WorldWideScience

Sample records for vol 2b pp

  1. Overexpression of RelA/SpoT homologs, PpRSH2a and PpRSH2b, induces the growth suppression of the moss Physcomitrella patens.

    Science.gov (United States)

    Sato, Michio; Takahashi, Tomohiro; Ochi, Kozo; Matsuura, Hideyuki; Nabeta, Kensuke; Takahashi, Kosaku

    2015-01-01

    Two genes encoding RelA/SpoT homologs, PpRSH2a and PpRSH2b, which are involved in the synthesis of bacterial alarmone guanosine 5'-diphosphate 3'-diphosphate (ppGpp) for the stringent response, were isolated from the moss, Physcomitrella patens. A complementary analysis of PpRSH2a and PpRSH2b in Escherichia coli showed that these genes had ppGpp biosynthetic activity. The recombinant PpRSH2a and PpRSH2b were also shown to synthesize ppGpp in vitro. Both proteins were localized to the chloroplasts of P. patens. Expression of the PpRSH genes was induced upon treatment with abscisic acid or abiotic stresses, such as dehydration and UV irradiation. Overexpression of PpRSH2a and PpRSH2b caused suppression of the growth in response to 1% (w/v) of glucose. The present study suggests the existence of a mechanism to regulate the growth of P. patens, which is governed by plant RSH in chloroplasts.

  2. 3D-QSAR studies on UDP-glucuronosyltransferase 2B7 substrates using the pharmacophore and VolSurf approaches.

    Science.gov (United States)

    Ako, Roland; Dong, Dong; Wu, Baojian

    2012-09-01

    UDP-glucuronosyltransferase 2B7 (UGT2B7) is an important enzyme responsible for clearance of many drugs. Here, we report two 3D quantitative structure-activity relationship (QSAR) models for UGT2B7 using the pharmacophore and VolSurf approach, respectively. The dataset included 53 structurally diverse UGT2B7 substrates, 36 of which were used for the training set and 17 of which for the external test set. Pharmacophore-based 3D-QSAR model (or hypothesis) was developed using the Discovery Studio program. A user-defined "glucuronidation site" feature was forcefully included in a pharmacophore hypothesis. VolSurf-based 3D-QSAR model was generated using the VolSurf program. This involves calculation of VolSurf descriptors, variable selection with the FFD algorithm, and partial least squares (PLS) analyses. The best pharmacophore model (r(2) = 0.736) consists of one glucuronidation site, one hydrogen bond acceptor, and three hydrophobic regions. Using this model, K(m) values for 14 of 17 test substrates were predicted within one log unit. The yielded VolSurf (PLS) model with two components shows statistical significance in both fitting and internal predicting (r(2) = 0.866, q(2) = 0.728). Further, the K(m) values for all test substrates were predicted within one log unit. In addition, the VolSurf model reveals an overlay of chemical features influencing the enzyme-substrate binding. Those include molecular size and shape, integy moments, capacity factors, best volumes of DRY probe, H-bonding, and log P. In conclusion, the pharmacophore and VolSurf approaches are successfully utilized to establish predictive models for UGT2B7. The derived models should be an efficient tool for high throughput prediction of UGT2B7 metabolism.

  3. Expression of protein phosphatases (PP-1, PP-2A, PP-2B and PTP-1B) and protein kinases (MAP kinase and P34cdc2) in the hippocampus of patients with Alzheimer disease and normal aged individuals.

    Science.gov (United States)

    Pei, J J; Sersen, E; Iqbal, K; Grundke-Iqbal, I

    1994-08-29

    Microtubule-associated protein tau is abnormally hyperphosphorylated in the brain of patients with Alzheimer disease (AD). Previous studies have shown (i) that in vitro tau can be phosphorylated to an Alzheimer abnormally phosphorylated state-like protein by proline-directed protein kinases MAP kinase and p34cdc2, and (ii) that the AD abnormally phosphorylated tau can be in vitro dephosphorylated by protein phosphatases PP-2B, PP-2A and PP-1 and not by PP-2C. However, to have a direct effect on the regulation of phosphorylation of tau, these enzymes should be present in the affected neurons. In the present study immunocytochemical localization of protein phosphatases PP-1, PP-2A, PP-2B and PTP, and protein kinases MAP kinase and p34cdc2 were studied in the hippocampal formation of AD and as a control in non-demented elderly patients. All the protein phosphatases and protein kinases studied were localized to both granular and pyramidal neurons. In the pyramidal neurons, the enzymes staining was observed in neuronal soma and neurites. PTP-1B, PP-1 and PP-2A were also highly expressed in microglia. The topographical distributions of all the enzymes studied were similar, i.e. the intensity of immunostaining in hippocampus in end-plate (CA3 and CA4) > prosubiculum, subiculum > entorhinal cortex > dentate gyrus > CA2 > CA1. Furthermore, the expression of all the enzymes was also observed in the tangle-bearing neurons. The PP-2B staining of the tangle-bearing neurons was weaker than the unaffected neurons in the same tissue section field in AD cases.

  4. Correction: Cocaine cardiomyopathy: A case report (2014, vol. 9, no. 3, pp. 233-237)

    OpenAIRE

    Georgijev Antonio; Zhivadinovic Julija

    2016-01-01

    In Sanamed Medical Journal, vol. 9, issue 3, in the text titled 'COCAINE CARDIOMYOPATHY-A CASE REPORT' authors made a mistake by inadequately citing parts of scientific paper, in sections Introduction and Discussion. The mistake was discovered by Center for Evaluation in Education and Science (CEON). Authors were informed from the Editorial Board of Medical Journal 'Sanamed' and the stated parts of paper were timely corrected.

  5. How Ca2+-permeable AMPA receptors, the kinase PKA, and the phosphatase PP2B are intertwined in synaptic LTP and LTD.

    Science.gov (United States)

    Hell, Johannes W

    2016-04-26

    Both synaptic long-term potentiation (LTP) and long-term depression (LTD) are thought to be critical for memory formation. Dell'Acqua and co-workers now demonstrate that transient postsynaptic incorporation of Ca(2+)-permeable (CP) α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptors (AMPARs) is required for LTD in the exemplary hippocampal CA1 region in 2-week-old mice. Mechanistically, LTD depends on AKAP150-anchored protein kinase A (PKA) to promote the initial functional recruitment of CP-AMPARs during LTD induction and on AKAP150-anchored protein phosphatase 2B (PP2B) to trigger their subsequent removal as part of the lasting depression of synaptic transmission.

  6. Ressenya a Àlex Broch (coord.) Història de la literatura catalana: Vol. I. Dels orígens al segle XIV; Vol. II. Segles XIV-XV; Vol. III. Segle XV, dirigit per Lola Badia, Barcelona, Enciclopèdia Catalana, Ed. Barcino iAjuntament de Barcelona, 2013-2014-2015, 543, 487, 494 pp. ISBN: 978-84-412-2253-3

    OpenAIRE

    Joan V. Fuertes Zapata

    2015-01-01

    Review to Àlex Broch (coord.) Història de la literatura catalana: Vol. I. Dels orígens al segle XIV; Vol. II. Segles XIV-XV; Vol. III. Segle XV, dirigitperLola Badia, Barcelona, EnciclopèdiaCatalana, Ed. Barcino iAjuntament de Barcelona, 2013-2014-2015, 543, 487, 494 pp. ISBN: 978-84-412-2253-3

  7. An Empirical Examination of Reverse Auction Appropriateness in B2B Source Selection

    Science.gov (United States)

    2006-01-01

    Measures of Marketing Constructs," Journal of Marketing Research, Vol. 16, No.2, pp. 64 - 73. Cohn, L. (2000), " B2B : The Hottest Net Bet Yet...AND SUBTITLE 5. FUNDING NUMBERS AN EMPIRICAL EXAMINATION OF REVERSE AUCTION APPROPRIATENESS IN B2B SOURCE SELECTION. 6. AUTHOR(S) MAJ HAWKINS TIMOTHY...Examination of Reverse Auction Appropriateness in B2B Source Selection D :7;TZU IUT•ITM STATER,;77TIT A Approved for Puhtic P-•-!,ase Distribution

  8. Measurement of the differential γ+2b-jet cross section and the ratio σ(γ+2b-jets/σ(γ+b-jet in pp¯ collisions at s=1.96 TeV

    Directory of Open Access Journals (Sweden)

    V.M. Abazov

    2014-10-01

    Full Text Available We present the first measurements of the differential cross section dσ/dpTγ for the production of an isolated photon in association with at least two b-quark jets. The measurements consider photons with rapidities |yγ|15 GeV and |yjet|<1.5. The ratio of differential production cross sections for γ+2 b-jets to γ+b-jet as a function of pTγ is also presented. The results are based on the proton–antiproton collision data at s=1.96 TeV collected with the D0 detector at the Fermilab Tevatron Collider. The measured cross sections and their ratios are compared to the next-to-leading order perturbative QCD calculations as well as predictions based on the kT-factorization approach and those from the sherpa and pythia Monte Carlo event generators.

