Asaluyeh, Persian Gulf: concentrations, spatial distributions, and sediment bioavailability/toxicity.

    Science.gov (United States)

    Arfaeinia, Hossein; Nabipour, Iraj; Ostovar, Afshin; Asadgol, Zahra; Abuee, Ehsan; Keshtkar, Mozhgan; Dobaradaran, Sina

    2016-05-01

    Sediment samples from the coastal area of Asaluyeh harbor were collected during autumn and spring 2015. The acid-volatile sulfide (AVS) and simultaneously extracted metals (SEMs) were measured to assess the sediment quality and potential ecological risks. The average concentrations (and relative standard deviation (RSD)) of AVS in the industrial sediments were 12.32 μmol/g (36.91) and 6.34 μmol/g (80.05) in autumn and spring, respectively, while in the urban area, these values were 0.44 μmol/g (123.50) and 0.31 μmol/g (160.0) in autumn and spring, respectively. The average concentrations of SEM (and RSD) in the industrial sediments were 15.02 μmol/g (14.38) and 12.34 μmol/g (20.65) in autumn and spring, respectively, while in the urban area, these values were 1.10 μmol/g (43.03) and 1.06 μmol/g (55.59) in autumn and spring, respectively. Zn was the predominant component (34.25-86.24 %) of SEM, while the corresponding value for Cd, much more toxic ingredient, was less than 1 %. Some of the coastal sediments in the harbor of Asaluyeh (20 and 47 % in autumn and spring, respectively) had expected adverse biological effects based on the suggested criterion by United States Environmental Protection Agency (USEPA), while most stations (80 and 53 % in autumn and spring, respectively) had uncertain adverse effects.

  2. The risk assessment of heavy metals in Futian mangrove forest sediment in Shenzhen Bay (South China) based on SEM-AVS analysis.

    Science.gov (United States)

    Chai, Minwei; Shen, Xiaoxue; Li, Ruili; Qiu, Guoyu

    2015-08-15

    The risks of heavy metal in Futian mangrove forest sediment were assessed using the acid-volatile sulfide (AVS) and simultaneously extracted metals (SEM) methods. The results indicated that AVS distributions were more variable than the SEM distributions at all 16 sampling sites. The positive correlation between AVS and SEM indicated that their similar formative and existing conditions and that AVS acted as an important carrier for SEM. The major SEM component was Zn (69.7.3-94.2%), whereas the Cd contribution (the most toxic metal present) to SEM was no more than 1%. The possible adverse effects caused by heavy metals at ten sampling sites may be due to higher levels of SEMs, rather than AVSs. The total organic carbon (TOC) was an important metal-binding phase in the sediments. Taking into account the TOC concentration, there were no adverse effects due to heavy metals in any of the Futian mangrove forest sediments.

  3. Field testing of ethanolamine, an alternative volatile alkalising agent; Faeltprovning av etanolamin vid Idbaeckens Kraftvaermeverk i Nykoeping

    Energy Technology Data Exchange (ETDEWEB)

    Tavast, J. [Alstom Power Sweden AB, Finspong (Sweden)

    2002-02-01

    The use of alternative volatile organic alkalising agents is increasing. These compounds are usually stronger bases than ammonia and most are also less volatile. This results in a higher pH-value in the first condensate, reducing the risk for erosion corrosion. The disadvantages are a higher cost as well as thermal decomposition in the boiler drum and in the superheater. The most common decomposition products are carbon dioxide and organic acids like formic and acetic acid. These decomposition products are acidic and may be corrosive as such. They also increase the cation conductivity making it difficult or impossible to use monitoring of cation conductivity to supervise steam purity. Thermal stability is therefore a desired property of an organic alkalising agent, in addition to a high base strength and a relatively low volatility. Ethanolamine (ETA) is a potential alternative volatile alkalising agent. ETA has shown promising alkalising properties in earlier tests performed. ETA did also show a better thermal stability than other candidates included in the tests. The results indicated that it should be possible to use a mixture of ammonia and ETA as an alkalising agent to reduce the risk for erosion corrosion without too much disturbance caused by the increase of the cation conductivity of the steam. The reason for the interest for the combination of ammonia and ETA is that such a combination should be well suited to alkalise the whole steam and condensate system. ETA should be enriched in the region of the first condensate while ammonia should be enriched in the latter part of the system. ETA has also been successfully used to reduce erosion corrosion as well as transport of iron oxides in PWR plants in the US. A field test as a complement to the earlier autoclave tests is a logical step towards establishing the use of a mixture of ETA and ammonia also in conventional fossil plants where erosion corrosion has been a problem. Such a field test has been performed

  4. Actinobacillus pleuropneumoniae is impaired by the garlic volatile allyl methyl sulfide (AMS) in vitro and in-feed garlic alleviates pleuropneumonia in a pig model.

    Science.gov (United States)

    Becker, Petra M; van Wikselaar, Piet G; Mul, Monique F; Pol, Arjan; Engel, Bas; Wijdenes, Jan W; van der Peet-Schwering, Carola M C; Wisselink, Henk J; Stockhofe-Zurwieden, Norbert

    2012-01-27

    Decomposition products of ingested garlic are to a certain extent excreted via the lungs. If the supposed health-supporting capacities associated with garlic extend to these exhaled sulfurous compounds, they could have an effect on the course of pneumonia. In this study, the garlic-derived volatile allyl methyl sulfide (AMS) as a lead compound of volatile garlic metabolites was shown to exhibit an antibacterial effect against the pig pathogen Actinobacillus pleuropneumoniae serotype 9. AMS caused a delay in the appearance of the optical density-monitored growth of A. pleuropneumoniae in medium when compared to unaffected growth curves, yet without lowering the stationary phase yield at the concentration range tested. At 1.1mM, AMS impaired the in vitro growth rate of A. pleuropneumoniae serotype 9 by 8% compared to unimpeded growth. In an animal trial, a garlic-fed group of 15 pigs that received a diet with 5% garlic feed component and a control group of 15 pigs that received a diet without garlic were infected with A. pleuropneumoniae serotype 2 via an aerosol and subsequently followed for 4 days. At the day of the challenge, blood AMS in the garlic-fed group amounted to 0.32 ± 0.13 μM. A beneficial, alleviating effect of garlic on the course and severity of an A. pleuropneumoniae infection in pigs was indicated by the reduced occurrence of characteristic pleuropneumonia lesions (27% of the lungs affected in the garlic-fed group vs. 47% in the control group) and a near to significant (p=0.06) lower relative lung weight post mortem in the garlic-fed group.

  5. Mechanisms of hydrogen sulfide removal by ground granulated blast furnace slag amended soil.

    Science.gov (United States)

    Xie, Mengyao; Leung, Anthony Kwan; Ng, Charles Wang Wai

    2017-02-06

    Ground granulated blast furnace slag (GGBS) amended soil has been found able to remove gaseous hydrogen sulfide (H2S). However, how H2S is removed by GGBS amended soil and why GGBS amended soil can be regenerated to remove H2S are not fully understood. In this study, laboratory column tests together with chemical analysis were conducted to investigate and reveal the mechanisms of H2S removal process in GGBS amended soil. Sulfur products formed on the surface of soil particle and in pore water were quantified. The test results reveal that the reaction between H2S and GGBS amended soil was a combined process of oxidation and acid-base reaction. The principal mechanism to remove H2S in GGBS amended soil was through the formation of acid volatile sulfide (AVS), elemental sulfur and thiosulfate. Soil pH value decreased gradually during regeneration and reuse cycles. It is found that the AVS plays a significant role in H2S removal during regeneration and reuse cycles. Adding GGBS increased the production of AVS and at the same time suppressed the formation of elemental sulfur. This mechanism is found to be more prominent when the soil water content is higher, leading to increased removal capacity.

  6. Katodisk beskyttelse av umbilicals

    OpenAIRE

    Mjølhus, Bjarte

    2008-01-01

    Ulike sider ved bruk av sinkbånd til korrosjonsbeskyttelse av karbonstål umbilical er evaluert. Det er utført litteraturstudie ved gjennomgang av tidligere rapporter, sammenligning av standarder og artikkelsøk. Langtidsforsøk med egne korrosjonsceller ble utført over 2 måneder for å undersøke korrosjonsbeskyttelse ved 4 ulike temperaturer. Det ble også gjort undersøkelser av korrosjonsbelegg i SEM for å undersøke og sammenligne med publiserte data. Åpen krets potensialet viste seg å ligge ...

  7. AVS on satellite

    Science.gov (United States)

    Zhao, Haiwu; Wang, Guozhong; Hou, Gang

    2005-07-01

    AVS is a new digital audio-video coding standard established by China. AVS will be used in digital TV broadcasting and next general optical disk. AVS adopted many digital audio-video coding techniques developed by Chinese company and universities in recent years, it has very low complexity compared to H.264, and AVS will charge very low royalty fee through one-step license including all AVS tools. So AVS is a good and competitive candidate for Chinese DTV and next generation optical disk. In addition, Chinese government has published a plan for satellite TV signal directly to home(DTH) and a telecommunication satellite named as SINO 2 will be launched in 2006. AVS will be also one of the best hopeful candidates of audio-video coding standard on satellite signal transmission.

  8. DESIGN AV FREMTIDENS KUMLOKK

    OpenAIRE

    Breien, William Topper

    2014-01-01

    Denne oppgavens mål har vært å utvikle et nytt design for kumlokk. Det nye designet skal være lettere enn utgangspunktet. Dette har blitt gjort ved hjelp av en iterativ designprosess, styrkeberegninger i Siemens NX 8, simuleringer av støp i Magmasofts MAGMA5, prøvestøping og testing ved støperiet til Ulefos Jernværk i Ulefoss. Denne rapporten inneholder teoretisk bakgrunn og beskrivelse av metoder tatt i bruk ved utvikling av nytt design, simulerin...

  9. Assessment of heavy metals pollution using AVS-SEM and fractionation techniques in Edku Lagoon sediments, Mediterranean Sea, Egypt.

    Science.gov (United States)

    El Zokm, Gehan M; Okbah, Mohamed A; Younis, Alaa M

    2015-01-01

    A method is presented to evaluate the fractionation of metals (Fe, Zn, Cu, Pb, Cd and Ni), acid volatile sulfide (AVS) and simultaneously extracted metals (SEM) in Edku lagoon sediments. Thirteen sediment samples were collected from the study area in the period of 2010-2011 to assess the potential bioavailability and toxicity of the selected metals. According to classification of the Interim Sediment Quality Quidelines (ISQG), five stations near the drains exhibited 10% toxic probability. The high AVS and low ∑SEM ranges in Summer were identified as 6-138 and 0.86-3.3 µmol g(-1) dry wet, respectively which are referring to the low mobility of heavy metals in this season and vice versa for winter (2.5-23.9 and 1.16-3.82 µmol g(-1) dry wet, respectively). According to the evaluation of USEPA, all sediment samples showed ∑SEM/AVS < 1 and ΣSEM-AVS < 0 and this indicates that Edku lagoon sediments didn't cause any adverse effects. Meanwhile, the calculations of the global contamination factor (GCF) and the individual contamination factors (ICF) using fractionation technique gave values of 111.644 and 84.555 in El Bosily drain and station 1 near the cages of fish farm, respectively due to possible contamination. Interestingly, the collected data refer that the mobility and bioavailability of heavy metals in Edku lagoon sediments posed a low risk of adverse biological effects due to cadmium, copper, lead, nickel and zinc in all evaluated stations.

  10. Verdsetting av brukermedvirkning ved utforming av skoleanlegg

    Directory of Open Access Journals (Sweden)

    Else Margrethe Lefdal

    2015-03-01

    Full Text Available Ved planlegging av offentlige bygninger i Norge forutsettes det at brukerne medvirker i prosessen. Dette er forankret i lov- og avtaleverk og motiveres ved at brukerne innehar en kompetanse som er av betydning for byggenes funksjonalitet. I denne artikkelen vil jeg belyse brukermedvirkningsproblematikk i planleggingen av et skoleanlegg for videregående opplæring. Tilgjengelige plan- og byggesaksdokumenter i den aktuelle fylkeskommunens digitale og fysiske arkiver er blitt analysert. I referater fra brukermøtene fremmes det for eksempel ønsker fra brukerne om begrenset bruk av glass. Det ferdige skole-anlegget har imidlertid utstrakt bruk av innvendige glassvegger, men det er ikke dokumentert diskusjoner knyttet til bestemmelsen av dette. Et profesjons- og maktperspektiv er relevant for å forstå hva som blir verdsatt, og hvilke strukt-urer og mekanismer som har påvirket planleggings­prosessen. De sentrale aktørgruppene er skoleeier og representantene for lærer- og arkitekt-profesjonen. Omfattende bruk av innvendig glass i skoleanlegget tolker jeg som et kompromiss mellom skoleeiers ønske om åpenhet og kontroll, lærernes ønske om mindre støy og arkitektens ønske om å skape romfølelse og visuelle siktlinjer.AbstractWhen planning public buildings in Norway, it is expected that users are involved in the process. This is grounded in legislation and agreements, and motivated by the idea that users have an expertise which is significant for the planning of the building’s functionality. The aim of this article is to investigate user participation in planning the school facilities for a secondary school. I have analyzed planning and building documents available in government records, digital and physical. In the reports from meetings with user groups, it is for example stated that users want to limit the use of glass. However, the completed school building has extensive use of glass dividing walls, but any discussions leading to this

  11. Aspects of the bottom sediment of Lake Nakaumi and Honjo area ~ featuring with organic matter and the Sulfides ~

    Science.gov (United States)

    Shinohara, R.

    2015-12-01

    Lake Nakaumi is a brackish water located at southwest Japan. Seawater from the Sea of Japan inflows through Sakai-strait, and river water flows through the Oohashi River into this lake. Lake Nakaumi is characterized with hypoxic and/or anoxic condition of bottom water derived with the distinct stratification of salinity in summer season. In this lake, a public project had been carried out for land reclamation since 1963. Honjo Area located to the north part of Lake Nakaumi, was semi-separated from Lake Nakaumi by reclamation dikes constructed for this project at 1981. However, this public project was aborted with the change of social conditions. To the effective utilization of the area, the partial removal of dike was carried out. Seawater from Sakai-strait flows directly into Honjo Area again. Environmental change of the lake is expected by this inflow of the seawater in Lake Nakaumi and Honjo Area after this restoration. It is well known that the surface sediment reflects the environment of lake bottom. The organic matter and the sulfides in sediment are good indicators of sedimentation environment. In this study, we analyzed them by several methods and grasped the bottom environment of both areas after the removal of dikes. We examined the impact of the restoration to both areas by comparing the observations with the past data. Surface sediment samples in Lake Nakaumi and Honjo Area were obtained at 77 and 40 stations, respectively. We collected surface sediment (about 1cm) were for each station, and analyzed total organic carbon (TOC) and total nitrogen (TN) as organic matter, and hydrogen sulfide (H2S) in pore water, total sulfide (TS) and acid volatile sulfide (AVS) as sulfides. TOC contents of Lake Nakaumi and Honjo Area range within 0.0-5.1% and 0.2-4.9%, respectively. TN contents range within 0.0-0.6 % and 0.1-0.6 %. TS contents range within 0.1-2.6% and 0.0-2.0 %. H2S contents range within 0.3-119.0 ppm and 0.5-140.4 ppm. AVS contents range within 0

  12. 深圳湾海域沉积物中酸可挥发性硫化物与重金属生态风险评价%Assessment on ecological risk of acid-volatile sulfide and tracemetals in marine sediment of Shenzhen Bay

    Institute of Scientific and Technical Information of China (English)

    施玉珍; 张际标; 李雪英; 柯盛; 孙省利

    2012-01-01

    The acid volatile sutiides (AVS), total organic carbon and heavy metals extracted simultaneously (SEM) in 10 surface sediment samples collected from the Shenzhen Bay were analyzed. The plane distribution of AVS and SEM and the relationships between AVS, SEM and TOC were researched. The results showed that AVS in the surface sediment ranged from0.06 to7.41 μmol/g with the mean of 2.51 μ.mol/g, The plane distribution of AVS and SEM was similar, which was decreased gradually from inside to outside of the Bay. SEM in the surface sediment ranged from 0.71 to 5.15 μmol/g with mean of 3.06 (μmol/g. The SEM and TOC were linearly related with AVS. The differences of XSEM-AVS at most of sample stations were 0< (ΣSEM-AVS) < 5, which showed thai there was a potential ecological risk of heavy metals in the Shenzhen Bay.%测定了深圳湾海域10个站点表层沉积物中的AVS、TOC和同步浸提重金属(SEM)的含量,对AVS、SEM的平面分布及AVS与SEM和TOC的相互关系进行了分析.结果表明:深圳湾海域表层沉积物AVS含量范围为0.06-7.41 μmol/g,平均值为2.51 μmol/g;SEM含量范围为0.71 -5.15 μmol/g,平均值为3.06μmol/g; AVS与SEM的平面分布较一致,呈从湾顶到湾中向湾外逐渐递减的明显趋势.调查海域AVS与SEM和TOC间具有良好的线性相关性,大多数站点∑SEM-AVS的差值均0< (∑SEM-AVS) <5,说明该海域可能存在重金属的中等毒性生态风险.

  13. AV dissociation, an inevitable response.

    Science.gov (United States)

    Wang, Kyuhyun; Benditt, David G

    2011-07-01

    The independent activation of the atria and ventricles, AV dissociation, is a common phenomenon that occurs during a wide variety of electrophysiologic circumstances. The clinical significance of AV dissociation is often misunderstood. This article examines the basis and clinical implications of AV dissociation. AV dissociation is often an obligatory, secondary phenomenon, and should not be construed as the primary disorder; it may be due to either the AV conduction system being completely blocked (3° AV block) or the P wave and the QRS complex being generated from separate sources (usually, the AV junction or ventricle) but occurring close together during the physiologic refractory period of each other. The latter may happen in junctional or ventricular arrhythmias including escape or accelerated rhythm, tachycardia, or premature beats. The crucial clinical point is not the AV dissociation itself, but that an underlying triggering primary disorder is present and should be identified. ©2011, Wiley Periodicals, Inc.

  14. Summer Student Report - AV Workflow

    CERN Document Server

    Abramson, Jessie

    2014-01-01

    The AV Workflow is web application which allows cern users to publish, update and delete videos from cds. During my summer internship I implemented the backend of the new version of the AV Worklow in python using the django framework.

  15. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  16. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  17. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  18. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  19. Introduction to AVS Audio

    Institute of Scientific and Technical Information of China (English)

    Hao-Jun Ai; Shui-Xian Chen; Rui-Min Hu

    2006-01-01

    This paper describes a general audio coding algorithm which has been recently standardized by AVS, China.The algorithm is based on a perceptual coding technique. The codec delivers near CD-quality audio at 128kb/s. This paper describes the coder structure in detail and discusses the reasons for specific design methods. A summary of the subjective test results are presented for the prototype codec. Comparison Mean Opinion Score (CMOS) test indicates that the quality of the AVS audio coder is comparable with MPEG Layer-3 audio coder. A real-time decoder was used for the characterization test,which is based on a 16-bit fixed-point DSP. The performance of the DSP solution was demonstrated, including computational complexity and storage characteristics.

  20. Negotiation Mechanism of AVS Standardization

    Institute of Scientific and Technical Information of China (English)

    Su Junbin

    2007-01-01

    @@ 1. Introduction The mission of the Audio Video Coding Standard (AVS) Working Group of China is to develop AVS standards drafts and deliver them to the national standardization administration authorities. Since its establishment in 2002, the AVS Working Group has developed rapidly, growing from 33 members in 2003 to 153 in 2006. By the end of 2006, it had put forward for approval nine standards drafts (Table 1) with Part 2 of the AVS 1.0 draft approved as a national standard in February 2006.

  1. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  2. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  3. Determination of hydrogen sulfide and volatile thiols in air samples by mercury probe derivatization coupled with liquid chromatography-atomic fluorescence spectrometry.

    Science.gov (United States)

    Bramanti, Emilia; D'Ulivo, Lucia; Lomonte, Cristina; Onor, Massimo; Zamboni, Roberto; Raspi, Giorgio; D'Ulivo, Alessandro

    2006-10-02

    A new procedure is proposed for the sampling and storage of hydrogen sulphide (H2S) and volatile thiols (methanethiol or methyl mercaptan, ethanethiol and propanethiol) for their determination by liquid chromatography. The sampling procedure is based on the trapping/pre-concentration of the analytes in alkaline aqueous solution containing an organic mercurial probe p-hydroxymercurybenzoate, HO-Hg-C6H4-COO- (PHMB), where they are derivatized to stable PHMB complexes based on mercury-sulfur covalent bonds. PHMB complexes are separated on a C18 reverse phase column, allowing their determination by liquid chromatography coupled with sequential non-selective UV-vis (DAD) and mercury specific (chemical vapor generation atomic fluorescence spectrometry, CVGAFS) on-line detectors. PHMB complexes, S(PHMB)2CH3S-PHMB, C2H5S-PHMB and C3H7S-PHMB, are stable alt least for 12 h at room temperature and for 3 months if stored frozen (-20 degrees C). The best analytical figures of merits in the optimized conditions were obtained by CVGAFS detection, with detection limits (LODc) of 9.7 microg L(-1) for H2S, 13.7 microg L(-1) for CH(3)SH, 17.7 microg L(-1) for C2H5SH and 21.7 microg L(-1) for C3H7SH in the trapping solution in form of RS-PHMB complexes, the relative standard deviation (R.S.D.) ranging between 1.0 and 1.5%, and a linear dynamic range (LDR) between 10 and 9700 microg L(-1). Conventional UV absorbance detectors tuned at 254 nm can be employed as well with comparable R.S.D. and LDR, but with LODc one order of magnitude higher than AFS detector and lower specificity. The sampling procedure followed by LC-DAD-CVGAFS analysis has been validated, as example, for H2S determination by a certified gas permeation tube as a source of 3.071+/-0.154 microg min(-1) of H2S, giving a recovery of 99.8+/-7% and it has been applied to the determination of sulfur compounds in real gas samples (biogas and the air of a plant for fractional distillation of crude oil).

  4. Determination of hydrogen sulfide and volatile thiols in air samples by mercury probe derivatization coupled with liquid chromatography-atomic fluorescence spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Bramanti, Emilia [Italian National Research Council, CNR-Istituto per i Processi Chimico-Fisici, Laboratory of Instrumental Analytical Chemistry, Via G. Moruzzi 1, 56124 Pisa (Italy)]. E-mail: emilia@ipcf.cnr.it; D' Ulivo, Lucia [Italian National Research Council, CNR-Istituto per i Processi Chimico-Fisici, Laboratory of Instrumental Analytical Chemistry, Via G. Moruzzi 1, 56124 Pisa (Italy); Lomonte, Cristina [Italian National Research Council, CNR-Istituto per i Processi Chimico-Fisici, Laboratory of Instrumental Analytical Chemistry, Via G. Moruzzi 1, 56124 Pisa (Italy); Ambiente s.c.r.l., Via Frassina 21, 54033, Carrrara, Massa (Italy); Onor, Massimo [Italian National Research Council, CNR-Istituto per i Processi Chimico-Fisici, Laboratory of Instrumental Analytical Chemistry, Via G. Moruzzi 1, 56124 Pisa (Italy); Zamboni, Roberto [Department of Chemistry and Industrial Chemistry, University of Pisa, Via Risorgimento 35, 56126 Pisa (Italy); Raspi, Giorgio [Italian National Research Council, CNR-Istituto per i Processi Chimico-Fisici, Laboratory of Instrumental Analytical Chemistry, Via G. Moruzzi 1, 56124 Pisa (Italy); D' Ulivo, Alessandro [Italian National Research Council, CNR-Istituto per i Processi Chimico-Fisici, Laboratory of Instrumental Analytical Chemistry, Via G. Moruzzi 1, 56124 Pisa (Italy)

    2006-10-02

    A new procedure is proposed for the sampling and storage of hydrogen sulphide (H{sub 2}S) and volatile thiols (methanethiol or methyl mercaptan, ethanethiol and propanethiol) for their determination by liquid chromatography. The sampling procedure is based on the trapping/pre-concentration of the analytes in alkaline aqueous solution containing an organic mercurial probe p-hydroxymercurybenzoate, HO-Hg-C{sub 6}H{sub 4}-COO{sup -} (PHMB), where they are derivatized to stable PHMB complexes based on mercury-sulfur covalent bonds. PHMB complexes are separated on a C{sub 18} reverse phase column, allowing their determination by liquid chromatography coupled with sequential non-selective UV-vis (DAD) and mercury specific (chemical vapor generation atomic fluorescence spectrometry, CVGAFS) on-line detectors. PHMB complexes, S(PHMB){sub 2}CH{sub 3}S-PHMB, C{sub 2}H{sub 5}S-PHMB and C{sub 3}H{sub 7}S-PHMB, are stable alt least for 12 h at room temperature and for 3 months if stored frozen (-20 deg. C). The best analytical figures of merits in the optimized conditions were obtained by CVGAFS detection, with detection limits (LODc) of 9.7 {mu}g L{sup -1} for H{sub 2}S, 13.7 {mu}g L{sup -1} for CH{sub 3}SH, 17.7 {mu}g L{sup -1} for C{sub 2}H{sub 5}SH and 21.7 {mu}g L{sup -1} for C{sub 3}H{sub 7}SH in the trapping solution in form of RS-PHMB complexes, the relative standard deviation (R.S.D.) ranging between 1.0 and 1.5%, and a linear dynamic range (LDR) between 10 and 9700 {mu}g L{sup -1}. Conventional UV absorbance detectors tuned at 254 nm can be employed as well with comparable R.S.D. and LDR, but with LODc one order of magnitude higher than AFS detector and lower specificity. The sampling procedure followed by LC-DAD-CVGAFS analysis has been validated, as example, for H{sub 2}S determination by a certified gas permeation tube as a source of 3.071 {+-} 0.154 {mu}g min{sup -1} of H{sub 2}S, giving a recovery of 99.8 {+-} 7% and it has been applied to the determination of

  5. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  6. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  7. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  8. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  9. Store Stokkavatn. Beskrivelse av forurensningssituasjonen

    OpenAIRE

    Holtan, H.

    1985-01-01

    Rapporten, som er et ledd i arbeidet med en vannbruksplan for Store Stokkavatn ved Stavanger, sammenstiller og diskuterer data som er samlet inn fra innsjøen og dens tilløp av Byveterinæretaten i Stavanger. Store Stokkavatnet er reservevannkilde for Stavanger og dessuten er innsjøen sentral i rekreasjonsmessig sammenheng. På bakgrunn av de foreliggende data, er innsjøens forurensningstilstand på grensen av det akseptable hva algeproduksjon (eutrofiering) og bakteriologiske forhold angår. Fler...

  10. Optimering av bergtransporter i underjordsgruva

    OpenAIRE

    Abrahamsson, Magnus

    2015-01-01

    Detta examensarbete utfördes på LKAB, en mineralkoncern som tillverkar och levererar järnmalmsprodukter. Arbetet utfördes för företagets underjordsgruva i Malmberget och behandlar tillredningens bergtransporter. Tillredningen är den process som förbereder nya delar av gruvan för järnmalmsbrytning. Målsättningen med arbetet har varit att kartlägga hur transporterna av tillredningsberg styrs samt att kvantifiera en besparingspotential för dessa transporter. Om möjligt skulle även förbättringsfö...

  11. Importance of sulfide interaction with iron as regulator of the microbial community in biogas reactors and its effect on methanogenesis, volatile fatty acids turnover, and syntrophic long-chain fatty acids degradation.

    Science.gov (United States)

    Shakeri Yekta, Sepehr; Ziels, Ryan M; Björn, Annika; Skyllberg, Ulf; Ejlertsson, Jörgen; Karlsson, Anna; Svedlund, Matilda; Willén, Magnus; Svensson, Bo H

    2017-05-01

    The inhibitory effects of sulfide on microbial processes during anaerobic digestion have been widely addressed. However, other effects of sulfide are less explored, given that sulfide is a potential sulfur source for microorganisms and its high reactivity triggers a suit of abiotic reactions. We demonstrated that sulfide interaction with Fe regulates the dynamics and activities of microbial community during anaerobic digestion. This was manifested by the S:Fe molar ratio, whose increase adversely influenced the acetoclastic methanogens, Methanosaeta, and turnover of acetate. Dynamics of hydrogenotrophic methanogens, Methanoculleus and Methanobrevibacter, were presumably influenced by sulfide-induced changes in the partial pressure of hydrogen. Interestingly, conversion of the long-chain fatty acid (LCFA), oleate, to methane was enhanced together with the abundance of LCFA-degrading, β-oxidizing Syntrophomonas at an elevated S:Fe molar ratio. The results suggested that sulfur chemical speciation is a controlling factor for microbial community functions in anaerobic digestion processes. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  12. Institusjonelle felt og forståelser av evaluering – en analyse av evalueringen av NAV-reformen

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Hansen, Morten Balle

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av...... interessene som var involvert i evalueringen. I EVANAV ble dette blant annet ivaretatt i formuleringen av fire mål som tilgodeser ulike behov. Basert på evalueringsteori og teori om institusjonelle felt bidrar analysen til en bedre forståelse av hva evaluering er, og hvordan ulike utfordringer knyttet til...

  13. PAH i forurenset sediment: Utredning av egnethet av PAHkomponenter/ grupperinger for vurdering av tiltaksbehov

    OpenAIRE

    Ruus, Anders; Arp, Hans Petter Heinrich; Oen, Amy M.P.; Grung, Merete; Breedveld, Gijs D.

    2015-01-01

    I Norge er det utarbeidet klassegrenser for til sammen 16 PAH-forbindelser i sediment og vann. Grenseverdiene baserer seg på kunnskap om toksisitet av de ulike stoffene og hva som er akseptabel eksponering for miljøet. I tillegg til grenseverdiene for enkeltkomponentene av PAH opererer norske miljømyndigheter med klassegrenser for PAH-grupperingen SUM PAH-16 i sediment. Disse klassegrensene bygger på overkonsentrasjoner i forhold til bakgrunnsnivå, og ikke økotoksikologiske dat...

  14. 3~5岁健康幼儿口腔挥发性硫化氢测量及影响因素分析%Levels of volatile hydrogen sulfide in oral cavity of 3-5 years old healthy children and influencing factors

    Institute of Scientific and Technical Information of China (English)

    高鑫鑫; 时清; 杨圣辉

    2011-01-01

    Objective To examine the levels of volatile hydrogen sulfide (H2S) in oral cavity of 3-5 years old healthy children and analyze the influencing factors. Methods The levels of volatile hydrogen sulfide in oral cavity were examined in a sample of 340 healthy children aged 3-5 years old. Oral malodor was measured with both organoleptic measurements and a portable volatile hydrogen sulfide monitor. Oral clinical status were assessed Pearson's correlation was used to determine the relationship between organoleptic scores ( OS), the levels of volatile H2S and clinical parameters. Bivariate logistic regression analysis was performed to detect the degree of association between OS and clinical parameters. Results The mean level of volatile H2S was 46. 72 ± 23. 27. The correlation coefficient of OS and H2S was 0. 807. Tongue coating score and oral hygiene index were significantly associated with OS. Conclusion The portable hydrogen sulfide monitor could be used to diagnose oral malodor in children. Tongue coating and debris are the important factors that influence oral malodor in healthy children.%目的 通过检测3~5岁健康幼儿口腔挥发性硫化氢水平,评估幼儿口腔健康状况,分析幼儿口腔异味的重要影响因素.方法 对340名3~5岁健康幼儿口腔挥发性硫化氢进行感官分析法评分及分析仪测量,记录多项口腔健康指数,分析感官分析法评分与仪器测量数值的关系,以及与口腔健康指数的多因素Logistic回归关系.结果 3~5岁健康幼儿口腔挥发性硫化氢水平均值为(46.72±23.27)×10-9.感官分析法评分和硫化氢分析仪读数之间相关系数r=0.807.舌苔指数、简化口腔卫生指数纳入以感官分析法评分为因变量的多因素Logistic回归方程.结论 挥发性硫化氢分析仪可用于临床检测幼儿口腔异味.舌苔、软垢为幼儿口腔异味的重要影响因素.

  15. Bruk av kartleggingsresultater i forbedringsarbeid

    DEFF Research Database (Denmark)

    Nordahl, Thomas; Hansen, Line Skov

    . Barnehagen har gjerne tilgang på informasjon fra kartlegginger, men det er ikke alltid denne informasjonen blir systematisk analysert og aktivt brukt i forbedringsarbeid. Forfatterne viser hvordan slike analyser kan gjennomføres på forskjellige nivåer i den enkelte barnehage, og vektlegger viktigheten av...

  16. Effect of Sodium Sulfide on Ni-Containing Carbon Monoxide Dehydrogenases

    Energy Technology Data Exchange (ETDEWEB)

    Jian Feng; Paul A. Lindahl

    2004-07-28

    OAK-B135 The structure of the active-site C-cluster in CO dehydrogenase from Carboxythermus hydrogenoformans includes a {mu}{sup 2}-sulfide ion bridged to the Ni and unique Fe, while the same cluster in enzymes from Rhodospirillum rubrum (CODH{sub Rr}) and Moorella thermoacetica (CODH{sub Mt}) lack this ion. This difference was investigated by exploring the effects of sodium sulfide on activity and spectral properties. Sulfide partially inhibited the CO oxidation activity of CODH{sub Rr} and generated a lag prior to steady-state. CODH{sub Mt} was inhibited similarly but without a lag. Adding sulfide to CODH{sub Mt} in the C{sub red1} state caused the g{sub av} = 1.82 EPR signal to decline and new features to appear, including one with g = 1.95, 1.85 and (1.70 or 1.62). Removing sulfide caused the g{sub av} = 1.82 signal to reappear and activity to recover. Sulfide did not affect the g{sub av} = 1.86 signal from the C{sub red2} state. A model was developed in which sulfide binds reversibly to C{sub red1}, inhibiting catalysis. Reducing this adduct causes sulfide to dissociate, C{sub red2} to develop, and activity to recover. Using this model, apparent K{sub I} values are 40 {+-} 10 nM for CODH{sub Rr} and 60 {+-} 30 {micro}M for CODH{sub Mt}. Effects of sulfide are analogous to those of other anions, including the substrate hydroxyl group, suggesting that these ions also bridge the Ni and unique Fe. This proposed arrangement raises the possibility that CO binding labilizes the bridging hydroxyl and increases its nucleophilic tendency towards attacking Ni-bound carbonyl.

  17. Analyse av klimatilpasningstiltak : en casestudie av overvannsnettet på Bogafjell i Sandnes kommune

    OpenAIRE

    Bekkum, Ina

    2012-01-01

    For å simulere klimaendringenes effekt på avløpssystemet og klimatilpasningstiltakenes avbøtende virkning kan man benyttes seg av urbanhydrologiske avløpsmodeller. I denne oppgaven er det gjennomført et casestudie av overvannsnettet på Bogafjell i Sandnes kommune. Det er gjort simuleringer av enkeltregn i form av symmetriske nedbørshyetogram, med og uten klimatillegg – i Rosie/ArcGIS med MOUSE beregningsmotor – for å teste tiltaksprinsipper som frakopling av overvann, fordrøyning av ...

  18. Transmembrane potentials of canine AV junctional tissues.

    Science.gov (United States)

    Tse, W W

    1986-06-01

    The atrioventricular (AV) junction comprises the AV node, His bundle (HB), and specialized tissues proximal to the node called paranodal fibers (PNF). In the present study, an in vitro, dissection-exposed canine right atrial (RA), transitional fiber (TF), AV junctional preparation was used. The TF and PNF formed a pathway running along the base of the septal cusp of the tricuspid valve (SCTV). In the first experiment, impulses elicited at the RA were monitored to propagate sequentially through the TF, PNF, AV node, and then the HB. This functional evidence supports the concept that a conduction pathway connecting the RA and the AV node exists along the base of the SCTV. This internodal pathway is referred to as the septal cusp pathway. In another experiment, transmembrane potentials and Vmax were determined on each of the AV junctional tissues. Results showed that PNF had the lowest Vmax (2.5 V/sec), followed by AV node (7.0 V/sec) and HB (33 V/sec). This finding showed that PNF, and not the AV node, has the lowest Vmax, suggesting that the PNF has the lowest conductivity among the AV junctional tissues, and this study advances our understanding on the mechanism of AV conduction delay in dog hearts.

  19. Evaluering av ABW-filter

    OpenAIRE

    Ohren, J.A.

    1986-01-01

    Det er foretatt en evaluering av ABW-filteret basert på forskningsresultater og driftserfaringer fra USA. ABW-filteret er godt egnet med sand eller sand-antrasitt i konvensjonelle fullrenseanlegg med flokkulering, sedimentering og filtrering. Etter disse prosessene er filteret også egnet med aktivt kull. ABW-filteret er også interessant for etterbehandling i kommunale og industrielle avløpsrenseanlegg.

  20. Solar thermal extraction of copper from sulfides

    Energy Technology Data Exchange (ETDEWEB)

    Winkel, L.; Guesdon, C.; Sturzenegger, M.

    2003-03-01

    With the aim to develop a solar-driven process for the extraction of copper from sulfide concentrates re-search on the decomposition of copper sulfides under inert atmospheres has been initiated. Thermogravimetric measurements on chalcocite (Cu{sub 2}S) revealed that copper is formed already at 1823 K. Chalcopyrite (CuFeS{sub 2}) also disintegrates at this temperature, although at a lower rate. Copper and iron have been identified in the solid residue. The results confirm the feasibility of copper extraction by direct decomposition of sulfides under atmospheric pressure. The decomposition under inert atmosphere prevents generation of SO{sub 2}, and is beneficial to the removal of volatile impurities. Chemical equilibrium calculations for CuFeS{sub 2} contaminated with enargite (Cu{sub 3}AsS{sub 4}) have shown that the absence of an oxidic slag allows for a complete evaporation of arsenic and subsequent separation. (author)

  1. Multimedia for læring av tallsystemer : utvikling av programvare for læring av og om tallsystemer

    OpenAIRE

    Idland, Terje

    2006-01-01

    Oppgaven har en teoretisk forankring innenfor Piagets konstruktivisme, Vygotskys sosialkonstruktivisme, Dienes teori for læring av posisjonssystemet og Mayer & Morenos teori for læring med multimedia. Primært har jeg brukt eksisterende teori som grunnlag for utvikling av pedagogisk programvare for læring av tallsystemer. Denne programvaren er todelt. En del er en interaktiv applett som er et utforskingsmiljø for posisjonssystemet. Den andre delen er en interaktiv multimediep...

  2. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  3. Volatility Discovery

    DEFF Research Database (Denmark)

    Dias, Gustavo Fruet; Scherrer, Cristina; Papailias, Fotis

    The price discovery literature investigates how homogenous securities traded on different markets incorporate information into prices. We take this literature one step further and investigate how these markets contribute to stochastic volatility (volatility discovery). We formally show...... that the realized measures from homogenous securities share a fractional stochastic trend, which is a combination of the price and volatility discovery measures. Furthermore, we show that volatility discovery is associated with the way that market participants process information arrival (market sensitivity...