  9. Reply to `Extended Rejoinder to "Extended Comment on "One-Range Addition Theorems for Coulomb Interaction Potential and Its Derivatives" by I. I. Guseinov (Chem. Phys. Vol. 309 (2005), pp. 209 - 211)", arXiv:0706.0975v2"

    CERN Document Server

    Weniger, Ernst Joachim

    2007-01-01

    In the years from 2001 to 2006, Guseinov and his coworkers published 40 articles on the derivation and application of one-range addition theorems. In E. J. Weniger, Extended Comment on ``One-Range Addition Theorems for Coulomb Interaction Potential and Its Derivatives'' by I. I. Guseinov (Chem. Phys. Vol. 309 (2005), pp. 209 - 213), arXiv:0704.1088v2 [math-ph], it was argued that Guseinov's treatment of one-range addition theorems is at best questionable and in some cases fundamentally flawed. In I. I. Guseinov, Extended Rejoinder to "Extended Comment on "One-Range Addition Theorems for Coulomb Interaction Potential and Its Derivatives'' by I. I. Guseinov (Chem. Phys. and Vol. 309 (2005)'', pp. 209-213), arXiv:0706.0975v2 [physics.chem-ph], these claims were disputed. To clarify the situation, the most serious mathematical flaws in Guseinov's treatment of one-range addition theorems are discussed in more depth.

  10. Anne Bysted, Carsten Selch Jensen, Kurt Villads Jensen, John H. Lind, Jerusalem in the North: Denmark and the Baltic Crusades, 1100–1522 (Outremer: Studies in the Crusades and the Latin East, vol. 1), Brepols, Turnhout 2012, 393 pp.+ 57 figures and 5 maps

    OpenAIRE

    Czaja, Roman

    2016-01-01

    Anne Bysted, Carsten Selch Jensen, Kurt Villads Jensen, John H. Lind, Jerusalem in the North: Denmark and the Baltic Crusades, 1100–1522 (Outremer: Studies in the Crusades and the Latin East, vol. 1), Brepols, Turnhout 2012, 393 pp. + 57 figures and 5 maps, ISBN: 978-2-503-52325-5.

  11. Authors' reply to Discussion by E. Siebrits and S. L. Crouch regarding the paper "A two-dimensional linear variation displacement discontinuity method for three-layered elastic media", International Journal of Rock Mechanics and Mining Sciences, Vol. 36, No. 6, pp. 719-729, 1999

    CSIR Research Space (South Africa)

    Shou, KJ

    2000-07-01

    Full Text Available to Discussion by E. Siebrits and S. L. Crouch regarding the paper ``A two-dimensional linear variation displacement discontinuity method for three-layered elastic media'', International Journal of Rock Mechanics and Mining Sciences, Vol. 36, No. 6, pp. 719... of judging the accuracy of their ``highly accurate semi-analytic simulator'' which is International Journal of Rock Mechanics and Mining Sciences 37 (2000) 877±878 1365-1609/00/$ - see front matter 7 2000 Elsevier Science Ltd. All rights reserved. PII: S...

  12. Discussion on the paper entitled "Indian Contribution in the Field of Palaeo-oceanography (2006-2012)" by A K Gupta et al., 2012. Proc Indian Nat Sci Acad Vol. 78, No. 3 (IUGS Special Issue) pp. 313-319: Serious flaws in the status report on Indian palaeoceanography

    Digital Repository Service at National Institute of Oceanography (India)

    Banakar, V.K.

    published papers, which are based on sediment cores collected by several Indian researchers on-board the Indian research vessels”. The third paragraph of Banakar’s comments again raises the question of not incorporating some references. Also he has mentioned... Discussion Discussion on the paper entitled “Indian Contribution in the Field of Palaeo-oceanography (2006-2012)” by A K Gupta et al., 2012. Proc Indian Nat Sci Acad Vol. 78, No. 3 (IUGS Special Issue) pp. 313-319 Discussion: Serious Flaws in the Status...

  13. B2B marketing

    OpenAIRE

    Pospíšilová, Lucie

    2010-01-01

    The main goal of this bachelor thesis is to apply theoretical knowledge in B2B marketing to the example of marketing processes in a particular company, to evaluate the current situation of its activities with regard to B2B principles and to suggest relevant recommendations. The theoretical part focuses on specific characteristics of B2B marketing, describes its differences from marketing on consumer markets, deals with buying behaviour of organizations and specifies particular features of mar...

  14. Measurement of jets produced in top quark events using the $e\\mu$ final state with 2 b-tagged jets in pp collisions at $\\sqrt{s }= $ 8 TeV with the ATLAS detector

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00354197

    The transverse momentum (pT) and multiplicity of jets produced in top quark events are measured using 20.3 inverse femtobarns of pp collision data at a center-of-mass energy of 8 TeV. Jets are selected from top events requiring an opposite-charge $e\\mu$ pair and two b-tagged jets in the final state. The data are corrected to obtain the particle-level fiducial cross section for additional jets with rank 1-4, where rank=1 is the leading additional jet. These distributions are used to obtain the extra jet multiplicity as a function of minimum jet pT threshold. The results are compared with several next to leading order Monte Carlo generators. The resulting measurements can be used to tune Monte Carlo QCD modelling and may also reduce associated modelling uncertainties for LHC top quark physics measurements.

  15. Measurement of sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1 -->J/psi gamma) in pp collisions at square root s=1.96 TeV.

    Science.gov (United States)

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; Datta, M; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-06-08

    We measure the ratio of cross section times branching fraction, Rp=sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1-->J/psi gamma), in 1.1 fb(-1) of pp collisions at square root s=1.96 TeV. This measurement covers the kinematic range pT(J/psi)>4.0 GeV/c, |eta(J/psi)1.0 GeV/c. For events due to prompt processes, we find Rp=0.395+/-0.016(stat)+/-0.015(syst). This result represents a significant improvement in precision over previous measurements of prompt chi c1,2 hadro production.