  4. Volatile Metabolites

    Directory of Open Access Journals (Sweden)

    Daryl D. Rowan

    2011-11-01

    Full Text Available Volatile organic compounds (volatiles comprise a chemically diverse class of low molecular weight organic compounds having an appreciable vapor pressure under ambient conditions. Volatiles produced by plants attract pollinators and seed dispersers, and provide defense against pests and pathogens. For insects, volatiles may act as pheromones directing social behavior or as cues for finding hosts or prey. For humans, volatiles are important as flavorants and as possible disease biomarkers. The marine environment is also a major source of halogenated and sulfur-containing volatiles which participate in the global cycling of these elements. While volatile analysis commonly measures a rather restricted set of analytes, the diverse and extreme physical properties of volatiles provide unique analytical challenges. Volatiles constitute only a small proportion of the total number of metabolites produced by living organisms, however, because of their roles as signaling molecules (semiochemicals both within and between organisms, accurately measuring and determining the roles of these compounds is crucial to an integrated understanding of living systems. This review summarizes recent developments in volatile research from a metabolomics perspective with a focus on the role of recent technical innovation in developing new areas of volatile research and expanding the range of ecological interactions which may be mediated by volatile organic metabolites.

  5. Effekten av karbohydrat- og proteininntak på restitusjon av utholdenhetskapasiteten etter et utmattende arbeid

    OpenAIRE

    Rustad, Per Inge

    2011-01-01

    Innledning: Dietten i etterkant av trening og konkurranser er av stor betydning for restitusjonsprosessen. Få studier har imidlertid undersøkt restitusjonseffekten av karbohydratog proteininntak etter et utmattende arbeid på utholdenhetskapasiteten dagen etter. I vår studie ble det gjennomført totalt tre diettintervensjoner for å undersøke følgende problemstillinger; 1) undersøke utholdenhetskapasiteten dagen etter et utmattende utholdenhetsarbeid etter inntak av en høy karbohy...

  6. AVS-M: From Standards to Applications

    Institute of Scientific and Technical Information of China (English)

    Ye-Kui Wang

    2006-01-01

    AVS stands for the Audio Video coding Standard Workgroup of China, who develops audio/video coding standards as well as system and digital right management standards. AVS-M is the AVS video coding standard targeting for mobile multimedia applications. Besides the coding specification, AVS also developed the file format and Real-time Transport Protocol (RTP) payload format specifications to enable the application of AVS-M video in various services. This paper reviews the high-level coding tools and features of the AVS-M coding standard as well as the file format and payload format standards.In particular, sixteen AVS-M high-level coding tools and features, which cover most of the high-level topics during AVS-M standardization, are discussed in some detail. After that, the error resilience tools are briefly reviewed before the file format and RTP payload format discussions. The coding efficiency and error resiliency performances of AVS-M are provided finally.H.264/AVC has been extensively used as a comparison in many of the discussions and the simulation results.

  7. The AV-8B Decision

    Science.gov (United States)

    1982-06-01

    isa csestudy of the debate overthdeionfte United States Gover mn to prc--u the McDonnell Douglas AV-8B Advanced Hrrier V/STOL jet aircraft for the U.S...Sciences 3 ABSTRACT This thesis is a case study of the debate over the decision of the United States Government to procure the McDonnell Douglas IT-8...a egrate4 dur nq the 1ive To r perIoo by the introduction of the moderNtely prcod F1-18 aircraft. The F/1 8 proqrts will, 0euce to*n uber and tpes of

  8. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  9. Syncope and Idiopathic (Paroxysmal) AV Block.

    Science.gov (United States)

    Brignole, Michele; Deharo, Jean-Claude; Guieu, Regis

    2015-08-01

    Syncope due to idiopathic AV block is characterized by: 1) ECG documentation (usually by means of prolonged ECG monitoring) of paroxysmal complete AV block with one or multiple consecutive pauses, without P-P cycle lengthening or PR interval prolongation, not triggered by atrial or ventricular premature beats nor by rate variations; 2) long history of recurrent syncope without prodromes; 3) absence of cardiac and ECG abnormalities; 4) absence of progression to persistent forms of AV block; 5) efficacy of cardiac pacing therapy. The patients affected by idiopathic AV block have low baseline adenosine plasma level values and show an increased susceptibility to exogenous adenosine. The APL value of the patients with idiopathic AV block is much lower than patients affected by vasovagal syncope who have high adenosine values. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Review of AVS Audio Coding Standard

    Institute of Scientific and Technical Information of China (English)

    ZHANG Tao; ZHANG Caixia; ZHAO Xin

    2016-01-01

    Audio Video Coding Standard (AVS) is a second⁃generation source coding standard and the first standard for audio and video coding in China with independent intellectual property rights. Its performance has reached the international standard. Its coding efficiency is 2 to 3 times greater than that of MPEG⁃2. This technical solution is more simple, and it can greatly save channel resource. After more than ten years ’develop⁃ment, AVS has achieved great success. The latest version of the AVS audio coding standard is ongoing and mainly aims at the increasing demand for low bitrate and high quality audio services. The paper reviews the history and recent develop⁃ment of AVS audio coding standard in terms of basic fea⁃tures, key techniques and performance. Finally, the future de⁃velopment of AVS audio coding standard is discussed.

  11. Tolkning av det verbala och det visuella

    Directory of Open Access Journals (Sweden)

    Barbro Sjöberg

    2011-12-01

    Full Text Available I en tidigare publicerad artikel i Techne serien (Sjöberg, 2005 gjordes en genre-beskrivning av fenomenet skissbok. Genrebeskrivningen baserade sig på en analys av sex formgivarstuderandes skissböcker. I den nu aktuella artikeln redogörs för hur genren tillämpats i en slöjdpedagogisk kontext inom två kurser i Konsthand-arbete under åren 2002 respektive 2004 inom de didaktikbaserade ämnesteknolo-giska studierna i slöjdpedagogik vid Åbo Akademi, Vasa. En av målsättningarna för kurserna var att testa skissboken i en slöjdpedagogisk kontext. Under kursens gång hade de studerande som uppgift att utforska och dokumentera ett givet tema i sina skissböcker. Efter avslutad kurs skannades skissböckerna in för att utgöra empiriskt material för tolkning och analys av hur de studerande utformat dokumen-tationen i sina skissböcker på basen av de instruktioner de fått under kursens gång. I föreliggande studie redogörs för bearbetning, tolkning och analys av det empiris-ka materialet med hjälp av NVivo 9, en version av NVivo som underlättar bearbet-ning och den vetenskapliga tolkningen av visuellt material. Resultaten visar att uppmuntran till horisontell mediering i samband med dokumentation i skissbok kan leda till en mångsidig och personlig utforskning av givet tema.Sökord: metod, slöjd, NVivo, skissbok, lärarutbildningURN:NBN:no-29968

  12. Virtual volatility

    Science.gov (United States)

    Silva, A. Christian; Prange, Richard E.

    2007-03-01

    We introduce the concept of virtual volatility. This simple but new measure shows how to quantify the uncertainty in the forecast of the drift component of a random walk. The virtual volatility also is a useful tool in understanding the stochastic process for a given portfolio. In particular, and as an example, we were able to identify mean reversion effect in our portfolio. Finally, we briefly discuss the potential practical effect of the virtual volatility on an investor asset allocation strategy.

  13. Virtual volatility

    OpenAIRE

    A. Christian Silva; Prange, Richard E.

    2006-01-01

    We introduce the concept of virtual volatility. This simple but new measure shows how to quantify the uncertainty in the forecast of the drift component of a random walk. The virtual volatility also is a useful tool in understanding the stochastic process for a given portfolio. In particular, and as an example, we were able to identify mean reversion effect in our portfolio. Finally, we briefly discuss the potential practical effect of the virtual volatility on an investor asset allocation st...

  14. Plant volatiles.

    Science.gov (United States)

    Baldwin, Ian T

    2010-05-11

    Plant volatiles are the metabolites that plants release into the air. The quantities released are not trivial. Almost one-fifth of the atmospheric CO2 fixed by land plants is released back into the air each day as volatiles. Plants are champion synthetic chemists; they take advantage of their anabolic prowess to produce volatiles, which they use to protect themselves against biotic and abiotic stresses and to provide information - and potentially disinformation - to mutualists and competitors alike. As transferors of information, volatiles have provided plants with solutions to the challenges associated with being rooted in the ground and immobile.

  15. Påvising av aminoglykosidresistens ved hjelp av massespektrometri. Utvikling av metode for deteksjon, stabilitet av aminoglykosid og molekylær karakterisering av teststammer

    OpenAIRE

    Kvarekvål, Torunn

    2014-01-01

    Aminoglykosid er potente antibiotika som vert brukt til behandling av alvorlege infeksjonar med aerobe bakteriar. Dei er baktericide og verkar ved å binda til ribosoma i bakteriane og på denne måten forstyrra den normale peptidsyntesen. Aminoglykosida er verdifulle medikament, men som for mange andre antibiotika er resistens mot desse midla eit aukande problem. Den viktigaste resistensmekanismen er aminoglykosidmodifiserande enzym (AME). Desse enzyma inaktiverer ...

  16. Cupriavidus necator H16 uses flavocytochrome c-sulfide dehydrogenase to oxidize self-produced and spiked sulfide.

    Science.gov (United States)

    Lü, Chuanjuan; Xia, Yongzhen; Liu, Daixi; Zhao, Rui; Gao, Rui; Liu, Honglei; Xun, Luying

    2017-09-01

    Heterotrophic bacteria producing sulfide (H2S, HS(-), and S(2-)) during aerobic growth is a common phenomenon. Some with sulfide:quinone oxidoreductase (SQR) and persulfide dioxygenase (PDO) can oxidize self-produced sulfide to sulfite and thiosulfate, but others without these enzymes will release sulfide into the medium, from which H2S can volatilize into the gas phase. Here, we report Cupriavidus necator H16 with the fccAB genes, encoding flavocytochrome c-sulfide dehydrogenases (FCSDs), also oxidized self-produced H2S. The mutant with fccAB being deleted accumulated and released H2S. When fccAB were expressed in a Pseudomonas aeruginosa strain Pa3K with deletions of its sqr and pdo genes, the recombinant rapidly oxidized sulfide to sulfane sulfur. When PDO was also cloned into the recombinant, the recombinant with both FCSD and PDO oxidized sulfide to sulfite and thiosulfate. Thus, the proposed pathway is similar to the pathway catalyzed by SQR and PDO, in which FCSD oxidizes sulfide to polysulfide, polysulfide spontaneously reacts with GSH to produce GSSH, and PDO oxidizes GSSH to sulfite, which chemically reacts with polysulfide to produce thiosulfate. About 20.6% of sequenced bacterial genomes contain SQR, and only 3.9% contain FCSD. This is not a surprise since SQR is more efficient in conserving energy because it passes electrons from sulfide oxidation into the electron transport chain at the quinone level, while FCSD passes electrons to cytochrome c The transport of electrons from the latter to O2 conserves less energy. FCSDs are grouped into three subgroups, well conserved at taxonomic levels. Thus, our data show the diversity in sulfide oxidation by heterotrophic bacteria.Importance Heterotrophic bacteria with SQR and PDO can oxidize self-produced sulfide and do not release H2S into the gas phase. C. necator H16 has FCSD but not SQR, and it does not release H2S. We confirmed that the bacterium used FCSD for the oxidation of self-produced sulfide. The

  17. Unstable volatility

    DEFF Research Database (Denmark)

    Casas, Isabel; Gijbels, Irène

    2012-01-01

    The objective of this paper is to introduce the break-preserving local linear (BPLL) estimator for the estimation of unstable volatility functions for independent and asymptotically independent processes. Breaks in the structure of the conditional mean and/or the volatility functions are common i...

  18. Unstable volatility

    DEFF Research Database (Denmark)

    Casas, Isabel; Gijbels, Irène

    2012-01-01

    The objective of this paper is to introduce the break-preserving local linear (BPLL) estimator for the estimation of unstable volatility functions for independent and asymptotically independent processes. Breaks in the structure of the conditional mean and/or the volatility functions are common i...

  19. Uptake of AV-1451 in meningiomas.

    Science.gov (United States)

    Bruinsma, Tyler J; Johnson, Derek R; Fang, Ping; Senjem, Matthew; Josephs, Keith A; Whitwell, Jennifer L; Boeve, Bradley F; Pandey, Mukesh K; Kantarci, Kejal; Jones, David T; Vemuri, Prashanthi; Murray, Melissa; Graff-Radford, Jonathan; Schwarz, Christopher G; Knopman, David S; Petersen, Ronald C; Jack, Clifford R; Lowe, Val J

    2017-09-08

    AV-1451 is an imaging agent labeled with the positron-emitting radiolabel Fluorine-18. 18F-AV-1451 binds paired helical filament tau (PHF-tau), a pathology related to Alzheimer's disease. In our study of AV-1451 uptake in the brains of cognitively normal subjects, we noted a case of a meningioma with visually significant uptake of AV-1451. We initiated the present retrospective study to further examine cases of meningioma that underwent AV-1451 imaging. We searched the patient records of 650 patients who had undergone AV-1451 at our institution for the keyword "meningioma" to identify potential cases. PET/CT and MRI results were visually reviewed and semi-quantitative analysis of PET was performed. A paired student's t test was run between background and tumor standard uptake values. Fisher's exact test was used to examine the association between AV-1451 uptake and presence of calcifications on CT. We identified 12 cases of meningioma, 58% (7/12) of which demonstrated uptake greater than background using both visual analysis and tumor-to-normal cortex ratios (T/N + 1.90 ± 0.83). The paired student's t test revealed no statistically significant difference between background and tumor standard uptake values (p = 0.09); however, cases with a T/N ratio greater than one showed statistically higher uptake in tumor tissue (p = 0.01). A significant association was noted between AV-1451 uptake and presence of calcifications (p = 0.01). AV-1451 PET imaging should be reviewed concurrently with anatomic imaging to prevent misleading interpretations of PHF-tau distribution due to meningiomas.

  20. Portering av programvara – metodik och fallstudie

    OpenAIRE

    Ståhl, Nils

    2012-01-01

    Carasoft AB är ett företag som specialiserat sig på utveckling av dokumenthanteringssystem. Man erbjuder bland annat ett Windowsbaserat dokumenthanteringssystem vid namn Caradoc. Systemet består av flertalet DLL:er skrivna i Delphi och har inte ändrats eller kompilerats sedan 2004. Det här examensarbetet har i syfte att utreda om det finns möjlighet att inom rimlig tid portera Caradoc till Windows 7, med hjälp av den nya Delphi-versionen XE2. Efter en förstudie i ämnet portering, programspråk...

  1. Basic Considerations on AVS DRM Architecture

    Institute of Scientific and Technical Information of China (English)

    Tie-Jun Huang; Yong-Liang Liu

    2006-01-01

    Digital Rights Management (DRM) is an important infrastructure for the digital media age. It is a part of the AVS (Audio and Video coding Standard) of China. AVS Trusted Decoder (ATD) that plays back digital media program according to rights conditions is the core of AVS DRM architecture. Adaptation layers are responsible for translating or negotiating between ATD and peripheral systems. The Packaging Adaptation Layer (PAL), Licensing Adaptation Layer (LAL) and Rendering Adaptation Layer (RAL) will help ATD to gain the interoperability in various DRM environments.

  2. Authigenic sulfide minerals and their sulfur isotopes in sediments of the northern continental slope of the South China Sea and their implications for methane flux and gas hydrate formation

    Institute of Scientific and Technical Information of China (English)

    PU XiaoQiang; ZHONG ShaoJun; YU WenQuan; TAO XiaoWan

    2007-01-01

    This is a report of the study of the authigenic sulfide minerals and their sulfur isotopes in a sediment core (NH-1) collected on the northern continental slope of the South China Sea, where other geophysical and geochemical evidence seems to suggest gas hydrate formation in the sediments. The study has led to the findings: (1) the pyrite content in sediments was relatively high and its grain size relatively large compared with that in normal pelagic or hemipelagic sediments; (2) the shallowest depth of the acid volatile sulfide (AVS) content maximum was at 437.5 cm (>2 μmol/g), which was deeper than that of the authigenic pyrite content maximum (at 141.5-380.5 cm); (3) δ34S of authigenic pyrite was positive (maximum: +15‰) at depth interval of 250-380 cm; (4) the positive δ34S coincided with pyrite enrichment. Compared with the results obtained from the Black Sea sediments by Jorgensen and coworkers, these observations indicated that at the NH-1 site, the depth of the sulfate-methane interface (SMI) would be or once was at about 437.5-547.5 cm and the relatively shallow SMI depth suggested high upward methane fluxes. This was in good agreement with the results obtained from pore water sulfate gradients and core head-space methane concentrations in sediment cores collected in the area. All available evidence suggested that methane gas hydrate formation may exist or may have existed in the underlying sediments.

  3. Sulfide Mineralogy and Geochemistry

    Science.gov (United States)

    Dilles, John

    2007-02-01

    Reviews in Mineralogy and Geochemistry Series, Volume 61 David J. Vaughan, Editor Geochemical Society and Mineralogical Society of America; ISBN 0-939950-73-1 xiii + 714 pp.; 2006; $40. Sulfide minerals as a class represent important minor rock-forming minerals, but they are generally known as the chief sources of many economic metallic ores. In the past two decades, sulfide research has been extended to include important roles in environmental geology of sulfide weathering and resultant acid mine drainage, as well as in geomicrobiology in which bacteria make use of sulfides for metabolic energy sources. In the latter respect, sulfides played an important role in early evolution of life on Earth and in geochemical cycling of elements in the Earth's crust and hydrosphere.

  4. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients.

    Science.gov (United States)

    Schmelter, Christopher; Raab, Udo; Lazarus, Friedrich; Ruppert, Volker; Vorwerk, Dierk

    2015-08-01

    The study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients. 63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5%), followed by complications of angioplasty with vessel rupture or dissection (31.8%). A high rate of procedural success was achieved (98.5%). The most frequent location of the deployed stent-graft was the draining vein (66.7%). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5% at 6 month, 31.3% at 12 month and 19.2% at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1%), followed by stenosis at the AV access (29.5%) and the deployed stent-graft (23.5%). Re-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  5. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  6. Integrasjon av vindkraft i energisystemet : effekten av variabilitet på markedsverdien

    OpenAIRE

    Brekken, Tormod Ween

    2014-01-01

    Klimapolitikken bidrar til å fase ut termisk kraftproduksjon basert på fossile kilder. Dette kan føre til at en mindre andel av kraftproduksjonen kan respondere på prissignaler. Det er planlagt å øke andelen vindkraft i flere kraftmarkeder. Vindkraft er avhengig av været, og er karakterisert av varierende produksjon. Dette påvirker inntekten til hva produsenter av vindkraft vil tjene i kraftmarkedet. Studier har funnet at markedsverdien til vindkraft reduseres ved økte andeler vindkraft i ma...

  7. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  8. En norsk pilotstudie av helsesøstres oppfatninger av pasienters health literacy: helsefremmende allmenndannelse

    OpenAIRE

    Hanne Søberg Finbråten; Kjell Sverre Pettersen

    2012-01-01

    Bakgrunn Uttrykket “ansvar for egen helse” innebærer også evnen til kritisk evaluering av helseinformasjon. Slike kunnskaper og ferdigheter reflekterer health literacy (HL) – på norsk; helsefremmende allmenndannelse, som handler om å forstå, kunne skaffe seg tilgang på, kritisk vurdere og adekvat anvende helseinformasjon for ervervelse av god helse. Hensikt Formålet var å kartlegge helsesøstres oppfatninger av brukeres tre hierarkiske nivåer av HL (Nutbeam 2000): functional HL (FHL), inte...

  9. Chasing volatility

    DEFF Research Database (Denmark)

    Caporin, Massimiliano; Rossi, Eduardo; Santucci de Magistris, Paolo

    The realized volatility of financial returns is characterized by persistence and occurrence of unpreditable large increments. To capture those features, we introduce the Multiplicative Error Model with jumps (MEM-J). When a jump component is included in the multiplicative specification, the condi...... models, the introduction of the jump component provides a sensible improvement in the fit, as well as for in-sample and out-of-sample volatility tail forecasts....

  10. Volatility Risk

    OpenAIRE

    Zhiguang Wang

    2009-01-01

    Classical capital asset pricing theory tells us that riskaverse investors would require higher returns to compensate for higher risk on an investment. One type of risk is price (return) risk, which reflects uncertainty in the price level and is measured by the volatility (standard deviation) of asset returns. Volatility itself is also known to be random and hence is perceived as another type of risk. Investors can bear price risk in exchange for a higher return. But are investors willing to p...

  11. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  12. Magmatic sulfides in the porphyritic chondrules of EH enstatite chondrites

    CERN Document Server

    Piani, Laurette; Libourel, Guy; Tissandier, Laurent

    2016-01-01

    The nature and distribution of sulfides within 17 porphyritic chondrules of the Sahara 97096 EH3 enstatite chondrite have been studied by backscattered electron microscopy and electron microprobe in order to investigate the role of gas-melt interactions in the chondrule sulfide formation. Troilite (FeS) is systematically present and is the most abundant sulfide within the EH3 chondrite chondrules. It is found either poikilitically enclosed in low-Ca pyroxenes or scattered within the glassy mesostasis. Oldhamite (CaS) and niningerite [(Mg,Fe,Mn)S] are present in about 60% of the chondrules studied. While oldhamite is preferentially present in the mesostasis, niningerite associated with silica is generally observed in contact with troilite and low-Ca pyroxene. The chondrule mesostases contain high abundances of alkali and volatile elements as well as silica. Our data suggest that most of the sulfides found in EH3 chondrite chondrules are magmatic minerals that formed after the dissolution of S from a volatile-r...

  13. Interstellar hydrogen sulfide.

    Science.gov (United States)

    Thaddeus, P.; Kutner, M. L.; Penzias, A. A.; Wilson, R. W.; Jefferts, K. B.

    1972-01-01

    Hydrogen sulfide has been detected in seven Galactic sources by observation of a single line corresponding to the rotational transition from the 1(sub 10) to the 1(sub 01) levels at 168.7 GHz. The observations show that hydrogen sulfide is only a moderately common interstellar molecule comparable in abundance to H2CO and CS, but somewhat less abundant than HCN and much less abundant than CO.

  14. Kartlegging av PCB i sedimenter fra Indre Sørfjord

    OpenAIRE

    Skei, J.; Klungsøyr, J

    1990-01-01

    Som følge av forhøyede nivåer av PCB i fiskelever innerst i Sørfjorden er det gjennomført en sedimentundersøkelse for om mulig å finne kilden til PCB. Det ble ikke registrert høye nivåer av PCB i sedimentene. Høyeste konsentrasjoner ble målt i munningen av Eitrheimsvågen. Analyser av trafooljer brukt i Tyssedalsområdet viste spor av PCB.

  15. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  16. Volatile Sulfur Compounds from Livestock Production

    DEFF Research Database (Denmark)

    Kasper, Pernille

    2017-01-01

    Volatile sulfur compounds, i.e. hydrogen sulfide, methanethiol and dimethyl sulfide have been identified as key odorants in livestock production due to their high concentration levels and low odor threshold values. At the same time their removal with abatement technologies based on mass transfer...... and, thus, odor removal in these systems. In this context, two processes based on the absorptive oxidation of sulfur compounds in trickling filters containing metal catalysts were examined. One process with iron chelated by ethylenediaminetetraacetic acid (EDTA) was shown to remove hydrogen sulfide...... that the original sample composition was significantly impaired due to adsorption and diffusion at the walls of the measuring equipment. Generally, sulfur compounds were best preserved in both olfactometers and sample bags, while carboxylic acids, 4-methylphenol and trimethylamine were found to undergo substantial...

  17. Utvärdering av event marketing

    OpenAIRE

    Fransson, Erik; Törnqvist, Johan

    2001-01-01

    Event marketing är en marknadsföringsform som har växt ordentligt under senare delen av 90-talet och det börjar bli ett naturligt inslag i företagens marknadskommunikation. Trots denna tillväxt har event marketing under en längre tid sammankopplats med brist på utvärderingsmetoder. En avsaknad av utvärderingsmetoder leder till svårigheter att avgöra vilka effekter en event marketing-satsning resulterar i, hur genomförandet kan förbättras samt huruvida event marketing är en lämplig form av mar...

  18. Eksakte metodar for analyse av tovegstabellar

    OpenAIRE

    Aaberge, Rolf

    1980-01-01

    Dei fleste matematisk-statistiske metodane som er utvikla til analyse av tabellar, byggjer på føresetnader om at talet på observasjonar i tabellcellene er "stort. Haldorsen (1977a) og (1977b) omtalar metodar som kviler på dette kravet. I denne rapporten skal vi presentere eksakte metodar for analyse av to-vegstabel lar, dvs. metodar som er gyldige sjølv om vi har småe observasjonstal i tabellcellene. I mange undersøkingar vil observasjonane ofte gi uttrykk for kva slags ...

  19. Grafisk presentasjon av GPenSim-simulering

    OpenAIRE

    2009-01-01

    GPenSim er et verktøy for modellering og simulering av diskret hendelsesystemer (DES). GPenSim er integrert i Matlab-plattformen, og har dermed tilgang til innebygde Matlabfunksjoner som plot etc. I GPenSim blir Petri net-grafen definert i Petri netdefinisjonsfiler. Resultatet av en simulering blir vist i tekst. Oppgaven gikk ut på å utvikle et verktøy som skulle presentere både Petri net-grafen og simuleringsresultatet grafisk. En grafisk presentasjon viser tydeligere sammenhe...

  20. AVS Intellectual Property Rights (IPR) Policy

    Institute of Scientific and Technical Information of China (English)

    Cliff Reader

    2006-01-01

    The AVS Workgroup has developed an IPR Policy to facilitate the adoption of standards in the marketplace.The policy is based on consideration of IPR issues in parallel with the technical work for drafting the standard. The paper describes the relationship between IPR and the standard, and how the goals for the standard must be complemented by goals for the IPR. The existing IPR policies of the ITU and ISO are outlined, and then the AVS IPR policy is described,organized by its three main components: commitment to license on declared basic terms, disclosure of intellectual property,and protection of IPR.

  1. Bruk av landstrøm for reduksjon av NOX og CO2 i norske havner

    OpenAIRE

    Frengstad, Åsmund Møll

    2014-01-01

    Bruk av Smart Grid og landstrøm for reduksjon av NOX- og CO2- utslipp i norske havner. I dag slippes det ut mye avgasser fra marine næringer i havner. Disse gassene bidrar både til internasjonale miljøutslipp i form av CO2, men også til lokal luftforurensing. Dette kan føre til redusert livskvalitet for befolkningen og besøkende til havnebyene. For å belyse problemet er Hurtigruten ASA benyttet som eksempel med de havnene den besøker på sin rute opp langs norskekysten. Rapporten gir en...

  2. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  3. Ishockeykjelke - Innfesting av spilleren: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  4. Instrumentering av Bergsøysundbrua og Gjemnesundbrua

    OpenAIRE

    Dahlen, Adrian; Lystad, Tor Martin

    2013-01-01

    Gjemnessundbrua og Bergsøysundbrua på Europavei E39 i Møre og Romsdal, skal instrumenteres for identifikasjon av strukturelle og dynamiske egenskaper. Denne rapporten omhandler dokumentasjon og beskrivelse av det utførte arbeidet ved monteringen av måleutstyret. Det er også gjort analyser av de ulike konstruksjonsdelene akselerometersensorer og anemometre er montert på. Til slutt er de initielle responssignalene fra systemet behandlet, der egenfrekvenser og ...

  5. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  6. Sulfide oxidation in a biofilter

    DEFF Research Database (Denmark)

    Pedersen, Claus Lunde; Dezhao, Liu; Hansen, Michael Jørgen;

    Observed hydrogen sulfide uptake rates in a biofilter treating waste air from a pig farm were too high to be explained within conventional limits of sulfide solubility, diffusion in a biofilm and bacterial metabolism. Clone libraries of 16S and 18S rRNA genes from the biofilter found no sulfide o...... higher hydrogen sulfide uptake followed by oxidation catalyzed by iron-containing enzymes such as cytochrome c oxidase in a process uncoupled from energy conservation....

  7. Sulfide oxidation in a biofilter

    DEFF Research Database (Denmark)

    Pedersen, Claus Lunde; Liu, Dezhao; Hansen, Michael Jørgen;

    2012-01-01

    Observed hydrogen sulfide uptake rates in a biofilter treating waste air from a pig farm were too high to be explained within conventional limits of sulfide solubility, diffusion in a biofilm and bacterial metabolism. Clone libraries of 16S and 18S rRNA genes from the biofilter found no sulfide o...... higher hydrogen sulfide uptake followed by oxidation catalyzed by iron-containing enzymes such as cytochrome c oxidase in a process uncoupled from energy conservation....

  8. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  9. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  10. Risikostyring av jetfuelprisen med futureskontrakter : en studie av hedgingstrategier for flyselskaper

    OpenAIRE

    Marker, Sebastian

    2013-01-01

    Denne oppgaven undersøker risikostyring av jetfuelprisen gjennom hedgingstrategier med WTI- og fyringsoljefutures som sikringsinstrument. Analysen tar sikte på å estimere minimum varians hedgingrater for ulike hedgingstrategier. Formålet er å finne hedgingstrategier som gir høyest hedgingeffektivitet, og dermed gir størst reduksjon i jetfuelprisrisiko. Første del av analysen vil estimere hedgingrater med utgangspunkt i flere analysemetoder under en klassisk lineær regresjonsmodell (CLRM). Hed...

  11. Sulfide and mercury species profiles in two Ontario boreal shield lakes.

    Science.gov (United States)

    Small, Jeff M; Hintelmann, Holger

    2014-09-01

    The cycling of sulfur in freshwater environments plays an important role in the cycling of metals. In this study, acid volatile sulfides were measured at nanomolar levels using a purge-and-trap preconcentration, followed by methylene blue derivatization with HPLC separation and UV-Vis detection. The limit of detection using the preconcentration step was 7.5ngL(-1) or 0.23nM sulfide. Profiles of sulfide and methylmercury were generated for two Ontario lakes. Sulfide concentrations were inversely related to dissolved oxygen concentrations and significant levels of anoxia had developed in both lakes. In both Plastic Lake and Lake 658, mercury concentrations also increased below the oxycline. Lake 658 showed a strong positive correlation between sulfide and methylmercury (CMeHg=2×10(-6)⋅Csulfide+0.198; r=0.96, p=1.2×10(-5)), at the time of sampling.

  12. Aktivitetsbasert pedagogikk; en studie av bachelorstudenters utvikling av handlingskompetanse gjennom aktivitetsbasert pedagogikk

    Directory of Open Access Journals (Sweden)

    Kari Margrete Hjelle

    2012-06-01

    Full Text Available Målet med artikkelen er å synliggjøre hvordan bachelorstudenter i ergoterapi kan utvikle profesjonell handlingskompetanse gjennom aktivitetsbasert pedagogikk. På bakgrunn av dette gjennomførte vi kvalitative fokusgruppeintervju med 12 ergoterapeutstudenter som hadde deltatt i undervisningsopplegget “Aktivitetsgrupper-lede og delta”. Datamaterialet ble analysert etter retningslinjer for fenomenologisk basert meningskondensering. Studentene diskuterte sine erfaringer og det kom tydelig fram at undervisningsopplegget ga dem muligheter til å bruke sitt engasjement og sin kreativitet i valg av aktiviteter for sin simulerte aktivitetsgruppe. Videre fikk de muligheter til å oppdage sider ved anvendelse av aktiviteter for ulike pasienter, som de ikke kunne forstå uten integrering av teori i praktisk ferdighetstrening. Ved planlegging, gjennomføring og refleksjon over å lede og delta i aktivitetsgrupper, oppøvet de evnen til handlingsrefleksjon. Aktivitetsbasert pedagogikk kan bidra til utvikling av profesjonell handlingskompetanse og det er behov for både teoretiske og praktiske læringsformer. Funnene ble diskutert i lys av pedagogisk handlingsteori.

  13. Low-Complexity Tools in AVS Part 7

    Institute of Scientific and Technical Information of China (English)

    Feng Yi; Qi-Chao Sun; Jie Dong; Lu Yu

    2006-01-01

    Audio Video coding Standard (AVS) is established by the AVS Working Group of China. The main goal of AVS part 7 is to provide high compression performance with relatively low complexity for mobility applications. There are 3 main low-complexity tools: deblocking filter, context-based adaptive 2D-VLC and direct intra prediction. These tools are presented and analyzed respectively. Finally, we compare the performance and the decoding speed of AVS part 7 and H.264 baseline profile. The analysis and results indicate that AVS part 7 achieves similar performance with lower cost.

  14. Overview of AVS-video: tools, performance and complexity

    Science.gov (United States)

    Yu, Lu; Yi, Feng; Dong, Jie; Zhang, Cixun

    2005-07-01

    Audio Video coding Standard (AVS) is established by the Working Group of China in the same name. AVS-video is an application driven coding standard. AVS Part 2 targets to high-definition digital video broadcasting and high-density storage media and AVS Part 7 targets to low complexity, low picture resolution mobility applications. Integer transform, intra and inter-picture prediction, in-loop deblocking filter and context-based two dimensional variable length coding are the major compression tools in AVS-video, which are well-tuned for target applications. It achieves similar performance to H.264/AVC with lower cost.

  15. Varmepumper i hushald. Analyse av endringar i effektforbruket hos hushald med panelomnar og vedfyring ved installasjon av ulike typar varmepumper

    OpenAIRE

    Øvrebotten, Kristian

    2015-01-01

    Sidan oljekrisa på 1970-talet som førte til ein gradvis overgang frå bruk av oljekjelar og parafinkaminar til panelomnar og varmepumper, har andelen elektrisitet stadig auka mens andelen av olje har vore redusert. Andelen av elektrisitet hos hushalda utgjer i dag om lag 79 % av den samla energibruken hos hushalda i Noreg. Dette høge forbruket av elektrisitet hos hushalda bidreg til å skape problem med høge effekttoppar i kraftnettet som igjen skapar problem for kraftdistributørar og er med...

  16. Removal Of Volatile Impurities From Copper Concentrates

    Energy Technology Data Exchange (ETDEWEB)

    Winkel, L.; Schuler, A.; Frei, A.; Sturzenegger, M.

    2005-03-01

    To study the removal of volatile impurities from two different copper concentrates they have been heated on a thermo balance to temperatures between 900 and 1500 C. This sample treatment revealed that both concentrates undergo strong weight losses at 500 and 700 C. They were attributed to the removal of sulfur. Elemental analyses of the residues by ICP spectrometry have shown that the thermal treatment efficiently removes the volatile impurities. Already below 900 C most of the arsenic is removed by evaporation, the largest fraction of lead and zinc is removed in the temperature interval of 1300-1500 C. It was observed that quartz in the concentrate leads to the formation of a silicon-enriched phase besides a metal rich sulfide phase. The former is interpreted as an early stage of a silicate slag. Elemental analysis showed that the formation of this distinct slag phase does not hinder the efficient removal of volatile impurities. (author)

  17. GC-MS analysis of off-odor volatiles from irradiated pork

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The main compounds of off-odor volatiles from irradiated refrigerated vacuum-packaged pork were analyzed by gas chromatograph/mass spectrometer (GC-MS). The analytical results showed that the main compounds of off-odor volatiles were dimethyl disulfide, dimethyl sulfide, dimethyl trisulfide, S-methyl thioacetate, and methanethiol. It was proved that the off-odor volatile came from irradiated S-containing amino acid and thiamin.

  18. Pricing Volatility Referenced Assets

    Directory of Open Access Journals (Sweden)

    Alan De Genaro Dario

    2006-12-01

    Full Text Available Volatility swaps are contingent claims on future realized volatility. Variance swaps are similar instruments on future realized variance, the square of future realized volatility. Unlike a plain vanilla option, whose volatility exposure is contaminated by its asset price dependence, volatility and variance swaps provide a pure exposure to volatility alone. This article discusses the risk-neutral valuation of volatility and variance swaps based on the framework outlined in the Heston (1993 stochastic volatility model. Additionally, the Heston (1993 model is calibrated for foreign currency options traded at BMF and its parameters are used to price swaps on volatility and variance of the BRL / USD exchange rate.

  19. Sulfide detoxification in plant mitochondria.

    Science.gov (United States)

    Birke, Hannah; Hildebrandt, Tatjana M; Wirtz, Markus; Hell, Rüdiger

    2015-01-01

    In contrast to animals, which release the signal molecule sulfide in small amounts from cysteine and its derivates, phototrophic eukaryotes generate sulfide as an essential intermediate of the sulfur assimilation pathway. Additionally, iron-sulfur cluster turnover and cyanide detoxification might contribute to the release of sulfide in mitochondria. However, sulfide is a potent inhibitor of cytochrome c oxidase in mitochondria. Thus, efficient sulfide detoxification mechanisms are required in mitochondria to ensure adequate energy production and consequently survival of the plant cell. Two enzymes have been recently described to catalyze sulfide detoxification in mitochondria of Arabidopsis thaliana, O-acetylserine(thiol)lyase C (OAS-TL C), and the sulfur dioxygenase (SDO) ethylmalonic encephalopathy protein 1 (ETHE1). Biochemical characterization of sulfide producing and consuming enzymes in mitochondria of plants is fundamental to understand the regulatory network that enables mitochondrial sulfide homeostasis under nonstressed and stressed conditions. In this chapter, we provide established protocols to determine the activity of the sulfide releasing enzyme β-cyanoalanine synthase as well as sulfide-consuming enzymes OAS-TL and SDO. Additionally, we describe a reliable and efficient method to purify OAS-TL proteins from plant material.

  20. A Novel MBAFF Scheme of AVS

    Institute of Scientific and Technical Information of China (English)

    Jian-Wen Chen; Guo-Ping Li; Yun He

    2006-01-01

    Adaptive frame/field coding techniques have been adopted in many international video standards for interlaced sequence coding. When the frame/field adaptation is applied on the picture level, the coding efficiency is improved greatly,compared with the pure frame coding or the pure field coding. The picture-level adaptive frame/field coding (PAFF) selects frame coding or field coding once for one picture. If this frame/field adaptation is extended to Macro Block (MB) level, the coding efficiency will be further increased. In this paper, a novel MB-level adaptive frame/field (MBAFF) coding scheme is proposed. In the proposed MBAFF scheme, the top field of the current picture is used as a reference. The experiments are implemented on the platforms of Audio Video coding Standard (AVS) base profile and H.264/AVC, respectively. On the AVS platform, 0.35dB gain can be achieved averagely, compared with AVS1.0 anchor. On the H.264/AVC platform, 0.16dB gain can be achieved averagely, compared with MBAFF scheme of H.264/AVC. Additionally, an extensive subjective quality enhancement can be achieved by the proposed scheme.

  1. Utveckling av ett webbforum med innehållshanteringssystemet Drupal

    OpenAIRE

    Lindqvist, Christoffer

    2010-01-01

    Detta examensarbete består av två huvuddelar. Den första delen är en teoretisk analys av innehållshanteringssystem i allmänhet och en forskning i hur det populära innehållshanteringsverktyget Drupal är uppbyggt. Den andra delen av arbetet är en praktisk genomgång av hur funktionalitet för ett webbforum kan byggas upp med hjälp av Drupals ramverk. Den teoretiska analysen undersöker vad ett innehållshanteringsverktyg är, vad det används till och vilka huvuddrag det i allmänhet består av. Sed...

  2. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  3. Kvinnors upplevelser av komplicerad förlossning

    OpenAIRE

    Samuelsson, Magdalena; Wahlberg, Christina

    2006-01-01

    Att vänta och föda barn beskrivs som en av de viktiga övergångsperioderna i livet och innebär ofta en personlig utveckling för den födande kvinnan. Då graviditeten och förlossningen av någon anledning kompliceras, kan denna process störas, och kvinnan kan istället få både fysiska och psykiska men i efterförloppet. Syftet med denna studie var att belysa kvinnors upplevelser av en komplicerad förlossning. Metoden var en granskning i form av en innehållsanalys av sju artiklar som utgjordes av fy...