  16. Measurement of the differential γ+2b-jet cross section and the ratio σ(γ+2b-jets)/σ(γ+b-jet) in pp{sup ¯} collisions at √(s)=1.96 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Abazov, V.M. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Abbott, B. [University of Oklahoma, Norman, OK 73019 (United States); Acharya, B.S. [Tata Institute of Fundamental Research, Mumbai (India); Adams, M. [University of Illinois at Chicago, Chicago, IL 60607 (United States); Adams, T. [Florida State University, Tallahassee, FL 32306 (United States); Agnew, J.P. [The University of Manchester, Manchester M13 9PL (United Kingdom); Alexeev, G.D. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Alkhazov, G. [Petersburg Nuclear Physics Institute, St. Petersburg (Russian Federation); Alton, A. [University of Michigan, Ann Arbor, MI 48109 (United States); Askew, A. [Florida State University, Tallahassee, FL 32306 (United States); Atkins, S. [Louisiana Tech University, Ruston, LA 71272 (United States); Augsten, K. [Czech Technical University in Prague, Prague (Czech Republic); Avila, C. [Universidad de los Andes, Bogotá (Colombia); Badaud, F. [LPC, Université Blaise Pascal, CNRS/IN2P3, Clermont (France); Bagby, L.; Baldin, B. [Fermi National Accelerator Laboratory, Batavia, IL 60510 (United States); Bandurin, D.V. [University of Virginia, Charlottesville, VA 22904 (United States); Banerjee, S. [Tata Institute of Fundamental Research, Mumbai (India); Barberis, E. [Northeastern University, Boston, MA 02115 (United States); Baringer, P. [University of Kansas, Lawrence, KS 66045 (United States); and others

    2014-10-07

    We present the first measurements of the differential cross section dσ/dp{sub T}{sup γ} for the production of an isolated photon in association with at least two b-quark jets. The measurements consider photons with rapidities |y{sup γ}|<1.0 and transverse momenta 3015 GeV and |y{sup jet}|<1.5. The ratio of differential production cross sections for γ+2b-jets to γ+b-jet as a function of p{sub T}{sup γ} is also presented. The results are based on the proton–antiproton collision data at √(s)=1.96 TeV collected with the D0 detector at the Fermilab Tevatron Collider. The measured cross sections and their ratios are compared to the next-to-leading order perturbative QCD calculations as well as predictions based on the k{sub T}-factorization approach and those from the SHERPA and PYTHIA Monte Carlo event generators.

  17. Fit 2-B FATHERS.

    Science.gov (United States)

    Maiorano, Joseph J.

    2001-01-01

    Fit 2-B FATHERS is a parenting-skills education program for incarcerated adult males. The goals of this program are for participants to have reduced recidivism rates and a reduced risk of their children acquiring criminal records. These goals are accomplished by helping participants become physically, practically, and socially fit for the demands…

  18. GRIN2B encephalopathy

    DEFF Research Database (Denmark)

    Platzer, Konrad; Yuan, Hongjie; Schütz, Hannah

    2017-01-01

    presented with neurodevelopmental disorders and a spectrum of hypotonia, movement disorder, cortical visual impairment, cerebral volume loss and epilepsy. Six patients presented with a consistent malformation of cortical development (MCD) intermediate between tubulinopathies and polymicrogyria. Missense...... treatment response in the respective patients still remains to be demonstrated. CONCLUSIONS: In addition to previously known features of intellectual disability, epilepsy and autism, we found evidence that GRIN2B encephalopathy is also frequently associated with movement disorder, cortical visual impairment...

  19. Interferon Alfa-2b Injection

    Science.gov (United States)

    Interferon alfa-2b injection is used to treat a number of conditions.Interferon alfa-2b injection is used alone or in ... Hodgkin's lymphoma (NHL; a slow-growing blood cancer). Interferon alfa-2b is in a class of medications ...

  20. Enregistreur de vol

    OpenAIRE

    Osen, Alexander; Bianchi, Christophe

    2012-01-01

    Ce travail consiste à développer un prototype d'enregistreur de vol spécifique au moto-planeur électrique, il doit donc pouvoir enregistrer la position du planeur et détecter si le système de propulsion est en marche

  1. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  2. State-of-the-art Review : Vol. 2B. Integrated Building Concepts

    DEFF Research Database (Denmark)

    van der Aa, Ad; Andresen, Inger; Asada, Hideo;

    The purpose of this report is to give examples of integrated building concepts and related available performance data and information. The report does not aspire to give a complete overview of all possible integrated building concepts and processes. The buildings included in the report have been ...

  3. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    Directory of Open Access Journals (Sweden)

    Emmanuel eStrahm

    2013-06-01

    Full Text Available Nandrolone (19-nortestosterone is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17 are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are the two main enzymes responsible of 19-norandrosterone glucuronidation. However, the identity of the enzyme involved in nandrolone metabolism in vivo together with their relative contribution and regulation remain unknown.Inhibition assays using human liver microsomes incubated with 19-norandrosterone and selective inhibitors confirmed that UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation, since the presence of the specific UGT2B7 and UGT2B15 inhibitors gemfibrosil and valproic acid inhibited the 19-norandrosterone glucuronidation by 35 and 45 %, respectively. Human liver microsomes were genotyped for UGT2B15 D85Y, UGT2B7 H268Y and the UGT2B17 deletion polymorphism. The glucuronidation activity on 19 norandrosterone was significantly higher in UGT2B15 DD than in the other UGT2B15 genotypes (p<0.05. Moreover, human liver cancer HepG2 cells were exposed to androgens to determine if the transcriptional activity of the genes of interest was affected. Only UGT2B7 mRNA expression was significantly increased (1.8-folds after incubation with nandrolone decanoate.These results show that the UGT2B7 and UGT2B15 are involved in 19-norandrosterone glucuronidation and that the UGT2B15 polymorphism (D85Y is the only UGT genetic variation that influences the glucuronidation activity. This could partly explain the inter-individual variation in 19 norandrosterone excretion.

  4. FE DE ERRATAS VOL. 10 No. 1

    OpenAIRE

    Poutou Piñales, Raúl Alberto; Departamento de Microbiología Facultad de Ciencias Pontificia Universidad Javeriana, Bogotá

    2005-01-01

    1. En el artículo publicado en el volumen 10, No. 1, pp. 5-14 los títulos de las figurasincluidas son:Figura 1. TÍTULO: Plasticidad de las células madre adultas.Figura 2a. TÍTULO: Modelo clásico de diferenciación celular. Adaptación de Körbling,M y Zeev, E. 2003. Adult Stem Cells for Tissue Repair. A New Therapeutic Concept?. NEngl J Med, 349:570-582.Figura 2b. TÍTULO: Modelo de diferenciación celular para precursores comprometidos. Adaptación de Körbling, M y Zeev, E. 2003. Adult Stem Cells ...

  5. Implication of human UGT2B7, 2B15 and 2B17 in 19-norandrosterone metabolism

    OpenAIRE

    Emmanuel eStrahm; Ulf eSjöberg; Mats eGarle; Anders eRane; Lena eEkström

    2013-01-01

    Nandrolone (19-nortestosterone) is an anabolic androgenic steroid commonly abused for doping purposes. Nandrolone is mainly metabolized in the liver into 19-norandrosterone prior to glucuronidation and excretion through urine over an extended period of time. Several UGTs (i.e. UGT2B7, UGT2B15 and UGT2B17) are thought to be the major enzymes responsible for conjugation of androgens in human. An in-vitro study using recombinant enzymes expressed in insect cells showed that UGT1A4 and UGT2B7 are...

  6. Investigation of Class 2b Trucks

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.C.

    2002-04-03

    The popularity of trucks in the class 2 category--that is, those with a 6,000 to 10,000 pounds (lbs) gross vehicle weight rating (GVWR)--has increased since the late 1970s/early 1980s. The purpose of this research is to identify and examine vehicles in the upper portion of the class 2 weight range (designated as vehicle class 2b) and to assess their impact. Vehicles in class 2b (8,500-10,000 lbs GVWR) include pickup trucks, sport utility vehicles (SUVs), and large vans (i.e., not minivans). Oak Ridge National Laboratory researched each individual truck model to determine which models were class 2b trucks and arrived at four methodologies to derive sales volumes. Two methods--one for calendar year and one for model year sales--were recommended for producing believable and reliable results. The study indicates that 521,000 class 2b trucks were sold in calendar year 1999--6.4% of sales of all trucks under 10,000 lbs. Eighty-two percent of class 2b trucks sold in 1999 were pickups; one third of class 2b trucks sold in 1999 were diesel. There were 5.8 million class 2b trucks on the road in 2000, which amounts to 7.8% of all trucks under 10,000 lbs. Twenty-four percent of the class 2b truck population is diesel. Estimates show that class 2b trucks account for 8% of annual miles traveled by trucks under 10,000 lbs and 9% of fuel use. Data on class 2b trucks are scarce. As the Tier 2 standards, which apply to passenger vehicles in the 8,500-10,000 lb GVWR category, become effective, additional data on class 2b trucks may become available--not only emissions data, but data in all areas. At the moment, distinguishing class 2b trucks from class 2 trucks in general is a substantial task requiring data on an individual model level.

  7. Vibration Theory, Vol. 1B

    DEFF Research Database (Denmark)

    Asmussen, J. C.; Nielsen, Søren R. K.

    The present collection of MATLAB exercises has been published as a supplement to the textbook, Svingningsteori, Bind 1 and the collection of exercises in Vibration theory, Vol. 1A, Solved Problems. Throughout the exercise references are made to these books. The purpose of the MATLAB exercises is ...... is to give a better understanding of the physical problems in linear vibration theory and to surpress the mathematical analysis used to solve the problems. For this purpose the MATLAB environment is excellent....

  8. Structural Basis for the Catalytic Activity of Human Serine/Threonine Protein Phosphatase type 5 (PP5)

    Science.gov (United States)

    Swingle, Mark R.; Ciszak, Ewa M.; Honkanen, Richard E.

    2004-01-01

    Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP-gene family of protein phosphatases that is widely expressed in mammalian tissues and is highly conserved among eukaryotes. PP5 associates with several proteins that affect signal transduction networks, including the glucocorticoid receptor (GR)-heat shock protein-90 (Hsp90)-heterocomplex, the CDC16 and CDC27 subunits of the anaphase-promoting complex, elF2alpha kinase, the A subunit of PP2A, the G12-alpha / G13-alpha subunits of heterotrimeric G proteins and DNA-PK. The catalytic domain of PP5 (PP5c) shares 35-45% sequence identity with the catalytic domains of other PPP-phosphatases, including protein phosphatase-1 (PP1), -2A (PP2A), -2B / calcineurin (PP2B), -4 (PP4), -6 (PP6), and -7 (PP7). Like PP1, PP2A and PP4, PP5 is also sensitive to inhibition by okadaic acid, microcystin, cantharidin, tautomycin, and calyculin A. Here we report the crystal structure of the PP5 catalytic domain (PP5c) at a resolution of 1.6 angstroms. From this structure we propose a mechanism for PP5-mediated hydrolysis of phosphoprotein substrates, which requires the precise positioning of two metal ions within a conserved Asp(sup 271)-M(sub 1):M(sub 2)-W(sup 1)-His(sup 304)-Asp(sup 274) catalytic motif. The structure of PP5c provides a possible structural basis for explaining the exceptional catalytic proficiency of protein phosphatases, which are among the most powerful known catalysts. Resolution of the entire C-terminus revealed a novel subdomain, and the structure of the PP5c should also aid development of type-specific inhibitors.

  9. Propofol inhibits LPS-induced apoptosis in lung epithelial cell line, BEAS-2B.

    Science.gov (United States)

    Lv, Xiang; Zhou, Xuhui; Yan, Jia; Jiang, Jue; Jiang, Hong

    2017-03-01

    Lipopolysaccharide (LPS) plays an important role in lung endothelial apoptosis which is crucial for lung fibrogenesis in ARDS progression. Reactive oxygen species (ROS) has been reported to be involved in LPS-induced lung epithelial cell apoptosis. Propofol is a commonly used intravenous anesthetic agent in clinic and it could attenuate LPS-induced epithelial cells oxidation and apoptosis. However, the mechanisms are still obscure. In this study, we examined whether and how propofol attenuates LPS-induced oxidation and apoptosis in BEAS-2B cells. Compared with control group, LPS up-regulated Pin-1, phosphatase A2 (PP2A) expression, induced p66(Shc)-Ser(36) phosphorylation, and facilitated p66(Shc) mitochondrial translocation, thus leading to superoxide anion (O2(-)) generation, mitochondrial cytochrome c release, active caspase 3 over-expression and cell viability inhibition. Importantly, propofol was shown to down-regulate LPS-induced PP2A expression, limit p66(Shc) mitochondrial translocation, decrease O2(-) generation, inhibit mitochondrial cytochrome c release, reduce active caspase 3 expression, and recover cells viability, while propofol had no effects on LPS-induced Pin-1 expression and p66(Shc)-Ser(36) phosphorylation. Moreover, the protective effects of propofol on LPS-induced BEAS-2B cells apoptosis were similar to that of calyculin A, which is an inhibitor of PP2A. We also found that FTY720, which is an activator of PP2A, can effectively reverse the protective function of propofol. Our data illustrated that propofol could alleviate LPS-induced BEAS-2B cells oxidation and apoptosis through down-regulating PP2A expression, limiting p66(Shc)-Ser(36) dephosphorylation and p66(Shc) mitochondrial translocation, decreasing O2(-) generation, mitochondrial cytochrome c release, activating caspase 3 expression. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  10. B2B Pioneer A Millionaire Maker

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    China should soon see its largest group of instant millionaires after Jack Ma,Chief Executive Officer and Chairman of Alibaba Group,announced on July 27 that the China’s preeminent e-commerce company has initiated the listing of its B2B unit alibaba.com

  11. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  12. WTS-2 b: Too close for comfort?

    Directory of Open Access Journals (Sweden)

    Kovács G.

    2013-04-01

    Full Text Available We report the discovery of WTS-2 b, a typical hot Jupiter in an unusually close 1.02-day orbit to a K-dwarf star. This is the second planet to be discovered in the infrared light curves of the WFCAM Transit Survey (WTS and is only one-and-a-half times the separation from its host star at which is would be destroyed by Roche lobe overflow. The predicted remaining lifetime of the planet is just 38 Myrs, assuming a tidal dissipation quality factor of Q'* = 106. The magnitude of Q'* is largely unconstrained by observations, thus WTS-2 b provides a useful calibration point for theories describing how frictional processes within a host star affect the tidal orbital evolution of its companion giant planets. It is expected that stars with large convective envelopes are more efficient at dissipating the orbital energy of the planet, and WTS-2 b provides an observational constraint in the sparsely populated K-dwarf regime. In addition, despite its relatively faint magnitude, the favourable size ratio of the WTS-2 star-planet system and the predicted hot equilibrium temperature of the planet will make it possible to characterise the planet's atmosphere via secondary eclipse measurements using existing ground-based instrumentation.

  13. Rotary-Balance Testing for Aircraft Dynamics (Les Essais sur Balance Rotative pour l’Etude de la Dynamique du Vol de l’Avion)

    Science.gov (United States)

    1990-01-01

    Applied Yawing Moments by Use of Rotary Balance Data. NACA TN 3321, 1954. 16. Bazzocchi, B.: Un Metodo per la Deterininazione alla Galleria del Vento...and’Barnhart, B. Spin Prediction Techniques. J. of Aircraft, Vol. 20, No. 2, Feb. 1983, pp. 97-101. 2. Valtorta, E.: Analisi delle prove in galleria con

  14. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  15. What Happened with Spectrometer Magnet 2B

    Energy Technology Data Exchange (ETDEWEB)

    Green, Michael A

    2010-05-27

    The spectrometer solenoid is supposed to be the first magnets installed in MICE [1]-[4]. This report described what happened during the test of the MICE spectrometer solenoid 2B. First, the report describes the temperatures in the magnet, the cooler top plate and the shield during the run where the magnet quenched at 258 A. During this quench, a lead between the bottom of the HTS leads and the diode bank burned out causing the magnet to quench. Second, three methods for measuring the net heat flow into the cold mass are described. Third, there is a discussion of possible resistive heating in the HTS leads between liquid helium temperature and the copper plate, which is at about 50 K. Fourth, there is a discussion of the measured first stage heat loads in the magnet, when there is no current in the magnet. The first stage heat load calculations are based on knowing the first stage temperatures of the three two-stage pulse tube coolers and the single stage GM cooler. Fifth, the estimated heat load to the first stage when the magnet has current in it is discussed. Sixth, there is a comparison of the stage 1 heat loads in magnet 1A [5], magnet 2A [6], and magnet 2B [7]. Finally there is a discussion of recommended changes for improving the spectrometer solenoids so that the coolers can keep them cold.