  4. AVS 3D Video Coding Technology and System

    Institute of Scientific and Technical Information of China (English)

    Siwei Ma; Shiqi Wang; Wen Gao

    2012-01-01

    Following the success of the audio video standard (AVS) for 2D video coding, in 2008, the China AVS workgroup started developing 3D video (3DV) coding techniques. In this paper, we discuss the background, technical features, and applications of AVS 3DV coding technology. We introduce two core techniques used in AVS 3DV coding: inter-view prediction and enhanced stereo packing coding. We elaborate on these techniques, which are used in the AVS real-time 3DV encoder. An application of the AVS 3DV coding system is presented to show the great practical value of this system. Simulation results show that the advanced techniques used in AVS 3DV coding provide remarkable coding gain compared with techniques used in a simulcast scheme.

  5. Sulfide oxidation in a biofilter

    DEFF Research Database (Denmark)

    Pedersen, Claus Lunde; Liu, Dezhao; Hansen, Michael Jørgen

    2012-01-01

    oxidizing bacteria but several fungal families including Trichocomaceae. A positive correlation was found between the presence of mold and sulfide uptake. However there have been no reports on fungi metabolizing hydrogen sulfide. We hypothesize that the mold increases the air exposed surface, enabling...... higher hydrogen sulfide uptake followed by oxidation catalyzed by iron-containing enzymes such as cytochrome c oxidase in a process uncoupled from energy conservation....

  6. Analyse av klimatilpassningstiltak : en casestudie av avløpsnettet i Veumdalen, Fredrikstad kommune

    OpenAIRE

    Myking, Jakob Severin Eide

    2012-01-01

    Økt forståelse av fortidens klimaendringer og klimasystemet i sin helhet, har gitt forskerne mulighet til å anta fremtidens klimaendringer. Denne økte forståelsen har gitt sikre tegn på at klimaendringene er knyttet til en stor grad av usikkerhet. Det eneste som er sikkert, er at klimaendringer kommer til å skje, og at det er umulig å si med sikkerhet når eller med hvilken kraft de vil inntreffe. Det som derimot kan sies med sikkerhet, er at befolkningen kommer til å øke. Dette vil føre til ø...

  7. Optimering av FISH- teknik för detektion av Laktobaciller

    OpenAIRE

    Hamidi, Helaleh

    2008-01-01

    Sammanfattning Syftet med den här studien var att utveckla och optimera FISH (Fluorescense In Situ Hybridisation) tekniken som en snabb och ganska billig metod för detektion av laktobaciller. Det vill säga att kunna på objektsglas använda FISH tekniken för att identifiera laktobaciller på artnivå med fluorescensmärkta prober mot 16S och 23S RNA. FISH är en allmän och användbar metod för att detektera och lokalisera mikroorganismer eller en specifik grupp av mikroorganismer i provet (1). Metod...

  8. Kunnskapsutvikling i et profesjonsperspektiv - En kvantitativ studie av sosialarbeideres bruk av kunnskapsressurser i arbeidslivet

    OpenAIRE

    2014-01-01

    Problemområde Profesjoner betraktes gjerne som grupper som rår over store deler av samfunnets ressurser. Som velferdsstatens portvakter anses de gjerne som grupper med definisjonsmakt og forvaltere av kunnskap (Molander og Smeby, 2013). Det moderne kunnskapssamfunnet byr imidlertid på nye utfordringer for profesjonsfeltet. Det stilles i økende grad krav til at profesjonsutøvere skal være faglig oppdaterte, utøve en kunnskapsbasert praksis og til en hver tid inneha nødvendig kompetanse. Sosial...

  9. Effects of borax treatment on hydrogen sulfide emissions and sulfate reducing bacteria in stored swine manure

    Science.gov (United States)

    Malodorous compounds and emissions produced from stored swine manure can pose both environmental and health issues. These nuisance odors largely result from compounds such as sulfides, volatile fatty acids, and phenols, which are produced as a result of anaerobic digestion of materials present in t...

  10. Functional mathematical model of dual pathway AV nodal conduction.

    Science.gov (United States)

    Climent, A M; Guillem, M S; Zhang, Y; Millet, J; Mazgalev, T N

    2011-04-01

    Dual atrioventricular (AV) nodal pathway physiology is described as two different wave fronts that propagate from the atria to the His bundle: one with a longer effective refractory period [fast pathway (FP)] and a second with a shorter effective refractory period [slow pathway (SP)]. By using His electrogram alternance, we have developed a mathematical model of AV conduction that incorporates dual AV nodal pathway physiology. Experiments were performed on five rabbit atrial-AV nodal preparations to develop and test the presented model. His electrogram alternances from the inferior margin of the His bundle were used to identify fast and slow wave front propagations. The ability to predict AV conduction time and the interaction between FP and SP wave fronts have been analyzed during regular and irregular atrial rhythms (e.g., atrial fibrillation). In addition, the role of dual AV nodal pathway wave fronts in the generation of Wenckebach periodicities has been illustrated. Finally, AV node ablative modifications have been evaluated. The model accurately reproduced interactions between FP and SP during regular and irregular atrial pacing protocols. In all experiments, specificity and sensitivity higher than 85% were obtained in the prediction of the pathway responsible for conduction. It has been shown that, during atrial fibrillation, the SP ablation significantly increased the mean HH interval (204 ± 39 vs. 274 ± 50 ms, P AV node mechanisms and should be considered as a step forward in the studies of AV nodal conduction.

  11. AV nodal dual pathway electrophysiology and Wenckebach periodicity.

    Science.gov (United States)

    Zhang, Youhua; Mazgalev, Todor N

    2011-11-01

    The precise mechanism(s) governing the phenomenon of AV nodal Wenckebach periodicity is not fully elucidated. Currently 2 hypotheses, the decremental conduction and the Rosenbluethian step-delay, are most frequently used. We have provided new evidence that, in addition, dual pathway (DPW) electrophysiology is directly involved in the manifestation of AV nodal Wenckebach phenomenon. AV nodal cellular action potentials (APs) were recorded from 6 rabbit AV node preparations during standard A1A2 and incremental pacing protocols. His electrogram alternans, a validated index of DPW electrophysiology, was used to monitor fast (FP) and slow (SP) pathway conduction. The data were collected in intact AV nodes, as well as after SP ablation. In all studied hearts the Wenckebach cycle started with FP propagation, followed by transition to SP until its ultimate block. During this process complex cellular APs were observed, with decremental foot formations reflecting the fading FP and second depolarizations produced by the SP. In addition, the AV node cells exhibited a progressive loss in maximal diastolic membrane potential (MDP) due to incomplete repolarization. The pause created with the blocked Wenckebach beat was associated with restoration of MDP and reinitiation of the conduction cycle via the FP wavefront. DPW electrophysiology is dynamically involved in the development of AV nodal Wenckebach periodicity. In the intact AV node, the cycle starts with FP that is progressively weakened and then replaced by SP propagation, until block occurs. AV nodal SP modification did not eliminate Wenckebach periodicity but strongly affected its paradigm. © 2011 Wiley Periodicals, Inc.

  12. Legemiddelbivirkninger – forekomst og vurdering av årsakssammenhenger.

    Directory of Open Access Journals (Sweden)

    Tone Westergren

    2009-09-01

    Full Text Available En gjennomgang av spontanrapportene fra den norske bivirkningsdatabasen viser en betydelig geografisk variasjon når det gjelder innrapportering av bivirkninger. I Norge blir disse meldingene evaluert ved RELIS (Regionale legemiddelinformasjonssentre av tverrfaglige team bestående av leger og farmasøyter. Bivirkningsarbeidet ved RELIS gjøres på oppdrag fra Statens legemiddelverk, som har det overordnede ansvar for legemiddelovervåkningen i Norge. Vurderingene baseres på kjent risikoprofil for mistenkte legemidler, indikasjon, dosering, tidsmessig sammenheng mellom reaksjon og medikamentinntak, effekt av seponering og eventuelle andre risikofaktorer. 3345 legemiddel/bivirkningskombinasjoner ble vurdert på bakgrunn av 1408 rapporter i 2006. De fleste mistenkte bivirkningene ble klassifisert som mulige, ettersom andre faktorer også kunne ha spilt en rolle. Få bivirkninger ble klassifisert som sikre. Informasjon om bivirkninger i litteratur og databaser er i flere tilfeller preget av manglende homogenitet, tilfeldige sammentreff i tid, manglende data og lite vurdering av sammenhengen mellom reaksjonen og medisinbruken. Kliniske studier har begrenset mulighet til å påvise annet enn de vanligste bivirkningene. Det kan ta år etter markedsføring å fastslå sammenhengen med mer sjeldne bivirkninger. Frekvenstabeller for bivirkninger er anslag basert på et begrenset antall pasienter, spesielt for nye legemidler. Evaluering av bivirkningsrapporter fra helsepersonell kan avdekke mangel på lett tilgjengelig informasjon og bidra til ny kunnskap om et legemiddels bivirkningsprofil

  13. Russisk oljetransport gjennom Barentshavet : En tilfellestudie av den norske responsen

    OpenAIRE

    Aasen, Kari

    2010-01-01

    Oppgaven er en tilfellestudie av den norske responsen på økningen av russisk oljetransport gjennom Barentshavet. Oljetransporten fra Nordvest-Russland tok seg plutselig dramatisk opp i 2002, noe som kom svært overraskende på norske myndigheter. Hensikten med oppgaven har derfor vært å kartlegge den norske responsen, for å finne ut hva som har preget den. På bakgrunn av kjennetegnene ved responsen har jeg deretter forsøkt å sannsynliggjøre hvilke oppfatninger av Russland som vært dominerende. ...

  14. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  15. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  16. Magmatic sulfides in the porphyritic chondrules of EH enstatite chondrites

    Science.gov (United States)

    Piani, Laurette; Marrocchi, Yves; Libourel, Guy; Tissandier, Laurent

    2016-12-01

    The nature and distribution of sulfides within 17 porphyritic chondrules of the Sahara 97096 EH3 enstatite chondrite have been studied by backscattered electron microscopy and electron microprobe in order to investigate the role of gas-melt interactions in the chondrule sulfide formation. Troilite (FeS) is systematically present and is the most abundant sulfide within the EH3 chondrite chondrules. It is found either poikilitically enclosed in low-Ca pyroxenes or scattered within the glassy mesostasis. Oldhamite (CaS) and niningerite [(Mg,Fe,Mn)S] are present in ≈60% of the chondrules studied. While oldhamite is preferentially present in the mesostasis, niningerite associated with silica is generally observed in contact with troilite and low-Ca pyroxene. The Sahara 97096 chondrule mesostases contain high abundances of alkali and volatile elements (average Na2O = 8.7 wt.%, K2O = 0.8 wt.%, Cl = 7100 ppm and S = 3700 ppm) as well as silica (average SiO2 = 62.8 wt.%). Our data suggest that most of the sulfides found in EH3 chondrite chondrules are magmatic minerals that formed after the dissolution of S from a volatile-rich gaseous environment into the molten chondrules. Troilite formation occurred via sulfur solubility within Fe-poor chondrule melts followed by sulfide saturation, which causes an immiscible iron sulfide liquid to separate from the silicate melt. The FeS saturation started at the same time as or prior to the crystallization of low-Ca pyroxene during the high temperature chondrule forming event(s). Protracted gas-melt interactions under high partial pressures of S and SiO led to the formation of niningerite-silica associations via destabilization of the previously formed FeS and low-Ca pyroxene. We also propose that formation of the oldhamite occurred via the sulfide saturation of Fe-poor chondrule melts at moderate S concentration due to the high degree of polymerization and the high Na-content of the chondrule melts, which allowed the activity of Ca

  17. Pollen transmission of asparagus virus 2 (AV-2) may facilitate mixed infection by two AV-2 isolates in asparagus plants.

    Science.gov (United States)

    Kawamura, Ryusuke; Shimura, Hanako; Mochizuki, Tomofumi; Ohki, Satoshi T; Masuta, Chikara

    2014-09-01

    Asparagus virus 2 (AV-2) is a member of the genus Ilarvirus and thought to induce the asparagus decline syndrome. AV-2 is known to be transmitted by seed, and the possibility of pollen transmission was proposed 25 years ago but not verified. In AV-2 sequence analyses, we have unexpectedly found mixed infection by two distinct AV-2 isolates in two asparagus plants. Because mixed infections by two related viruses are normally prevented by cross protection, we suspected that pollen transmission of AV-2 is involved in mixed infection. Immunohistochemical analyses and in situ hybridization using AV-2-infected tobacco plants revealed that AV-2 was localized in the meristem and associated with pollen grains. To experimentally produce a mixed infection via pollen transmission, two Nicotiana benthamiana plants that were infected with each of two AV-2 isolates were crossed. Derived cleaved-amplified polymorphic sequence analysis identified each AV-2 isolate in the progeny seedlings, suggesting that pollen transmission could indeed result in a mixed infection, at least in N. benthamiana.

  18. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  19. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  20. Bochdalek Hernia As A Cause Of Intermittent AV Block

    OpenAIRE

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-01-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  1. Introduction to AVS2 Scene Video Coding Techniques

    Institute of Scientific and Technical Information of China (English)

    Jiaying Yan; Siwei Dong; Yonghong Tian; Tiejun Huang

    2016-01-01

    The second generation Audio Video Coding Standard (AVS2) is the most recent video coding standard. By introducing several new coding techniques, AVS2 can provide more efficient compression for scene videos such as surveillance videos, conference videos, etc. Due to the limited scenes, scene videos have great redundancy especially in background region. The new scene video coding techniques applied in AVS2 mainly focus on reducing redundancy in order to achieve higher compression. This paper introduces several important AVS2 scene video coding techniques. Experimental results show that with scene video coding tools, AVS2 can save nearly 40%BD⁃rate (Bjøntegaard⁃Delta bit⁃rate) on scene videos.

  2. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  3. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  4. Sulfide intrusion and detoxification in Zostera marina

    DEFF Research Database (Denmark)

    Hasler-Sheetal, Harald; Holmer, Marianne

    2014-01-01

    nutrition in general. By a global review of sulfide intrusion, coupled with a series of field studies and in situ experiments we elucidate sulfide intrusion and different strategies of seagrasses to sustain sulfide intrusion. Using stable isotope tracing, scanning electron microscopy with x-ray analysis...... indicating a possible role of sulfide in the sulfur nutrition beside the detoxification function. Our results suggest different adaptations of Z. marina to reduced sediments and sulfide intrusion ranging from bacterial and chemical reoxidation of sulfide to sulfate to incorporation of sulfide into organic...

  5. A novel method for improving cerussite sulfidization

    Institute of Scientific and Technical Information of China (English)

    Qi-cheng Feng; Shu-ming Wen; Wen-juan Zhao; Qin-bo Cao; Chao L

    2016-01-01

    Evaluation of flotation behavior, solution measurements, and surface analyses were performed to investigate the effects of chloride ion addition on the sulfidization of cerussite in this study. Micro-flotation tests indicate that the addition of chloride ions prior to sulfidization can significantly increase the flotation recovery of cerussite, which is attributed to the formation of more lead sulfide species on the mineral surface. Solution measurement results suggest that the addition of chloride ions prior to sulfidization induces the transformation of more sul-fide ions from pulp solution onto the mineral surface by the formation of more lead sulfide species. X-ray diffraction and energy-dispersive spectroscopy indicate that more lead sulfide species form on the mineral surface when chloride ions are added prior to sulfidization. These results demonstrate that the addition of chloride ions prior to sulfidization can significantly improve the sulfidization of cerussite, thereby enhancing the flotation performance.

  6. Prevention of sulfide oxidation in sulfide-rich waste rock

    Science.gov (United States)

    Nyström, Elsa; Alakangas, Lena

    2015-04-01

    The ability to reduce sulfide oxidation in waste rock after mine closure is a widely researched area, but to reduce and/or inhibit the oxidation during operation is less common. Sulfide-rich (ca 30 % sulfur) waste rock, partially oxidized, was leached during unsaturated laboratory condition. Trace elements such as As and Sb were relatively high in the waste rock while other sulfide-associated elements such as Cu, Pb and Zn were low compared to common sulfide-rich waste rock. Leaching of unsaturated waste rock lowered the pH, from around six down to two, resulting in continuously increasing element concentrations during the leaching period of 272 days. The concentrations of As (65 mg/L), Cu (6.9 mg/L), Sb (1.2 mg/L), Zn (149 mg/L) and S (43 g/L) were strongly elevated at the end of the leaching period. Different alkaline industrial residues such as slag, lime kiln dust and cement kiln dust were added as solid or as liquid to the waste rock in an attempt to inhibit sulfide oxidation through neo-formed phases on sulfide surfaces in order to decrease the mobility of metals and metalloids over longer time scale. This will result in a lower cost and efforts of measures after mine closure. Results from the experiments will be presented.

  7. Mechanochemical reduction of copper sulfide

    DEFF Research Database (Denmark)

    Balaz, P.; Takacs, L.; Jiang, Jianzhong

    2002-01-01

    The mechanochemical reduction of copper sulfide with iron was induced in a Fritsch P-6 planetary mill, using WC vial filled with argon and WC balls. Samples milled for specific intervals were analyzed by XRD and Mossbauer spectroscopy. Most of the reaction takes place during the first 10 min...... of milling and only FeS and Cu are found after 60 min. The main chemical process is accompanied by phase transformations of the sulfide phases as a result of milling. Djurleite partially transformed to chalcocite and a tetragonal copper sulfide phase before reduction. The cubic modification of FeS was formed...... first, transforming to hexagonal during the later stages of the process. The formation of off-stoichiometric phases and the release of some elemental sulfur by copper sulfide are also probable....

  8. Hydrogen sulfide in signaling pathways.

    Science.gov (United States)

    Olas, Beata

    2015-01-15

    For a long time hydrogen sulfide (H₂S) was considered a toxic compound, but recently H₂S (at low concentrations) has been found to play an important function in physiological processes. Hydrogen sulfide, like other well-known compounds - nitric oxide (NO) and carbon monoxide (CO) is a gaseous intracellular signal transducer. It regulates the cell cycle, apoptosis and the oxidative stress. Moreover, its functions include neuromodulation, regulation of cardiovascular system and inflammation. In this review, I focus on the metabolism of hydrogen sulfide (including enzymatic pathways of H₂S synthesis from l- and d-cysteine) and its signaling pathways in the cardiovascular system and the nervous system. I also describe how hydrogen sulfide may be used as therapeutic agent, i.e. in the cardiovascular diseases.

  9. Bioseguridad en granjas avícolas

    Directory of Open Access Journals (Sweden)

    Sandra L. Ricaurte Galindo

    2005-02-01

    Full Text Available La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extraños a la granja, limpieza y desinfección de los galpones, control de visitas, evitar el stress en las aves encasetadas, evitar la contaminación del pienso, control de vacunaciones y medicaciones y control de deyecciones, cadáveres, etc.The biosecurity is the group of practical of handling designed to prevent the entrance and agents' pathologies transmission that can affect the sanity in the poultry farms. The biosecurity is since a fundamental part of any poultry company it provides an increase of the productivity of the chickens and hens and an increase in the economic yield. In general lines, the localization of the farm should be contemplated, characteristic constructive of the ship, control of strange chickens and hens to the farm, cleaning and disinfection of the ship, control of visits, to avoid the stress in the birds housed, to avoid the contamination of the I think, control of vaccinations and medications and dejections control, cadavers, etc.

  10. Volatile Organic Compounds (VOCs)

    Science.gov (United States)

    ... Contact Us Share Volatile Organic Compounds' Impact on Indoor Air Quality On this page: Introduction Sources Health Effects Levels in Homes Steps to Reduce Exposure Standards or Guidelines Additional Resources Introduction Volatile organic compounds ( ...

  11. Mantle Volatiles - Distribution and Consequences

    Science.gov (United States)

    Luth, R. W.

    2003-12-01

    O and 10-44% of the CO2 that is subducted is returned to the surface in arc magmatism. He emphasized that the "missing" volatiles may have multiple fates, including incorporation into the mantle wedge, large-scale fluid flow up along the interface between the subducting slab and overlying mantle, and transport into the deeper mantle.Because of the hydrous nature of arc magmatism, a common hypothesis is that there is a hydrous phase that breaks down at subarc conditions to trigger melting in the overlying mantle wedge to produce arc magmas. A key research goal has been to identify this phase, or phases. For example, serpentine in peridotite will break down during subduction to produce olivine+orthopyroxene+fluid or, in cooler slabs, a progression of DHMSs, the last of which may survive into the transition zone.At some point, however, because of the limited thermal or pressure stability of the hydrous phases, water will be liberated from the slab into the surrounding mantle. At this point, the water will either exist as a fluid, a melt - or something intermediate if we are above the second critical end point in the relevant system (Wyllie and Ryabchikov, 2000) - or it may dissolve into nominally anhydrous phases.The understanding of the relevant phase relations for the other volatiles is not as advanced. For carbon, we have a reasonable understanding of its phase stability in the mantle, but there is still no good understanding of the relative importance of carbonates, elemental carbon, and other forms as hosts for carbon in the mantle. In the upper mantle, sulfur resides primarily in sulfides; their behavior during partial melting will play a major role in the geochemical cycling of sulfur as well as of chalcophile elements. The halogens are rare (and rarely studied) in mantle-derived samples; more insight into their behavior is currently coming from the study of mantle-derived magmas.This review will first consider the evidence from mantle-derived magmas pertaining

  12. Phase 4 paroxysmal AV block in a patient with scleroderma.

    Science.gov (United States)

    Butschek, Ross; Powell, Brian D; Littmann, Laszlo

    2013-01-01

    A 72-year-old man with limited cutaneous systemic scleroderma was hospitalized for two episodes of witnessed syncope. The baseline 12-lead electrocardiogram was normal but on telemetry there were numerous episodes of paroxysmal AV block with asystolic periods of up to 7.5 s duration. Analysis of the rhythm strips revealed phase 4 intra-His bundle block characterized by critical P-P intervals that triggered the AV block, and a narrow range of junctional escape to subsequent P wave intervals that were required to release the AV block. A dual chamber pacemaker was implanted. Copyright © 2013 Elsevier Inc. All rights reserved.

  13. Ishockeykjelke - Understell: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  14. "Oktober i lederstolen" og "Harlekins Alle hjerters dag" : to noveller av Neil Gaiman : oversatt og kommentert

    OpenAIRE

    Eilertsen, Helle Elisabet Jæger

    2011-01-01

    Oppgaven består av oversettelser av to noveller skrevet av Neil Gaiman, og en kommentardel. Novellene er innenfor sjangeren fantastisk litteratur. Kommentardelen tar for seg relevante problemstillinger, blant annet oversettelse av navn, særegne uttrykk og dobbeltbetydning. Den tar også for seg hjemliggjøring/fremmedgjøring og valg av stil. Dette er knyttet til oversettelsesteoretikere som Schleiermacher, Nida, Koller og Berman.

  15. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  16. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  17. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  18. EST Table: AV399431 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399431 NV120218 10/09/28 91 %/131 aa ref|NP_047488.1| CG30 [Bombyx mori NPV] gb|A...AC63757.1| CG30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  19. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  20. EST Table: AV404175 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404175 pg--0560 10/09/28 100 %/209 aa ref|NP_040587.1| capsid component [Enteroba...EFF06860.1| phage major capsid protein E [Escherichia coli B185] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404434 pg-- ...

  1. EST Table: AV399451 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399451 NV120246 10/09/28 94 %/223 aa ref|NP_047521.1| AcMNPV orf124 [Bombyx mori ...NPV] gb|AAC63790.1| AcMNPV orf124 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399564 NV12 ...

  2. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  3. AV-95 Sun Devil: High-Speed Military Rotorcraft

    Science.gov (United States)

    1996-01-01

    The AV-95 Sun Devil must combine helicopter capabilities, such as vertical takeoff and landings (VTOL) and rotor-powered flight, along with long-duration cruise and high-speed dash capabilities unobtainable by conventional helicopters. To be able to perform both tasks, and perform them well, the AV-95 Sun Devil design incorporates several unconventional devices; the AV-95 uses two convertible turbofan engines, able to provide both shaft power for the main rotor and tall fan as well as jet thrust either separately or simultaneously. Other devices used for the AV-95 include a variable diameter main rotor and a blown flap. In helicopter mode, the AV-95 Sun Devil performs like a winged helicopter. The addition of wings to an attack helicopter results in two significant advantages. First, the addition of wings makes a helicopter more maneuverable than a wingless, but otherwise similar helicopter. Second, since the wings produce lift, rotor stall and compressibility effects can be significantly delayed at high tip velocities. In fixed-wing mode, the main rotor is completely off-loaded but slightly powered, and the rotor diameter has been minimized. The AV-95 Sun Devil has many advantages over other VTOL aircraft. The conversion process is simple and fast; conversion does not make the AV-95 vulnerable to enemy attack during conversion such as a tilt-wing or a tilt-rotor. Stop-rotor aircraft and a stowed rotor aircraft require heavy breaking of the rotor for conversion; this adds time for conversion and weight to the aircraft. Because the AV-95 never stops the rotor in flight, much weight is spared, and conversion is much simpler and faster.

  4. EST Table: AV404360 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404360 pg--0892 11/12/09 n.h 10/09/28 61 %/132 aa sp|P03764.2|STF_LAMBD RecName: ...Full=Side tail fiber protein 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404360 pg-- ...

  5. EST Table: AV399747 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399747 NV120691 10/09/28 89 %/128 aa ref|YP_950793.1| gp41 [Maruca vitrata MNPV] ...gb|ABL76015.1| gp41 [Maruca vitrata MNPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399524 NV12 ...

  6. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  7. Gradering av kvaliteten på dokumentasjonen

    Directory of Open Access Journals (Sweden)

    Gunn E. Vist

    2013-11-01

    Full Text Available Hva menes med at noe er ”godt dokumentert”? I hvilken grad kan vi stole på forskningsresultater? Den mest brukte metoden for å vurdere kvalitet på dokumentasjon og styrke på anbefalinger er GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE brukes i systematiske oversikter og i retningslinjer der man vurderer effekten av og gir anbefalinger om ulike behandlingsalternativer. I GRADE gjøres et klart skille mellom kvaliteten på dokumentasjonen og styrken på anbefalingene. For å vurdere kvaliteten på dokumentasjonen tar GRADE utgangspunkt i en godt utført systematisk oversikt som omfatter den aktuelle problemstillingen. Både randomiserte forsøk og observasjonsstuder kan inngå. GRADE benytter fem kriterier som vurderes for eventuell nedgradering av kvaliteten på dokumentasjonen: studiekvalitet, konsistens mellom studiene, direkthet, presisjon og rapporteringsskjevheter. I tillegg kan observasjonsstudier vurderes for oppgradering ved følgende tre kriterier: sterke assosiasjoner, dose-responseffekter og forvekslingsfaktorer. Alle vurderingene noteres og presenteres sammen med resultatene i oppsummeringstabeller.Vist GE, Sæterdal I, Vandvik PO, Flottorp SA. Grading the quality of the evidence. Nor J Epidemiol 2013; 23 (2: 151-156.ENGLISH SUMMARY What is meant by the claim that something is “well documented”? How much confidence can we have in the results? The most commonly used method to grade the quality of the evidence is GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE is used in systematic reviews, where the effects of different treatments or options are being compared, and in guidelines with recommendations about the competing options. GRADE makes a clear distinction between the quality of the evidence and the strength of recommendation. When grading the quality of the evidence with GRADE, the starting point is a well conducted systematic review of research on the

  8. Silicate sulfidation and chemical differences between enstatite chondrites and Earth

    Science.gov (United States)

    Lehner, S. W.; Petaev, M. I.; Buseck, P. R.

    2013-12-01

    Isotopic similarity between the Earth-Moon system and enstatite chondrites (ECs) led to the idea that ECs were Earth's building blocks [1-3]. However, compared to Earth's mantle, ECs have low Fe0/Fe ratios, are enriched in volatile elements, and depleted in refractory lithophile elements and Mg [4]. Therefore, deriving Earth composition from ECs requires a loss of volatiles during or prior to accretion and sequestering a large fraction of Si in the deep Earth. Alternatively, the isotopic similarity between the Earth and ECs is explained by their formation from a common precursor that experienced different evolutionary paths resulting in the chemical difference [4]. The vestiges of such a precursor are still present in the unequilibrated ECs as FeO-rich silicates with O isotopic compositions identical to bulk ECs and Earth [5]. Conversion of such a precursor into the characteristic EC mineral assemblage requires high-temperature processing in an H-poor environment with high fS2 and fO2 close to that of the classic solar nebula [6], consistent with redox conditions inferred from Ti4+/Ti3+ ratios in EC pyroxene [7]. Under such conditions reaction of FeO-rich silicates with S-rich gas results in their replacement by the assemblage of FeO-poor silicates; Fe, Mg, Ca sulfides; free silica; and Si-bearing Fe,Ni metal alloy. The progressive sulfidation of ferromagnesian silicates in chondrules results in loss of Mg and addition of Fe, Mn, S, Na, K and, perhaps, other volatiles [6]. At the advanced stages of silicate sulfidation recorded in the metal-sulfide nodules [8], a portion of Si is reduced and dissolved in the Fe,Ni metal. This process is known to fractionate Si isotopes [9,10] and would explain the differences between the ECs and Earth's mantle [11]. The sulfidation of silicates also produces porous S-rich silica, a peculiar phase observed so far only in the ECs. It consists of a sinewy SiO2-rich framework enclosing numerous vesicles filled with beam

  9. Problemstillingar rundt framføring av transkribert musikk - Ei analyse av Bach/Busoni: Chaconne i d-moll

    OpenAIRE

    Flem, Kato Nogva

    2014-01-01

    Ei samanlikning og analyse av Busoni sin transkripsjon av Bach sin Chaconne frå partita nr. 2 for solofiolin. Partita for Violin No. 2 was written by Johann Sebastian Bach during 1717-1723 and consists of five movements; Allemande, Courante, Sarabande, Gigue and Chaconne. The chaconne is longer than the rest of the piece combined, and is frequently played separately. Yehudi Menuhin calls the Chaconne "the greatest structure for solo violin that exists." (Menuhin, 1997, p. 236) Violinist...

  10. Enhanced A-V nodal conduction (Lown-Ganong-Levine syndrome) by congenitally hypoplastic A-V node.

    Science.gov (United States)

    Ometto, R; Thiene, G; Corrado, D; Vincenzi, M; Rossi, L

    1992-11-01

    The basic anatomical substrate of enhanced A-V nodal conduction, manifesting or not as Lown-Ganong-Levine syndrome, is still a controversial issue. We describe the case of a 34-year-old man who presented episodes of ventricular fibrillation. Electrophysiological studies showed that the AH interval was 55 ms, and increased by only 20 ms at paced cycle lengths of 300 ms; atrial pacing induced atrial fibrillation, with a shortest RR interval of 240 ms. Despite verapamil therapy, this patient died suddenly at home. Histological study disclosed a severe A-V node hypoplasia that was evidently congenital in nature; the rest of the conduction system was normal, and no accessory A-V pathways were present. We suggest that enhanced A-V nodal conduction in this patient was due to the developmental defect in the A-V node; this abnormality caused a loss of specific impulse-delaying function, and thus allowed rapid, unfiltered atrial impulses to reach the lower A-V junction and ventricles.

  11. Synthesis of furan from allenic sulfide derivatives

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    In this paper, we report the synthesis of furan derivatives from allenic sulfides. By the reaction with NaH, β-Hydroxyl allenic sulfides were found to generate furan products in excellent yields with the removal of phenylthio group. β-Aldehyde allenic sulfides were found to give similar furan products with one more substituent when treated with additional nucleophilic reagents. β-ketone allenic sulfides can also cyclize to give furan derivatives with the promotion of P2O5.

  12. Synthesis of furan from allenic sulfide derivatives

    Institute of Scientific and Technical Information of China (English)

    PENG LingLing; ZHANG Xiu; MA Jie; ZHONG ZhenZhen; ZHANG Zhe; ZHANG Yan; WANG JianBo

    2009-01-01

    In this paper, we report the synthesis of furan derivatives from allenic sulfides. By the reaction with NaH.,β-Hydroxyl allenic sulfides were found to generate furan products in excellent yields with the removal of phenylthio group.β-Aldehyde allenic sulfides were found to give similar furan products with one more substituent when treated with additional nucleophilic reagents. β-ketone allenic sulfides can also cyclize to give furan derivatives with the promotion of P2O5.

  13. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  14. Alteration of Mantle Sulfides: the Effects of Oxidation and Melt Infiltration in a Kilbourne Hole Harzburgite Xenolith

    Science.gov (United States)

    Barrett, T. J.; Harvey, J.; Warren, J. M.; Klein, F.; Walshaw, R.

    2013-12-01

    Sulfides, while commonly present in volumetrically minor amounts (account for up to 22 weight % of the sulfide. Critically, no fresh, unaltered sulfides were recovered and in all of the sulfides there is evidence for at least two secondary processes. EDS mapping of the sulfides reveals pervasive, but incomplete, oxidation in all of the grains; Raman spectroscopy reveals this oxide to be goethite. In addition, there is also evidence for the interaction of many of the sulfides with a volatile-rich silicate melt. Silicate melt veins cross-cut the original sulfide mineralogy in some areas of the sulfide grain, while leaving other areas virtually untouched. The degree of oxidation and sulfide-melt interaction varies from slight to almost complete alteration amongst the 24 sulfide grains. Remarkably, in some grains, the melt infiltration, which could be due either to metasomatism before the xenolith was entrained or occurred during transport to the surface, appears to cross-cut some of the oxidation features, i.e. at least some of the oxidation features appear to pre-date the melt-rock interaction. This makes it difficult to attribute all of the oxidation to supergene weathering and suggests that some of the oxidation occurred before melt-rock interaction and must therefore have occurred within the sub-continental lithospheric mantle. [1] Luguet et al. (2001) Earth Planet. Sci. Lett. 189, 285-294. [2] Burton et al. (1999) Earth Planet. Sci. Lett. 172, 311-322. [3] Harvey et al. (2011) Geochim. Cosmochim. Acta 75, 5574-5596. [4] Alard et al. (2011) J. Petrol. 52, 2009-2045. [5] Lorand et al. (2003) 67, 4137-4151. [6] Handler & Bennett (1999) Geology 27, 75-78.

  15. 30 CFR 250.604 - Hydrogen sulfide.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Hydrogen sulfide. 250.604 Section 250.604... OPERATIONS IN THE OUTER CONTINENTAL SHELF Oil and Gas Well-Workover Operations § 250.604 Hydrogen sulfide. When a well-workover operation is conducted in zones known to contain hydrogen sulfide (H2S) or...

  16. 30 CFR 250.504 - Hydrogen sulfide.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Hydrogen sulfide. 250.504 Section 250.504... OPERATIONS IN THE OUTER CONTINENTAL SHELF Oil and Gas Well-Completion Operations § 250.504 Hydrogen sulfide. When a well-completion operation is conducted in zones known to contain hydrogen sulfide (H2S) or...

  17. 30 CFR 250.808 - Hydrogen sulfide.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Hydrogen sulfide. 250.808 Section 250.808... OPERATIONS IN THE OUTER CONTINENTAL SHELF Oil and Gas Production Safety Systems § 250.808 Hydrogen sulfide. Production operations in zones known to contain hydrogen sulfide (H2S) or in zones where the presence of...

  18. Nanostructured metal sulfides for energy storage.

    Science.gov (United States)

    Rui, Xianhong; Tan, Huiteng; Yan, Qingyu

    2014-09-07

    Advanced electrodes with a high energy density at high power are urgently needed for high-performance energy storage devices, including lithium-ion batteries (LIBs) and supercapacitors (SCs), to fulfil the requirements of future electrochemical power sources for applications such as in hybrid electric/plug-in-hybrid (HEV/PHEV) vehicles. Metal sulfides with unique physical and chemical properties, as well as high specific capacity/capacitance, which are typically multiple times higher than that of the carbon/graphite-based materials, are currently studied as promising electrode materials. However, the implementation of these sulfide electrodes in practical applications is hindered by their inferior rate performance and cycling stability. Nanostructures offering the advantages of high surface-to-volume ratios, favourable transport properties, and high freedom for the volume change upon ion insertion/extraction and other reactions, present an opportunity to build next-generation LIBs and SCs. Thus, the development of novel concepts in material research to achieve new nanostructures paves the way for improved electrochemical performance. Herein, we summarize recent advances in nanostructured metal sulfides, such as iron sulfides, copper sulfides, cobalt sulfides, nickel sulfides, manganese sulfides, molybdenum sulfides, tin sulfides, with zero-, one-, two-, and three-dimensional morphologies for LIB and SC applications. In addition, the recently emerged concept of incorporating conductive matrices, especially graphene, with metal sulfide nanomaterials will also be highlighted. Finally, some remarks are made on the challenges and perspectives for the future development of metal sulfide-based LIB and SC devices.

  19. Influence of arsenic on iron sulfide transformations

    NARCIS (Netherlands)

    Wolthers, M.; Butler, I.B.; Rickard, D.

    2007-01-01

    The association of arsenate, As(V), and arsenite, As(III), with disordered mackinawite, FeS, was studied in sulfide-limited (Fe:S = 1:1) and excess-sulfide (Fe:S = 1:2) batch experiments. In the absence of arsenic, the sulfide-limited experiments produce disordered mackinawite while the

  20. 快速 AVS 帧内预测算法%FAST AVS INTRA PREDICTION ALGORITHM

    Institute of Scientific and Technical Information of China (English)

    王双龙

    2015-01-01

    As to the complexity process of choosing best probable encoding mode in AVS intra prediction,we proposed a fast intra predic-tion encoding algorithm.With the analysis of AVS intra prediction encoding theory and its implementation in reference software GDM2.1,we derived the threshold of zero coefficient block determination.The fast algorithm determines whether or not the current block is a zero coeffi-cient block according to its threshold discriminant condition.For zero coefficient block,it encodes cbp element directly and terminates intra prediction encoding in advance,which avoids the consequent complex process.As for the non-zero coefficient blocks,the fast selection algo-rithm associating the time domain SAD and the frequency domain SATD is used,which excludes 40% to 80% impossible prediction modes, and the rate distortion function is applied to the remained prediction modes to select the best prediction mode.It was verified through experi-ment that when PSNR (peak signal-to-noise ratio)decreased within 0.25db and bits rate increased within 2%,the time of AVS encoding de-creased over 40%,and the encoding efficiency was largely improved as well.%针对 AVS(Audio Video code Standard)帧内预测中选择最优编码模式流程复杂的问题,提出一种快速帧内预测编码的算法。通过分析 AVS 帧内预测编码的原理及其在参考软件 GDM2.1中的代码实现,推导出判定零系数块的阈值。该快速算法根据零系数块的判定阈值条件判定当前块,对于零系数块,直接编码 cbp 元素,提前中止帧内预测编码,避免了后续的复杂流程;对于非零系数块,采用时域 SAD(Sum of Absolute Difference)与频域 SATD(Sum of Absolute Transformed Difference)相联合的快速选择算法,排除了40%~80%的不可能预测模式,对余下的模式采用率失真代价函数的方法选取最佳预测模式。经实验验证,在 PSNR(Peak Sig-nal to Noise Ratio)降低0

  1. Effect of Se treatment on the volatile compounds in broccoli.

    Science.gov (United States)

    Lv, Jiayu; Wu, Jie; Zuo, Jinhua; Fan, Linlin; Shi, Junyan; Gao, Lipu; Li, Miao; Wang, Qing

    2017-02-01

    Broccoli contains high levels of bioactive compounds but deteriorates and senesces easily. In the present study, freshly harvested broccoli was treated with selenite and stored at two different temperatures. The effect of selenite treatment on sensory quality and postharvest physiology were analyzed. Volatile components were assessed by HS-SPME combined with GC-MS and EN. The metabolism of Se and S was also examined. Results indicated that Se treatment had a significant effect on maintaining the sensory quality, suppressing the respiration intensity and ethylene production, as well as increasing the content of Se and decreasing the content of S. In particular, significant differences in the composition of volatile compounds were present between control and Se-treated. The differences were mainly due to differences in alcohols and sulfide compounds. These results demonstrate that Se treatment can have a positive effect on maintaining quality and enhancing its sensory quality through the release of volatile compounds.