  16. Vol 38 2010 Art 6.pub

    African Journals Online (AJOL)

    p2613611

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 38, 2010 .... m only —foods which prom ote health beyond providing .... health conscious individuals may be motivated to process ...... Food industry forecast: Consumer.

  17. Vol 37 2009 Art 3.pub

    African Journals Online (AJOL)

    user

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 37, 2009. Young adult ..... decision making on products (Alch, 2005; Anderson et al, 2007; Berndt, .... gies during the shopping process (Y Monsuwe´ et al,. 2004).

  18. State-of-the-art Review : Vol. 2B. Methods and Tools for Designing Integrated Building Concepts

    DEFF Research Database (Denmark)

    van der Aa, Ad; Andresen, Inger; Asada, Hideo;

    The purpose of this report is to give examples of methods and tools that are used in the design of integrated building. The report does not aspire to give a complete overview of all possible design methods and tool. The report will serve as a common basis for the research and development work tha...

  19. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  20. PP-HBP改性PP/PVC的流变行为%Study on Rheologic Behavior of PP Grafted with Hyperbranched Poly (amide-ester)/PP/PVC Blends

    Institute of Scientific and Technical Information of China (English)

    刁建志; 宋晓红; 张建民; 彭政

    2006-01-01

    研究了聚丙烯接枝超支化聚(酰胺-酯)(PP-HBP)/PP/聚氯乙烯(PVC)共混体系的流变行为.讨论了PP-HBP用量对PP/PVC共混体系流变行为的影响.结果表明,当PP/PVC共混体系中加入PP-HBP不大于5份时,PP/PVC/PP-HBP共混体系的表观粘度大于PP/PVC共混体系的;当加入PP-HBP大于5份时,PP/PVC/PP-HBP共混体系的表观粘度小于PP/PVC共混体系的;随着温度升高,PP/PVC和PP/PVC/PP-HBP共混体系表观粘度减小.

  1. Microstructure analysis of graphite/Cu joints brazed with (Cu-50TiH{sub 2}) + B composite filler

    Energy Technology Data Exchange (ETDEWEB)

    Mao, Yangwu, E-mail: yangwu.mao@gmail.com [Key Laboratory of Plasma Chemistry and Advanced Materials of Hubei Province, Wuhan Institute of Technology, Wuhan 430073 (China); Yu, Si [Key Laboratory of Plasma Chemistry and Advanced Materials of Hubei Province, Wuhan Institute of Technology, Wuhan 430073 (China); Zhang, Yizhong [Zhuzhou Cemented Carbide Cutting Tools Co., Ltd., Zhuzhou, Hunan 412007 (China); Guo, Beibei; Ma, Zhibin; Deng, Quanrong [Key Laboratory of Plasma Chemistry and Advanced Materials of Hubei Province, Wuhan Institute of Technology, Wuhan 430073 (China)

    2015-11-15

    Highlights: • TiB whiskers are synthesized in situ in the filler layer of graphite/copper joints. • Boron content has a considerable effect on the strength and microstructure of joints. • TiB whiskers could serve as reinforcements, contributing to the improvement of joints. - Abstract: Joining of carbon materials to copper will benefit the fabrication of plasma facing components for fusion applications. Graphite/Cu joints have been prepared by brazing with (Cu-50TiH{sub 2}) + B composite filler in a vacuum. The effect of boron content in the composite filler on the mechanical property and microstructure of brazed graphite/Cu joints has been investigated. The average shear strength of joints increases with boron content raising from 0 to 15 vol%. The maximum average shear strength of 19.8 MPa was obtained with boron content of 15 vol%. Then, the strength of joints decreases with boron content higher than 15 vol%. The microstructure analysis of joints brazed with (Cu-50TiH{sub 2}) + 15 vol% B filler indicates that TiB whiskers have been in situ synthesized in the filler layer. The filler layer is mainly composed of Cu based solid solution and Ti-Cu intermetallic compounds with TiB whiskers distributed inside. The distribution of TiB whiskers in the filler layer could serve as reinforcements, contributing to the improvement of graphite/Cu joints.

  2. Facile Method to Fabricate Highly Thermally Conductive Graphite/PP Composite with Network Structures.

    Science.gov (United States)

    Feng, Changping; Ni, Haiying; Chen, Jun; Yang, Wei

    2016-08-03

    Thermally conductive polymer composites have aroused significant academic and industrial interest for several decades. Herein, we report a novel fabrication method of graphite/polypropylene (PP) composites with high thermal conductivity in which graphite flakes construct a continuous thermally conductive network. The thermal conductivity coefficient of the graphite/PP composites is markedly improved to be 5.4 W/mK at a graphite loading of 21.2 vol %. Such a great improvement of the thermal conductivity is ascribed to the occurrence of orientations of crystalline graphite flakes with large particles around PP resin particles and the formation of a perfect thermally conductive network. The model of Hashin-Shtrikman (HS) is adopted to interpret the outstanding thermally conductive property of the graphite/PP composites. This work provides a guideline for the easy fabrication of thermally conductive composites with network structures.

  3. Potential existence of two independent centrosome- targeting domains in PP4

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Protein phosphatase 4 (PP4) is an important member in the PPP family of protein Ser/Thr phosphatases. It has been proven to regulate a variety of cellular processes such as centrosome maturation, microtubule nucleation, splicesome assembly, and JNK pathway activation. Compared to the crystallized and structurally well defined phosphatase PP1 and PP2B, little is known about the structure of PP4. Besides the conserved motifs characteristic of the PPP family, no information is available on the other domains of PP4. PP4 is reported to localize to the centrosome in many species such as Drosophila, Caenorhabditis elegans and mammalian cells, which suggests a conserved role of PP4 in the regulation of centrosome function. Unlike several other centrosomal proteins, no sequence has been identified for PP4 that can target it to specific centrosomal localization. In this study, we used a combination of PCR mutagenesis and transient expression of GFP-tagged proteins in mammalian cells, and identified two PP4 centrosome-targeting domains of 68―136 and 134―220 aa. These two domains may be associated for appropriate localization to the centrosome. The findings are useful for further elucidating the function of the domains and other structural characteristics of PP4.

  4. Index to the Journal of American Indian Education, Vol. 1, No. 1 - Vol. 8, No. 1.

    Science.gov (United States)

    Loomis, Charlotte Ann

    All articles (112) that appeared in the "Journal of American Indian Education" (JAIE), Vol. 1., No. 1 (June 1961) through Vol. 8, No 1 (October 1968) are indexed and annotated. The publication is divided into 3 parts: (1) annotations listed in order of appearance in JAIE by volume, number, and page; (2) author index; and (3) subject index. Later…

  5. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  6. 7 CFR 301.80-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.80-2b Section 301.80-2b....80-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines. (a) The following articles are exempt from the certification and permit...

  7. 7 CFR 301.85-2b - Exempted articles. 1

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles...

  8. Genetics Home Reference: CHMP2B-related frontotemporal dementia

    Science.gov (United States)

    ... Conditions CHMP2B-related frontotemporal dementia CHMP2B-related frontotemporal dementia Enable Javascript to view the expand/collapse boxes. ... Open All Close All Description CHMP2B -related frontotemporal dementia is a progressive brain disorder that affects personality, ...

  9. AFRREV IJAH, Vol.2 (4) September, 2013

    African Journals Online (AJOL)

    First Lady

    2013-09-08

    Sep 8, 2013 ... memorandum at the Stanford Research Institute. It defined .... responsibility, the Green Paper of the European Commission (July. 2001) defines it as a concept ..... Is more fit better? Journal of Retailing, 83(4), Pp. 437‐445.

  10. STUDY ON PP/PVC/PP-HBP BLENDS%PP/PVC/PP-HBP共混体系研究

    Institute of Scientific and Technical Information of China (English)

    刁建志; 巴信武; 丁海涛; 李春子

    2005-01-01

    研究了聚丙烯接枝超支化聚(酰胺-酯)(PP-HBP)对聚丙烯/聚氯乙烯(PP/PVC)共混体系力学性能的影响.结果表明,在PP/PVC(质量比为70/30)共混体系中加入5份PP-HBP时,共混物拉伸强度和冲击强度均出现最大值.扫描电子显微镜(SEM)研究结果证明,PP-HBP增强了PP/PVC的界面粘结作用,减小了共混体系的相分离程度.

  11. Africa Insight - Vol 38, No 3 (2008)

    African Journals Online (AJOL)

    Journal Home > Archives > Vol 38, No 3 (2008) ... The impact of sport on nation building: A Critical Analysis of South Africa and the 2010 FIFA World ... Sport tourism: comparing participant profiles and impact of three one-day events in South ...

  12. Vol 38 2010 Art 1.pub

    African Journals Online (AJOL)

    user

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 38, 2010. Soft drink ... area, City of Cape Town,. South Africa and the factors influencing the consumption. 1 ... gaskoeldrank deur die ouers self, die beskikbaarheid daarvan in die ...... drinks were the favourite beverage to buy at the tuck shop. In both ...

  13. Analysis list: Gtf2b [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Gtf2b Blood,Cardiovascular,Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Gtf2b.1.tsv htt...p://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Gtf2b.5.tsv http://dbarchive.bio...sciencedbc.jp/kyushu-u/mm9/target/Gtf2b.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gtf2b.Blood.tsv,http:...//dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gtf2b.Cardiovascular.tsv,http:...//dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gtf2b.Liver.tsv http://dbarchive.biosciencedbc.jp/kyu

  14. Crisis Communication (Handbooks of Communication Science Vol. 23)

    DEFF Research Database (Denmark)

    Vol. 23 - The Handbook of Communication Science General editors: Peter J. Schultz and Paul Cobley......Vol. 23 - The Handbook of Communication Science General editors: Peter J. Schultz and Paul Cobley...

  15. Sierra Leone Journal of Biomedical Research Vol. 2 (2) pp. 103-114 ...

    African Journals Online (AJOL)

    Owner

    down-regulated (Inal et al., 1999; Mimc-Oka et al.,. 1999; Sindhu et al., ... containing 4.9g/L glucose and 0.584 g L-glutamine, .... particularly lipid peroxidation, DNA and protein synthesis ..... pathway. The major pathways for metabolism are .... Redox Signal. .... Effect of. Insulin on Impaired Activities in Aortic Endothelial.

  16. Aquaculture Asia, vol. 8, no. 3, pp.1-58, July - September 2003

    OpenAIRE

    2003-01-01

    CONTENTS: Ornamental Fish Farming – Successful Small Scale Aqua business in India, by Abalika Ghosh, B. K. Mahapatra and N.C. Datta. Tilapia: A species for Indian Aquaculture? by Graham Mair. Peri-urban food production in Southeast Asia, by Peter Edwards. Shrimp Farming Practices and its Socio- Economic Consequences in East Godavari District, Andhra Pradesh, India - A Case Study, by M.Kumaran, P.Ravichandran, B.P.Gupta and A.Nagavel. Breeding technique ...

  17. Aquaculture Asia, Vol. 7, No. 3, pp.1-60, July - September 2002

    OpenAIRE

    2002-01-01

    CONTENTS: Sustainable Aquaculture - Peter Edwards writes on rural aquaculture: Aquaculture for Poverty Alleviation and Food Security - Part II. Shrimp pond waste management by U Win Latt. The role of rural extension in the sustainable development of Chinese aquaculture by Min Kuanhong. Farmers as Scientists: Diversity enhances profitability and sustainability by M.C. Nandeesha. Properties of Liming Materials by Claude E. Boyd, Mali Boonyaratpalin & Taworn Thunjai. Seed Produc...

  18. African CropScience Journal,Vol. 2. No 4, pp. 563-582, 1994 ISSN ...

    African Journals Online (AJOL)

    widespread, although the incidence was relatively high in Nigeria, Malawi and Tanzania. ... the four problems were lower when cassava was grown in rotation with other crops than in other ...... this, selection work on cassava had been carried.

  19. Aquaculture Asia, Vol 9, No. 3, pp.1-52, July-September 2004

    OpenAIRE

    2004-01-01

    CONTENTS: Genetic considerations in fisheries & aquaculture with regard to impacts upon biodiversity, by Thuy T. T. Nguyen. Rice-fish culture for food and environmental security, by by M.C. Nandeesha. [Farmers as Scientists series] Research and development on land-based aquaculture of spotted Babylon, Babylonia areolata in Thailand: Pilot hatcher-based seedling operation, by Nilnaj Chaitanawisuti Sirusa Kritsanapuntu, and Yutaka Natsukari. Native catfish culture - a boon to In...

  20. Aquaculture Asia, Vol.13, No.2, pp.1-56, April-June 2008

    OpenAIRE

    2008-01-01

    Peter Edwards writes on rural aquaculture: From integrated carp polyculture to intensive monoculture in the Pearl River Delta, South China. Better management practices for Vietnamese catfish. Ipomoea aquatica – an aquaculture friendly macrophyte. A status overview of fisheries and aquaculture development in Pakistan with context to other Asian countries. The changing face of post-grad education in aquaculture: contributing to soaring production and sustainable practices. H...

  1. Sierra Leone Journal of Biomedical Research Vol. 2 (1) pp. 23-27 ...

    African Journals Online (AJOL)

    2010-06-27

    Jun 27, 2010 ... of differently packaged sachet drinking water were purchased from producers, distributors, marketers and hawkers. ... 70-90% and temperature range of 21 to 36oC. Awka is an ..... Laboratory Methods in Medical Parasitology.

  2. Sierra Leone Journal of Biomedical Research Vol. 2 (1) pp. 4 -16 ...

    African Journals Online (AJOL)

    2010-06-16

    Jun 16, 2010 ... comparable fatty acid composition of the two oils. (Koh, 1987). Sesame oil, in ..... and extracellular signal-regulated kinase (ERK) ... of signal transduction pathway or nuclear transcription .... Lowering Food Component. JARQ.

  3. Sierra Leone Journal of Biomedical Research Vol. 2 (2) pp. 135-141 ...

    African Journals Online (AJOL)

    Owner

    this drug. Although majority had dispensed ECP, their knowledge of the drug is limited. There is need for pharmacists to receive continue education on ECP to enable them serve better the clients who need this service. ... have private spaces for counseling which makes it easier ... pregnancy risk by at least 75%‟ and „ECP.

  4. Ilorin Journal of Religious Studies, (IJOURELS) Vol.3 No.1, 2013, Pp ...

    African Journals Online (AJOL)

    mr tomir

    (intransitive, passive). It also means “to arouse”, “to stir up,” (transitive);. “to erect”, “to set up,” “to raise up” (transitive); “to raise oneself,” “to rise up” (transitive).

  5. Sierra Leone Journal of Biomedical Research Vol. 2 (1) pp. 70-74 ...

    African Journals Online (AJOL)

    2010-06-15

    Jun 15, 2010 ... 1Department of Biochemistry, College of Science, Engineering and Technology, Osun State University, ... function parameters in malaria patients in Freetown, Sierra Leone. ..... Message From Genetic Diversity (2nd Edition).

  6. Aquaculture Asia, vol. 8, no. 4, pp.1-52, October - December 2003

    OpenAIRE

    2003-01-01

    CONTENTS: Freshwater prawn, Macrobrachium nobilii a promising candidate for rural nutrition, by Pitchimuthu Mariappan, P. Balamurugan, and Chellam Balasundaram. Snapshots of a clean, innovative, socially responsible fishfarm in Sri Lanka, by Pedro Bueno. Introduction of rainbow trout Onchorynchus mykiss in Nepal: Constraints and prospects, by Tek Bahadur Gurung, Sadhu Ram Basnet. Tilapia seed production in Ho Chi Minh City, Southern Vietnam, by H. P. V. Huy, A. MacNiven, N. V....