  2. Emerging Equity Market Volatility

    OpenAIRE

    Geert Bekaert; Harvey, Campbell R.

    1995-01-01

    Returns in emerging capital markets are very different from returns in developed markets. While most previous research has focused on average returns, we analyze the volatility of the returns in emerging equity markets. We characterize the time-series of volatility in emerging markets and explore the distributional foundations of the variance process. Of particular interest is evidence of asymmetries in volatility and the evolution of the variance process after periods of capital market refor...

  3. Volatility in Equilibrium

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Sizova, Natalia; Tauchen, George

    Stock market volatility clusters in time, carries a risk premium, is fractionally inte- grated, and exhibits asymmetric leverage effects relative to returns. This paper develops a first internally consistent equilibrium based explanation for these longstanding empirical facts. The model is cast......, and the dynamic cross-correlations of the volatility measures with the returns calculated from actual high-frequency intra-day data on the S&P 500 aggregate market and VIX volatility indexes....

  4. Kortisonskepsis : En studie om holdninger til kortisonkrem blant foreldre av barn med atopisk eksem

    OpenAIRE

    Gustavsen, Hanne Engstrøm

    2010-01-01

    Bakgrunn: Kortisonkremer er en viktig del av behandlingen mot atopisk eksem. Mange foreldre er skeptiske til bruken av kortisonkremer, fordi de har lest eller hørt om bivirkninger. Pasienters og pårørendes holdninger til bruk av kortisonkrem kan påvirke gjennomføringen av behandlingen. Formål: Vi ønsket å undersøke holdninger til bruk av kortisonkrem blant foreldre og pårørende av barn med atopisk eksem. Vi ville også undersøke om det er en sammenheng mellom kunnskapsnivå om kortisonkreme...

  5. Utviklingen av Noark-standarden 1984 – 2008

    Directory of Open Access Journals (Sweden)

    Trond Sirevåg

    2014-11-01

    Full Text Available Artikkelen behandler utviklingen av Noark – standarden for elektronisk arkivdanning i norsk offentlig forvaltning – fra versjon 1 (1984 til versjon 5 (2008. Den beskriver omstendighetene som medførte at standarden ble til i 1984, og søker å forklare hvorfor og hvordan det lyktes å utbre standarden slik at Noark-systemer ble enerådende i offentlig forvaltning i løpet av 1990-årene. Riksarkivarens strategier i Noark-utviklingen behandles, – de som fra først av fikk Riksarkivaren til å engasjere seg i standardiseringsarbeidet, de som deretter fikk Riksarkivaren til å overta forvalteransvaret for Noark, og de som senere er endret eller justert som resultat av erfaringer med Noark-baserte systemer og av nyåpnede teknologiske muligheter. Særlig vekt legges på å belyse Riksarkivarens motiver for å overta ansvaret for Noark-standarden fra 1990. Noark plasseres også i det internasjonale bildet, og sammenholdes med andre standarder som ISO 15489 og EU-standarden MoReq. Da Noark-utviklingen startet i 1984, pågikk tilsvarende utviklingsprosjekter både i Danmark og i Sverige. Artikkelen søker forklaringer på at en journal- og sakarkivstandard bare ble en realitet i Norge.

  6. STUDY OF HYDROGEN SULFIDE REMOVAL FROM GROUNDWATER

    Directory of Open Access Journals (Sweden)

    T. Lupascu

    2013-06-01

    Full Text Available The process of the hydrogen sulfide removal from the underground water of the Hancesti town has been investigated. By oxygen bubbling through the water containing hydrogen sulfide, from the Hancesti well tube, sulfur is deposited in the porous structure of studied catalysts, which decreases their catalytic activity. Concomitantly, the process of adsorption / oxidation of hydrogen sulfide to sulfate take place. The kinetic research of the hydrogen sulfide removal from the Hancesti underground water, after its treatment by hydrogen peroxide, proves greater efficiency than in the case of modified carbonic adsorbents. As a result of used treatment, hydrogen sulfide is completely oxidized to sulfates

  7. Vesicle-metal-sulfide assemblages from the Chelyabinsk meteorite

    Science.gov (United States)

    Andronikov, A.; Lauretta, D.; Hill, D.; Andronikova, I.

    2014-07-01

    On February 15, 2013, an ET object entered the Earth's atmosphere over the Russian city of Chelyabinsk. It entered at a preatmospheric velocity of 18.6 km/sec at the angle of 17--20°. The bolide responsible for this event was estimated to be 17-20 m in diameter and had a mass of ˜10 Ktons; the ensuing airburst occurred at an altitude >20 km and released a total energy of ˜440 kT [1,2]. The Chelyabinsk meteorite is an equilibrated LL5 ordinary chondrite, shock stage S4, and weathering grade WG0 similar to other LL5 falls [1,2]. Our studied sample is an impact melt breccia consisting of shock-darkened chondrite clasts (SDC) and vesicular impact melt lithology (IML). The SDC have recrystallized textures and contain barred- and porphyritic-olivine, porphyritic-olivine-pyroxene and radial-pyroxene chondrules in the intrachondrule matrix. A dense network of thin fractures in the SDC is filled up with opaque minerals [cf. 3]. Metals in the SDC are kamacite (4.7--8.5 % Ni), taenite (21.4--33.5 % Ni), and martensite (14.5--18.6 % Ni). The IML consists mostly of tiny (bearing troilite (62.2--64.2 % Fe; 35.2--37.2 % S; 3000--5000 ppm Ni), with rare pentlandite (41.2--48.6 % Fe, 33.2--34.3 % S, 19.4--23.9 % Ni). The presence of abundant vesicles in the IML indicates strong heating and volatilization. Since no other phase except for sulfide-metal assemblages were observed to fill up vesicles, the likely source of volatiles is S vapor formed by vaporization of FeS during impact melting [cf. 4]. Molten metal and sulfide coalesced into droplets of metal-sulfide liquids forming eventually sulfide-metal assemblages. A notable compositional difference is observed between sulfides not containing metals and those with metals. The metal-free sulfides display higher concentrations of such elements as Ni, Co, Ga, Ge, As, Mo, Ru, Pd, Sn, Sb, Te, Au, and Hg, and lower amounts of Cu than their metal-bearing counterparts. The metal-free sulfides may represent loci of former ''parental'' Fe

  8. Understanding Financial Market Volatility

    NARCIS (Netherlands)

    A. Opschoor (Anne)

    2014-01-01

    markdownabstract__Abstract__ Volatility has been one of the most active and successful areas of research in time series econometrics and economic forecasting in recent decades. Loosely speaking, volatility is defined as the average magnitude of fluctuations observed in some phenomenon over time. Wi

  9. Improving Garch Volatility Forecasts

    NARCIS (Netherlands)

    Klaassen, F.J.G.M.

    1998-01-01

    Many researchers use GARCH models to generate volatility forecasts. We show, however, that such forecasts are too variable. To correct for this, we extend the GARCH model by distinguishing two regimes with different volatility levels. GARCH effects are allowed within each regime, so that our model

  10. Understanding Financial Market Volatility

    NARCIS (Netherlands)

    A. Opschoor (Anne)

    2014-01-01

    markdownabstract__Abstract__ Volatility has been one of the most active and successful areas of research in time series econometrics and economic forecasting in recent decades. Loosely speaking, volatility is defined as the average magnitude of fluctuations observed in some phenomenon over

  11. Volatile metabolites from actinomycetes

    DEFF Research Database (Denmark)

    Scholler, C.E.G.; Gurtler, H.; Pedersen, R.

    2002-01-01

    Twenty-six Streptomyces spp. were screened for their volatile production capacity on yeast starch agar. The volatile organic compounds (VOCs) were concentrated on a porous polymer throughout an 8-day growth period. VOCs were analyzed by gas chromatography with flame ionization detection and ident...

  12. Kartläggning av byggprocessen hos Peab med hjälp av SCOR

    OpenAIRE

    Johansson, Robin

    2012-01-01

    Detta är ett examensarbete utfört på Institutionen för teknik och naturvetenskap (ITN) i Norrköping som är en del av Linköpings Universitet i samarbete med Peab som intressent. Historiskt sett har byggbranschens intresse för logistik varit svalt vilket har lett till att logistiken inom denna bransch har halkat efter i förhållande till övriga branscher. Syftet med detta examensarbete är att utifrån ett logistiskt synsätt tillhandahålla anpassningsförslag till SCOR-processerna ”Make” och ”Retur...

  13. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  14. Solmoduler på balkongfronter : Renovering av flerbostadshus i miljonprogrammet

    OpenAIRE

    Persson, Maria

    2015-01-01

    Under det senaste seklet har en intensiv energianvändning orsakat stora utsläpp av koldioxid och andra växthusgaser i atmosfären med negativa miljöeffekter som följd. Den alltjämt ökade efterfrågan på elektricitet runtom i världen måste mötas av förnybara energikällor i kombination med energieffektiviseringar för att inte riskera ytterligare miljöförstöring. I Sverige är bostads- och servicesektorn en intensiv energianvändare och några av de byggnader som förbrukar mest energi finns i miljonp...

  15. En kartläggning av stereoskopisk 3D

    OpenAIRE

    Holmström, Benny

    2011-01-01

    Det här lärdomsprovet är en genomgång av ett av den moderna tidens största modeord: stereoskopisk 3D och syskontermen autostereoskopisk 3D. Kort sagt de tekniker som går ut på att leverera en bild till vardera av människans två ögon och därmed simulera djup i tvådimensionella bilder. Det här kan göras på en mängd olika sätt, och i detta examensarbete går jag igenom de vanligaste teknikerna och förklarar dem kortfattat, en och en. Utöver tekniken analyserar jag även dagens marknad, teknikernas...

  16. Speciation and mobility of volatile heavy metals (Cd, Pb, and Tl) in fly ashes.

    Science.gov (United States)

    Świetlik, Ryszard; Trojanowska, Marzena; Karbowska, Bożena; Zembrzuski, Włodzimierz

    2016-11-01

    Speciation of volatile metals Cd, Pb, and Tl in fly ashes (FAs) produced from burning of hard coal in stocker-fired boilers (SFBs) was studied. Two grain fractions of fly ash collected in a multicyclone and battery cyclone of the systems of dust separation from three SFB units operating in various urban heating plants were analyzed. The characteristic feature of speciation of the three metals was a large share of labile fractions: Cd (av. 46.1 %), Pb (av. 39.8 %), and Tl (av. 21.6 %). The fraction which most clearly reflected the different chemical properties of the investigated metals was the oxidizable fraction: F(4)-Cd-0 %, F(4)-Pb-av. 10.0 %, and F(4)-Tl-av. 30.2 %. The importance of condensation of the volatile metal species on FA particles for shaping speciation of these metals was characterized using the normalized enrichment factor (NEF): Pb (2.3 ± 0.8) > Tl (1.8 ± 0.9) ≈ Cd (1.7 ± 0.6). Speciation of heavy metals may also be important economically, because the level of mobility coefficients (K Cd = 0.46, K Pb = 0.40, and K Tl = 0.22) in the case of fly ashes considerably enriched with toxic metals (Cd 4.8 ± 3.4 mg/kg, Pb 293 ± 210 mg/kg, and Tl 6.3 ± 4.5 mg/kg) may limit their utilization range.

  17. Brachial artery aneurysms following brachio-cephalic AV fistula ligation.

    Science.gov (United States)

    Khalid, Usman; Parkinson, Frances; Mohiuddin, Kamran; Davies, Paula; Woolgar, Justin

    2014-01-01

    Peripheral artery aneurysms proximal to a long-standing arteriovenous (AV) fistula can be a serious complication. It is important to be aware of this and manage it appropriately. Vascular access nurses input all data regarding patients undergoing dialysis access procedures into a securely held database prospectively. This was retrospectively reviewed to identify cases of brachial artery aneurysms over the last 3 years. In Morriston Hospital, around 200 forearm and arm AV fistulas are performed annually for vascular access in renal dialysis patients. Of these, approximately 15 (7.5%) are ligated. Three patients who had developed brachial artery aneurysms following AV fistula ligation were identified. All 3 patients had developed brachial artery aneurysms following ligation of a long-standing brachio-cephalic AV fistula. Two patients presented with pain and a pulsatile mass in the arm, and one presented with pins and needles and discoloration of fingertips. Two were managed with resection of the aneurysm and reconstruction with a reversed long saphenous vein interposition graft, the third simply required ligation of a feeding arterial branch. True aneurysm formation proximal to an AV fistula that has been ligated is a rare complication. There are several reasons for why these aneurysms develop in such patients, the most plausible one being the increase in blood flow and resistance following ligation of the AV fistula. Of note, all the patients in this study were on immunosuppressive therapy following successful renal transplantation. Vigilance by the vascular access team and nephrologists is paramount to identify those patients who may warrant further evaluation and investigation by the vascular surgeon.

  18. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  19. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_3_ORF2 E26799A422BE33BE PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) NA ? IPR015500 unintegrated ...

  20. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  1. Selenium Uptake and Volatilization by Marine Algae

    Science.gov (United States)

    Luxem, Katja E.; Vriens, Bas; Wagner, Bettina; Behra, Renata; Winkel, Lenny H. E.

    2015-04-01

    Selenium (Se) is an essential trace nutrient for humans. An estimated one half to one billion people worldwide suffer from Se deficiency, which is due to low concentrations and bioavailability of Se in soils where crops are grown. It has been hypothesized that more than half of the atmospheric Se deposition to soils is derived from the marine system, where microorganisms methylate and volatilize Se. Based on model results from the late 1980s, the atmospheric flux of these biogenic volatile Se compounds is around 9 Gt/year, with two thirds coming from the marine biosphere. Algae, fungi, and bacteria are known to methylate Se. Although algal Se uptake, metabolism, and methylation influence the speciation and bioavailability of Se in the oceans, these processes have not been quantified under environmentally relevant conditions and are likely to differ among organisms. Therefore, we are investigating the uptake and methylation of the two main inorganic Se species (selenate and selenite) by three globally relevant microalgae: Phaeocystis globosa, the coccolithophorid Emiliania huxleyi, and the diatom Thalassiosira oceanica. Selenium uptake and methylation were quantified in a batch experiment, where parallel gas-tight microcosms in a climate chamber were coupled to a gas-trapping system. For E. huxleyi, selenite uptake was strongly dependent on aqueous phosphate concentrations, which agrees with prior evidence that selenite uptake by phosphate transporters is a significant Se source for marine algae. Selenate uptake was much lower than selenite uptake. The most important volatile Se compounds produced were dimethyl selenide, dimethyl diselenide, and dimethyl selenyl sulfide. Production rates of volatile Se species were larger with increasing intracellular Se concentration and in the decline phase of the alga. Similar experiments are being carried out with P. globosa and T. oceanica. Our results indicate that marine algae are important for the global cycling of Se

  2. Modellering og dimensjonering av kaianlegg etter Eurokode 2

    OpenAIRE

    Lilleaker, Tore; Tvervåg, Henrik

    2010-01-01

    Dette er sluttrapporten for masteroppgaven på en kaikonstruksjon utført ved NTNU, institutt for konstruksjonsteknikk. Det er i oppgaven gjennomført en prosjektering og dimensjonering av en betongkai etter NS-EN 1992-1-1. Det er også gjennomført et litteraturstudie med en tilhørende teoridel om bestandighet for betongkonstruksjoner i et marint miljø, samt at det er gjennomført en sannsynlighetsbasert bestandighetsanalyse av denne konstruksjonen. Avslutningsvis er det drøftet litt rundt teori, ...

  3. EST Table: AV403981 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available terminase large subunit (DNA packaging protein A) from bacteriophage origin [Escherichia coli UMN026] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403981 pg-- ... ...AV403981 pg--0297 11/12/09 n.h 10/09/28 100 %/265 aa ref|YP_002411376.1| terminase large subunit (DNA packag...ing protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1|

  4. Modellering av nedslagsfeltet- Veumdalen i Fredrikstad med programmet SWMM

    OpenAIRE

    2015-01-01

    Fredrikstad kommune har hatt store prosjekter pågang i de siste årene i forbindelse med opprustning av ledningsnettet. Oppfylte kjellere har vært en viktig tema for kommunen, og de har en intensjon om å redusere faren for oversvømmelser i utsatte steder. En av de utsatte stedene i Fredrikstad er Veumdalen som har problemer med oversvømmelser nesten hvert år. Som en forebyggende tiltak har kommunen i samarbeid med COWI bygget en tunnel fra Veumveien/Veumbekken til Seutelva. Det ...

  5. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  6. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  7. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  8. EST Table: AV399757 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399757 NV120719 11/12/09 n.h 10/09/28 83 %/234 aa ref|NP_047435.1| AcMNPV orf30 [...Bombyx mori NPV] gb|AAC63704.1| AcMNPV orf30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399757 NV12 ...

  9. Prosjektering og analyse av Nordøyvegen bru 3

    OpenAIRE

    Lauknes, Andreas; Arild, Audun

    2016-01-01

    Rapporten tar for seg prosjektering av en etteroppspent betongbru, der beregninger og dimensjoneringen er i henhold til det Europeiske regelverket, nasjonale tillegg og Håndbøker fra Statens vegvesen. Brua som skal dimensjoneres og bli gjort kapasitetskontroll for er Nordøyvegen bru 3, som skal bygges som en del av et større fastlandsprosjekt for nordøyene i Haram kommune. Brua skal bygges som en bjelke-/platebru, og konstruksjonsmetoden er fritt frambygg med totalt syv byggefaser. Den består...

  10. Fysisk aktivitet inom rehabiliteringen av anorexi : - En systematisk litteraturstudie

    OpenAIRE

    Högnäs, Maria

    2011-01-01

    Studiens syfte var att undersöka hur fysisk aktivitet påverkar unga flickor (12-24 år) med anorexi, i samband med rehabilitering. Skribenten vill dessutom ytterligare få specificerat vilken typ av fysisk aktivitet som kan vara lämplig för denna målgrupp. Frågeställningarna besvaras genom en systematisk litteraturstudie. Genom databassökning och frisökning hittades 14 relevanta artiklar som genomgick en kvalitetsgranskning, enligt en modifierad metod för kvalitetsgranskning av Forsberg & Wengs...

  11. Norsk passivhusstandard og Passivhauskonzept: en sammenlignende analyse av krav og kriterier

    DEFF Research Database (Denmark)

    Anton, Karin; Vestergaard, Inge

    kriterier som omfattes av passivhuskonseptet med tilhørende sertifisering og kriterier i Norsk Standard 3701. Gjennom analysen ønsker vi å systematisere og sammenlikne de forskjellige kriteriene i standarden: optimalisering, kuldebroer, lufttetthet og trykktesting, utnyttelse av passiv solenergi, bruk av...

  12. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...

  13. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  14. Idiosyncratic Volatility Puzzle

    DEFF Research Database (Denmark)

    Aslanidis, Nektarios; Christiansen, Charlotte; Lambertides, Neophytos;

    from a large pool of macroeconomic and Önancial variables. Cleaning for macro-Önance e§ects reverses the puzzling negative relation between returns and idiosyncratic volatility documented previously. Portfolio analysis shows that the e§ects from macro-Önance factors are economically strong......In this paper, we scrutinize the cross-sectional relation between idiosyncratic volatility and stock returns. As a novelty, the idiosyncratic volatility is obtained by conditioning upon macro-Önance factors as well as upon traditional asset pricing factors. The macro-Önance factors are constructed...

  15. Redox Biochemistry of Hydrogen Sulfide*

    OpenAIRE

    Kabil, Omer; Banerjee, Ruma

    2010-01-01

    H2S, the most recently discovered gasotransmitter, might in fact be the evolutionary matriarch of this family, being both ancient and highly reduced. Disruption of γ-cystathionase in mice leads to cardiovascular dysfunction and marked hypertension, suggesting a key role for this enzyme in H2S production in the vasculature. However, patients with inherited deficiency in γ-cystathionase apparently do not present vascular pathology. A mitochondrial pathway disposes sulfide and couples it to oxid...

  16. Hydrogen sulfide and translational medicine

    OpenAIRE

    Guo, Wei; Cheng, Ze-yu; Zhu, Yi-Zhun

    2013-01-01

    Hydrogen sulfide (H2S) along with carbon monoxide and nitric oxide is an important signaling molecule that has undergone large numbers of fundamental investigations. H2S is involved in various physiological activities associated with the regulation of homeostasis, vascular contractility, pro- and anti-inflammatory activities, as well as pro- and anti-apoptotic activities etc. However, the actions of H2S are influenced by its concentration, reaction time, and cell/disease types. Therefore, H2S...

  17. A study of the trace sulfide mineral assemblages in the Stillwater Complex, Montana, USA

    Science.gov (United States)

    Aird, Hannah M.; Ferguson, Katherine M.; Lehrer, Malia L.; Boudreau, Alan E.

    2017-03-01

    The sulfide assemblages of the Stillwater Complex away from the well-studied ore zones are composed mainly of variable proportions of pyrrhotite, chalcopyrite, pentlandite, and ±pyrite. Excluding vein assemblages and those affected by greenschist and lower temperature alteration, the majority can be classified into two broad assemblages, defined here as pristine (multiphase, often globular in shape) or volatile-bearing (multiphase, high-temperature, volatile-rich minerals such as biotite, hornblende, or an unmixed calcite-dolomite assemblage). The volatile-bearing assemblages are mainly found within and below the J-M reef, where native copper and sphalerite are also locally present. Pristine sulfides are found throughout the stratigraphy. Both groups can be affected by apparent S loss in the form of pyrite being converted to magnetite and chalcopyrite to a Cu-Fe-oxide (delafossite), with little to no silicate alteration. An upward trend from pentlandite-rich to pyrrhotite-rich to pyrite-rich assemblages is observed in the footwall rocks in upper GN-I, and the same trend repeats from just below the reef and continues into the overlying N-II and GN-II. Modeling suggests that the sulfide Ni in the Peridotite Zone is largely controlled by silicate Ni. When taken together, observations are most readily explained by the remobilization of selected elements by a high-temperature fluid with the apparent loss of S > Cu > Ni. This could concentrate ore metals by vapor refining, eventually producing a platinum group element-enriched sulfide ore zone, such as the J-M reef.

  18. A study of the trace sulfide mineral assemblages in the Stillwater Complex, Montana, USA

    Science.gov (United States)

    Aird, Hannah M.; Ferguson, Katherine M.; Lehrer, Malia L.; Boudreau, Alan E.

    2016-07-01

    The sulfide assemblages of the Stillwater Complex away from the well-studied ore zones are composed mainly of variable proportions of pyrrhotite, chalcopyrite, pentlandite, and ±pyrite. Excluding vein assemblages and those affected by greenschist and lower temperature alteration, the majority can be classified into two broad assemblages, defined here as pristine (multiphase, often globular in shape) or volatile-bearing (multiphase, high-temperature, volatile-rich minerals such as biotite, hornblende, or an unmixed calcite-dolomite assemblage). The volatile-bearing assemblages are mainly found within and below the J-M reef, where native copper and sphalerite are also locally present. Pristine sulfides are found throughout the stratigraphy. Both groups can be affected by apparent S loss in the form of pyrite being converted to magnetite and chalcopyrite to a Cu-Fe-oxide (delafossite), with little to no silicate alteration. An upward trend from pentlandite-rich to pyrrhotite-rich to pyrite-rich assemblages is observed in the footwall rocks in upper GN-I, and the same trend repeats from just below the reef and continues into the overlying N-II and GN-II. Modeling suggests that the sulfide Ni in the Peridotite Zone is largely controlled by silicate Ni. When taken together, observations are most readily explained by the remobilization of selected elements by a high-temperature fluid with the apparent loss of S > Cu > Ni. This could concentrate ore metals by vapor refining, eventually producing a platinum group element-enriched sulfide ore zone, such as the J-M reef.

  19. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  20. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  1. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  2. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  3. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  4. EST Table: AV405806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405806 wdV30260 10/09/28 65 %/199 aa ref|NP_001119709.1| transformer 2 isoform E ...[Bombyx mori] gb|AAX47003.1| transformer-2 protein E [Bombyx mori] 10/08/28 low homology 10/08/27 low homolo

  5. EST Table: AV400604 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400604 br--1517 10/09/28 48 %/208 aa ref|XP_001863389.1| wolfram syndrome 1 [Cule...x quinquefasciatus] gb|EDS38516.1| wolfram syndrome 1 [Culex quinquefasciatus] 10/08/28 50 %/173 aa FBpp0291

  6. EST Table: AV398407 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398407 NV021774 10/09/28 100 %/186 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...507-PA 10/09/10 48 %/236 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  7. EST Table: AV398495 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398495 NV021874 10/09/28 91 %/209 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 54 %/213 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  8. EST Table: AV401468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401468 e96h0771 10/09/28 87 %/171 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 55 %/166 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 e96h ...

  9. EST Table: AV403752 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

  10. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  11. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  12. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  13. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  14. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  15. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  16. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  17. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  18. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  19. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  20. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  1. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  2. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  3. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  4. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  5. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  6. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  7. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  8. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  9. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  10. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  11. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  12. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  13. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  14. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  15. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  16. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  17. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  18. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  19. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  20. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  1. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  2. EST Table: AV399507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399507 NV120319 10/09/28 70 %/144 aa ref|YP_803401.1| baculovirus repeated ORF-b [Anticars...ia gemmatalis nucleopolyhedrovirus] gb|ABI13791.1| baculovirus repeated ORF-b [Anticarsia gemmatali

  3. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  4. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  5. EST Table: AV403894 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ref|XP_001605691.1| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Nasonia vitripennis] 10/08/28 52...%/206 aa gi|189241712|ref|XP_968082.2| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Tribolium castaneum] AV403894 pg-- ...

  6. Centralized Library Services for Audiovisual Media. AV in Action 4.

    Science.gov (United States)

    Nederlands Bibliotheek en Lektuur Centrum, The Hague (Netherlands).

    Designed to provide assistance to countries in developing centralized services to their libraries for nonbook materials, this pamphlet contains examples from five countries that have succeeded in establishing such services. Those examples include: (1) "The Central Library Service for AV-Materials in Denmark" (Suzanne Hemmeth…

  7. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  8. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  9. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something about...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  10. EST Table: AV398194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398194 NV021231 10/09/28 38 %/170 aa ref|NP_724426.2| vulcan, isoform D [Drosophi...la melanogaster] gb|AAM68355.2| vulcan, isoform D [Drosophila melanogaster] 10/08/28 38 %/170 aa FBpp0289730

  11. EST Table: AV406060 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406060 wdV30561X 10/09/28 99 %/122 aa gb|ACN86367.1| troponin T transcript varian...006588#locus:tnt- 3#status:Partially_confirmed#UniProt:B9WRS6#protein_id:AC M46022.1 10/09/10 81 %/122 aa AG

  12. EST Table: AV405690 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405690 wdV30118 10/09/28 93 %/225 aa ref|NP_001040124.1| exuperantia [Bombyx mori] gb|ABD36117.1| exuperan...9360-PA 10/09/10 53 %/220 aa gi|91085815|ref|XP_974770.1| PREDICTED: similar to exuperantia [Tribolium castaneum] FS919769 wdV3 ...

  13. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  14. EST Table: AV401871 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401871 heS00267 11/12/09 GO hit GO:0046872(metal ion binding) 10/09/28 65 %/194 aa gb|ACR61720.1| triglyce...ride lipase [Manduca sexta] 10/08/28 48 %/206 aa FBpp0147001|DgriGH13095-PA 10/08/2

  15. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  16. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  17. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  18. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  19. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  20. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  1. EST Table: AV405516 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405516 wdV10864 10/09/28 33 %/180 aa ref|XP_969213.1| PREDICTED: similar to artemis...0768|ref|XP_969213.1| PREDICTED: similar to artemis protein [Tribolium castaneum] FS920671 wdV1 ...

  2. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  3. Forskerskoler som modeller for forskerutdanning: Progresjon og utvikling av ekspertise

    Directory of Open Access Journals (Sweden)

    Sten Ludvigsen

    2013-12-01

    Full Text Available I de senere årene har forskerskoler blitt fremhevet som en mulig løsning på ulike utfordringer innenfor forskerutdanningen. På bakgrunn av erfaringer med to forskerskoler innenfor utdanningsvitenskap, vil vi i denne artikkelen belyse to problemstillinger: Hvordan kan man organisere læringsforløpet til ph.d.-kandidatene slik at det støtter deres progresjon? Og hva må forskerutdanningen inneholde for at ph.d.-kandidatene skal utvikle tilstrekkelig ekspertise innenfor et avgrenset kunnskapsområde?For å skape progresjon, bør utdanningsprogrammet bidra til å gi struktur og angi faglig retning. Videre må utdanningselementene være relevante for avhandlingsarbeidet. I tillegg kan progresjon fremmes gjennom seminarer, der utviklingen av tekster og artikler følges opp. Argumentet om at forskerskoler bør bygge på gode forskningsmiljøer har stått sentralt i utredningen av ulike modeller for forskerutdanning i Norge. Ett aspekt som har fått økende oppmerksomhet er betydningen av å oppnå en tilstrekkelig grad av spesialisering. Uten utvikling av en slik ekspertise, vil ph.d.-kandidatene ikke kunne publisere internasjonalt og delta i forskningsfellesskap.Ved Det utdanningsvitenskapelige fakultet har man de siste 10 årene utviklet flere typer forskerskoler. I denne artikkelen tar vi utgangspunkt i den UiO-finansierte, tematisk avgrensede forskerskolen «Læring, kommunikasjon og IKT» (2004–2008 og den NFR-finansierte nasjonale forskerskolen i utdanningsvitenskap, NATED (2008–2016, hvor ph.d.-kandidatene deltar i faglige aktiviteter organisert i fire spor.Metodene som brukes for å besvare problemstillingene omfatter intervjuer, spørreskjema og refleksjoner vedrørende de to ulike forskerskolene.Resultatene viser at man kan oppnå nødvendig spesialisering, høy kvalitet, høy tilfredshet og høy relevans ved bruk av forskerskoler som virkemiddel i forskerutdanningen. Begge forskerskolene har tilrettelagt for internasjonal

  4. On guidance and volatility

    NARCIS (Netherlands)

    Billings, M.B.; Jennings, R.; Lev, B.

    2013-01-01

    Survey evidence suggests that managers voluntarily disclose information, particularly earnings guidance, with an aim toward dampening share price volatility. Yet, consultants and influential institutions advise against providing guidance — citing fears of litigation and market penalties associated w

  5. Dynamic Volatility Arbitrage

    DEFF Research Database (Denmark)

    Dorn, Jochen

    profit on well-developed markets. Dynamic participation features on cross asset portfolios are at rst sight a remedy to that dilemma. Based on volatility thresholds and portfolio re-balancing, the fund engineers try to create a "volatility guaranteed" investment opportunity by surfing on the unusual high...... concepts, next to nothing is known about position reverting strategies and how, and -even more important- in which context they are applied in practice. In the recent market downturn only one sector generated signicant profits for the leading investment banks: Volatility trading activities, namely on Forex......, interest rates and commodities. If an investor positions himself on the (volatility) market within a long/short trading framework, he typically bets on a traditional mispricing arbitrage. However as this corresponds to a call spread with equal exercise prices, this strategy alone would not generate enough...

  6. It’s all about volatility of volatility

    DEFF Research Database (Denmark)

    Grassi, Stefano; Santucci de Magistris, Paolo

    2015-01-01

    for the realized volatility series. It emerges that during the recent financial crisis the relative weight of the daily component dominates over the monthly term. The estimates of the two factor stochastic volatility model suggest that the change in the dynamic structure of the realized volatility during...... the financial crisis is due to the increase in the volatility of the persistent volatility term. A set of Monte Carlo simulations highlights the robustness of the methodology adopted in tracking the dynamics of the parameters....

  7. Minimizing ventricular pacing by a novel atrioventricular (AV) delay hysteresis algorithm in patients with intact or compromised intrinsic AV conduction and different atrial and ventricular lead locations.

    Science.gov (United States)

    Pakarinen, Sami; Toivonen, Lauri

    2013-09-01

    To investigate if an advanced AV search hysteresis (AVSH) algorithm, Ventricular Intrinsic Preference (VIP(™)), reduces the incidence of ventricular pacing (VP) in sinus node dysfunction (SND) with both intact and compromised AV conduction and with intermittent AV block regardless of the lead positions in the right atria and the ventricle. Patients were classified as having intact AV (AVi) conduction if the PR interval was ≤ 210 ms on ECG and 1:1 AV conduction during atrial pacing up to 120 bpm with PR interval ≤ 350 ms. Otherwise the AV conduction was classified as compromised (AVc). Both AVi and AVc patients were randomized to VIP ON or OFF. VIP performed an intrinsic AV conduction search every 30 s for three consecutive atrial cycles with the extension of the sensed and paced AV (SAV/PAV) delays from basic values of 150/200 ms to 300/350 ms. Extended AV intervals were allowed for three cycles when VP occurred before returning to basic AV delays. The primary end-point was %VP at 12 months. Among 389 patients, 30.1% had intact and 69.9% had compromised AV conduction. The mean %VP at 12 months was 9.6% by VIP compared to 51.8% with standard AV settings in patients with AVi (P < 0.0001) and 28.0% versus 78.9% (P < 0.0001) with AVc. With VIP, excessive %VP among most used lead positions was not seen. Conversely, when VIP was off %VP was low only in patients who had leads in the RA septal-RV septal position (23.0%). VIP feature reduces VP both in patients with SND and with intermittent heart block regardless of the lead positions in the right atria and the ventricle.

  8. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  9. Fra strømfordeling til pengestrøm? : Statnett fra forvaltningsbedrift til statsforetak : en konsekvensanalyse av omorganiseringen av Statnett seks år etter

    OpenAIRE

    Knudsen, Halvor Gillund

    1998-01-01

    Fra strømfordeling til pengestrøm? Statnett fra forvaltningsbedrift til statsforetak en konsekvensanalyse av omorganiseringen av Statnett seks år etter. Tema for oppgaven er konsekvenser av endrete tilknytningsformer i staten. Temaet er kommet frem gjennom tilknytning til et samarbeidsprosjekt mellom Universitetet i Oslo ved Vitenskapsbutikken og Arbeids- og administrasjonsdepartementet. Årsaken til at man ønsker å se på slike forhold er den stadige kritikken mot en etter sigende alt for...

  10. Non-volatile memories

    CERN Document Server

    Lacaze, Pierre-Camille

    2014-01-01

    Written for scientists, researchers, and engineers, Non-volatile Memories describes the recent research and implementations in relation to the design of a new generation of non-volatile electronic memories. The objective is to replace existing memories (DRAM, SRAM, EEPROM, Flash, etc.) with a universal memory model likely to reach better performances than the current types of memory: extremely high commutation speeds, high implantation densities and retention time of information of about ten years.

  11. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  12. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  13. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  14. Sulfide intrusion and detoxification in seagrasses ecosystems

    DEFF Research Database (Denmark)

    Hasler-Sheetal, Harald; Holmer, Marianne

    strategies of seagrasses to sustain sulfide intrusion. Using stable isotope tracing, scanning electron microscopy with x-ray analysis, tracing sulfur compounds combined with ecosystem parameters we found different spatial, intraspecific and interspecific strategies to cope with sulfidic sediments. 1......) Tolerance, by elimination (eg. Zostera marina); where we found precipitation of sulfide as non-toxic elemental sulfur on the inner wall of the root lacunae. 2) Utilization (eg. Z. marina), where seagrasses detoxify and incorporate sulfides by active uptake and metabolize to sulfate, representing a non...

  15. Forbuden frukt smaker best en studie av nordmenns spise- og drikkemønster av sjokolade, søtsaker, salt snacks, sukkerholdige leskedrikker og lignende

    OpenAIRE

    Bugge, Annechen Bahr

    2010-01-01

    Denne studien er en del av forskningsprosjektene Young Food og HealthMeal. Begge prosjektene er finansiert av Norges forskningsråd. Temaet i rapporten er nordmenns spise- og drikkemønster av en type mat og drikke som helsemyndighetene ønsker at befolkningen skal redusere forbruket sitt av – slik som sjokolade, søtsaker, søte bakervarer, salt snacks og sukkerholdige drikker. Selv om forbruksutviklingen de seneste par årene har vist positive tendenser, har altså nordmenn fremdeles et langt høye...

  16. En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap

    OpenAIRE

    2014-01-01

    Abstrakt Utvecklingsarbetet ”En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap”, är en fortsättning på examensarbetet ”Abort - En systematisk översikt av kvinnornas upplevelser och av vårdpersonalens betydelse” som publicerades och presenterades våren 2013. Syftet med utvecklingsarbetet är att producera en handlingsmodell för hälsovårdspersonalen. Handlingsmodellen kommer att ge råd och tips på hur man som hälsovårdspe...

  17. Corn or sorghum wet distiller's grains with solubles in combination with steam-flaked corn: In vitro fermentation and hydrogen sulfide production

    Science.gov (United States)

    The effects of wet distiller's grains with solubles (WDG) on in vitro rate of gas production, in vitro dry matter disappearance (IVDMD), hydrogen sulfide (H2S) production, and volatile fatty acids (VFA) were evaluated. Five substrate treatments that were balanced for ether extract content were arran...

  18. Cloning and characterization of a novel apolipoprotein gene, apolipoprotein AV, in tree shrews.

    Science.gov (United States)

    Li, Guoping; Luo, Huairong; Sun, Guotao; Wu, Guisheng; Wu, Gang; Wang, Yan; Man, Yong; Wang, Shu; Li, Jian; Chen, Baosheng

    2013-09-01

    Apolipoprotein AV (apoAV) modulates plasma triglyceride levels, which is an independent risk factor for cardiovascular disease. ApoAV is also involved in atherosclerosis lesion formation. In order to systematically evaluate the apolipoprotein-related gene profile in tree shrew, a model for its insusceptibility to atherosclerosis, we performed apoAV cloning and characterization. The full-length cDNA of apoAV was identified using SMART-RACE. ApoAV cDNA sequence revealed two transcripts, 1,948 and 1,397 base pairs, due to alternative polyadenylation. These two transcripts share the same open reading frame (ORF), which encodes a 369-amino acid protein with high identity to human apoAV (75 %), including a 23-amino acid N-terminal signal peptide. ApoAV is expressed exclusively in the liver. Mature apoAV was expressed in E. coli BL21(DE3) and purified by Ni-chelated resin. Lipoprotein lipase activity was significantly stimulated by this recombinant protein. The full-length ORF of apoAV was cloned into pDsRed-monomer-N1 vector with a red fluorescent protein tag and was primarily localized in cytoplasm of hepG2 cells. The successful cloning, expression and localization of apoAV in tree shrew has laid down the foundation for further investigation on its structure and functions.