  7. PTK2b function during fertilization of the mouse oocyte

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Jinping [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); McGinnis, Lynda K. [Department of Molecular and Integrative Physiology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Carlton, Carol [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States); Beggs, Hilary E. [Department of Ophthalmology, University of California, San Francisco, CA (United States); Kinsey, William H., E-mail: wkinsey@kumc.edu [Department of Anatomy and Cell Biology, University of Kansas Medical Center, Kansas City, KS 66160 (United States)

    2014-08-01

    Highlights: • PTK2b is expressed in oocytes and is activated following fertilization. • PTK2b suppression in oocytes prevents fertilization, but not parthenogenetic activation. • PTK2b suppression prevents the oocyte from fusing with or incorporating bound sperm. • PTK2b suppressed oocytes that fail to fertilize do not exhibit calcium oscillations. - Abstract: Fertilization triggers rapid changes in intracellular free calcium that serve to activate multiple signaling events critical to the initiation of successful development. Among the pathways downstream of the fertilization-induced calcium transient is the calcium-calmodulin dependent protein tyrosine kinase PTK2b or PYK2 kinase. PTK2b plays an important role in fertilization of the zebrafish oocyte and the objective of the present study was to establish whether PTK2b also functions in mammalian fertilization. PTK2b was activated during the first few hours after fertilization of the mouse oocyte during the period when anaphase resumption was underway and prior to the pronuclear stage. Suppression of PTK2b kinase activity in oocytes blocked sperm incorporation and egg activation although sperm-oocyte binding was not affected. Oocytes that failed to incorporate sperm after inhibitor treatment showed no evidence of a calcium transient and no evidence of anaphase resumption suggesting that egg activation did not occur. The results indicate that PTK2b functions during the sperm-egg fusion process or during the physical incorporation of sperm into the egg cytoplasm and is therefore critical for successful development.

  8. Rapid modulation of the organic anion transporting polypeptide 2B1 (OATP2B1, SLCO2B1) function by protein kinase C-mediated internalization.

    Science.gov (United States)

    Köck, Kathleen; Koenen, Anna; Giese, Bernd; Fraunholz, Martin; May, Karen; Siegmund, Werner; Hammer, Elke; Völker, Uwe; Jedlitschky, Gabriele; Kroemer, Heyo K; Grube, Markus

    2010-04-09

    Members of the organic anion transporting polypeptide (OATP) family are involved in various pharmacological, pathophysiological, and physiological processes, such as hepatic drug uptake, progress of cancer, or transport of hormones. Although variability in expression and function of OATPs has been investigated in detail, data concerning regulation are rather limited. Here, we report a novel mechanism for rapid regulation of OATP2B1 mediated by protein kinase C (PKC) resulting in significant changes of transport activity. PKC activation by the phorbol ester (phorbol 12-myristate 13-acetate, PMA) resulted in increased phosphorylation of OATP2B1 as well as reduced OATP2B1 transport activity with a decrease in V(max) of E(1)S uptake (288 +/- 21 (control) versus 165 +/- 16 pmol/min/mg of protein (PMA)). This effect was sensitive to the PKC inhibitor bisindolylmaleimide I (BIM-I). Confocal microscopy, fluorescence-based internalization assay, and live-cell imaging using green fluorescent protein-tagged OATP2B1 revealed that transport inhibition was due to internalization of the transporter. Furthermore, colocalization with LAMP-2 and chloroquine-sensitive degradation of OATP2B1 suggest that the internalized protein is targeted to a lysosomal degradation pathway. With regard to the underlying mechanism inhibition of caveolin/lipid raft-mediated endocytosis failed to prevent OATP2B1 internalization, whereas inhibition of clathrin-mediated processes blocked OATP2B1 sequestration. However, small interfering RNA-mediated clathrin knock-down affected general trafficking of OATP2B1 and resulted in intracellular accumulation in the absence of PMA. In conclusion, our data demonstrate that OATP2B1 function is regulated by PKC-mediated, clathrin-dependent internalization and followed by lysosomal degradation. Furthermore, internalization could be shown in an ex vivo placenta perfusion. Our findings represent a new, rapid mechanism in regulation of human OATPs.

  9. Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei

    Directory of Open Access Journals (Sweden)

    Diego Símini

    2015-01-01

    Full Text Available Reseña de Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei, Alinea (Secoli d’Oro, 67; Commedia Aurea Spagnola e Pubblico Italiano, VIII, Florencia, 2013, 257 pp. ISBN: 9788860557865.

  10. Matrix Theory of pp Waves

    CERN Document Server

    Michelson, J

    2004-01-01

    The Matrix Theory that has been proposed for various pp wave backgrounds is discussed. Particular emphasis is on the existence of novel nontrivial supersymmetric solutions of the Matrix Theory. These correspond to branes of various shapes (ellipsoidal, paraboloidal, and possibly hyperboloidal) that are unexpected from previous studies of branes in pp wave geometries.

  11. Haplotypes frequencies of CYP2B6 in Malaysia

    Directory of Open Access Journals (Sweden)

    N Musa

    2012-01-01

    Full Text Available Background: Drugs with complex pharmacology are used in the management of drug use disorder (DUD and HIV/AIDS in Malaysia and in parts of South-East Asia. Their multiethnic populations suggest complexity due to the genetic polymorphism, such as CYP2B6 that metabolizes methadone and anti-retroviral. Aims: Our aim was to explore the genetic polymorphism of CYP2B6 among Malays, Chinese, Indians, and opiate-dependent individuals in Malaysia. Settings and Design: The study utilized DNA from our previous studies on CYPs and new recruitments from opiate-dependent individuals. Materials and Methods: For the new recruitment, after obtaining consent and baseline demography, 5 ml blood was obtained from patients attending methadone maintenance therapy (MMT Clinics. Genomic DNA was extracted using standard methods. 10 nucleotide changes associated with CYP2B6FNx0110, CYP2B6FNx012, CYP2B6FNx0117, CYP2B6FNx0111, CYP2B6FNx018, CYP2B6FNx0114, CYP2B6FNx019, CYP2B6FNx014, CYP2B6FNx016, CYP2B6FNx0127, and CYP2B6FNx0120 were determined using multiplex nested allele-specific PCR. Statistical Analysis: Descriptive statistics were used to summarize demographic data. Differences in allele frequencies between populations were tested using Chi-squared test and were corrected using the Bonferroni test. Results: CYP2B6 polymorphism in Malaysia is variable with trends that suggest an ethnic difference. Reduced activity CYP2B6FNx016 occurred in 13% to 26% among Malays, Chinese, Indians and opiate-dependent individuals. Another ′reduced activity′, CYP2B6FNx012 allele, was found at much lower percentages in the groups. Conclusions: The relative commonness of reduced-activity CYP2B6 alleles in our study called for attention in terms of dosage requirements for MMT and ARV in Malaysia. It also implored follow-up association studies to determine its relevance and consequences in personalized medicine for drug use disorder and HIV/AIDS.