  19. Viktigheten av fysisk aktivitet og trening blant eldre

    Directory of Open Access Journals (Sweden)

    Hilde Lohne-Seiler

    2012-11-01

    Full Text Available Regelmessig fysisk aktivitet er viktig for eldres helse. Sammenhengen mellom en fysisk aktiv livsstil og helsegevinster som forebygging av sykdom, opprettholdelse av uavhengighet og økt livskvalitet er godt dokumentert (ACSM's Position Stand 1998; Spirduso & Cronin, 2001; Taylor et al., 2004. Hensikten med denne oversiktsartikkelen er derfor å redegjøre for viktigheten av regelmessig fysisk aktivitet og trening i aldringsprosessen, samt utdype sammenhengen mellom en fysisk aktiv livsstil og fysisk funksjon blant eldre. Basert på en nasjonal multisenterstudie (Anderssen et al., 2009, tilfredsstilte 20% voksne og eldre (20-85 år de nasjonale anbefalinger om 30 minutter med daglig fysisk aktivitet. Kun 12% i den eldste aldersgruppen (80-85 år tilfredsstilte anbefalingene. Totalt fysisk aktivitetsnivå, målt ved hjelp av akselerometer, ble redusert med økende alder, hvor de eldste (80-85 år hadde 50% lavere aktivitetsnivå sammenlignet med de yngste (65-69 år (Lohne-Seiler et al., 2012. Fra 25-års alder reduseres utholdenhet og muskelstyrke med 10% per 10 år dersom individet er inaktiv (Heath et al., 1981; Wilmore, 1991. Systematisk utholdenhets- og styrketrening ser derimot ut til å redusere tapet med inntil halvparten, det vil si en reduksjon tilsvarende 5% per 10 år hos fysisk aktive individer (Heath et al., 1981. Eldre individer ser ut til å ha de samme treningsinduserte effekter som yngre, det vil si at man får effekt av økt aktivitet uansett alder, og da også lik prosentvis fremgang (Hagberg et al., 1989. Studier har vist at det er mulig å øke maksimalt oksygenopptak og maksimal muskelstyrke med inntil 10-20% i løpet av en 12 ukers intervensjon (Hagberg et al., 1989; Reeves et al., 2003; Lohne-Seiler et al, in press. Da muskelstyrke ser ut til å ha en sterk sammenheng med individets funksjonsevne/mobilitet, er det viktig å kunne tilrettelegge for systematisk styrketrening for eldre for på den måten å oppnå

  20. Oil and stock market volatility: A multivariate stochastic volatility perspective

    Energy Technology Data Exchange (ETDEWEB)

    Vo, Minh, E-mail: minh.vo@metrostate.edu

    2011-09-15

    This paper models the volatility of stock and oil futures markets using the multivariate stochastic volatility structure in an attempt to extract information intertwined in both markets for risk prediction. It offers four major findings. First, the stock and oil futures prices are inter-related. Their correlation follows a time-varying dynamic process and tends to increase when the markets are more volatile. Second, conditioned on the past information, the volatility in each market is very persistent, i.e., it varies in a predictable manner. Third, there is inter-market dependence in volatility. Innovations that hit either market can affect the volatility in the other market. In other words, conditioned on the persistence and the past volatility in their respective markets, the past volatility of the stock (oil futures) market also has predictive power over the future volatility of the oil futures (stock) market. Finally, the model produces more accurate Value-at-Risk estimates than other benchmarks commonly used in the financial industry. - Research Highlights: > This paper models the volatility of stock and oil futures markets using the multivariate stochastic volatility model. > The correlation between the two markets follows a time-varying dynamic process which tends to increase when the markets are more volatile. > The volatility in each market is very persistent. > Innovations that hit either market can affect the volatility in the other market. > The model produces more accurate Value-at-Risk estimates than other benchmarks commonly used in the financial industry.

  1. Microbial- and Thiosulfate-Mediated Dissolution of Mercury Sulfide Minerals and Transformation to Gaseous Mercury

    Directory of Open Access Journals (Sweden)

    Adiari eVázquez-Rodríguez

    2015-06-01

    Full Text Available Mercury (Hg is a toxic heavy metal that poses significant human and environmental health risks. Soils and sediments, where Hg can exist as the Hg sulfide mineral metacinnabar (β-HgS, represent major Hg reservoirs in aquatic environments. Metacinnabar has historically been considered a sink for Hg in all but severely acidic environments, and thus disregarded as a potential source of Hg back to aqueous or gaseous pools. Here, we conducted a combination of field and laboratory incubations to identify the potential for metacinnabar as a source of dissolved Hg within near neutral pH environments and the underpinning (abiotic mechanisms at play. We show that the abundant and widespread sulfur-oxidizing bacterium Thiobacillus extensively colonized metacinnabar chips incubated within aerobic, near neutral pH creek sediments. Laboratory incubations of axenic Thiobacillus cultures lead to the release of metacinnabar-hosted Hg(II and subsequent volatilization to Hg(0. This dissolution and volatilization was greatly enhanced in the presence of the sulfur intermediate, thiosulfate, which served a dual role by enhancing HgS dissolution and providing an additional metabolic substrate for Thiobacillus. These findings reveal a new coupled abiotic-biotic pathway for the transformation of metacinnabar-bound Hg(II to Hg(0, while expanding the sulfide substrates available for neutrophilic chemosynthetic bacteria to Hg-laden sulfides. They also point to mineral-hosted Hg as an underappreciated source of gaseous elemental Hg to the environment.

  2. Hydrogen sulfide and vascular relaxation

    Institute of Scientific and Technical Information of China (English)

    SUN Yan; TANG Chao-shu; DU Jun-bao; JIN Hong-fang

    2011-01-01

    Objective To review the vasorelaxant effects of hydrogen sulfide (H2S) in arterial rings in the cardiovascular system under both physiological and pathophysiological conditions and the possible mechanisms involved.Data sources The data in this review were obtained from Medline and Pubmed sources from 1997 to 2011 using the search terms "hydrogen sulfide" and ""vascular relaxation".Study selection Articles describing the role of hydrogen sulfide in the regulation of vascular activity and its vasorelaxant effects were selected.Results H2S plays an important role in the regulation of cardiovascular tone.The vasomodulatory effects of H2S depend on factors including concentration,species and tissue type.The H2S donor,sodium hydrosulfide (NarS),causes vasorelaxation of rat isolated aortic rings in a dose-dependent manner.This effect was more pronounced than that observed in pulmonary arterial rings.The expression of KATP channel proteins and mRNA in the aortic rings was increased compared with pulmonary artery rings.H2S is involved in the pathogenesis of a variety of cardiovascular diseases.Downregulation of the endogenous H2S pathway is an important factor in the pathogenesis of cardiovascular diseases.The vasorelaxant effects of H2S have been shown to be mediated by activation of KATP channels in vascular smooth muscle cells and via the induction of acidification due to activation of the CI/HCO3 exchanger.It is speculated that the mechanisms underlying the vasoconstrictive function of H2S in the aortic rings involves decreased NO production and inhibition of cAMP accumulation.Conclusion H2S is an important endogenous gasotransmitter in the cardiovascular system and acts as a modulator of vascular tone in the homeostatic regulation of blood pressure.

  3. The effect of Yucca schidigera extract on canine and feline faecal volatiles occurring concurrently with faecal aroma amelioration.

    Science.gov (United States)

    Lowe, J A; Kershaw, S J; Taylor, A J; Linforth, R S

    1997-01-01

    Addition of Yucca schidigera extract (YSE) products to canine or feline diets improved faecal aroma as monitored by a human panel. Odour port-gas chromatography (GC) indicated different odour component types in dog faecal volatiles and, in particular, 'faecal'-type odours due to methyl sulfides. GC-mass spectrometry demonstrated several chemical compound classes present in faecal volatiles and quantitation in the cat indicated apparently significant changes in the concentrations of several compounds on YSE treatment, although these were not necessarily aroma components. The potential for direct YSE alteration of aroma perception in a mixture of volatiles, possibly by binding, was demonstrated.

  4. Kartlegging av læreres kunnskap er ikke enkelt

    Directory of Open Access Journals (Sweden)

    Reidar Mosvold

    2015-05-01

    Full Text Available Læreres kunnskap har betydning for elevenes læring, og som et ledd i prosessen for styrking av kvaliteten i norsk skole har politikere i senere tid ytret ønske om å kartlegge læreres kunnskap. Kartlegging av læreres kunnskap er imidlertid ikke enkelt, og i denne artikkelen undersøker vi hvordan de samme lærernes undervisningskunnskap i matematikk kan se ut til å være forskjellig når den måles ved hjelp av oppgaver med ulikt format. Deltakerne i studien var 30 praktiserende lærere, og instrumentet besto av 28 flervalgsoppgaver med tilhørende åpne oppgaver. Sammenhengen mellom lærernes kunnskap slik den måles ved hjelp av flervalgsoppgavene og de åpne oppgavene er ikke alltid klar. Det er derfor nødvendig å tilnærme seg måling av læreres undervisnings-kunnskap i matematikk med stor varsomhet. Nærmere undersøkelser er nødvendig for å finne ut hva slags type kunnskap som kan måles med ulike typer oppgaver og hva slags måleinstrumenter som kan brukes til hvilke formål.Nøkkelord: Undervisningskunnskap i matematikk, kartlegging, måleinstrument-er, flervalgsoppgaver AbstractTeachers’ knowledge influence students’ learning, and as part of their attempts to increase the quality of Norwegian schools, politicians have announced their intentions to measure the knowledge of teachers. Measuring teacher knowledge is not straightforward, however, and this article investigates how a group of mathematics teachers’ knowledge might appear different when measured by items of different formats. The participants in this study were 30 in-service teachers, and the instrument consisted of 28 multiple-choice items with associated open-response items. The connection between the teachers’ know-ledge as measured by multiple-choice items and open-response items is not always straightforward. As an implication, it is necessary to approach measure-ment of teachers’ mathematical knowledge for teaching with great care. Further studies are

  5. Molybdenum sulfide/carbide catalysts

    Science.gov (United States)

    Alonso, Gabriel; Chianelli, Russell R.; Fuentes, Sergio; Torres, Brenda

    2007-05-29

    The present invention provides methods of synthesizing molybdenum disulfide (MoS.sub.2) and carbon-containing molybdenum disulfide (MoS.sub.2-xC.sub.x) catalysts that exhibit improved catalytic activity for hydrotreating reactions involving hydrodesulfurization, hydrodenitrogenation, and hydrogenation. The present invention also concerns the resulting catalysts. Furthermore, the invention concerns the promotion of these catalysts with Co, Ni, Fe, and/or Ru sulfides to create catalysts with greater activity, for hydrotreating reactions, than conventional catalysts such as cobalt molybdate on alumina support.

  6. Medical Functions of Hydrogen Sulfide.

    Science.gov (United States)

    Olas, Beata

    2016-01-01

    Hydrogen sulfide (H(2)S) is a gasomediator synthesized from L- and D-cysteine in various tissues. It is involved in a number of physiological and pathological processes. H(2)S exhibits antiatherosclerotic, vasodilator, and proangiogenic properties, and protects the kidney and heart from damage following ischemia/reperfusion injury. H(2)S donors may be natural or synthetic, and may be used for the safe treatment of a wide range of diseases. This review article summarizes the current state of knowledge of the therapeutic function of H(2)S.

  7. Avsluttende studentevaluering i Bachelorutdanningen : avgangsstudenters vurdering av undervisning og utdanning ved Politihøgskolen, Kull 05–08

    OpenAIRE

    Hove, Kjersti

    2010-01-01

    Denne rapporten inneholder en oppsummering og enkle analyser av studenters evaluering av utdanningen ved slutten av studiet. Evalueringen bygger delvis på spørsmål hentet fra StudData, og en tilsvarende rapport fra HiO ( Hatlevik, Ida Katrine Riksaasen: Avgangsstudenten – Studentenes vurdering av undervisning, praksis, studieforhold, tilegnet kompetanse, studieatferd og fremtidig utdanning. HiO-notat nr 2 -2009) hvor analyser av flere studentgruppers evalueringer er sammenstilt. Rapporten fra...

  8. Ammonia and hydrogen sulfide removal using biochar

    Science.gov (United States)

    Reducing ammonia and hydrogen sulfide emissions from livestock facilities is an important issue for many communities and livestock producers. Ammonia has been regarded as odorous, precursor for particulate matter (PM), and contributed to livestock mortality. Hydrogen sulfide is highly toxic at elev...

  9. Micro and nano sulfide solid lubrication

    CERN Document Server

    Wang, Haidou; Liu, Jiajun

    2014-01-01

    Sulfide solid lubrication is a vital field of tribology with the potential to save both energy and materials. This book examines the low-temperature sulfuration technology developed in China, as well as two-step methods for preparing sulfide lubrication films.

  10. Sulfide toxicity kinetics of a uasb reactor

    Directory of Open Access Journals (Sweden)

    D. R. Paula Jr.

    2009-12-01

    Full Text Available The effect of sulfide toxicity on kinetic parameters of anaerobic organic matter removal in a UASB (up-flow anaerobic sludge blanket reactor is presented. Two lab-scale UASB reactors (10.5 L were operated continuously during 12 months. The reactors were fed with synthetic wastes prepared daily using glucose, ammonium acetate, methanol and nutrient solution. One of the reactors also received increasing concentrations of sodium sulfide. For both reactors, the flow rate of 16 L.d-1 was held constant throughout the experiment, corresponding to a hydraulic retention time of 15.6 hours. The classic model for non-competitive sulfide inhibition was applied to the experimental data for determining the overall kinetic parameter of specific substrate utilization (q and the sulfide inhibition coefficient (Ki. The application of the kinetic parameters determined allows prediction of methanogenesis inhibition and thus the adoption of operating parameters to minimize sulfide toxicity in UASB reactors.

  11. Understanding Interest Rate Volatility

    DEFF Research Database (Denmark)

    Volker, Desi

    This thesis is the result of my Ph.D. studies at the Department of Finance of the Copenhagen Business School. It consists of three essays covering topics related to the term structure of interest rates, monetary policy and interest rate volatility. The rst essay, \\Monetary Policy Uncertainty...... and Interest Rates", examines the role of monetary policy uncertainty on the term structure of interest rates. The second essay, \\A Regime-Switching A ne Term Structure Model with Stochastic Volatility" (co-authored with Sebastian Fux), investigates the ability of the class of regime switching models...... with and without stochastic volatility to capture the main stylized features of U.S. interest rates. The third essay, \\Variance Risk Premia in the Interest Rate Swap Market", investigates the time-series and cross-sectional properties of the compensation demanded for holding interest rate variance risk. The essays...

  12. Volatiles in protoplanetary disks

    CERN Document Server

    Pontoppidan, Klaus M; Bergin, Edwin A; Brittain, Sean; Marty, Bernard; Mousis, Olvier; Oberg, Karin L

    2014-01-01

    Volatiles are compounds with low sublimation temperatures, and they make up most of the condensible mass in typical planet-forming environments. They consist of relatively small, often hydrogenated, molecules based on the abundant elements carbon, nitrogen and oxygen. Volatiles are central to the process of planet formation, forming the backbone of a rich chemistry that sets the initial conditions for the formation of planetary atmospheres, and act as a solid mass reservoir catalyzing the formation of planets and planetesimals. This growth has been driven by rapid advances in observations and models of protoplanetary disks, and by a deepening understanding of the cosmochemistry of the solar system. Indeed, it is only in the past few years that representative samples of molecules have been discovered in great abundance throughout protoplanetary disks - enough to begin building a complete budget for the most abundant elements after hydrogen and helium. The spatial distributions of key volatiles are being mapped...

  13. Stochastic volatility selected readings

    CERN Document Server

    Shephard, Neil

    2005-01-01

    Neil Shephard has brought together a set of classic and central papers that have contributed to our understanding of financial volatility. They cover stocks, bonds and currencies and range from 1973 up to 2001. Shephard, a leading researcher in the field, provides a substantial introduction in which he discusses all major issues involved. General Introduction N. Shephard. Part I: Model Building. 1. A Subordinated Stochastic Process Model with Finite Variance for Speculative Prices, (P. K. Clark). 2. Financial Returns Modelled by the Product of Two Stochastic Processes: A Study of Daily Sugar Prices, 1961-7, S. J. Taylor. 3. The Behavior of Random Variables with Nonstationary Variance and the Distribution of Security Prices, B. Rosenberg. 4. The Pricing of Options on Assets with Stochastic Volatilities, J. Hull and A. White. 5. The Dynamics of Exchange Rate Volatility: A Multivariate Latent Factor ARCH Model, F. X. Diebold and M. Nerlove. 6. Multivariate Stochastic Variance Models. 7. Stochastic Autoregressive...

  14. Wirevagn : Utvecklingen av en utrullare för hisslinor

    OpenAIRE

    Rehnsfeldt, Patrik

    2014-01-01

    Kandidatexamensarbetet som utgick från en förfrågan från företaget Irongrip AB hade som mål att utveckla ett produktförslag på en utlindare av stålvajer för hissmontörer. Irongrip AB som tillverkar och säljer verktyg för hantering av stålvajer hade uppmärksammat att en efterfrågan på en sådan produkt fanns på marknaden då befintliga lösningar var bristfälliga och inte hade alla de funktioner som är önskvärda hos en sådan produkt.Arbetet inleddes med en förstudie där studiebesök vid lindragnin...

  15. EST Table: AV400562 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400562 br--1452X 10/09/28 59 %/160 aa ref|XP_001843664.1| neuroendocrine protein ...7b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 41 ...47 %/159 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  16. EST Table: AV400244 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400244 br--1010 10/09/28 53 %/100 aa ref|XP_001654557.1| neuroendocrine protein 7...b2 [Aedes aegypti] gb|EAT46754.1| neuroendocrine protein 7b2 [Aedes aegypti] 10/08/28 n.h 10/08/27 n.h 10/09/10 low homology 10/09/10 n.h 10/09/10 n.h BP115163 br-- ...

  17. EST Table: AV398380 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398380 NV021745 10/09/28 70 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV02 ...

  18. EST Table: AV399091 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399091 NV060650 10/09/28 71 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV06 ...

  19. EST Table: AV399252 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399252 NV060970 10/09/28 62 %/104 aa ref|NP_001119705.1| transformer 2 isoform A ...[Bombyx mori] gb|AAT42220.2| transformer-2 protein A [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 low homology 10/09/10 low homology NM_001126237 NV06 ...

  20. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  1. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  2. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  3. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  4. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  5. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  6. EST Table: AV398139 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398139 NV021172 10/09/28 46 %/243 aa ref|XP_001661901.1| DNA mismatch repair protein muts... [Aedes aegypti] gb|EAT36110.1| DNA mismatch repair protein muts [Aedes aegypti] 10/08/28 43 %/238 a...el|GB10970-PA 10/09/10 42 %/247 aa gi|91082687|ref|XP_971522.1| PREDICTED: similar to DNA mismatch repair protein muts [Tribolium castaneum] BY922838 NV02 ...

  7. Effekter av endringer i finansieringsansvaret for TNF-hemmere

    OpenAIRE

    Hagen, Terje P.; Bjarkum, Irina; Hobbel, Silje; Orderdalen, Karianne

    2009-01-01

    Tumor necreosis factor alfa (TNF-a) - hemmere, og andre biologiske inflammatoriske modifiserende legemidler blir brukt innen reumatologi, gastroenterologi og dermatologi. I denne rapporten analyseres effekter av endringer i finansieringssystemet for seks legemidler som faller innenfor disse legemiddelgruppene og som langt på vei er substitutter: Humira, Enbrel og Remicade som er TNF-hemmere, Raptiva og Orencia som er registrert under kategorien selektive immunsuppressiver og MabThera som er r...

  8. EST Table: AV401797 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401797 heS00172 10/09/28 94 %/235 aa ref|NP_001036831.1| saposin-related [Bombyx ...9/10 low homology 10/09/10 low homology 10/09/10 41 %/191 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 heS0 ...

  9. EST Table: AV401078 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401078 e96h0200 10/09/28 42 %/112 aa ref|XP_001648294.1| Juvenile hormone-inducib...le protein, putative [Aedes aegypti] gb|EAT44634.1| Juvenile hormone-inducible protein, putative [Aedes aegy... 10/09/10 36 %/106 aa gi|91080979|ref|XP_974925.1| PREDICTED: similar to Juvenile hormone-inducible protein, putative [Tribolium castaneum] FS808716 e96h ...

  10. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    skull". Trots stora framsteg inom medicinen finns det skäl att stanna upp och fråga: Vad håller vi på med egentligen? Redaktörerna och författarna till denna bok lyfter fram behovet av att reflektera över medicinsk praktik och att kritiskt granska de teorier som ligger till grund för vad vi gör. I boken...

  11. Pricing Volatility of Stock Returns with Volatile and Persistent Components

    DEFF Research Database (Denmark)

    Zhu, Jie

    2009-01-01

    This paper introduces a two-component volatility model based on first moments of both components to describe the dynamics of speculative return volatility. The two components capture the volatile and the persistent part of volatility, respectively. The model is applied to 10 Asia-Pacific stock...... markets. Their in-mean effects on returns are tested. The empirical results show that the persistent component is much more important for the volatility dynamic process than is the volatile component. However, the volatile component is found to be a significant pricing factor of asset returns for most...... markets. A positive or risk-premium effect exists between the return and the volatile component, yet the persistent component is not significantly priced for the return dynamic process....

  12. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  13. Toward robust AV conferencing on next-generation networks

    Science.gov (United States)

    Liu, Haining; Cheng, Liang; El Zarki, Magda

    2005-01-01

    In order to enable a truly pervasive computing environment, next generation networks (including B3G and 4G) will merge the broadband wireless and wireline networking infrastructure. However, due to the tremendous complexity in administration and the unreliability of the wireless channel, provision of hard-guarantees for services on such networks will not happen in the foreseeable future. This consequently makes it particularly challenging to offer viable AV conferencing services due to their stringent synchronization, delay and data fidelity requirements. We propose in this paper a robust application-level solution for wireless mobile AV conferencing on B3G/4G networks. Expecting no special treatment from the network, we apply a novel adaptive delay and synchronization control mechanism to maintain the synchronization and reduce the latency as much as possible. We also employ a robust video coding technique that has better error-resilience capability. We investigate the performance of the proposed solution through simulations using a three-state hidden Markov chain as the generic end-to-end transport channel model. The results show that our scheme yields tight synchronization performance, relatively low end-to-end latency and satisfactory presentation quality. The scheme successfully provides a fairly robust AV conferencing service.

  14. Synliggörande av tyst kunskap i gymnasial yrkesutbildning

    Directory of Open Access Journals (Sweden)

    Mats Lundgren

    2012-04-01

    Full Text Available Yrkesutbildning skiljer sig från andra former av gymnasieutbildning genom att den innehåller praktisk kunskap som kan vara svårfångad, ofta benämnd som tyst kunskap. Tyst kunskap utgör en förutsättning för att yrkeselever ska kunna tillägna sig ett yrkes kultur, praxis och kunskapstradition. Med utgångspunkt i yrkeslärares berättelser beskrivs i artikeln med stöd av tre definierade kompetensområden, 1 yrkesfältet, 2 handlag i yrket samt 3 interaktion och social kompetens, hur yrkeslärare arbetar för att möjliggöra att ett yrkes tysta kunskaper kan läras i en skolmiljö. Resultatet visar betydelsen av att yrkeslärares tysta kunskaper blottläggs för eleverna genom att de i sin undervisning, berättar, visar och ställer frågor. Det är i dessa möten som den tysta kunskapens betydelse i yrkesutövning kan bli synlig för eleverna.

  15. Bruk av ordlæringsstrategier blant norske tyskelever

    Directory of Open Access Journals (Sweden)

    Anna Gausland

    2011-05-01

    Full Text Available Interessen for forskning på læringsstrategier er økende i Norge. Det finnes likevel ennå ingen publiserte empiriske studier som fokuserer på læringsstrategier i andre fremmedspråk. Hensikten med den foreliggende artikkelen er å gi et første innblikk i 54 norske tyskelevers bruk av ordlæringsstrategier. Studien er gjennomført som en skriftlig spørreundersøkelse hvor elevene beskrev hvordan de hadde arbeidet for å lære en liste med tysk-norske ordpar. Samlet sett ser vi at elevene behersker ordlæringsstrategier av ulik art, men at noen få strategier er hyppig forekomne hos de fleste elevene. Det viser seg at elevene i hovedsak bruker ordlæringsstrategier som inneholder element av repetisjon, altså strategier som krever lite kognitiv bearbeiding. Dernest blir metakognitive strategier som organiserer og planlegger læringen mest brukt. Artikkelens siste del sammenligner funn fra undersøkelsen med internasjonale studier og skisserer videre forskningsbehov innen feltet.

  16. Pricing Volatility of Stock Returns with Volatile and Persistent Components

    DEFF Research Database (Denmark)

    Zhu, Jie

    In this paper a two-component volatility model based on the component's first moment is introduced to describe the dynamic of speculative return volatility. The two components capture the volatile and persistent part of volatility respectively. Then the model is applied to 10 Asia-Pacific stock m......, a positive or risk-premium effect exists between return and the volatile component, yet the persistent component is not significantly priced for return dynamic process.......In this paper a two-component volatility model based on the component's first moment is introduced to describe the dynamic of speculative return volatility. The two components capture the volatile and persistent part of volatility respectively. Then the model is applied to 10 Asia-Pacific stock...... markets. Their in-mean effects on return are also tested. The empirical results show that the persistent component accounts much more for volatility dynamic process than the volatile component. However the volatile component is found to be a significant pricing factor of asset returns for most markets...

  17. Sulfide oxidation as a process for the formation of copper-rich magmatic sulfides

    Science.gov (United States)

    Wohlgemuth-Ueberwasser, Cora C.; Fonseca, Raúl O. C.; Ballhaus, Chris; Berndt, Jasper

    2013-01-01

    Typical magmatic sulfides are dominated by pyrrhotite and pentlandite with minor chalcopyrite, and the bulk atomic Cu/Fe ratio of these sulfides is typically less than unity. However, there are rare magmatic sulfide occurrences that are dominated by Cu-rich sulfides (e.g., bornite, digenite, and chalcopyrite, sometimes coexisting with metallic Cu) with atomic Cu/Fe as high as 5. Typically, these types of sulfide assemblages occur in the upper parts of moderately to highly fractionated layered mafic-ultramafic intrusions, a well-known example being the Pd/Au reef in the Upper Middle Zone of the Skaergaard intrusion. Processes proposed to explain why these sulfides are so unusually rich in Cu include fractional crystallization of Fe/(Ni) monosulfide and infiltration of postmagmatic Cu-rich fluids. In this contribution, we explore and experimentally evaluate a third possibility: that Cu-rich magmatic sulfides may be the result of magmatic oxidation. FeS-dominated Ni/Cu-bearing sulfides were equilibrated at variable oxygen fugacities in both open and closed system. Our results show that the Cu/Fe ratio of the sulfide melt increases as a function of oxygen fugacity due to the preferential conversion of FeS into FeO and FeO1.5, and the resistance of Cu2S to being converted into an oxide component even at oxygen fugacities characteristic of the sulfide/sulfate transition (above FMQ + 1). This phenomenon will lead to an increase in the metal/S ratio of a sulfide liquid and will also depress its liquidus temperature. As such, any modeling of the sulfide liquid line of descent in magmatic sulfide complexes needs to address this issue.

  18. Särhållning av gruvavfall med avseende på syrabildande potential : en studie av svenska sulfidmalmsgruvor

    OpenAIRE

    Sellin, Jessica

    2016-01-01

    Gruvavfall utgör över 80 % av den totala mängden avfall i Sverige. Avfallet från gruvindustrin kan påverka våra ekosystem negativt om tungmetaller och försurande ämnen lämnar materialet. I Sverige utgör avfall från sulfidmalmer störst risk för miljön eftersom det innehåller mineral som genom kontakt med luft vittrar och producerar surt och metallhaltigt lakvatten. Efterbehandling av dessa material är viktigt för att förhindra läckage till omgivningen. Eftersom efterbehandli...

  19. Mellom bibel og menneskerettigheter : en studie av Vårt Land og Dagens vinkling av Palestina/Israel-konflikten

    OpenAIRE

    2005-01-01

    Sammendrag Tittel: Israel og Palestina mellom bibel og menneskerettigheter. - Vinkling av Palestina/Israelkonflikten i avisene Vårt Land og Dagens lederartikler Spørsmålsstilling: Hvilke holdninger til Palestina/Israel-konflikten reflekterer lederartikler i de to kristne dagsavisene Dagen og Vårt Land? Er det mulig å spore en endring i vinklingen over tid? Hvordan kan disse lederartiklene gi oss innblikk i en debatt om Palestina/Israel-konflikten blant kristne i Norge? Metode...

  20. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  1. Dynamic Volatility Arbitrage

    DEFF Research Database (Denmark)

    Dorn, Jochen

    concepts, next to nothing is known about position reverting strategies and how, and -even more important- in which context they are applied in practice. In the recent market downturn only one sector generated signicant profits for the leading investment banks: Volatility trading activities, namely on Forex...

  2. 21 CFR 177.2490 - Polyphenylene sulfide resins.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Polyphenylene sulfide resins. 177.2490 Section 177... Components of Articles Intended for Repeated Use § 177.2490 Polyphenylene sulfide resins. Polyphenylene sulfide resins (poly(1,4-phenylene sulfide) resins) may be safely used as coatings or components...

  3. Stock markets liberalization affects volatility?

    OpenAIRE

    Ioan Alin NISTOR; Maria-Lenuţa CIUPAC-ULICI; GHERMAN Mircea-Cristian

    2012-01-01

    Regarding the impact of liberalization, the results show that, in general, market opening is accompanied by a significant increase in market volatility. In particular, volatility tends to decrease due to large capital inflows and domestic growth.The study analyzes the impact of stock market liberalization on volatility in six emerging stock markets by using GARCH methodology. Theory on the effects of financial liberalization on volatility has been ambiguous, and empirical work has yielded con...

  4. Har forhold under svangerskapet betydning for utviklingen av otitis media?

    Directory of Open Access Journals (Sweden)

    Kari J. Kværner

    2009-10-01

    Full Text Available  SAMMENDRAGMed utgangspunkt i data fra et populasjonsbasert utvalg av 7 992 norske tvillinger ble sammenhengenmellom gjentatte ørebetennelser og forhold under svangerskapet studert. Som parametre på intrauterinevekstforhold ble informasjon om fødselsvekt og gestasjonsalder fra Medisinsk Fødselsregister benyttet.Informasjon om rapporterte øreinfeksjoner ble basert på spørreskjemaer som ble besvart av tvillingene ialderen 18–25 år. Først studerte vi individuelle effekter av fødselsvekt og gestasjonsalder på forekomsten avotitis media (OM. Rapportert fødselsvekt hos individer med OM var signifikant lavere enn hos kontrollene,med en gjennomsnittsforskjell på 86 gram. Hos de som rapporterte OM var gjennomsnittlig gestasjonsalder3 dager kortere enn i kontrollmaterialet. Deretter beregnet vi effekten av fødselsvekt ved bruk av co-twinkontroll metoden. Blant monozygote (MZ tvillingpar gjenspeiler fødselsvektforskjeller innenfor tvillingparetintra-uterine miljøforskjeller. Blant dizygote (DZ par kan vektforskjellen være både genetiske ogmiljøbetinget. Ved sammenligning av fødselsvektforskjeller innenfor tvillingparene er tvillingen som ikkehar gjentatte øreinfeksjoner en matchet kontroll blant OM diskordante par. Resultatene antyder at lavfødselsvekt er en risikofaktor for otitis media. Gjennomsnittlig vektforskjell blant par diskordante for OMvar 48 gram, og den av tvillingen som ikke rapporterte OM hadde signifikant høyere fødselsvekt.Kværner KJ, Tambs K, Harris J, Magnus P. Do pregnancy-related factors influence the development ofotitis media? Nor J Epidemiol 1997; 7 (1: 55-58.  ENGLISH SUMMARYThe association between intrauterine growth, as measured by weight and gestational age, and the occurrenceof recurrent ear infections was studied using data from a population based sample of 7992 Norwegian twins.Perinatal measures were collected from the Medical Birth Registry, and reports of recurrent ear infectionswere based on

  5. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  6. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  7. Implementering av nye GOLD-stadier hos pasienter med KOLS i allmennpraksis

    OpenAIRE

    Storaker, Marit Aarvaag; Nerwey, Ibrahim; Kierulf-Strømme, Kirsten; Tengesdal, Randi Hauge; Wyller, Nora Guttormsgaard; Skårn, Elling Skeide; Cagrici, Ufuk

    2014-01-01

    Bakgrunn: GOLD (Global Initiative for Chronic Obstructive Lung Disease) lanserte i 2011 nye kriterier for gradering av alvorlighetsgrad av KOLS, der man i tillegg til FEV1 ved spirometri også tar hensyn til antall eksaserbasjoner og pasientens symptombyrde. Mange pasienter havner i en lavere risikogruppe etter den nye inndelingen, og er følgelig overbehandlet med f.eks. inhalasjonssteroider. Andre kan identifiseres tidligere som høyrisikopasienter for hyppige eksaserbasjoner og raskt tap av l...

  8. The exploitation of volatile oil

    Institute of Scientific and Technical Information of China (English)

    MENG Teng; ZHANG Da; TENG Xiangjin; LINing; HAO Zaibin

    2007-01-01

    Rose is a kind of favorite ornamental plant. This article briefly introduced the cultivation and the use of rose around the world both in ancient time and nowadays. Today, volatile oil becomes the mainstream of the rose industry. People pay attention to the effect of volatile oil; meanwhile, they speed up their research on extracting volatile oil and the ingredients.

  9. Plant volatiles and the environment

    NARCIS (Netherlands)

    Loreto, F.; Dicke, M.; Schnitzler, J.P.; Turlings, T.C.J.

    2014-01-01

    Volatile organic compounds emitted by plants represent the largest part of biogenic volatile organic compounds (BVOCs) released into our atmosphere. Plant volatiles are formed through many biochemical pathways, constitutively and after stress induction. In recent years, our understanding of the func

  10. Adequate hydrogen sulfide, healthy circulation

    Institute of Scientific and Technical Information of China (English)

    DU Jun-bao; CHEN Stella; JIN Hong-fang; TANG Chao-shu

    2011-01-01

    Previously,hydrogen sulfide (H2S) was considered to be a toxic gas.However,recently it was discovered that it could be produced in mammals and even in plants,throughtheproductionandmetabolismof sulfur-containing amino acids.In mammals,H2S is mainly catalyzed by cystathionine-γ-lyase (CSE),cystathionin-β-lyase (CBS) and 3-mercaptopyruvate sulfurtransferase (MPST) with the substrate of L-cysteine.Endogenous H2S exerts many important physiological and pathophysiological functions,including hypotensive action,vasorelaxation,myocardial dilation,inhibition of smooth muscle cell proliferation,and antioxidatve actions.Importantly,it plays a very important role in the pathogenesis of systemic hypertension,pulmonary hypertension,atherosclerosis,myocardialinjury,angiogenesis,hyperhomocysteinemi aandshock.Therefore,H2S is now being considered to be a novel gasotransmitter after nitric oxide and carbon monoxide in the regulation of circulatory system.

  11. Redox biochemistry of hydrogen sulfide.

    Science.gov (United States)

    Kabil, Omer; Banerjee, Ruma

    2010-07-16

    H(2)S, the most recently discovered gasotransmitter, might in fact be the evolutionary matriarch of this family, being both ancient and highly reduced. Disruption of gamma-cystathionase in mice leads to cardiovascular dysfunction and marked hypertension, suggesting a key role for this enzyme in H(2)S production in the vasculature. However, patients with inherited deficiency in gamma-cystathionase apparently do not present vascular pathology. A mitochondrial pathway disposes sulfide and couples it to oxidative phosphorylation while also exposing cytochrome c oxidase to this metabolic poison. This report focuses on the biochemistry of H(2)S biogenesis and clearance, on the molecular mechanisms of its action, and on its varied biological effects.

  12. Microbial control of hydrogen sulfide production

    Energy Technology Data Exchange (ETDEWEB)

    Montgomery, A.D.; Bhupathiraju, V.K.; Wofford, N.; McInerney, M.J. [Univ. of Oklahoma, Tulsa, OK (United States)] [and others

    1995-12-31

    A sulfide-resistant strain of Thiobacillus denitrificans, strain F, prevented the accumulation of sulfide by Desulfovibrio desulfuricans when both organisms were grown in liquid medium. The wild-type strain of T. denitrificans did not prevent the accumulation of sulfide produced by D. desulfuricans. Strain F also prevented the accumulation of sulfide by a mixed population of sulfate-reducing bacteria enriched from an oil field brine. Fermentation balances showed that strain F stoichiometrically oxidized the sulfide produced by D. desulfuricans and the oil field brine enrichment to sulfate. The ability of a strain F to control sulfide production in an experimental system of cores and formation water from the Redfield, Iowa, natural gas storage facility was also investigated. A stable, sulfide-producing biofilm was established in two separate core systems, one of which was inoculated with strain F while the other core system (control) was treated in an identical manner, but was not inoculated with strain F. When formation water with 10 mM acetate and 5 mM nitrate was injected into both core systems, the effluent sulfide concentrations in the control core system ranged from 200 to 460 {mu}M. In the test core system inoculated with strain F, the effluent sulfide concentrations were lower, ranging from 70 to 110 {mu}M. In order to determine whether strain F could control sulfide production under optimal conditions for sulfate-reducing bacteria, the electron donor was changed to lactate and inorganic nutrients (nitrogen and phosphate sources) were added to the formation water. When nutrient-supplemented formation water with 3.1 mM lactate and 10 mM nitrate was used, the effluent sulfide concentrations of the control core system initially increased to about 3,800 {mu}M, and then decreased to about 1,100 {mu}M after 5 weeks. However, in the test core system inoculated with strain F, the effluent sulfide concentrations were much lower, 160 to 330 {mu}M.

  13. Structural studies in limestone sulfidation

    Energy Technology Data Exchange (ETDEWEB)

    Fenouil, Laurent A. [Univ. of California, Berkeley, CA (United States)

    1993-05-01

    This study investigates the sulfidation of limestone at high temperatures (700--900°C) as the first step in the design of a High-Temperature Coal-Gas Clean-Up system using millimeter-size limestone particles. Several workers have found that the rate of this reaction significantly decreases after an initial 10 to 15% conversion of CaCO3 to CaS. The present work attempts to explain this feature. It is first established that millimeter-size limestone particles do not sinter at temperatures up to the CaCO3 calcination point (899°C at 1.03 bar CO2} partial pressure). It is then shown that CaS sinters rapidly at 750 to 900°C if CO2 is present in the gas phase. Scanning Electron Microscope (SEM) photographs and Electron Dispersive Spectroscopy (EDS) data reveal that the CaS product layer sinters and forms a quasi-impermeable coating around the CaCO3 grains that greatly hinders more H2S from reaching the still unreacted parts of the stone. Moreover, most of the pores initially present within the limestone structure begin to disappear or, at least, are significantly reduced in size. From then on, subsequent conversion is limited by diffusion of H2S through the CaS layer, possibly by S2- ionic diffusion. The kinetics is then adequately described by a shrinking-core model, in which a sharp front of completely converted limestone is assumed to progress toward the center of the pellet. Finally, experimental evidence and computer simulations using simple sintering models suggest that the CaS sintering, responsible for the sharp decrease in the sulfidation rate, is surface-diffusion controlled.

  14. Latent Integrated Stochastic Volatility, Realized Volatility, and Implied Volatility: A State Space Approach

    DEFF Research Database (Denmark)

    Bach, Christian; Christensen, Bent Jesper

    We include simultaneously both realized volatility measures based on high-frequency asset returns and implied volatilities backed out of individual traded at the money option prices in a state space approach to the analysis of true underlying volatility. We model integrated volatility as a latent...... fi…rst order Markov process and show that our model is closely related to the CEV and Barndorff-Nielsen & Shephard (2001) models for local volatility. We show that if measurement noise in the observable volatility proxies is not accounted for, then the estimated autoregressive parameter in the latent...... process is downward biased. Implied volatility performs better than any of the alternative realized measures when forecasting future integrated volatility. The results are largely similar across the stock market (S&P 500), bond market (30-year U.S. T-bond), and foreign currency exchange market ($/£ )....

  15. Removal of methanethiol, dimethyl sulfide, dimethyl disulfide, and hydrogen sulfide from contaminated air by Thiobacillus thioparus TK-m.

    OpenAIRE

    Kanagawa, T; Mikami, E.

    1989-01-01

    Methanethiol, dimethyl sulfide, dimethyl disulfide, and hydrogen sulfide were efficiently removed from contaminated air by Thiobacillus thioparus TK-m and oxidized to sulfate stoichiometrically. More than 99.99% of dimethyl sulfide was removed when the load was less than 4.0 g of dimethyl sulfide per g (dry cell weight) per day.

  16. STUDY ON EFFICIENT COMPUTATION AND PERFORMANCE OF AV-BASED REDUCED-RANK FILTERING

    Institute of Scientific and Technical Information of China (English)

    Xu Bin; Yang Chenyang; Mao Shiyi

    2005-01-01

    In this paper, the complexity and performance of the Auxiliary Vector (AV) based reduced-rank filtering are addressed. The AV filters presented in the previous papers have the general form of the sum of the signature vector of the desired signal and a set of weighted AVs,which can be classified as three categories according to the orthogonality of their AVs and the optimality of the weight coefficients of the AVs. The AV filter with orthogonal AVs and optimal weight coefficients has the best performance, but requires considerable computational complexity and suffers from the numerical unstable operation. In order to reduce its computational load while keeping the superior performance, several low complexity algorithms are proposed to efficiently calculate the AVs and their weight coefficients. The diagonal loading technique is also introduced to solve the numerical unstability problem without complexity increase. The performance of the three types of AV filters is also compared through their application to Direct Sequence Code Division Multiple Access (DS-CDM A) systems for interference suppression.

  17. Utveckling av mjukglassomrörare : En studie för ökad luftinblandning

    OpenAIRE

    2010-01-01

    Den här rapporten är ämnad som underlag till ett fortsatt utvecklingsarbete av en omrörare för mjukglassmaskiner. I en mjukglassmaskin kyls glassen under kontinuerlig omrörning, på så vis blandas luft in och ger glassen fluffighet. Omrörarens huvudfunktioner är luftinblandning, avskrapning av iskristaller längs innerhöljet av kylcylindern samt utmatning av mjukglass mot öppningsdörr. Med en ny utformning ska omröraren bidra till en mer kostnadseffektiv mjukglass-maskin samt ge en godare glass...

  18. Handlingsplan för ägare av transformatorer med korrosiv olja

    OpenAIRE

    Weidemann, Stephan

    2016-01-01

    Sedan början av 2000-talet har ett stort antal transformatorer havererat av en initialt, okänd anledning. Problemet visade sig vara att en antioxidationstillsats i oljan, dibensyl disulfid (DBDS), reagerat med kopparen i lindningarna och vilket gett upphov till avlagringar på isolationspapperet i form av kopparsulfid. Kopparsulfiden i sin tur försvagade papperets isolationsförmåga och allvarliga driftstörningar eller driftstopp på grund av kortslutningar kan ske. Ett stort antal studier har g...

  19. NATO i krigen mot terror : En analyse av NATOs rolle i Afghanistan etter 11. september

    OpenAIRE

    Berg-Hansen, Susanne

    2007-01-01

    Denne oppgaven studerer NATOs rolle i den USA-ledede Operation Enduring Freedom i Afghanistan. Noen timer etter terrorangrepet mot USA 11. september 2001, påkalte NATO for første gang i historien sin grunnpilar, Artikkel 5 i NATO-traktaten, som fastslår at et angrep på ett av medlemmene er et angrep på alle NATO-landene. Til tross for alliansens påkallelse av Artikkel 5, ble NATO stående på sidelinjen i hovedfasen av "Operation Enduring Freedom". USA valgte å gjennomføre mesteparten av kamp...

  20. Tibetanisering : religiøs og etnisk utdanning av tibetanske flyktningbarn i Nord-India

    OpenAIRE

    Lind, Trude

    2007-01-01

    Religiøs sosialisering og nasjonal identitet blant tibetanske flyktningbarn i Nord-India er tema for denne oppgaven. Mye av materialet bygger på feltarbeidet jeg utførte ved Tibetan Children’s Village (TCV) Dharamsala høsten 2003. TCV regnes som en av de viktigste sekulære utdanningsinstitusjonene for tibetanerne i eksil. Siden den kinesiske invasjonen av Tibet i 1950 har mer en 100 000 tibetanere flyktet over fjellene i Himalaya til India, Nepal og Bhutan. Et av Dalai Lamas og eksilregje...

  1. Hydrogen Sulfide Induces Oxidative Damage to RNA and DNA in a Sulfide-Tolerant Marine Invertebrate

    OpenAIRE

    Joyner-Matos, Joanna; Predmore, Benjamin L.; Stein, Jenny R.; Leeuwenburgh, Christiaan; Julian, David

    2010-01-01

    Hydrogen sulfide acts as an environmental toxin across a range of concentrations and as a cellular signaling molecule at very low concentrations. Despite its toxicity, many animals, including the mudflat polychaete Glycera dibranchiata, are periodically or continuously exposed to sulfide in their environment. We tested the hypothesis that a broad range of ecologically relevant sulfide concentrations induces oxidative stress and oxidative damage to RNA and DNA in G. dibranchiata. Coelomocytes ...

  2. Nitrate-reducing, sulfide-oxidizing bacteria as microbial oxidants for rapid biological sulfide removal.

    Science.gov (United States)

    De Gusseme, Bart; De Schryver, Peter; De Cooman, Michaël; Verbeken, Kim; Boeckx, Pascal; Verstraete, Willy; Boon, Nico

    2009-01-01

    The emission of hydrogen sulfide into the atmosphere of sewer systems induces the biological production of sulfuric acid, causing severe concrete corrosion. As a possible preventive solution, a microbial consortium of nitrate-reducing, sulfide-oxidizing bacteria (NR-SOB) was enriched in a continuously stirred tank reactor in order to develop a biological technique for the removal of dissolved sulfide. The consortium, dominated by Arcobacter sp., was capable of removing 99% of sulfide. Stable isotope fractioning of the sulfide indicated that the oxidation was a biological process. The capacity of the NR-SOB consortium for rapid removal of sulfide was demonstrated by using it as an inoculum in synthetic and real sewage. Removal rates up to 52 mg sulfide-S g VSS(-1) h(-1) were achieved, to our knowledge the highest removal rate reported so far for freshwater species in the absence of molecular oxygen. Further long-term incubation experiments revealed the capacity of the bacteria to oxidize sulfide without the presence of nitrate, suggesting that an oxidized redox reserve is present in the culture.

  3. Organic silicon compounds anf hydrogen sulfide removal from biogas by mineral and adsorbent

    Science.gov (United States)

    Choi, J.

    2015-12-01

    Biogas utilized for energy production needs to be free from organic silicon compounds and hydrogen sulfide , as their burning has damaging effects on utilities and humans; organic silicon compounds and hydrogen sulfide can be found in biogas produced from biomass wastes, due to their massive industrial use in synthetic product,such as cosmetics, detergents and paints.Siloxanes and hydrogen sulfide removal from biogas can be carried out by various methods (Ajhar et al., 2010); aim of the present work is to find a single practical andeconomic way to drastically and simultaneously reduce both hydrogen sulfide and the siloxanes concentration to less than 1 ppm. Some commercial activated carbons previously selected (Monteleoneet al., 2011) as being effective in hydrogen sulfide up taking have been tested in an adsorption measurement apparatus, by flowing both hydrogen sulphide and volatile siloxane (Decamethycyclopentasiloxane or D5) in a nitrogen stream,typically 25-300 ppm D5 over N2, through an clay minerals, Fe oxides and Silica; the adsorption process was analyzed by varying some experimental parameters (concentration, grain size, bed height). The best silica shows an adsorption capacity of 0.2 g D5 per gram of silica. The next thermo gravimetric analysis (TGA) confirms the capacity data obtained experimentally by the breakthrough curve tests.The capacity results depend on D5 and hydrogen sulphide concentrations. A regenerative silica process is then carried out byheating the silica bed up to 200 ° C and flushing out the adsorbed D5 and hydrogen sulphide samples in a nitrogen stream in athree step heating procedure up to 200 ° C. The adsorption capacity is observed to degrade after cyclingthe samples through several adsorption-desorption cycles.

  4. Optimizing headspace sampling temperature and time for analysis of volatile oxidation products in fish oil

    DEFF Research Database (Denmark)

    Rørbæk, Karen; Jensen, Benny

    1997-01-01

    Headspace-gas chromatography (HS-GC), based on adsorption to Tenax GR(R), thermal desorption and GC, has been used for analysis of volatiles in fish oil. To optimize sam sampling conditions, the effect of heating the fish oil at various temperatures and times was evaluated from anisidine values (......) and HS-CC. AV indicated sample degradations at 90 degrees C but only small alterations between 60 and 75 degrees C. HS-GC showed increasing response with temperature and rime. Purging at 75 degrees C for 45 min was selected as the preferred sampling condition for oxidized fish oil....

  5. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  6. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  7. [Fatal outcome of an hydrogen sulfide poisoning].

    Science.gov (United States)

    Querellou, E; Jaffrelot, M; Savary, D; Savry, C; Perfus, J-P

    2005-10-01

    We report a case of fatal outcome poisoning by massive exposure to hydrogen sulfide of a sewer worker. This rare event was associated with a moderate intoxication of two members of the rescue team. The death was due to asystole and massive lung oedema. Autopsy analysis showed diffuse necrotic lesions in lungs. Hydrogen sulfide is a direct and systemic poison, produced by organic matter decomposition. The direct toxicity mechanism is still unclear. The systemic toxicity is due to an acute toxicity by oxygen depletion at cellular level. It is highly diffusable and potentially very dangerous. At low concentration, rotten egg smell must trigger hydrogen sulfide suspicion since at higher concentration it is undetectable, making intoxication possible. In case of acute intoxication, there is an almost instantaneous cardiovascular failure and a rapid death. Hydrogen sulfide exposure requires prevention measures and more specifically the use of respiratory equipment for members of the rescue team.

  8. Hydrogen sulfide in hemostasis: friend or foe?

    Science.gov (United States)

    Olas, Beata

    2014-06-25

    Hydrogen sulfide (H2S) is a well known toxic gas that is synthesized from the amino acids: cysteine (Cys) and homocysteine (Hcy) by three enzymes: cystathionine-β-synthase (CBS), cystathionine-γ-lyase (CSE) and mercaptopyruvate sulfurtransferase (3-MST). Hydrogen sulfide, like carbon monoxide (CO) or nitric oxide (NO) is a signaling molecule in different biological systems, including the cardiovascular system. Moreover, hydrogen sulfide plays a role in the pathogenesis of various cardiovascular diseases. It modulates different elements of hemostasis (activation of blood platelet, and coagulation process) as well as proliferation and apoptosis of vascular smooth muscle cells. However, the biological role and the therapeutic potential of H2S is not clear. This review summarizes the different functions of hydrogen sulfide in hemostasis.

  9. Overvåking av vassdrag i Ringsaker - Undersøkelser av innsjøer og bekker i 2012

    OpenAIRE

    Løvik, J.; Brettum, Pål

    2013-01-01

    Rapporten omhandler vannkvalitet og miljøtilstand i fire innsjøer og fem mindre vassdrag i Ringsaker kommune i 2012. Hovedvekten er lagt på effekter av næringsstoffer, dvs. overgjødsling. Basert på mengder og sammensetning av planteplankton, sammensetning av dyreplankton samt fysisk/kjemiske støtteparametre vurderes innsjøenes økologiske tilstand mht. overgjødsling som følger: Ljøsvatnet: moderat, Sjusjøen: moderat, men nær grensen til god og Næra og Botsenden: god. Vurderingene bør betraktes...

  10. An uncommon case of spontaneous conversion from AV re-entry tachycardia to AV nodal re-entry tachycardia in a patient with dual tachycardia.

    Science.gov (United States)

    Zeljković, Ivan; Benko, Ivica; Manola, Šime; Radeljić, Vjekoslav; Pavlović, Nikola

    2015-01-01

    We report the case of a 46-year old patient in whom an electrophysiology study (EP) was performed due to paroxysmal supraventricular tachycardia documented in 12-lead ECG. During the EP study, supraventricular tachycardia was induced easily and it corresponded to orthodromic AV reentry tachycardia (AVRT) using a concealed left free wall accessory pathway. However, during the study AVRT spontaneously and repeatedly converted to the typical slow-fast AV node reentry tachycardia (AVNRT). Both accessory and AV nodal slow pathways were ablated, due to the finding that both AVRT and AVNRT were independently inducible during the EP study.

  11. Karakterisering av vannkjemisk status i bekker og innsjøer før utbygging av E 18 Grimstad-Kristiansand

    OpenAIRE

    Hindar, A.

    2005-01-01

    Førtilstanden er kartlagt for i alt 25 bekke- og innsjølokaliteter som blir krysset av planlagt E 18 fra Grimstad til Kristiansand. Forsuring har stått i fokus fordi deler av vegstrekningen vil gå gjennom sulfidgneis, og fordi det er avdekket omfattende problemer med avrenningsvann ved utsprengning i slik berggrunn. Det har vært et mål å forsøke å skille effekten av sur nedbør fra den påvirkning ueksponert og eksponert sulfidgneis gir. Naturtilstand i kombinasjon med sur nedbør gir sulfatkons...

  12. Harmonikk for det indre øret : En studie av harmonikk som assosiasjonsgiver i Bernard Herrmanns musikk til filmen Vertigo av Alfred Hitchcock

    OpenAIRE

    Bøe, Brynjar

    2012-01-01

    I denne oppgaven tar jeg for meg Bernard Herrmanns musikk til filmen Vertigo fra 1958, regissert av Alfred Hitchcock. Jeg vil forsøke å finne sammenhenger mellom komponistens bruk av harmonikk og filmfortellingen for øvrig. Jeg vil se hvilke hvordan filmkomponisten være med på å fortelle historien i filmen, og hvilke musikalske virkemidler, med vekt på harmonikkrelaterte sådan, han/hun har til rådighet for å gjøre dette. Jeg vil se på noen av de musikalske valgene Herrmann har tatt...

  13. Sensorisk realisme i Carlos Reygadas' Post Tenebras Lux (2012) - En undersøkelse av tilskuerhenvendelsen i lys av nyere realismeteori og filmfenomenologi

    OpenAIRE

    Johnson, Silja Espolin

    2015-01-01

    I dette prosjektet undersøker den meksikanske filmregissøren Carlos Reygadas fjerde og nyeste spillefilm Post Tenebras Lux (2012) i lys av den nærværsbaserte og "fysiske" tilskueropplevelsen den produserer. Prosjektet består av fire kapitler. I det første kapittelet presenterer jeg filmen i konteksten av en tendens som har markert seg på filmfestivaler verden over de siste to tiårene som går under flere navn, blant andre: slow cinema, hybridfilm og, det begrepet jeg har funnet mest fruktbart...

  14. Scaling Foreign Exchange Volatility

    OpenAIRE

    Jonathan Batten; Craig Ellis

    2001-01-01

    When asset returns are normally distributed the risk of an asset over a long return interval may be estimated by scaling the risk from shorter return intervals. While it is well known that asset returns are not normally distributed a key empirical question concerns the effect that scaling the volatility of dependent processes will have on the pricing of related financial assets. This study provides an insight into this issue by investigating the return properties of the most important currenc...

  15. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  16. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  17. Air-water transfer of hydrogen sulfide

    DEFF Research Database (Denmark)

    Yongsiri, C.; Vollertsen, J.; Rasmussen, M. R.

    2004-01-01

    The emissions process of hydrogen sulfide was studied to quantify air–water transfer of hydrogen sulfide in sewer networks. Hydrogen sulfide transfer across the air–water interface was investigated at different turbulence levels (expressed in terms of the Froude number) and pH using batch...... experiments. By means of the overall mass–transfer coefficient (KLa), the transfer coefficient of hydrogen sulfide (KLaH2S), referring to total sulfide, was correlated to that of oxygen (KLaO2) (i.e., the reaeration coefficient). Results demonstrate that both turbulence and pH in the water phase play...... a significant role for KLaH2S. An exponential expression is a suitable representation for the relationship between KLaH2S and the Froude number at all pH values studied (4.5 to 8.0). Because of the dissociation of hydrogen sulfide, KLaH2S increased with decreasing pH at a constant turbulence level. Relative...

  18. Mechanism of mechanical activation for sulfide ores

    Institute of Scientific and Technical Information of China (English)

    HU Hui-ping; CHEN Qi-yuan; YIN Zhou-lan; HE Yue-hui; HUANG Bai-yun

    2007-01-01

    Structural changes for mechanically activated pyrite, sphalerite, galena and molybdenite with or without the exposure to ambient air, were systematically investigated using X-ray diffraction analysis(XRD), particle size analysis, gravimetrical method, X-ray photo-electron spectroscopy(XPS) and scanning electron microscopy(SEM), respectively. Based on the above structural changes for mechanically activated sulfide ores and related reports by other researchers, several qualitative rules of the mechanisms and the effects of mechanical activation for sulfide ores are obtained. For brittle sulfide ores with thermal instability, and incomplete cleavage plane or extremely incomplete cleavage plane, the mechanism of mechanical activation is that a great amount of surface reactive sites are formed during their mechanical activation. The effects of mechanical activation are apparent. For brittle sulfide ores with thermal instability, and complete cleavage plane, the mechanism of mechanical activation is that a great amount of surface reactive sites are formed, and lattice deformation happens during their mechanical activation. The effects of mechanical activation are apparent. For brittle sulfide ores with excellent thermal stability, and complete cleavage plane, the mechanism of mechanical activation is that lattice deformation happens during their mechanical activation. The effects of mechanical activation are apparent. For sulfide ores with high toughness, good thermal stability and very excellent complete cleavage plane, the mechanism of mechanical activation is that lattice deformation happens during their mechanical activation, but the lattice deformation ratio is very small. The effects of mechanical activation are worst.

  19. Sulfide as a soil phytotoxin - A review

    Directory of Open Access Journals (Sweden)

    Leon P M Lamers

    2013-07-01

    Full Text Available In wetland soils and underwater sediments of marine, brackish and freshwater systems, the strong phytotoxin sulfide may accumulate as a result of microbial reduction of sulfate during anaerobiosis, its level depending on prevailing edaphic conditions. In this review, we compare an extensive body of literature on phytotoxic effects of this reduced sulfur compound in different ecosystem types, and review the effects of sulfide at multiple ecosystem levels: the ecophysiological functioning of individual plants, plant-microbe associations, and community effects including competition and facilitation interactions. Recent publications on multi-species interactions in the rhizosphere show even more complex mechanisms explaining sulfide resistance. It is concluded that sulfide is a potent phytotoxin, profoundly affecting plant fitness and ecosystem functioning in the full range of wetland types including coastal systems, and at several levels. Traditional toxicity testing including hydroponic approaches generally neglect rhizospheric effects, which makes it difficult to extrapolate results to real ecosystem processes. To explain the differential effects of sulfide at the different organizational levels, profound knowledge about the biogeochemical, plant physiological and ecological rhizosphere processes is vital. This information is even more important, as anthropogenic inputs of sulfur into freshwater ecosystems and organic loads into freshwater and marine systems are still much higher than natural levels, and are steeply increasing in Asia. In addition, higher temperatures as a result of global climate change may lead to higher sulfide production rates in shallow waters.

  20. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  1. Community structure and activity of sulfate-reducing bacteria in an intertidal surface sediment: a multi-method approach

    DEFF Research Database (Denmark)

    Llobet-Brossa, Enrique; Rabus, Ralf; Böttcher, Michael E.

    2002-01-01

    by the presence of acid-volatile sulfides (AVS, essentially iron monosulfide). Stable sulfur isotope discrimination between dissolved sulfate and AVS was dominated by sulfate reduction. The diversity of SRB was studied using denaturant gradient gel electrophoresis of 16S rDNA, phospholipid fatty acid analysis...

  2. Posthumanisme /nymaterialisme og nomadisme - affektive brytninger av barnehagens observasjonspraksiser

    Directory of Open Access Journals (Sweden)

    Ann Merete Otterstad

    2015-09-01

    Full Text Available This article challenges observation as a method in early childhood, justified as a mapping tool for creating knowledge about children. Observation as data material is about writing down already known categorisation about children and their development. Categories and categorisation make a foundation for correspondence and coherence   - connections that might create generalising knowledge about children in early years. The article is about a research project conducted in a child-centre over a two-year period. We had an on-going conversation with the personnel around theories about ‘child development’. In the article we experiment with observation based on posthuman/newmaterial theories. Our specific interests are to explore the complexities around observation by asking; why observations, what do we expect through observation, and what might observation as datamaterial be/become? We are inspired by the Norwegian film “Kitchen Stories” (Salmer fra Kjøkkenet, Hamer, 2003 both as affect/provocation and desire (Koro-Ljungberg & MacLure, 2013. We search for affective bending and messiness (Lather, 2007; Law, 2004 to disturb and challenge observation as dominating paradigm in the field of early years, to break some patterns around the positioning of data material. Artikkelen utfordrer observasjon i barnehagen ut fra at metoden brukes som verktøy for å kartlegge og danne grunnlaget for utvikling av kunnskap om barn.  Observasjon som datamateriale innebærer iakttagelser og nedtegnelser av allerede gitte kategoriseringer om barn og barns utvikling.  Kategorier og kategorisering legger grunnlag for mønster som har i seg ideer om korrespondanse og koherens – sammenhenger som kan bidra til generaliserende kunnskap om barna i barnehagen. Omrisset av artikkelen dreies rundt et forskningsarbeid gjort i en barnehage over en toårs-periode, der vi sammen med de ansatte diskuterer teorier om barn og barns ’utvikling’. Vi bruker posthumane

  3. EST Table: AV401818 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401818 heS00196 10/09/28 77 %/219 aa ref|NP_001103813.1| P-element somatic inhibi...tor [Bombyx mori] dbj|BAF91871.1| Bombyx homolog of P-element somatic inhibitor [Bombyx mori] 10/08/28 35 %/...irmed#UniProt: Q9BLA0#protein_id:AAK09071.1 10/09/10 33 %/182 aa AGAP011446-PA Pr...otein|3L:24763465:24770148:-1|gene:AGAP011446 10/09/10 47 %/174 aa gnl|Amel|GB18145-PA 10/09/10 46 %/184 aa gi|18

  4. EST Table: AV400561 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400561 br--1451 10/09/28 62 %/198 aa ref|XP_001843664.1| neuroendocrine protein 7...b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 42 %.../196 aa FBpp0240992|DwilGK11849-PA 10/08/27 54 %/104 aa T03D8.3#CE18921#WBGene00011392#locus:sbt-1#neuroendocrine...45-PA 10/09/10 51 %/199 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  5. EST Table: AV405781 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405781 wdV30227 10/09/28 88 %/272 aa ref|NP_001106136.1| Annexin IX isoform B [Bo...mbyx mori] dbj|BAA92810.1| annexin IX-B [Bombyx mori] 10/08/28 71 %/270 aa FBpp0280989|DpseGA19090-PA 10/08/...9 10/09/10 62 %/270 aa gnl|Amel|GB16448-PA 10/09/10 73 %/271 aa gi|91092420|ref|XP_967931.1| PREDICTED: similar to Annexin IX CG5730-PC [Tribolium castaneum] NM_001043376 wdV3 ...

  6. EST Table: AV402401 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402401 heS00969 10/09/28 85 %/225 aa dbj|BAB16697.1| annexin [Bombyx mori] dbj|BAB16698.1| anne...a#CE23956#WBGene00003589#locus:nex- 2#Annexin#status:Confirmed#UniProt:Q27512#protein_id:CAA 82571.2 10/09/1... %/220 aa gnl|Amel|GB16448-PA 10/09/10 73 %/220 aa gi|91092420|ref|XP_967931.1| PREDICTED: similar to Annexin IX CG5730-PC [Tribolium castaneum] NM_001043376 heS0 ...

  7. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  8. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  9. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  10. Framväxten av koncernfackligt samarbete inom metallindustrin

    OpenAIRE

    Kjellberg, Anders

    2006-01-01

    The chapter "Framväxten av koncernfackligt samarbete inom metallindustrin" (pp. 177-239) by Anders Kjellberg analyzes the rise and development of trade union cooperation within groups in Swedish metal industry. Special attention is paid to the two large metal enterprises in Finspång, situated in the northern part of the province of Östergötland: (1) the turbine company (for a long period of time called STAL), which were owned by the following groups: Asea, ABB, Alstom and today ...

  11. Gulliver's Travels av Jonathan Swift : fra politisk satire til barnebok

    OpenAIRE

    Krog, Kira Katarina

    2004-01-01

    Denne oppgaven tar for seg Jonathan Swifts bok Gulliver’s Travels’ (1727) utvikling fra politisk satire til barnebok. Med utgangspunkt i opplysningstidens tro på menneskets suverene fornuft og tradisjonen fra antikkens greske satire har oppgaven en historisk problemstilling. Den følger satirens og barnebokens utvikling gjennom tidene og ender i en lesning av en norsk barnebokversjon, utgitt nærmere 300 år etter førsteutgaven. Oppgaven har tre hoveddeler. Den første tar for seg hvordan bok...

  12. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  13. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  14. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  15. Fysiologiske effekter av delvis okklusjon under ettbeins utholdenhetsarbeid

    OpenAIRE

    Henriksen, Bjørnar Sandland

    2009-01-01

    Unilateral perifer aterosklerose i beinet har tidligere vist å gi en fysiologisk adaptasjon til sykdommen ved å endre den oksidative kapasiteten i muskelen (Jansson, 1988; Henriksson et al., 1980). Denne observasjonen er blitt fulgt opp med treningsstudier som har undersøkt effekten av ischemi ved sykkelarbeid hos friske (Sundberg, 1994), samt intervalltrening på tredemølle med okklusjon på begge beina (Abe et al., 2006). Det er imidlertid ikke utført noen treningsstudier med ett – beins knee...

  16. Formation of Zn- and Fe-sulfides near hydrothermal vents at the Eastern Lau Spreading Center: implications for sulfide bioavailability to chemoautotrophs

    Directory of Open Access Journals (Sweden)

    Yucel Mustafa

    2008-05-01

    Full Text Available Abstract Background The speciation of dissolved sulfide in the water immediately surrounding deep-ocean hydrothermal vents is critical to chemoautotrophic organisms that are the primary producers of these ecosystems. The objective of this research was to identify the role of Zn and Fe for controlling the speciation of sulfide in the hydrothermal vent fields at the Eastern Lau Spreading Center (ELSC in the southern Pacific Ocean. Compared to other well-studied hydrothermal systems in the Pacific, the ELSC is notable for unique ridge characteristics and gradients over short distances along the north-south ridge axis. Results In June 2005, diffuse-flow ( 250°C vent fluids were collected from four field sites along the ELSC ridge axis. Total and filtered Zn and Fe concentrations were quantified in the vent fluid samples using voltammetric and spectrometric analyses. The results indicated north-to-south variability in vent fluid composition. In the high temperature vent fluids, the ratio of total Fe to total Zn varied from 39 at Kilo Moana, the most northern site, to less than 7 at the other three sites. The concentrations of total Zn, Fe, and acid-volatile sulfide indicated that oversaturation and precipitation of sphalerite (ZnS(s and pyrite (FeS2(s were possible during cooling of the vent fluids as they mixed with the surrounding seawater. In contrast, most samples were undersaturated with respect to mackinawite (FeS(s. The reactivity of Zn(II in the filtered samples was tested by adding Cu(II to the samples to induce metal-exchange reactions. In a portion of the samples, the concentration of labile Zn2+ increased after the addition of Cu(II, indicating the presence of strongly-bound Zn(II species such as ZnS clusters and nanoparticles. Conclusion Results of this study suggest that Zn is important to sulfide speciation at ELSC vent habitats, particularly at the southern sites where Zn concentrations increase relative to Fe. As the hydrothermal

  17. Endogenous RGS proteins modulate SA and AV nodal functions in isolated heart: implications for sick sinus syndrome and AV block.

    Science.gov (United States)

    Fu, Ying; Huang, Xinyan; Piao, Lin; Lopatin, Anatoli N; Neubig, Richard R

    2007-05-01

    G protein-coupled receptors play a pivotal role in regulating cardiac automaticity. Their function is controlled by regulator of G protein signaling (RGS) proteins acting as GTPase-activating proteins for Galpha subunits to suppress Galpha(i) and Galpha(q) signaling. Using knock-in mice in which Galpha(i2)-RGS binding and negative regulation are disrupted by a genomic Galpha(i2)G184S (GS) point mutation, we recently (Fu Y, Huang X, Zhong H, Mortensen RM, D'Alecy LG, Neubig RR. Circ Res 98: 659-666, 2006) showed that endogenous RGS proteins suppress muscarinic receptor-mediated bradycardia. To determine whether this was due to direct regulation of cardiac pacemakers or to alterations in the central nervous system or vascular responses, we examined isolated, perfused hearts. Isoproterenol-stimulated beating rates of heterozygote (+/GS) and homozygote (GS/GS) hearts were significantly more sensitive to inhibition by carbachol than were those of wild type (+/+). Even greater effects were seen in the absence of isoproterenol; the potency of muscarinic-mediated bradycardia was enhanced fivefold in GS/GS and twofold in +/GS hearts compared with +/+. A(1)-adenosine receptor-mediated bradycardia was unaffected. In addition to effects on the sinoatrial node, +/GS and GS/GS hearts show significantly increased carbachol-induced third-degree atrioventricular (AV) block. Atrial pacing studies demonstrated an increased PR interval and AV effective refractory period in GS/GS hearts compared with +/+. Thus loss of the inhibitory action of endogenous RGS proteins on Galpha(i2) potentiates muscarinic inhibition of cardiac automaticity and conduction. The severe carbachol-induced sinus bradycardia in Galpha(i2)G184S mice suggests a possible role for alterations of Galpha(i2) or RGS proteins in sick sinus syndrome and pathological AV block.

  18. Sulfide response analysis for sulfide control using a pS electrode in sulfate reducing bioreactors.

    Science.gov (United States)

    Villa-Gomez, D K; Cassidy, J; Keesman, K J; Sampaio, R; Lens, P N L

    2014-03-01

    Step changes in the organic loading rate (OLR) through variations in the influent chemical oxygen demand (CODin) concentration or in the hydraulic retention time (HRT) at constant COD/SO4(2-) ratio (0.67) were applied to create sulfide responses for the design of a sulfide control in sulfate reducing bioreactors. The sulfide was measured using a sulfide ion selective electrode (pS) and the values obtained were used to calculate proportional-integral-derivative (PID) controller parameters. The experiments were performed in an inverse fluidized bed bioreactor with automated operation using the LabVIEW software version 2009(®). A rapid response and high sulfide increment was obtained through a stepwise increase in the CODin concentration, while a stepwise decrease to the HRT exhibited a slower response with smaller sulfide increment. Irrespective of the way the OLR was decreased, the pS response showed a time-varying behavior due to sulfide accumulation (HRT change) or utilization of substrate sources that were not accounted for (CODin change). The pS electrode response, however, showed to be informative for applications in sulfate reducing bioreactors. Nevertheless, the recorded pS values need to be corrected for pH variations and high sulfide concentrations (>200 mg/L). Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Sulfide response analysis for sulfide control using a pS electrode in sulfate reducing bioreactors

    NARCIS (Netherlands)

    Villa Gomez, D.K.; Cassidy, J.; Keesman, K.J.; Sampaio, R.M.; Lens, P.N.L.

    2014-01-01

    Step changes in the organic loading rate (OLR) through variations in the influent chemical oxygen demand (CODin) concentration or in the hydraulic retention time (HRT) at constant COD/SO4 2- ratio (0.67) were applied to create sulfide responses for the design of a sulfide control in sulfate reducing

  20. NEAR-CONTINUOUS MEASUREMENT OF HYDROGEN SULFIDE AND CARBONYL SULFIDE BY AN AUTOMATIC GAS CHROMATOGRAPH

    Science.gov (United States)

    An automatic gas chromatograph with a flame photometric detector that samples and analyzes hydrogen sulfide and carbonyl sulfide at 30-s intervals is described. Temperature programming was used to elute trace amounts of carbon disulfide present in each injection from a Supelpak-S...

  1. Hydrogen sulfide induces oxidative damage to RNA and DNA in a sulfide-tolerant marine invertebrate.

    Science.gov (United States)

    Joyner-Matos, Joanna; Predmore, Benjamin L; Stein, Jenny R; Leeuwenburgh, Christiaan; Julian, David

    2010-01-01

    Hydrogen sulfide acts as an environmental toxin across a range of concentrations and as a cellular signaling molecule at very low concentrations. Despite its toxicity, many animals, including the mudflat polychaete Glycera dibranchiata, are periodically or continuously exposed to sulfide in their environment. We tested the hypothesis that a broad range of ecologically relevant sulfide concentrations induces oxidative stress and oxidative damage to RNA and DNA in G. dibranchiata. Coelomocytes exposed in vitro to sulfide (0-3 mmol L(-1) for 1 h) showed dose-dependent increases in oxidative stress (as 2',7'-dichlorofluorescein fluorescence) and superoxide production (as dihydroethidine fluorescence). Coelomocytes exposed in vitro to sulfide (up to 0.73 mmol L(-1) for 2 h) also acquired increased oxidative damage to RNA (detected as 8-oxo-7,8-dihydroguanosine) and DNA (detected as 8-oxo-7,8-dihydro-2'-deoxyguanosine). Worms exposed in vivo to sulfide (0-10 mmol L(-1) for 24 h) acquired elevated oxidative damage to RNA and DNA in both coelomocytes and body wall tissue. While the consequences of RNA and DNA oxidative damage are poorly understood, oxidatively damaged deoxyguanosine bases preferentially bind thymine, causing G-T transversions and potentially causing heritable point mutations. This suggests that sulfide can be an environmental mutagen in sulfide-tolerant invertebrates.

  2. Sulfide response analysis for sulfide control using a pS electrode in sulfate reducing bioreactors

    NARCIS (Netherlands)

    Villa Gomez, D.K.; Cassidy, J.; Keesman, K.J.; Sampaio, R.M.; Lens, P.N.L.

    2014-01-01

    Step changes in the organic loading rate (OLR) through variations in the influent chemical oxygen demand (CODin) concentration or in the hydraulic retention time (HRT) at constant COD/SO4 2- ratio (0.67) were applied to create sulfide responses for the design of a sulfide control in sulfate reducing

  3. Hydrogen sulfide can inhibit and enhance oxygenic photosynthesis in a cyanobacterium from sulfidic springs

    NARCIS (Netherlands)

    Klatt, Judith M.; Haas, Sebastian; Yilmaz, Pelin; de Beer, Dirk; Polerecky, Lubos

    2015-01-01

    We used microsensors to investigate the combinatory effect of hydrogen sulfide (H2S) and light on oxygenic photosynthesis in biofilms formed by a cyanobacterium from sulfidic springs. We found that photosynthesis was both positively and negatively affected by H2S: (i) H2S accelerated the recovery of

  4. Hydrogen sulfide can inhibit and enhance oxygenic photosynthesis in a cyanobacterium from sulfidic springs

    NARCIS (Netherlands)

    Klatt, Judith M.; Haas, Sebastian; Yilmaz, Pelin; de Beer, Dirk; Polerecky, Lubos

    We used microsensors to investigate the combinatory effect of hydrogen sulfide (H2S) and light on oxygenic photosynthesis in biofilms formed by a cyanobacterium from sulfidic springs. We found that photosynthesis was both positively and negatively affected by H2S: (i) H2S accelerated the recovery of

  5. sulfide – reality or fantasy?

    Directory of Open Access Journals (Sweden)

    Paulina Brodek

    2016-08-01

    Full Text Available Hydrogen sulfide (H2S is a signaling gasotransmitter, involved in different physiological and pathological processes. H2S regulates apoptosis, the cell cycle and oxidative stress. H2S exerts powerful effects on smooth muscle cells, endothelial cells, inflammatory cells, endoplasmic reticulum, mitochondria and nuclear transcription factors. H2S is known to be produced from L-cysteine, D-cysteine and L-homocysteine in the body. Four enzymes – cystathionine-b synthase (CBS, mercaptopyruvate sulfurtransferase (3-MST, cystathionine-γ lyase (CSE and cysteine aminotransferase (CAT – are involved in H2S synthesis. The biosynthetic pathway for the production of H2S from D-cysteine involves 3-MST and D-amino acid oxidase (DAO. The therapeutic potential of H2S is not clear. However, recently results have demonstrated that H2S has protective action for ischemic heart disease or hypertension, and protects against ischemia of the brain. This review summarizes the negative and the positive roles of H2S in various biological systems, for example the cardiovascular system and nervous system. We also discuss the function of classical, therapeutic and natural (for example garlic donors of H2S in pre-clinical and clinical studies.

  6. Thermal decomposition of mercuric sulfide

    Energy Technology Data Exchange (ETDEWEB)

    Leckey, J.H.; Nulf, L.E.

    1994-10-28

    The rate of thermal decomposition of mercuric sulfide (HgS) has been measured at temperatures from 265 to 345 C. These data have been analyzed using a first-order chemical reaction model for the time dependence of the reaction and the Arrhenius equation for the temperature dependence of the rate constant. Using this information, the activation energy for the reaction was found to be 55 kcal/mol. Significant reaction vessel surface effects obscured the functional form of the time dependence of the initial portion of the reaction. The data and the resulting time-temperature reaction-rate model were used to predict the decomposition rate of HgS as a function of time and temperature in thermal treatment systems. Data from large-scale thermal treatment studies already completed were interpreted in terms of the results of this study. While the data from the large-scale thermal treatment studies were consistent with the data from this report, mass transport effects may have contributed to the residual amount of mercury which remained in the soil after most of the large-scale runs.

  7. InterProScan Result: AV398327 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398327 AV398327_4_ORF1 65C8DA7FC6C4D303 PANTHER PTHR10590 SODIUM/NUCLEOSIDE COTRA...NSPORTER 1.3e-109 T IPR008276 Concentrative nucleoside transporter Molecular Function: nucleoside:sodium sym

  8. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523:SF15 SODIUM/POTASSIUM-D...EPENDENT ATPASE BETA SUBUNIT, INSECT NA ? IPR000402 unintegrated Molecular Function: sodium:potassium-exchan...ss: potassium ion transport (GO:0006813)|Biological Process: sodium ion transport (GO:0006814)|Cellular Component: membrane (GO:0016020) ...

  9. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523 SODIUM/POTASSIUM-DEPEND...ENT ATPASE BETA SUBUNIT 1.1e-19 T IPR000402 ATPase, P-type cation exchange, beta subunit Molecular Function: sodiu...006754)|Biological Process: potassium ion transport (GO:0006813)|Biological Process: sodiu

  10. AVS/Express (application visualization system) user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-09-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS/Express for image processing software and Stereo viewing system. This report summarizes the information to use AVS/Express efficiently in the computer environment for image processing. (author)

  11. InterProScan Result: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 AV399953_3_ORF1 920D8122A6A51D76 PFAM PF00175 NAD_binding_1 2.5e-08 T IPR001433 Oxido...reductase FAD/NAD(P)-binding Molecular Function: oxidoreductase activity (GO:0016491)|Biological Process: oxidation reduction (GO:0055114) ...

  12. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_1_ORF2 384AC61A6604E3FD PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) 1.8e-17 T IPR015500 unintegrated ...

  13. InterProScan Result: AV405377 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405377 AV405377_1_ORF1 5614E1377E837F70 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.1e-06 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  14. InterProScan Result: AV399408 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399408 AV399408_2_ORF1 5D6D9219C673BB29 PFAM PF05274 Baculo_E25 1.3e-78 T IPR007938 unintegrated Cellular... Component: viral envelope (GO:0019031)|Cellular Component: host cell nucleus (GO:0042025) ...

  15. Pilot Implementation and Preliminary Evaluation of START:AV Assessments in Secure Juvenile Correctional Facilities.

    Science.gov (United States)

    Desmarais, Sarah L; Sellers, Brian G; Viljoen, Jodi L; Cruise, Keith R; Nicholls, Tonia L; Dvoskin, Joel A

    2012-01-01

    The Short-Term Assessment of Risk and Treatability: Adolescent Version (START:AV) is a new structured professional judgment guide for assessing short-term risks in adolescents. The scheme may be distinguished from other youth risk assessment and treatment planning instruments by its inclusion of 23 dynamic factors that are each rated for both vulnerability and strength. In addition, START:AV is also unique in that it focuses on multiple adverse outcomes-namely, violence, self-harm, suicide, unauthorized leave, substance abuse, self-neglect, victimization, and general offending-over the short-term (i.e., weeks to months) rather than long-term (i.e., years). This paper describes a pilot implementation and preliminary evaluation of START:AV in three secure juvenile correctional facilities in the southern United States. Specifically, we examined the descriptive characteristics and psychometric properties of START:AV assessments completed by 21 case managers on 291 adolescent offenders (250 boys and 41 girls) at the time of admission. Results provide preliminary support for the feasibility of completing START:AV assessments as part of routine practice. Findings also highlight differences in the characteristics of START:AV assessments for boys and girls and differential associations between the eight START:AV risk domains. Though results are promising, further research is needed to establish the reliability and validity of START:AV assessments completed in the field.

  16. InterProScan Result: AV401371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401371 AV401371_2_ORF2 4E899180012BEB2A GENE3D G3DSA:3.30.465.10 no description 7...e-07 T IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 Molecular Function: catalytic

  17. Third-degree AV block sensitive to prednisolone 72 hours post AVNRT ablation.

    Science.gov (United States)

    Parwani, Abdul S; Schröder, Anna I; Blaschke, Daniela; Blaschke, Florian; Huemer, Martin; Attanasio, Philipp; Pieske, Burkert; Boldt, Leif-Hendrik; Haverkamp, Wilhelm

    2017-05-01

    A patient developed a transient first-degree AV block during a radiofrequency ablation of an atrioventricular nodal reentrant tachycardia. Three days later the patient presented with a third-degree AV block. It resolved within 24 h under antiphlogistic therapy. Patient was asymptomatic without necessity for pacemaker implantation at 12 months follow-up.

  18. InterProScan Result: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 AV404903_2_ORF1 4CB4FF124EAAC1C5 PFAM PF05187 ETF_QO 1.7e-14 T IPR007859 Electron transfer flav...oprotein-ubiquinone oxidoreductase Molecular Function: electron-transferring-flavoprote

  19. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  20. InterProScan Result: AV399740 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399740 AV399740_3_ORF2 7A42A41D4F3F6388 PFAM PF00067 p450 1.2e-19 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  1. InterProScan Result: AV404187 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404187 AV404187_4_ORF1 AB84B56694D3FC58 PFAM PF00267 Porin_1 3.5e-13 T IPR001702 Por...in, Gram-negative type Molecular Function: transporter activity (GO:0005215)|Biological Process: transport (GO:0006810)|Cellular Component: membrane (GO:0016020) ...

  2. InterProScan Result: AV404181 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404181 AV404181_1_ORF1 F6474B68BA8D3768 PANTHER PTHR10783:SF4 XENOTROPIC AND POLY...TROPIC MURINE LEUKEMIA VIRUS RECEPTOR XPR1 NA ? IPR004342 unintegrated Cellular Component: integral to membrane (GO:0016021) ...

  3. InterProScan Result: AV404181 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404181 AV404181_1_ORF1 F6474B68BA8D3768 PANTHER PTHR10783:SF4 XENOTROPIC AND POLY...TROPIC MURINE LEUKEMIA VIRUS RECEPTOR XPR1 1.4e-114 T IPR004342 unintegrated Cellular Component: integral to membrane (GO:0016021) ...

  4. InterProScan Result: AV399344 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399344 AV399344_1_ORF2 5604F45CA0D42E5E PFAM PF05314 Baculo_ODV-E27 1.4e-47 T IPR007978 Baculovirus occlus...ion-derived virus envelope EC27 Cellular Component: viral envelope (GO:0019031) ...

  5. InterProScan Result: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 AV399741_2_ORF2 F87D90D9B5BA6C11 PFAM PF02778 tRNA_int_endo_N 5.4e-08 T IPR006678 tRNA intro...n endonuclease, N-terminal Molecular Function: tRNA-intron endonuclease activity (GO:0000213) ...

  6. InterProScan Result: AV405061 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405061 AV405061_3_ORF2 400BDC036077591E PANTHER PTHR10590 SODIUM/NUCLEOSIDE COTRA...NSPORTER 1.8e-12 T IPR008276 Concentrative nucleoside transporter Molecular Function: nucleoside:sodium symp

  7. InterProScan Result: AV398727 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398727 AV398727_2_ORF2 9953252ABA69E49B PFAM PF00762 Ferrochelatase 8.4e-28 T IPR001015 Ferroche...latase Molecular Function: ferrochelatase activity (GO:0004325)|Biological Process: heme biosynthetic process (GO:0006783) ...

  8. InterProScan Result: AV399409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 429 Baculovirus LEF-11 Biological Process: viral infectious cycle (GO:0019058)|Biological Process: regulation of transcription (GO:0045449) ... ...AV399409 AV399409_1_ORF2 07DC81A7C7B2FA42 PFAM PF06385 Baculo_LEF-11 3e-33 T IPR009

  9. InterProScan Result: AV403947 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403947 AV403947_3_ORF2 9625723E9868C46D PANTHER PTHR13768:SF2 GAMMA-SOLUBLE NSF A...TTACHMENT PROTEIN (SNAP-GAMMA) 8.7e-75 T IPR011990 unintegrated Molecular Function: binding (GO:0005488) ...

  10. InterProScan Result: AV401295 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401295 AV401295_2_ORF2 87FC32DE014A3D18 PROFILE PS50141 A_DEAMIN_EDITASE 15.862 T IPR002466 Adenosine deam...inase/editase Molecular Function: RNA binding (GO:0003723)|Molecular Function: adenosine deam

  11. InterProScan Result: AV401829 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401829 AV401829_3_ORF1 B72A6A008C2EBEA4 PANTHER PTHR11359 AMP DEAMINASE NA ? IPR0...01365 unintegrated Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)|Molecular Function: deaminase activity (GO:0019239) ...

  12. InterProScan Result: AV401295 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401295 AV401295_2_ORF2 87FC32DE014A3D18 PANTHER PTHR10910:SF17 ADENOSINE DEAMINAS...ular Function: adenosine deaminase activity (GO:0004000)|Biological Process: RNA processing (GO:0006396) ...

  13. InterProScan Result: AV401829 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401829 AV401829_3_ORF1 B72A6A008C2EBEA4 PANTHER PTHR11359 AMP DEAMINASE 6e-56 T I...PR001365 unintegrated Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)|Molecular Function: deaminase activity (GO:0019239) ...

  14. InterProScan Result: AV401888 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401888 AV401888_3_ORF1 2F04E8AA567F7BCF PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 1.5e-119 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  15. InterProScan Result: AV402282 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402282 AV402282_2_ORF1 D1F0DCC6A8296985 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 5e-97 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  16. InterProScan Result: AV399297 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ulovirus p35, apoptosis preventing protein Biological Process: anti-apoptosis (GO:0006916)|Molecular Function: caspase inhibitor activity (GO:0043027) ... ...AV399297 AV399297_3_ORF2 F5C6B0DD046B3A9D PFAM PF02331 P35 5.2e-107 T IPR003429 Bac

  17. Selvbestemmelse og oppdragelse : en teoretisk analyse av oppdragelsens påvirkning på utviklingen av selvbestemmelse

    OpenAIRE

    2007-01-01

    1) Problemstilling Hensikten med oppgaven er å rette fokus mot oppdragelse som en påvirkningsfaktor på utviklingen av selvbestemmelsen, og hvilken betydning behovstilfredsstillelse har for individets subjektive velvære. Oppdragelse er et populært tema som stadig blir debattert i mediene. Det diskuteres blant annet hvorfor oppdragelse er viktig, hvordan det er mulig å oppdra barn på best mulig måte og hvem som er viktige oppdragere i dagens samfunn. Vår oppgave handler om individets selvbes...

  18. 中国新一代图像编码格式"AVS"%Chinese new Video coding format AVS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ 中国在光盘、无线LAN、家庭内部网络等各种领域不断推出自己的规格.其中,包括中国计划2004年实现标准化的新一代图像编码格式"AVS".中国科学院有关负责人将在NAB2004技术论坛"Leading Edge Tech for TV"上,就定位相当于"MPEG"的AVS规格发表演讲.

  19. Endrer motivasjonen seg i løpet av de fire første ukene av livsstilsendringskurset EasyLife?

    OpenAIRE

    Strand, Hanne Embretsen; Nordengen, Solveig

    2011-01-01

    Vi har undersøkt motivasjonsregulering hos deltagere i et livsstilsendringsprogram. Teoretisk har vi benyttet oss av Helseoppfatningsmodellen (The Health Belief Model; Rosenstock, 1966), Den transteoretiske modellen (The Transtheoretical Model; DiClemente & Prochaska, 1982; Marcus & Simkin, 1994), Selvbestemmelsesteorien (Self-Determination Theory; Deci & Ryan, 2000) og Rosenstocks fire modeller for ansvar. For å kartlegge motivasjonsregulering har vi benyttet oss av BREQ-2 (Markland & Tobin ...

  20. Kosttilskudd og doping : metabolisme av synefrin og oktopamin og utskillelse i urin etter inntak av tilsvarende kosttilskuddsprodukter hhv. et spesielt matinntak

    OpenAIRE

    Stensrud, Linda Sørvang

    2010-01-01

    Etter at efedrin ble forbudt som tilsetningsstoff i kosttilskuddsprodukter på grunn av faren for uheldige bivirkninger, har det de senere årene dukket opp flere produkter med innhold av synefrin. Synefrin er et stimulerende stoff med lignende struktur som efedrin, men den sentralstimulerende effekten er mindre. En vanlig kilde til synefrin, som blir brukt som tilsetningsstoff i kosttilskuddspreparater og næringsmidler, er Citrus aurantium (bitterappelsin). Et annet stimulerende stoff med lign...

  1. Skolebasert forebygging av røyking blant ungdom

    Directory of Open Access Journals (Sweden)

    Ola Jøsendal m.fl

    2009-10-01

    Full Text Available SAMMENDRAGI første del av denne artikkelen gjennomgås en del utvalgte studier av skolebaserte tiltak mot røyking. Utviklingenhar gått gjennom tre faser der den siste generasjonen er de omfattende tiltakene som baserer seg på ensosial påvirkningsmodell. Godt planlagte tiltak som er basert på denne modellen har vist seg å føre til at færrebegynner å røyke. I artikkelens andre del presenteres et prosjekt som gjennomføres av Den NorskeKreftforening og som omfatter 4 441 elever fra 195 klasser ved 99 ungdomsskoler. Valg av undervisningstemaog pedagogiske tilnærminger er begrunnet i aktuelle sosialpsykologiske begreper og modeller ogerfaringer fra tidligere forskning. Intervensjonen bygger et stykke på vei på en sosial påvirkningsmodell.Skolene er delt i fire grupper. Gruppe A er kontrollgruppe. Elevene i gruppe B gjennomgår et undervisningsprogram,foreldrene involveres og lærerne gjennomgår kurser i hvordan de skal gjennomføre intervensjonen.I gruppe C gjør en det samme som i gruppe B, men lærerne kurses ikke. I gruppe D gjør en det samme som igruppe B, men foreldrene involveres ikke. Underveis gjennomføres det blant annet spørreskjemaundersøkelserblant elevene for å studere endringer i røykevaner, hvilke grupper av elever en lykkes best i å nå,hvordan elevene reagerer på tiltakene og hva som kan forklare eventuelle positive virkninger av intervensjonene.Foreløpige analyser av resultatene etter et halvt års oppfølging tyder på at det er færrest sombegynner å røyke i gruppe B, med andre ord at virkningene av tiltakene er best der lærerne kurses ogforeldrene involveres.Jøsendal O, Aarø LE, Bergh IH. School-based prevention of smoking among youths.Nor J Epidemiol ENGLISH SUMMARYThe first part of this article presents selected studies of school-based intervention programmes againstsmoking. Historically it can be distinguished between three phases in the development of such programmes.The last generation are the

  2. Indium sulfide buffer/CIGSSe interface engineering: Improved cell performance by the addition of zinc sulfide

    Energy Technology Data Exchange (ETDEWEB)

    Allsop, N.A. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany)]. E-mail: allsop@hmi.de; Camus, C. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany); Haensel, A. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany); Gledhill, S.E. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany); Lauermann, I. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany); Lux-Steiner, M.C. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany); Fischer, Ch.-H. [Hahn-Meitner-Institut Berlin, Department SE2, Glienicker Str. 100, D-14109 Berlin (Germany)

    2007-05-31

    Indium sulfide buffer layers deposited by the spray-ion layer gas reaction (Spray-ILGAR) technique are a viable alternative to the traditional cadmium sulfide buffer layer in thin film solar cells. In the present work we report on the results of manipulating the absorber/buffer interface between the chalcopyrite Cu(In,Ga)(S,Se){sub 2} absorber (CIGSSe) and the indium sulfide buffer. It is shown that the deposition of a small amount of zinc sulfide at the absorber/buffer interface can be used to increase the open circuit voltage. A small but significant increase of 20 mV (up to 580 mV), as compared to the pure indium sulfide buffered cells is possible leading to an increase in the overall efficiency.

  3. Examination of office visit patient preferences for the after-visit summary (AVS).

    Science.gov (United States)

    Neuberger, Marolee; Dontje, Katherine; Holzman, Greg; Corser, Bill; Keskimaki, Abigail; Chant, Ericka

    2014-01-01

    The federal government advocates the practice of routinely providing an after-visit summary (AVS) to patients after each office-based visit as an element of stage 1 meaningful use. A significant potential benefit of the AVS is improved patient engagement achieved by enabling patients and family members to better understand and retain key health information. The methodology for this study was a mixed-methods pilot study to examine, through the perspectives of adult primary care patients, how relevant and actionable data can be better formatted in the AVS. Results of this study suggest that the goal of the AVS to serve as a communication tool to engage and support patients is frequently not being met. Further study is needed to understand, from the viewpoints of patients and providers, what barriers are keeping them from optimally providing and using the information on the AVS.

  4. 77 FR 12163 - Airworthiness Directives; 328 Support Services GmbH (Type Certificate Previously Held by AvCraft...

    Science.gov (United States)

    2012-02-29

    ... Services GmbH (Type Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier... Services GmbH (Type Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier...: 2012-04-06 328 Support Services GmbH (Type Certificate Previously Held by AvCraft Aerospace...

  5. Vurdering av andrespråksinnlærere - en utfordring i skolen

    Directory of Open Access Journals (Sweden)

    Kirsten Palm

    2014-06-01

    Full Text Available Vurdering av andrespråkselevers språkkompetanse og språkutvikling er en sentral del av læreres arbeid, og forskning har vist at dette er en utfordring for skolene. Det er stor variasjon i vurderingsformer, og skolene mangler ofte vurderingskompetanse. På bakgrunn av dette utarbeidet Utdanningsdirektoratet i 2007 vurderingsverktøyet Kartleggingsmateriell. Språkkompetanse i grunnleggende norsk for språklige minoriteter. Materiellet er utarbeidet blant annet med referanse til Common European Framework of Reference for Languages (CEFR. I artikkelen redegjør vi for en undersøkelse der målet var å finne ut hvorvidt dette kartleggingsmateriellet er hensiktsmessig for å vurdere andrespråkselevers språkkompetanse. Hoveddataene er innhentet gjennom kasusstudier ved tre grunnskoler, der vi intervjuet skoleledelse og lærere samt observerte kartleggingssituasjoner og klasseromsundervisning. Kasusstudiene ble senere fulgt opp av to spørreundersøkelser, én til de samme skolene, og én til et større antall skoler for å få bredere innsikt i kartleggingspraksis og skolers oppfatninger av denne formen for vurdering. Undersøkelsen viser at flere av informantene mener verktøyet kan bidra til mer tilpasset og systematisk andrespråkopplæring og bedre vurdering av andrespråkselevenes språkkompetanse. Samtidig er det utfordringer knyttet til å bruke vurderingsverktøyet, dette skyldes blant annet mangelfull kompetanse i skolen når det gjelder andrespråkstilegnelse og vurdering av elevenes språkkompetanse. Det er ikke tidligere forsket på bruk av et slikt konkret kartleggingsverktøy i norsk grunnskole. Undersøkelsen kan gi et bidrag til økt kunnskap om vurdering av andrespråkskompetanse og tilpasset undervisning for andrespråksinnlærere.

  6. [(18) F]AV-1451 tau positron emission tomography in progressive supranuclear palsy.

    Science.gov (United States)

    Whitwell, Jennifer L; Lowe, Val J; Tosakulwong, Nirubol; Weigand, Stephen D; Senjem, Matthew L; Schwarz, Christopher G; Spychalla, Anthony J; Petersen, Ronald C; Jack, Clifford R; Josephs, Keith A

    2017-01-01

    The [(18) F]AV-1451 positron emission tomography ligand allows the in vivo assessment of tau proteins in the brain. It shows strong binding in Alzheimer's dementia, but little is known about how it performs in progressive supranuclear palsy, a primary 4R tauopathy. The objectives of this study were to determine whether [(18) F]AV-1451 uptake can be observed in progressive supranuclear palsy and to characterize the regional distribution when compared with controls and Alzheimer's dementia. [(18) F]AV-1451 positron emission tomography was performed in 10 patients with probable progressive supranuclear palsy. These patients were age- and gender-matched to 50 controls and 10 Alzheimer's dementia patients who had undergone identical [(18) F]AV-1451 imaging. Regional comparisons of [(18) F]AV-1451 uptake were performed across the whole brain using region-of-interest and voxel-level analyses, and correlations between regional [(18) F]AV-1451 and the progressive supranuclear palsy rating scale were assessed. An elevated [(18) F]AV-1451 signal was observed in progressive supranuclear palsy when compared with controls in the pallidum, midbrain, dentate nucleus of the cerebellum, thalamus, caudate nucleus, and frontal regions. Signal in the cerebellar dentate and pallidum were also greater in progressive supranuclear palsy when compared with Alzheimer's dementia. Conversely, the [(18) F]AV-1451 signal across the cortex was higher in Alzheimer's dementia when compared with progressive supranuclear palsy. The [(18) F]AV-1451 signal in a number of regions correlated with the progressive supranuclear palsy rating scale. Progressive supranuclear palsy is associated with an elevated [(18) F]AV-1451 signal in a characteristic and distinct regional pattern that correlates with disease severity and differs from the patterns observed in Alzheimer's dementia. © 2016 International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  7. In vivo retention of (18)F-AV-1451 in corticobasal syndrome.

    Science.gov (United States)

    Smith, Ruben; Schöll, Michael; Widner, Håkan; van Westen, Danielle; Svenningsson, Per; Hägerström, Douglas; Ohlsson, Tomas; Jögi, Jonas; Nilsson, Christer; Hansson, Oskar

    2017-08-22

    To study the usefulness of (18)F-AV-1451 PET in patients with corticobasal syndrome (CBS). We recruited 8 patients with CBS, 17 controls, 31 patients with Alzheimer disease (AD), and 11 patients with progressive supranuclear palsy (PSP) from the Swedish BioFINDER study. All patients underwent clinical assessment, (18)F-AV-1451 PET, MRI, and quantification of β-amyloid pathology. A subset of participants also underwent (18)F-FDG-PET. In the 8 patients with CBS, 6 had imaging findings compatible with the corticobasal degeneration pathology and 2 with typical AD pathology. In the 6 patients with CBS without typical AD pathology, there were substantial retentions of (18)F-AV-1451 in the motor cortex, corticospinal tract, and basal ganglia contralateral to the most affected body side. These patients could be clearly distinguished from patients with AD dementia or PSP using (18)F-AV-1451. However, cortical atrophy was more widespread than the cortical retention of (18)F-AV1451 in these CBS cases, and cortical AV-1451 uptake did not correlate with cortical thickness or glucose hypometabolism. These results are in sharp contrast to AD dementia, where (18)F-AV-1451 retention was more widespread than cortical atrophy, and correlated well with cortical thickness and hypometabolism. Patients with CBS without typical AD pathology exhibited AV-1451 retention in the motor cortex, corticospinal tract, and basal ganglia contralateral to the affected body side, clearly different from controls and patients with AD dementia or PSP. However, cortical atrophy measured with MRI and decreased (18)F-fluorodeoxyglucose uptake were more widespread than (18)F-AV-1451 uptake and probably represent earlier, yet less specific, markers of CBS. This study provides Class III evidence that (18)F-AV-1451 PET distinguishes between CBS and AD or PSP. Copyright © 2017 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of the American Academy of Neurology.

  8. In vivo retention of 18F-AV-1451 in corticobasal syndrome

    Science.gov (United States)

    Schöll, Michael; Widner, Håkan; van Westen, Danielle; Svenningsson, Per; Hägerström, Douglas; Ohlsson, Tomas; Jögi, Jonas; Nilsson, Christer

    2017-01-01

    Objective: To study the usefulness of 18F-AV-1451 PET in patients with corticobasal syndrome (CBS). Methods: We recruited 8 patients with CBS, 17 controls, 31 patients with Alzheimer disease (AD), and 11 patients with progressive supranuclear palsy (PSP) from the Swedish BioFINDER study. All patients underwent clinical assessment, 18F-AV-1451 PET, MRI, and quantification of β-amyloid pathology. A subset of participants also underwent 18F-FDG-PET. Results: In the 8 patients with CBS, 6 had imaging findings compatible with the corticobasal degeneration pathology and 2 with typical AD pathology. In the 6 patients with CBS without typical AD pathology, there were substantial retentions of 18F-AV-1451 in the motor cortex, corticospinal tract, and basal ganglia contralateral to the most affected body side. These patients could be clearly distinguished from patients with AD dementia or PSP using 18F-AV-1451. However, cortical atrophy was more widespread than the cortical retention of 18F-AV1451 in these CBS cases, and cortical AV-1451 uptake did not correlate with cortical thickness or glucose hypometabolism. These results are in sharp contrast to AD dementia, where 18F-AV-1451 retention was more widespread than cortical atrophy, and correlated well with cortical thickness and hypometabolism. Conclusions: Patients with CBS without typical AD pathology exhibited AV-1451 retention in the motor cortex, corticospinal tract, and basal ganglia contralateral to the affected body side, clearly different from controls and patients with AD dementia or PSP. However, cortical atrophy measured with MRI and decreased 18F-fluorodeoxyglucose uptake were more widespread than 18F-AV-1451 uptake and probably represent earlier, yet less specific, markers of CBS. Classification of evidence: This study provides Class III evidence that 18F-AV-1451 PET distinguishes between CBS and AD or PSP. PMID:28754841

  9. Option Pricing using Realized Volatility

    DEFF Research Database (Denmark)

    Stentoft, Lars Peter

    In the present paper we suggest to model Realized Volatility, an estimate of daily volatility based on high frequency data, as an Inverse Gaussian distributed variable with time varying mean, and we examine the joint properties of Realized Volatility and asset returns. We derive the appropriate...... benchmark model estimated on return data alone. Hence the paper provides evidence on the value of using high frequency data for option pricing purposes....

  10. Option Pricing using Realized Volatility

    DEFF Research Database (Denmark)

    Stentoft, Lars Peter

    In the present paper we suggest to model Realized Volatility, an estimate of daily volatility based on high frequency data, as an Inverse Gaussian distributed variable with time varying mean, and we examine the joint properties of Realized Volatility and asset returns. We derive the appropriate d...... benchmark model estimated on return data alone. Hence the paper provides evidence on the value of using high frequency data for option pricing purposes....

  11. A study of the stability of cadmium sulfide/copper sulfide and cadmium sulfide copper-indium-diselenide solar cells

    Science.gov (United States)

    Noel, G.; Richard, N.; Gaines, G.

    1984-08-01

    Groups of high efficiency cadmium sulfide/copper sulfide solar cells were exposed to combinations of stresses designed to isolate and accelerate intrinsic degradation mechanisms. Stresses included elevated temperature, illumination intensity, and cell loading conditions. All stress exposures and tests were conducted in a benign (high purity argon) atmosphere. Two primary intrinsic modes of degradation were identified: degradation of the open circuit voltage under continuous illumination and nonzero loading was found to be self recovering upon interruption of illumination or upon shorting or reverse biasing the cells. It was attributed to traps in the depletion region. Recovery from decay of light generated current was not spontaneous but could be partially accomplished by annealing in a reducing (hydrogen) environment. It was attributed to changes in the stoichiometry of the copper sulfide under the influence of electric fields and currents.

  12. Value of the adenosine test for diagnosis of dual AV nodal physiology in patients with AV nodal reentrant tachycardia

    Institute of Scientific and Technical Information of China (English)

    周斌全; 胡申江; 鲁端; 王建安

    2002-01-01

    Objectives: This study was aimed at assessing the value of the adenosine test for noninvasive diagnosis of dual AV nodal physiology(DAVNP) in patients with AV nodal reentrant tachycardia (AVNRT). Methods: 53 patients with paroxysmal supraventricular tachycardia (PSVT) were given incremental doses of adenosine intravenously during sinus rhythm before electrophysiological study. The adenosine test was repeated on a subset of 18 patients with AVNRT after radiofrequency catheter ablation. Results: Sudden increments of PR interval of more than 60 msec between two consecutive beats were observed in 26(83.9%) of 31 patients with typical AVNRT and 2 (9.1%) of 22 patients with AVRT and AT (P<0.01). The maximal PR increment between 2 consecutive beats in the AVNRT group(105±45ms) was significantly greater than that in the AVRT and AT group (20±13ms) (P<0.01).In postablation adenosine test, DAVNP was eliminated in all 8 patients who underwent slow pathway abolition that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS showed the slow pathway persisted. Six of 10 patients who exhibited persistent duality showed a marked reduction in the number of beats conducted in the slow pathway after adenosine injection(P<0.01).Conclusions: Administration of adenosine during sinus rhythm may be a useful bedside test for diagnosis of DAVNP in high percentage of patients with typical AVNRT and additionally for evaluating the effects of radiofrequency ablation.

  13. Sulfide capacities of fayalite-base slags

    Science.gov (United States)

    Simeonov, S. R.; Sridhar, R.; Toguri, J. M.

    1995-04-01

    The sulfide capacities of fayalite-base slags were measured by a gas-slag equilibration technique under controlled oxygen and sulfur potentials similar to those encountered in the pyrometallurgical processing of nonferrous metals. The oxygen pressure range was from 10-9.5 to 10-11 MPa and the sulfur pressure range from 10-3 to 10-4.5 MPa, over a temperature range of 1473 to 1623 K. The slags studied were FeO-SiO2 at silica saturation and those with addition of CaO, MgO, and Al2O3 to determine their effect on sulfide capacities. For these slags, the sulfide capacities were found to vary from 10-3.3 to 10-5. The sulfide capacities increased with increasing temperature from 1473 to 1623 K. A comparison of the reported plant data on sulfur content of industrial slags shows good agreement with the present experimental results. The present data will be useful in estimating metal losses in slag due to metal sulfide entrainment in nonferrous smelters.

  14. Hydrogen sulfide: neurochemistry and neurobiology.

    Science.gov (United States)

    Qu, K; Lee, S W; Bian, J S; Low, C-M; Wong, P T-H

    2008-01-01

    Current evidence suggests that hydrogen sulfide (H2S) plays an important role in brain functions, probably acting as a neuromodulator as well as an intracellular messenger. In the mammalian CNS, H2S is formed from the amino acid cysteine by the action of cystathionine beta-synthase (CBS) with serine (Ser) as the by-product. As CBS is a calcium and calmodulin dependent enzyme, the biosynthesis of H2S should be acutely controlled by the intracellular concentration of calcium. In addition, it is also regulated by S-adenosylmethionine which acts as an allosteric activator of CBS. H2S, as a sulfhydryl compound, has similar reducing properties as glutathione. In neurons, H2S stimulates the production of cAMP probably by direct activation of adenylyl cyclase and thus activate cAMP-dependent processes. In astrocytes, H2S increases intracellular calcium to an extent capable of inducing and propagating a "calcium wave", which is a form of calcium signaling among these cells. Possible physiological functions of H2S include potentiating long-term potentials through activation of the NMDA receptors, regulating the redox status, maintaining the excitatory/inhibitory balance in neurotransmission, and inhibiting oxidative damage through scavenging free radicals and reactive species. H2S is also involved in CNS pathologies such as stroke and Alzheimer's disease. In stroke, H2S appears to act as a mediator of ischemic injuries and thus inhibition of its production has been suggested to be a potential treatment approach in stroke therapy.

  15. Realization of AVS +DVB -S2 Professional Integrated Receiver Decoder%AVS +DVB -S2专业解码器的实现方法

    Institute of Scientific and Technical Information of China (English)

    周钦光; 杨雪松

    2015-01-01

    AVS +是我国自主创新的视频编码技术,可解决广播电视行业面临的频道资源问题。介绍了一种具备 DVB -S2专业多流接收和多节目再复用解密功能的 AVS +专业高清解码器的实现方法,该设备不仅能完成传统专业数字卫星解码器的所有功能,而且能进行 DVB -S2专业接收、再复用、多节目的CI 接口任意组合解密和 AVS +高清解码,为广电运营商提供了一种成本低、功能强大的 DVB -S2专业AVS +解码设备,将为早日实现 AVS +端到端应用的全覆盖做出一定的贡献。%AVS +is a Chinese independent innovative technology for video encoding.Its objective is to solve frequency resource problem in broadcasting television industry.This article shows the realization of AVS +high definition Integrated Receiver decoder,which can not only all functions of traditional and professional digital satellite decoder,but also the functions of DVB -S2 professional receiving,re-multiplexing for CI combination decrypting of multiple programs,and AVS +high definition decoding.In other words,this decoder provides op-erators with a low-cost but powerful functioning DVB -S2 professional receiving and AVS +high definition de-coding solution,making a certain contribution to the overall coverage of AVS +end -to -end application.

  16. Volatile signals during pregnancy.

    Science.gov (United States)

    Vaglio, Stefano

    2010-01-01

    Scents play a key role in mediating reproductive interactions in many vertebrates including mammals. Nowadays, several studies indicate that humans seem to use remarkably olfactory communication and are even able to produce and perceive pheromones. Furthermore, over the past several years, it became increasingly clear that pheromone-like chemical signals probably play a role in offspring identification and mother recognition. Recently developed technical procedures (solid-phase microextraction and dynamic headspace extraction) now allow investigators to characterize volatile compounds with high reliability. We analyzed the volatile compounds in sweat patch samples collected from the para-axillary and nipple-areola regions of women during pregnancy and after childbirth. We hypothesized that, at the time of birth and during the first weeks of life, the distinctive olfactory pattern of the para-axillary area is probably useful to newborn babies for recognizing and distinguishing their own mother, whereas the characteristic pattern of the nipple-areola region is probably useful as a guide to nourishment.

  17. Molecular plant volatile communication.

    Science.gov (United States)

    Holopainen, Jarmo K; Blande, James D

    2012-01-01

    Plants produce a wide array of volatile organic compounds (VOCs) which have multiple functions as internal plant hormones (e.g., ethylene, methyl jasmonate and methyl salicylate), in communication with conspecific and heterospecific plants and in communication with organisms of second (herbivores and pollinators) and third (enemies of herbivores) trophic levels. Species specific VOCs normally repel polyphagous herbivores and those specialised on other plant species, but may attract specialist herbivores and their natural enemies, which use VOCs as host location cues. Attraction of predators and parasitoids by VOCs is considered an evolved indirect defence, whereby plants are able to indirectly reduce biotic stress caused by damaging herbivores. In this chapter we review these interactions where VOCs are known to play a crucial role. We then discuss the importance of volatile communication in self and nonself detection. VOCs are suggested to appear in soil ecosystems where distinction of own roots from neighbours roots is essential to optimise root growth, but limited evidence of above-ground plant self-recognition is available.

  18. BMP2 expression in the endocardial lineage is required for AV endocardial cushion maturation and remodeling.

    Science.gov (United States)

    Saxon, Jacob G; Baer, Daniel R; Barton, Julie A; Hawkins, Travis; Wu, Bingruo; Trusk, Thomas C; Harris, Stephen E; Zhou, Bin; Mishina, Yuji; Sugi, Yukiko

    2017-10-01

    Distal outgrowth, maturation and remodeling of the endocardial cushion mesenchyme in the atrioventricular (AV) canal are the essential morphogenetic events during four-chambered heart formation. Mesenchymalized AV endocardial cushions give rise to the AV valves and the membranous ventricular septum (VS). Failure of these processes results in several human congenital heart defects. Despite this clinical relevance, the mechanisms governing how mesenchymalized AV endocardial cushions mature and remodel into the membranous VS and AV valves have only begun to be elucidated. The role of BMP signaling in the myocardial and secondary heart forming lineage has been well studied; however, little is known about the role of BMP2 expression in the endocardial lineage. To fill this knowledge gap, we generated Bmp2 endocardial lineage-specific conditional knockouts (referred to as Bmp2 cKO(Endo)) by crossing conditionally-targeted Bmp2(flox/flox) mice with a Cre-driver line, Nfatc1(Cre), wherein Cre-mediated recombination was restricted to the endocardial cells and their mesenchymal progeny. Bmp2 cKO(Endo) mouse embryos did not exhibit failure or delay in the initial AV endocardial cushion formation at embryonic day (ED) 9.5-11.5; however, significant reductions in AV cushion size were detected in Bmp2 cKO(Endo) mouse embryos when compared to control embryos at ED13.5 and ED16.5. Moreover, deletion of Bmp2 from the endocardial lineage consistently resulted in membranous ventricular septal defects (VSDs), and mitral valve deficiencies, as evidenced by the absence of stratification of mitral valves at birth. Muscular VSDs were not found in Bmp2 cKO(Endo) mouse hearts. To understand the underlying morphogenetic mechanisms leading to a decrease in cushion size, cell proliferation and cell death were examined for AV endocardial cushions. Phospho-histone H3 analyses for cell proliferation and TUNEL assays for apoptotic cell death did not reveal significant differences between control

  19. Hydrogen sulfide exposure increases desiccation tolerance in Drosophila melanogaster.

    Science.gov (United States)

    Zhong, Jian-Feng; Wang, Shu-Ping; Shi, Xiao-Qin; Mu, Li-li; Li, Guo-Qing

    2010-12-01

    Hydrogen sulfide (H(2)S) has been shown to effect physiological alterations in several animals, frequently leading to an improvement in survival in otherwise lethal conditions. In the present paper, a volatility bioassay system was developed to evaluate the survivorship of Drosophila melanogaster adults exposed to H(2)S gas that emanated from a K(2)S donor. Using this bioassay system, we found that H(2)S exposure significantly increased the survival of flies under arid and food-free conditions, but not under humid and food-free conditions. This suggests that H(2)S plays a role in desiccation tolerance but not in nutritional stress alleviation. To further confirm the suggestion, the mRNA levels of two desiccation tolerance-related genes Frost and Desat2, and a starvation-related gene Smp-30, from the control and treated flies were measured by quantitative real-time PCR. These genes were up-regulated within 2h when the flies transferred to the arid and food-free bioassay system. Addition of H(2)S further increased Frost and Desat2 mRNA levels, in contrast to Smp-30. Thus, our molecular results were consistent with our bioassay findings. Because of the molecular and genetic tools available for Drosophila, the fly will be a useful system for determining how H(2)S regulates various physiological alterations. Copyright © 2010 Elsevier Ltd. All rights reserved.

  20. A 2:1 AV rhythm: an adverse effect of a long AV delay during DDI pacing and its prevention by the ventricular intrinsic preference algorithm in DDD mode.

    Science.gov (United States)

    Minamiguchi, Hitoshi; Oginosawa, Yasushi; Kohno, Ritsuko; Tamura, Masahito; Takeuchi, Masaaki; Otsuji, Yutaka; Abe, Haruhiko

    2012-07-01

    A 91-year-old woman received a dual-chamber pacemaker for sick sinus syndrome and intermittently abnormal atrioventricular (AV) conduction. The pacemaker was set in DDI mode with a 350-ms AV delay to preserve intrinsic ventricular activity. She complained of palpitation during AV sequential pacing. The electrocardiogram showed a 2:1 AV rhythm from 1:1 ventriculoatrial (VA) conduction during ventricular pacing in DDI mode with a long AV interval. After reprogramming of the pacemaker in DDD mode with a 250-ms AV interval and additional 100-ms prolongation of the AV interval by the ventricular intrinsic preference function, VA conduction disappeared and the patient's symptom were alleviated without increasing unnecessary right ventricular pacing.

  1. Sulfide and methane production in sewer sediments.

    Science.gov (United States)

    Liu, Yiwen; Ni, Bing-Jie; Ganigué, Ramon; Werner, Ursula; Sharma, Keshab R; Yuan, Zhiguo

    2015-03-01

    Recent studies have demonstrated significant sulfide and methane production by sewer biofilms, particularly in rising mains. Sewer sediments in gravity sewers are also biologically active; however, their contribution to biological transformations in sewers is poorly understood at present. In this study, sediments collected from a gravity sewer were cultivated in a laboratory reactor fed with real wastewater for more than one year to obtain intact sediments. Batch test results show significant sulfide production with an average rate of 9.20 ± 0.39 g S/m(2)·d from the sediments, which is significantly higher than the areal rate of sewer biofilms. In contrast, the average methane production rate is 1.56 ± 0.14 g CH4/m(2)·d at 20 °C, which is comparable to the areal rate of sewer biofilms. These results clearly show that the contributions of sewer sediments to sulfide and methane production cannot be ignored when evaluating sewer emissions. Microsensor and pore water measurements of sulfide, sulfate and methane in the sediments, microbial profiling along the depth of the sediments and mathematical modelling reveal that sulfide production takes place near the sediment surface due to the limited penetration of sulfate. In comparison, methane production occurs in a much deeper zone below the surface likely due to the better penetration of soluble organic carbon. Modelling results illustrate the dependency of sulfide and methane productions on the bulk sulfate and soluble organic carbon concentrations can be well described with half-order kinetics.

  2. Membrane for hydrogen recovery from streams containing hydrogen sulfide

    Science.gov (United States)

    Agarwal, Pradeep K.

    2007-01-16

    A membrane for hydrogen recovery from streams containing hydrogen sulfide is provided. The membrane comprises a substrate, a hydrogen permeable first membrane layer deposited on the substrate, and a second membrane layer deposited on the first layer. The second layer contains sulfides of transition metals and positioned on the on a feed side of the hydrogen sulfide stream. The present invention also includes a method for the direct decomposition of hydrogen sulfide to hydrogen and sulfur.

  3. Ansatte perspektiver på utvikling av tverrfaglighet i ny sykehusavdeling

    Directory of Open Access Journals (Sweden)

    Hildfrid V. Brataas

    2009-02-01

    Full Text Available Artikkelen omhandler en følgestudie om ansattes perspektiver på teamorganisert og brukerinvolvert tverrfaglig samarbeid i en ny rehabiliteringsavdeling i et norsk sykehus. Studiens formål var å bringe frem mer kunnskap om forhold av betydning ved utvikling av tverrfaglige arbeidsformer i sammensatte helsetjenester.Metode: Undersøkelsen var kvalitativt beskrivende og fortolkende med bruk av fokusgruppeintervjuer tre og fem år etter oppstart av rehabiliteringsavdelingen.Resultater: Over en femårsperiode var praksis erfart å endre karakter, fra flerfaglig samarbeid til funksjonelt tverrfaglig samarbeid. Profesjonsoverbyggende teori om rehabiliterings-virksomheten og ledelsens kvalitetsorientering var erfart som hjelp for teamenes utvikling av funksjonell tverrfaglighet.Konklusjon: Langsiktighet, kvalitetsorientert ledelse og teamorganisert rehabiliteringsarbeid basert på profesjonsoverbyggende teoriramme synes å underbygge utvikling av funksjonell tverrfaglighetsforståelse og praksis. Denne kunnskapen er relevant ved omlegging til teamorganisert rehabiliteringsvirksomhet i eksisterende og nye virksomheter. Det er behov for mer forskning om betydning av personfaktorer og motivasjon, ledelse og overbyggende teorirammeverk for samarbeidsutvikling og kvalitet i praksis.

  4. Nodal recovery, dual pathway physiology, and concealed conduction determine complex AV dynamics in human atrial tachyarrhythmias.

    Science.gov (United States)

    Masè, Michela; Glass, Leon; Disertori, Marcello; Ravelli, Flavia

    2012-11-15

    The genesis of complex ventricular rhythms during atrial tachyarrhythmias in humans is not fully understood. To clarify the dynamics of atrioventricular (AV) conduction in response to a regular high-rate atrial activation, 29 episodes of spontaneous or pacing-induced atrial flutter (AFL), covering a wide range of atrial rates (cycle lengths from 145 to 270 ms), were analyzed in 10 patients. AV patterns were identified by applying firing sequence and surrogate data analysis to atrial and ventricular activation series, whereas modular simulation with a difference-equation AV node model was used to correlate the patterns with specific nodal properties. AV node response at high atrial rate was characterized by 1) AV patterns of decreasing conduction ratios at the shortening of atrial cycle length (from 236.3 ± 32.4 to 172.6 ± 17.8 ms) according to a Farey sequence ordering (conduction ratio from 0.34 ± 0.12 to 0.23 ± 0.06; P AV block patterns occurring during regular atrial tachyarrhythmias. The characterization of AV nodal function during different AFL forms constitutes an intermediate step toward the understanding of complex ventricular rhythms during atrial fibrillation.

  5. Baseline HV-interval predicts complete AV-block secondary to transcatheter aortic valve implantation.

    Science.gov (United States)

    Shin, Dong-In; Merx, Marc W; Meyer, Christian; Kirmanoglou, Kiriakos; Hellhammer, Katharina; Ohlig, Jan; Katsani, Dimitra; Zeus, Tobias; Westenfeld, Ralf; Eickholt, Christian; Linke, Axel; Kelm, Malte

    2015-10-01

    Development of AV-block is a frequent complication associated with transcatheter aortic valve implantation (TAVI). To date little is known about the predictive value of the HV-interval prior to TAVI with respect to the risk of AV-block development. HV-interval was determined in 25 consecutive elderly patients with severe aortic valve stenosis (AS) before and immediately after TAVI. All patients subsequently underwent TAVI and 8 of these 25 patients (32%) developed complete AV-block during the TAVI procedure requiring permanent pacemaker implantation. Six of these 8 patients (75%) had marked HV prolongation (>54 ms). Pre-procedural HV-interval was significantly prolonged in the subgroup developing complete AV-block (62.1 ms±13.0 vs 49.2 ms±12.9; P=0.029). Prolongation of the HV-interval above 54 ms was associated with a higher rate of complete AV-block (sensitivity 75.0%, specificity 77.8%, P=0.01). HV-interval was prolonged in approximately one third of our elderly patients with aortic valve stenosis and associated with a high rate of complete AV-block following TAVI. HV-interval is easily obtained during TAVI screening procedures, thus facilitating identification of patients at risk for complete AV-block due to TAVI and consequently enabling bespoke risk management.

  6. Mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet

    Directory of Open Access Journals (Sweden)

    Sven B Eriksson

    2013-01-01

    Full Text Available Det pedagogiska ledarskapet inom högre utbildning fokuseras allt mer. Det understryks genom att flera lärosäten föreskriver såväl att pedagogiska ledare ska finnas på olika nivåer, som vilka övergripande uppgifter dessa ska ha. Denna artikel är ett resultat av en fallstudie av hur de tillägnade kunskaperna och färdigheterna från kursen Pedagogiskt ledarskap, en kurs för målgruppen studierektorer/pedagogiskt ansvariga eller motsvarande arrangerad av Universitetspedagogiskt centrum, har bidragit till deltagarnas professionalisering av det pedagogiska ledarskapet ett år efter kursens slut. Fallstudien genomfördes genom gruppintervjuer. Respondenterna uttryckte att de fått ett stärkt självförtroende i rollen som pedagogiska ledare samt att kursen bidrog till en professionalisering av rollen som pedagogiska ledare genom att stärka identiteten, att skapa en början till en handlingsetik bestående av delvis delade värderingar kring det pedagogiska ansvaret samt ge utbildning och träning i färdigheter som har sin grund i teoretisk kunskap. Kursen Pedagogiskt ledarskap ger därmed ett stöd i en process mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet.

  7. Performance Comparison of AVS and H.264/AVC Video Coding Standards

    Institute of Scientific and Technical Information of China (English)

    Xin-Fu Wang; De-Bin Zhao

    2006-01-01

    A new audio and video compression standard of China, known as advanced Audio Video coding Standard (AVS),is emerging. This standard provides a technical solution for many applications within the information industry such as digital broadcast, high-density laser-digital storage media, and so on. The basic part of AVS, AVS1-P2, targets standard definition (SD) and high definition (HD) format video compression, and aims to achieve similar coding efficiency as H.264/AVC but with lower computational complexity. In this paper, we first briefly describe the major coding tools in AVS1-P2, and then perform the coding efficiency comparison between AVS1-P2 Jizhun profile and H.264/AVC main profile. The experimental results show that the AVS1-P2 Jizhun profile has an average of 2.96% efficiency loss relative to H.264/AVC main profile in terms of bit-rate saving on HD progressive-scan sequences, and an average of 28.52% coding loss on interlace-scan sequences.Nevertheless, AVS1-P2 possesses a valuable feature of lower computational complexity.

  8. Developing a computational model of human hand kinetics using AVS

    Energy Technology Data Exchange (ETDEWEB)

    Abramowitz, Mark S. [State Univ. of New York, Binghamton, NY (United States)

    1996-05-01

    As part of an ongoing effort to develop a finite element model of the human hand at the Institute for Scientific Computing Research (ISCR), this project extended existing computational tools for analyzing and visualizing hand kinetics. These tools employ a commercial, scientific visualization package called AVS. FORTRAN and C code, originally written by David Giurintano of the Gillis W. Long Hansen`s Disease Center, was ported to a different computing platform, debugged, and documented. Usability features were added and the code was made more modular and readable. When the code is used to visualize bone movement and tendon paths for the thumb, graphical output is consistent with expected results. However, numerical values for forces and moments at the thumb joints do not yet appear to be accurate enough to be included in ISCR`s finite element model. Future work includes debugging the parts of the code that calculate forces and moments and verifying the correctness of these values.

  9. EST Table: AV398400 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398400 NV021766 10/09/28 97 %/109 aa ref|NP_001091759.1| annexin isoform 2 [Bomby.../27 47 %/107 aa T07C4.9a#CE23956#WBGene00003589#locus:nex- 2#Annexin#status:Confirmed#UniProt:Q27512#protein...1|gene:ANXB10B 10/09/10 low homology 10/09/10 48 %/104 aa gi|91090858|ref|XP_967143.1| PREDICTED: similar to annexin B13a isoform 1 [Tribolium castaneum] NM_001098288 NV02 ... ...x mori] gb|ABD36280.1| annexin isoform 2 [Bombyx mori] 10/08/28 67 %/103 aa FBpp0123640|DanaGF20448-PA 10/08

  10. American AV: Edgar Dale and the Information Age Classroom.

    Science.gov (United States)

    Acland, Charles R

    2017-01-01

    This article demonstrates how the influential scholar Edgar Dale, alongside a generation of educational technologists, helped build an essential place for AV materials and pedagogical methods in the American classroom. It also shows that, for decades, the Payne Fund philanthropy supported multimedia research agendas that shaped ideas about teaching and technology, far beyond involvement in their famed studies on motion pictures and children in the 1930s. With his writings and research programs, Dale advanced concepts of media experience and systematicity, which came to be understood as common sense to the information society. In so doing he was a leading contributor to the discursive and ideological structure of our age of technological and informational abundance.

  11. EST Table: AV404143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404143 pg--0524 11/12/09 n.h 10/09/28 100 %/131 aa pdb|3FZB|A Chain A, Crystal Structure... Of The Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|B Chain B, Crystal Structure Of T...he Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|C Chain C, Crystal Structure Of The Tail Term...inator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|D Chain D, Crystal Structure O...f The Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|E Chain E, Crystal Structure Of The Tail T

  12. Consistent ranking of volatility models

    DEFF Research Database (Denmark)

    Hansen, Peter Reinhard; Lunde, Asger

    2006-01-01

    We show that the empirical ranking of volatility models can be inconsistent for the true ranking if the evaluation is based on a proxy for the population measure of volatility. For example, the substitution of a squared return for the conditional variance in the evaluation of ARCH-type models can...

  13. Political institutions and economic volatility

    NARCIS (Netherlands)

    Klomp, Jeroen; de Haan, Jakob

    2009-01-01

    We examine the effect of political 'institutions' on economic growth volatility, using data from more than 100 countries over the period 1960 to 2005, taking into account various control variables as suggested in previous studies. Our indicator of volatility is the relative standard deviation of the

  14. Acute inhalation toxicity of carbonyl sulfide

    Energy Technology Data Exchange (ETDEWEB)

    Benson, J.M.; Hahn, F.F.; Barr, E.B. [and others

    1995-12-01

    Carbonyl sulfide (COS), a colorless gas, is a side product of industrial procedures sure as coal hydrogenation and gasification. It is structurally related to and is a metabolite of carbon disulfide. COS is metabolized in the body by carbonic anhydrase to hydrogen sulfide (H{sub 2}S), which is thought to be responsible for COS toxicity. No threshold limit value for COS has been established. Results of these studies indicate COS (with an LC{sub 50} of 590 ppm) is slightly less acutely toxic than H{sub 2}S (LC{sub 50} of 440 ppm).

  15. Modeling of Sulfide Microenvironments on Mars

    Science.gov (United States)

    Schwenzer, S. P.; Bridges, J. C.; McAdam, A.; Steer, E. D.; Conrad, P. G.; Kelley, S. P.; Wiens, R. C.; Mangold, N.; Grotzinger, J.; Eigenbrode, J. L.; Franz, H. B.; Sutter, B.

    2016-01-01

    Yellowknife Bay (YKB; sol 124-198) is the second site that the Mars Science Laboratory Rover Curiosity investigated in detail on its mission in Gale Crater. YKB represents lake bed sediments from an overall neutral pH, low salinity environment, with a mineralogical composition which includes Ca-sulfates, Fe oxide/hydroxides, Fe-sulfides, amorphous material, and trioctahedral phyllosilicates. We investigate whether sulfide alteration could be associated with ancient habitable microenvironments in the Gale mudstones. Some textural evidence for such alteration may be pre-sent in the nodules present in the mudstone.

  16. Iron-sulfide crystals in probe deposits

    DEFF Research Database (Denmark)

    Laursen, Karin; Frandsen, Flemming

    1998-01-01

    Iron-sulfides were observed in deposits collected on a probe inserted at the top of the furnace of a coal-fired power station in Denmark. The chemical composition of the iron-sulfides is equivalent to pyrrhotite (FeS). The pyrrhotites are present as crystals and, based on the shape of the crystals......, it was deduced that they were not deposited but instead grew within the deposit. The presence of unburned char particles within the deposits supports the concept that a reducing environment existed in the deposits. Two processes are proposed for explaining the existence of pyrrhotite crystals within a deposit...

  17. En språkfundert kompetansemodell for planlegging av undervisning

    Directory of Open Access Journals (Sweden)

    Erik Knain

    2016-04-01

    Full Text Available I utdanningsvitenskapelig litteratur er ulike former for ”literacy” et vedvarende fokus både teoretisk og empirisk. I engelskspråklig naturfagdidaktisk litteratur brukes betegnelsen ”scientific literacy”. Jeg skisserer i denne artikkelen et planleggingsverktøy for undervisning som bygger på en eksplisitt teoretisk modell for deltakelse gjennom språk. Modellen er bindeledd mellom et generalisert kompetansebegrep og planlegging av undervisning ved at den knytter sammen de didaktiske spørsmålene hva, hvem, hvordan og hvorfor med en modell for funksjonell deltakelse. Modellen er spesielt relevant for et allmenndannende ”naturfag for alle”, men favner også et naturfag som fokuserer på utdanning av framtidas naturvitere. Artikkelen retter seg mot naturfag i skolen, men modellen bør kunne anvendes også i andre skolefag. Modellen peker mot et situert og transformativt kompetansebegrep.Nøkkelord: naturfag , kompetanse , diskurs , deltakelse, undervisning og læringAbstractVarious forms of literacy have long been the focus of educational discourses, not the least in science education where the term “scientific literacy” has been an enduring concern for decades. In this article I describe a tool for designing teaching based on a theoretical perspective on participation through language. The model connects a general conception of competence with the planning of teaching. To do so it drowe on the didactical questions of “what, who, how and why”. The model is particularly relevant in a “science for all” perspective but also for the educating of future science specialists. Although school science is the primary focus in this article, the model should be applicable to other school subjects as well. The model opens for a situated and transformative notion of competence.Keywords: scientific literacy, discourse, participation, teaching and learning

  18. Stöttning av skrivande i ett digitalt diskussionsforum

    Directory of Open Access Journals (Sweden)

    Stina Hållsten

    2017-07-01

    Full Text Available Vi vet att studenter ofta upplever akademiskt skrivande som svårt. Att skrivandet dessutom förläggs till en digital lärplattform underlättar kanske inte alltid. Större studentgrupper och minskade resurser, parallellt med ett större utbud av distanskurser, gör att digitala lärplattformar blir än viktigare inom högre utbildning. Forskning visar dock att vi i första hand använder lärplattformar i administrativt syfte, trots möjligheter till en mer pedagogisk användning, exempelvis genom mer interaktion och ett större fokus på skrivandet. Hur kan lärplattformens design och användning utvecklas pedagogiskt, närmare bestämt med ett genrepedagogiskt upplägg?Empirin för artikeln är en distanskurs i kriminologi, där all kursaktivitet skedde över utbildningens lärplattform. Kursdesignen och lärarnas aktivitet (instruktioner, responsgivande och annan stöttning analyserades tillsammans med ett mindre antal studenters användande av lärplattformen i arbetet med uppgiften Lärandedialogen. Vilka genrepedagogiska drag uppvisas redan i kursdesignen, och vilka skulle kunna förstärkas? Genrepedagogiken tar fasta på den muntliga dialogen kring text och innehåll. Därför diskuteras även hur man kan se den skriftliga, asynkrona diskussionen som något liknande det muntliga seminariesamtalet.

  19. Use of biogenic sulfide for ZnS precipitation

    NARCIS (Netherlands)

    Esposito, G.; Veeken, A.; Weijma, J.; Lens, P.N.L.

    2006-01-01

    A 600 ml continuously stirred tank reactor was used to assess the performance of a zinc sulfide precipitation process using a biogenic sulfide solution (the effluent of a sulfate-reducing bioreactor) as sulfide source. In all experiments, a proportional-integral (PI) control algorithm was used to co

  20. A physiologically based kinetic model for bacterial sulfide oxidation

    NARCIS (Netherlands)

    Klok, J.B.; Graaff, M. de; Bosch, P.L. van den; Boelee, N.C.; Keesman, K.J.; Janssen, A.J.W.M.

    2013-01-01

    In the biotechnological process for hydrogen sulfide removal from gas streams, a variety of oxidation products can be formed. Under natron-alkaline conditions, sulfide is oxidized by haloalkaliphilic sulfide oxidizing bacteria via flavocytochrome c oxidoreductase. From previous studies, it was concl

  1. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  2. Subcortical (18) F-AV-1451 binding patterns in progressive supranuclear palsy.

    Science.gov (United States)

    Cho, Hanna; Choi, Jae Yong; Hwang, Mi Song; Lee, Seung Ha; Ryu, Young Hoon; Lee, Myung Sik; Lyoo, Chul Hyoung

    2017-01-01

    Accumulation of cortical and subcortical tau pathology is the primary pathological substrate for progressive supranuclear palsy (PSP). (18) F-AV-1451, a radiotracer that binds to the pathological tau protein, may be helpful for in vivo visualization and quantitation of tau pathology in PSP. The objectives of this study were to investigate cortical and subcortical (18) F-AV-1451 binding patterns in patients with PSP. We recruited 14 PSP patients and compared their cortical and subcortical binding patterns in (18) F-AV-1451 positron emission tomography (PET) studies with those of 15 Parkinson's disease (PD) patients and 15 healthy controls. In both the PD and PSP groups, subcortical (18) F-AV-1451 binding did not correlate with the severity of motor dysfunctions, and cortical binding did not differ between the controls and each patient group. However, the PSP patients showed greater (18) F-AV-1451 binding in the putamen, globus pallidus, subthalamic nucleus, and dentate nucleus when compared with the controls, whereas the PD patients showed lower (18) F-AV-1451 binding in the substantia nigra than controls. The PSP and PD patients showed distinct subcortical (18) F-AV-1451 binding patterns reflecting subcortical tau pathology in PSP and reduced nigral neuromelanin in PD. However, there was no correlation with the severity of motor dysfunction, no cortical regions with increased binding in PSP patients, and variable degrees of subcortical binding even in the controls. Therefore, the (18) F-AV-1451 PET may be less than ideal for assessing tau pathology in PSP. Further studies will be required to validate the clinical correlation and to understand the clinical utility of (18) F-AV-1451 PET for PSP patients. © 2016 International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  3. Pathological correlations of [F-18]-AV-1451 imaging in non-alzheimer tauopathies.

    Science.gov (United States)

    Marquié, Marta; Normandin, Marc D; Meltzer, Avery C; Siao Tick Chong, Michael; Andrea, Nicolas V; Antón-Fernández, Alejandro; Klunk, William E; Mathis, Chester A; Ikonomovic, Milos D; Debnath, Manik; Bien, Elizabeth A; Vanderburg, Charles R; Costantino, Isabel; Makaretz, Sara; DeVos, Sarah L; Oakley, Derek H; Gomperts, Stephen N; Growdon, John H; Domoto-Reilly, Kimiko; Lucente, Diane; Dickerson, Bradford C; Frosch, Matthew P; Hyman, Bradley T; Johnson, Keith A; Gómez-Isla, Teresa

    2017-01-01

    Recent studies have shown that positron emission tomography (PET) tracer AV-1451 exhibits high binding affinity for paired helical filament (PHF)-tau pathology in Alzheimer's brains. However, the ability of this ligand to bind to tau lesions in other tauopathies remains controversial. Our goal was to examine the correlation of in vivo and postmortem AV-1451 binding patterns in three autopsy-confirmed non-Alzheimer tauopathy cases. We quantified in vivo retention of [F-18]-AV-1451 and performed autoradiography, [H-3]-AV-1451 binding assays, and quantitative tau measurements in postmortem brain samples from two progressive supranuclear palsy (PSP) cases and a MAPT P301L mutation carrier. They all underwent [F-18]-AV-1451 PET imaging before death. The three subjects exhibited [F-18]-AV-1451 in vivo retention predominantly in basal ganglia and midbrain. Neuropathological examination confirmed the PSP diagnosis in the first two subjects; the MAPT P301L mutation carrier had an atypical tauopathy characterized by grain-like tau-containing neurites in gray and white matter with heaviest burden in basal ganglia. In all three cases, autoradiography failed to show detectable [F-18]-AV-1451 binding in multiple brain regions examined, with the exception of entorhinal cortex (reflecting incidental age-related neurofibrillary tangles) and neuromelanin-containing neurons in the substantia nigra (off-target binding). The lack of a consistent significant correlation between in vivo [F-18]-AV-1541 retention and postmortem in vitro binding and tau measures in these cases suggests that this ligand has low affinity for tau lesions primarily made of straight tau filaments. AV-1451 may have limited utility for in vivo selective and reliable detection of tau aggregates in these non-Alzheimer tauopathies. ANN NEUROL 2017;81:117-128. © 2016 American Neurological Association.

  4. Emerging non-volatile memories

    CERN Document Server

    Hong, Seungbum; Wouters, Dirk

    2014-01-01

    This book is an introduction to the fundamentals of emerging non-volatile memories and provides an overview of future trends in the field. Readers will find coverage of seven important memory technologies, including Ferroelectric Random Access Memory (FeRAM), Ferromagnetic RAM (FMRAM), Multiferroic RAM (MFRAM), Phase-Change Memories (PCM), Oxide-based Resistive RAM (RRAM), Probe Storage, and Polymer Memories. Chapters are structured to reflect diffusions and clashes between different topics. Emerging Non-Volatile Memories is an ideal book for graduate students, faculty, and professionals working in the area of non-volatile memory. This book also: Covers key memory technologies, including Ferroelectric Random Access Memory (FeRAM), Ferromagnetic RAM (FMRAM), and Multiferroic RAM (MFRAM), among others. Provides an overview of non-volatile memory fundamentals. Broadens readers' understanding of future trends in non-volatile memories.

  5. AV interval optimization using pressure volume loops in dual chamber pacemaker patients with maintained systolic left ventricular function.

    Science.gov (United States)

    Eberhardt, Frank; Hanke, Thorsten; Fitschen, Joern; Heringlake, Matthias; Bode, Frank; Schunkert, Heribert; Wiegand, Uwe K H

    2012-08-01

    Atrioventricular (AV) interval optimization is often deemed too time-consuming in dual-chamber pacemaker patients with maintained LV function. Thus the majority of patients are left at their default AV interval. To quantify the magnitude of hemodynamic improvement following AV interval optimization in chronically paced dual chamber pacemaker patients. A pressure volume catheter was placed in the left ventricle of 19 patients with chronic dual chamber pacing and an ejection fraction >45 % undergoing elective coronary angiography. AV interval was varied in 10 ms steps from 80 to 300 ms, and pressure volume loops were recorded during breath hold. The average optimal AV interval was 152 ± 39 ms compared to 155 ± 8 ms for the average default AV interval (range 100-240 ms). The average improvement in stroke work following AV interval optimization was 935 ± 760 mmHg/ml (range 0-2,908; p AV interval changes the average stroke work by 207 ± 162 mmHg/ml. AV interval optimization also leads to improved systolic dyssynchrony indices (17.7 ± 7.0 vs. 19.4 ± 7.1 %; p = 0.01). The overall hemodynamic effect of AV interval optimization in patients with maintained LV function is in the same range as for patients undergoing cardiac resynchronization therapy for several parameters. The positive effect of AV interval optimization also applies to patients who have been chronically paced for years.

  6. Pengaruh Cara Aplikasi Pasta Gigi Herbal terhadap Produksi Volatile Sulfur Compound

    Directory of Open Access Journals (Sweden)

    Suryono Suryono

    2015-12-01

    Full Text Available Volatile Sulfur Compound (VSC merupakan komponen gas yang dihasilkan oleh bakteri dalam rongga mulut, terdiri dari Hidrogen sulfide, Methyl Mercaptan dan Dimethyl Sulfide. Ketiga komponen gas tersebut sering digunakan sebagai indikator untuk menilai status bau mulut seseorang. Pasta gigi berbasis herbal telah dilaporkan pada penelitian sebelumnya mampu menghambat pertumbuhan kuman penyebab penyakit periodontal. Bakteri plak dalam rongga mulut dapat dikurangi melalui cara gosok gigi dan/atau penggunaan material antiseptik. Dua kelompok subjek terpilih diberikan perlakuan dengan menggunakan pasta gigi herbal dengan cara yang berbeda, kelompok pertama dengan cara menggosok gigi dengan pasta gigi herbal sesuai dengan cara yang sudah biasa mereka lakukan dan kelompok ke-2 diberikan perlakuan dengan cara mengoleskan pasta herbal di daerah molar kiri dan kanan rahang atas. Pengambilan sampel nafas dilakukan sebelum perlakuan, 5 menit dan 2 jam paska menggosok gigi atau mengoles pasta herbal. Hasil pengamatan menunjukkan bahwa penggunaan pasta gigi herbal dengan cara sikat gigi maupun pengolesan memiliki pola yang sama pada masing-masing komponen gas sulfur yaitu peningkatan pada lima menit paska aplikasi kemudian menurun pada 2 jam paska aplikasi. Pasta gigi herbal yang diaplikasikan dengan cara gosok gigi maupun dengan cara pengolesan mempengaruhi kadar VSC yaitu yaitu menurunkan kadar Hydrogen sulfide, relatif stabil kadar methyl mercaptan dan terjadi peningkatan kadar dimethyl sulfide. Pasta gigi berbasis herbal dapat digunakan dengan cara sikat gigi maupun pengolesan untuk menurunkan kadar gas VSC, khususnya Hydrogen sulfide pada subjek normal. Effect of Herbal Toothpaste Application Method on Production of Volatile Sulfur Compound. Volatile sulfur compound (VSC is a component of the gas produced by bacteria in the oral cavity, consisting of hydrogen sulfide,methyl mercaptan and dimethyl sulfide. This gas is often used as an indicator to assess the

  7. Using the sulfide replacement petrology in lunar breccia 67915 to construct a thermodynamic model of S-bearing fluid in the lunar crust

    Science.gov (United States)

    Bell, Aaron S.; Shearer, Charles; deMoor, J. Maarten; Provencio, Paula

    2015-12-01

    In this work, we investigate the compositions and origin of metasomatic fluids responsible for the formation of sulfide replacement textures in Mg-Suite lithologies of lunar samples 67915-149 and 67915-150. We have constructed a quantitative thermodynamic model of the composition of the metasomatic fluid using fO2, fS2, and temperature constraints derived from a thermodynamic analysis of the metasomatic fluid-mineral reactions and the measured compositions of the phases in the sulfide assemblages. Results from this modeling indicate that the metasomatic fluid responsible for the formation of the sulfide replacement textures was likely dominated by a combination of H2 and CH4, with minor abundances of H2O, CO, and H2S. The modeling indicates that H2S was, by orders of magnitude, the dominant S-species present in the metasomatic fluid and S isotopes in the replacement sulfides suggest that the fluid experienced significant removal of H2S by sulfide precipitation. The calculated H2 and H2O contents of the metasomatic fluid are consistent with those that might be expected for the late stage degassing of shallowly emplaced, intrusive magma bodies. Sulfur, heat, and other volatile constituents (i.e., chalcophile metals and carbon) were sourced from the breccia-producing impactor; the volatile phase produced by the impact event subsequently metasomatized the crust (Haskin and Warren, 1991); The sulfide metasomatism occurred in an ejecta blanket, where both the heat and sulfur that were produced by the impactor re-mobilized volatiles, causing hydrothermal circulation within the crust that redistributed both sulfur and chalcophile elements to produce sulfide-silicate intergrowths (Haskin and Warren, 1991); and Sulfur, heat, and other volatile constituents, sourced from degassing intrusive magmas and sulfur-bearing fluid from the degassing magma, percolated into surrounding crust, metasomatizing the adjacent country rock (Norman et al., 1995). The development of these models

  8. Den blivande förskollärarens formering. En studie av verksamhetsförlagda handledningssamtal, argumentationstraditioner och metaforik

    Directory of Open Access Journals (Sweden)

    Marie-Louise Hjort

    2014-06-01

    Full Text Available I denna studie analyserar vi hur erfarna förskollärare i rollen som handledare introducerar förskollärarstudenter i professionen. Studien genomförs mot bakgrund av ett delvis nytt uppdrag som förskolan fått under senare år, som bland annat yttrar sig i att förskolan nu är en del av utbildningssystemet. Med utgångspunkt i det teoretiska begreppet argumentationstraditioner och genom att analysera metaforiken i deltagarnas resonerande, studeras hur erfarna och blivande förskollärare navigerar spänningar centrala för professionen. Deltagarnas betoning av vissa argumentationstraditioner och användningen av viss metaforik diskuteras i termer av vad de implicerar för utvecklingen av de barn som deltar i en förskoleverksamhet som formas av dessa.

  9. Governmentally amplified output volatility

    Science.gov (United States)

    Funashima, Yoshito

    2016-11-01

    Predominant government behavior is decomposed by frequency into several periodic components: updating cycles of infrastructure, Kuznets cycles, fiscal policy over business cycles, and election cycles. Little is known, however, about the theoretical impact of such cyclical behavior in public finance on output fluctuations. Based on a standard neoclassical growth model, this study intends to examine the frequency at which public investment cycles are relevant to output fluctuations. We find an inverted U-shaped relationship between output volatility and length of cycle in public investment. This implies that periodic behavior in public investment at a certain frequency range can cause aggravated output resonance. Moreover, we present an empirical analysis to test the theoretical implication, using the U.S. data in the period from 1968 to 2015. The empirical results suggest that such resonance phenomena change from low to high frequency.

  10. Volatility Exposure for Strategic Asset Allocation

    OpenAIRE

    Briere, Marie; Burgues, Alexandre; Signori, Ombretta

    2010-01-01

    The authors examine the advantages of incorporating strategic exposure to equity volatility into the investment opportunity set of a long-term equity investor. They consider two standard volatility investments: implied volatility and volatility risk premium strategies. An analytical framework, which offers pragmatic solutions for long-term investors who seek exposure to volatility, is used to calibrate and assess the risk-return profiles of portfolios. The benefit of volatility exposure for a...

  11. Reduced Heart Rate Volatility

    Science.gov (United States)

    Grogan, Eric L.; Morris, John A.; Norris, Patrick R.; France, Daniel J.; Ozdas, Asli; Stiles, Renée A.; Harris, Paul A.; Dawant, Benoit M.; Speroff, Theodore

    2004-01-01

    Objective: To determine if using dense data capture to measure heart rate volatility (standard deviation) measured in 5-minute intervals predicts death. Background: Fundamental approaches to assessing vital signs in the critically ill have changed little since the early 1900s. Our prior work in this area has demonstrated the utility of densely sampled data and, in particular, heart rate volatility over the entire patient stay, for predicting death and prolonged ventilation. Methods: Approximately 120 million heart rate data points were prospectively collected and archived from 1316 trauma ICU patients over 30 months. Data were sampled every 1 to 4 seconds, stored in a relational database, linked to outcome data, and de-identified. HR standard deviation was continuously computed over 5-minute intervals (CVRD, cardiac volatility–related dysfunction). Logistic regression models incorporating age and injury severity score were developed on a test set of patients (N = 923), and prospectively analyzed in a distinct validation set (N = 393) for the first 24 hours of ICU data. Results: Distribution of CVRD varied by survival in the test set. Prospective evaluation of the model in the validation set gave an area in the receiver operating curve of 0.81 with a sensitivity and specificity of 70.1 and 80.0, respectively. CVRD predict death as early as 24 hours in the validation set. Conclusions: CVRD identifies a subgroup of patients with a high probability of dying. Death is predicted within first 24 hours of stay. We hypothesize CVRD is a surrogate for autonomic nervous system dysfunction. PMID:15319726

  12. LNG tidscertepartier : En innføring generelt og regulering av boil-off spesielt

    OpenAIRE

    Bull, Johan Storm

    2005-01-01

    Oppgaven gir en innføring i langsiktige LNG tidscertepartier. Den tar for seg både hva som er særegent for denne kontraktstypen generelt, og gir en oversikt over typiske sider ved den konkrete reguleringen av et utvalg certepartier. Som et spesialemne, tar oppgaven for seg reguleringen av ansvaret for boil-off mellom partene. Dette er et fenomen som er spesielt for LNG farten. LNG certepartier tar for seg transport av LNG med skip. LNG står for Liquefied Natural Gas, eller flytende naturg...

  13. Måleegenskaper ved den norske versjonen av Teacher's Report Form (TRF)

    OpenAIRE

    Kornør, Hege; Drugli, May Britt

    2011-01-01

    Beskrivelse. TRF inngår som én av tre tester i Achenbach System of Empirically Based Assessment (ASEBA). Thomas Achenbach og Leslie Rescorla står bak denne testen, som kom ut i sin originalversjon på engelsk 2001. Torunn S. Nøvik og Sonja Heyerdahl publiserte den norske oversettelsen av TRF i 2002. TRF skal besvares av lærere for å kartlegge faglig fungering, tilpasning og problemområder hos barn og ungdom i skolealder. Problemdelen har én totalskåre som danner utgangspunkt for...

  14. "The Power of Christ Compels You". En studie av eksorsisme i tre filmer.

    OpenAIRE

    Morland, Espen Steensnæs

    2014-01-01

    Denne oppgaven er en studie av fenomenet eksorsisme i de tre filmene The Exorcist (1973), The Exorcist III (1990) og The Exorcism of Emily Rose (2005). Målet har vært å finne ut hvilke roller eksorsisme, kjønnsroller, det overnaturlige og Den katolske kirke spiller i disse tre filmene. I tillegg inneholder oppgaven en sammenligning av de tre filmene. De tre filmene er både like og forskjellige når det gjelder deres tilnærming til eksorsisme. En viktig del av det katolske eksorsismeritualet...

  15. [The functional dissociation of conduction within the human AV-node (author's transl)].

    Science.gov (United States)

    Runge, M; Narula, O S; Ehlers, E; Luckmann, E; Pantlen, H

    1980-07-15

    The functional dissociation (FD) of conduction within the AV-node is characterized by sudden prolongations and/or shortenings of the AH-time during stimulation. Examples for FD are presented during regular atrial stimulation and atrial extrastimulus technique. The appearance of FD is no proof for functional impairment of the AV-node. The blockade of the parasympathetic nervous system abolishes FD and leads to the well known continuous and regular adaptation of the AH-time with the various kinds of stimulation examined. It is recommended to replace the term "pathways" by the more comprehensive concept of functional dissociation with the AV-node.

  16. Om inflammatorisk tarmsykdom, samt protokollutvikling for isolasjon av enkeltceller fra colonslimhinnebiopsier

    OpenAIRE

    Dahl, Jim André; Krokstrand, Tobias Tysnes

    2011-01-01

    Inflammatorisk tarmsykdom (IBD) omfatter primært de to tilstandene, ulcerøs kolitt (UC) og morbus Crohn (MbC). Begge tilstandene karakteriseres ved kronisk inflammasjon i fordøyelseskanalen. Etiologien er ukjent, men en teori som har blitt fremmet er dysregulasjon av immunresponsen mot den kommensale tarmflora hos genetisk predisponerte individer. Insidensen av IBD er høyere i den vestlige verden enn i utviklingsland, og Norge er et av landene med høyest registrert insidens. Tilstanden kan...

  17. Langtidseffekten av kalking på lystgassemisjonen frå dyrka organisk jord

    OpenAIRE

    Hovlandsdal, Linn

    2011-01-01

    Kultivert jord er den viktigaste antropogene kjelda til dinitrogenoksid (N2O), også kalla lystgass. N2O er ein klimagass og bidreg til øydelegging av stratosfærisk ozon. Dyrka myrjord har ein større emisjon av N2O enn mineraljord. Sjølv om dyrka myrjord berre utgjer 7 – 8 % av det totale dyrka arealet i Noreg, kan dei potensielt vere ein stor bidragsytar til N2O - emisjonen frå norsk jordbruk. pH i jord er ein nøkkelvariabel for dei fleste biologiske prosessane i jorda. Kalking kan føre ti...

  18. Religion, visdom och humanism : en teologisk läsning av Hermann Hesses Siddhartha

    OpenAIRE

    Sandström, Henning E.

    2007-01-01

    Hermann Hesse (1877-1962) er en av 1900-tallets mest leste og innflytelserike forfattere. Hele hans forfatterskap kan sies å være historien om hans egen søken etter sannhet. Han var influert av Freud, Jung, mystikk og østerlandsk filosofi, men ønsket ikke å bli plassert under en etikette. I flere av sine mest berømte verker forteller han om en person som samtidig er han selv og en representant for menneskeheten. Denne personen søker sannheten om seg selv og den absolutte sannheten, men kan i...

  19. Photocatalytic degradation of 2-phenethyl-2-chloroethyl sulfide in liquid and gas phases.

    Science.gov (United States)

    Vorontsov, Alexandre V; Panchenko, Alexander A; Savinov, Evgueni N; Lion, Claude; Smirniotis, Panagiotis G

    2002-12-01

    This work explores the ability of photocatalysis to decontaminate water and air from chemical warfare agent mustard using its simulant 2-phenethyl 2-chloroethyl sulfide (PECES). PECES like mustard slowly dissolves in water with hydrolysis, forming 2-phenethyl 2-hydroxyethyl sulfide (PEHES). Irradiation of TiO2 suspension containing PECES with the unfiltered light of a mercury lamp (lambda > or = 254 nm) decomposed all PECES mostly via photolysis. Reaction under filtered light (lambda > 300 nm) proceeds mainly photocatalytically and requires longer time. Sulfur from starting PECES is completely transformed into sulfuric acid at the end of the reaction. Detected volatile, nonvolatile, surface products, and the suggested scheme of degradation are reported. The main volatile products are styrene and benzaldehyde, nonvolatile--hydroxylated PEHES, surface--2-phenethyl disulfide. Photolysis of PECES produced the same set of volatile products as photocatalysis. Photocatalytic degradation of gaseous PECES in air results in its mineralization but is accompanied by TiO2 deactivation. The highest rate of mineralization with minimum deactivation was observed at about room temperature and a water concentration of 27,500 ppm. No gaseous products except CO2 were detected. The main extracted surface product was styrene. It was concluded that PECES photocatalytic degradation proceeds mainly via C-S bond cleavage and further oxidation of the products. Hydrolysis of the C-S bond was detected only in gas-phase photocatalytic degradation. The quantum efficiency of gas-phase degradation (0.28%) was much higher than that of liquid-phase degradation (0.008%). The results demonstrate the ability of photocatalysis to decontaminate an aqueous and especially an air environment

  20. Vad vill kvinnor ha? : En undersökning av en lokaltidnings bilaga i form av ett livsstilsmagasin.

    OpenAIRE

    Heurling, Åsa; Lovisa, Lesse

    2011-01-01

    Folkbladet är en dagstidning i Norrköping med en stark lokal prägel vars prenumeranter till största delen är sportintresserade män. För att försöka bredda sin läsekrets har man sedan 2009 gett ut en tidning kallad Trend, som vänder sig till kvinnor i åldern 20 - 50 år. Denna tidning med lokal prägel, i form av ett livsstilsmagasin för kvinnor, handlar om mode, skönhet, heminredning och resor. Maga- sinet ges ut i fyra nummer per år och delas ut gratis till alla hushåll i Norrköping med omnejd...