  12. Haplotypes frequencies of CYP2B6 in Malaysia.

    Science.gov (United States)

    Musa, N; Zulkafli, M I; Talib, N; Mohamad, N; Fauzi, H; Ismail, R

    2012-01-01

    Drugs with complex pharmacology are used in the management of drug use disorder (DUD) and HIV/AIDS in Malaysia and in parts of South-East Asia. Their multiethnic populations suggest complexity due to the genetic polymorphism, such as CYP2B6 that metabolizes methadone and anti-retroviral. Our aim was to explore the genetic polymorphism of CYP2B6 among Malays, Chinese, Indians, and opiate-dependent individuals in Malaysia. The study utilized DNA from our previous studies on CYPs and new recruitments from opiate-dependent individuals. For the new recruitment, after obtaining consent and baseline demography, 5 ml blood was obtained from patients attending methadone maintenance therapy (MMT) Clinics. Genomic DNA was extracted using standard methods. 10 nucleotide changes associated with CYP2B6*10, CYP2B6*2, CYP2B6*17, CYP2B6*11, CYP2B6*8, CYP2B6*14, CYP2B6*9, CYP2B6*4, CYP2B6*6, CYP2B6*27, and CYP2B6*20 were determined using multiplex nested allele-specific PCR. Descriptive statistics were used to summarize demographic data. Differences in allele frequencies between populations were tested using Chi-squared test and were corrected using the Bonferroni test. CYP2B6 polymorphism in Malaysia is variable with trends that suggest an ethnic difference. Reduced activity CYP2B6*6 occurred in 13% to 26% among Malays, Chinese, Indians and opiate-dependent individuals. Another 'reduced activity', CYP2B6*2 allele, was found at much lower percentages in the groups. The relative commonness of reduced-activity CYP2B6 alleles in our study called for attention in terms of dosage requirements for MMT and ARV in Malaysia. It also implored follow-up association studies to determine its relevance and consequences in personalized medicine for drug use disorder and HIV/AIDS.

  13. Analysis list: GTF2B [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available GTF2B Blood,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GT...F2B.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/GTF2B.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/hg19/target/GTF2B.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/GTF2B.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/GTF2B.Uterus.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Uterus.gml ...

  14. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  15. Scientific core hole Valles caldera No. 2b (VC-2b), New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Garner, J.N.; Hulen, J.B.; Lysne, P.; Jacobson, R.; Goff, F.; Nielson, D.L.; Pisto, L.; Criswell, C.W.; Gribble, R. (Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Sandia National Labs., Albuquerque, NM (USA); Los Alamos National Lab., NM (USA); Utah Univ. Research Inst., Salt Lake City, UT (USA); Tonto Drilling Services, Inc., Salt Lake City, UT (USA); Los Alamo

    1989-01-01

    Research core hole was continuously cored to 1.762 km on the western flank of the caldera's resurgent dome in 1988. Bottom hole temperature is about 295{degree}C within Precambrian (1.5 Ga) quartz monzonite, deep within the liquid-dominated portions of the Sulphur Springs hydrothermal system. VC-2b may be the deepest, hottest, continuously cored hole in North America. Core recovery was 99.2%. The only major drilling problems encountered were when temperatures at the bit exceeded 225{degree}C below depths of about 1000 m. The result of these conditions was loss of viscosity and/or lubricity in the mud, apparently caused by breakdown of the high temperature polymers. Lithologies in caldera-fill indicate the drill site may be proximal to ignimbrite vents and that an intracaldera lake with temperatures approaching boiling formed soon after the caldera itself. Structural correlations between VC-2b and the 528-m-deep companion hole VC-2a indicate the earlier Toledo caldera (1.45 Ma; Otowi Member tuffs) and even older Lower Tuffs caldera experienced no structural resurgence similar to the 1.12 million year old Valles caldera. The hydrothermal system penetrated by these bores, consists of a shallow vapor-rich cap, which has evolved from an earlier 200{degree}C liquid-dominated system, overlying stacked, liquid-dominated zones up to about 300{degree}C. Geochemistry of mud returns collected during drilling suggests chloride-rich geothermal fluids were entering the bore and mixing with the drilling fluids in the fractured lower Paleozoic and Precambrian sections. 23 refs., 5 figs., 1 tab.

  16. RAZVOJ B2B PORTALA ZA POTREBE ELEKTRONSKEGA POSLOVANJA

    OpenAIRE

    Slanič, Matej

    2011-01-01

    V diplomski nalogi opredelimo vlogo B2B portalov in pomen elektronskega poslovanja. B2B portale smo razvrstili glede na različne kriterije in predstavili različne modele trgovanja na njih. Velik del pozornosti smo posvetili tudi strateškemu načrtovanju B2B poslovanja in vključevanju podjetij na B2B portale, dotaknili pa smo se tudi vizije elektronskega poslovanja. Osrednji del naloge obsega predstavitev gradnje specifičnega portala Bbuines.com ter z njo povezane oblikovne in tehnološke rešitv...

  17. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I;

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient. ...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  18. Extracting the Odderon from $pp$ and $\\bar pp$ scattering data

    CERN Document Server

    Ster, Andras; Csorgo, Tamas

    2015-01-01

    Starting from a simple empirical parametrization of the scattering amplitude, successfully describing the dip-bump structure of elastic $pp$ scattering in $t$ at fixed values of $s$, we construct a toy model interpolating between missing energy gaps to extract the Odderon contribution from the difference between $\\bar pp$ and $pp$ elastic and total cross sections. The model is fitted to data from $\\sqrt s=23.5$ GeV to 7 TeV and used to extract the Odderon and its ratio to the Pomeron.

  19. (-p)p and pp Elastic Scattering at High Energies

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Based on the eikonalized Glauber representation of hadron-hadron scattering, we study the diffractive processes of -pp and pp elastic scattering at high energies. From our theoretical calculations and fits to the corresponding experimental data at high energies and all available momentum transfer, we find that the Pomeron exchange contributions play a significant role in description of differential cross section dσ/dt in the whole experimental domain. The Pomeron exchange contributions are related to multi-gluon exchanges in QCD, which are color singlet bound state of Reggeized gluons, such as tensor glueball and Odderon. Accordingly, we may claim that the -pp and pp diffractive processes at high energies s and moderate momentum transfer t would be a good tool to verify the existence of the color singlet multigluon bound states and to test QCD since QCD theory does predict the existence of these states. Therefore, we believe that the experimental measurement should be done for these diffractive processes.

  20. Building Customized University-to-Business (U2B) Partnerships

    Science.gov (United States)

    Irvine, George; Verma, Lisa

    2013-01-01

    Continuing education (CE) units throughout the United States have successfully built University-to-Business (U2B) partnerships to provide greater value to their community partners and to increase revenue for the university. Our experience in building U2B partnerships and feedback from our partners--businesses, corporations, state agencies, and…

  1. Genetic and bibliographic information: HTR2B [GenLibi

    Lifescience Database Archive (English)

    Full Text Available HTR2B 5-hydroxytryptamine (serotonin) receptor 2B human alcoholism (MeSH) Disorders... of Environmental Origin (C21) > Substance-Related Disorders (C21.739) > Alcohol-Related Disorders (C21.739.100) > Alcoholism (C21.739.100.250) 01A0634580 ...

  2. STECH VOL5 (1) FEBRUARY, 2016

    African Journals Online (AJOL)

    Copyright 1AARR 2012-2016: www.afrrevjo.net

    2016-02-11

    Feb 11, 2016 ... Climate Change and Infectious Diseases in Funtua Local. Government ... This study examines the impact of climate change on the prevalence of cholera ... A warmer and more variable climate leads to higher levels of some air · pollutants and more frequent extreme weather events. ..... Climate Review (pp.

  3. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  4. Frontotemporal dementia caused by CHMP2B mutations

    DEFF Research Database (Denmark)

    Isaacs, A M; Johannsen, P; Holm, I

    2011-01-01

    CHMP2B mutations are a rare cause of autosomal dominant frontotemporal dementia (FTD). The best studied example is frontotemporal dementia linked to chromosome 3 (FTD-3) which occurs in a large Danish family, with a further CHMP2B mutation identified in an unrelated Belgian familial FTD patient....... These mutations lead to C-terminal truncations of the CHMP2B protein and we will review recent advances in our understanding of the molecular effects of these mutant truncated proteins on vesicular fusion events within the endosome-lysosome and autophagy degradation pathways. We will also review the clinical...... features of FTD caused by CHMP2B truncation mutations as well as new brain imaging and neuropathological findings. Finally, we collate the current data on CHMP2B missense mutations, which have been reported in FTD and motor neuron disease....

  5. PP/共聚PP/POE共混体系的研究%Study of PP/Co-PP/POE Blend

    Institute of Scientific and Technical Information of China (English)

    刘西文; 纪立军; 王重

    2008-01-01

    研究了POE用量对T30S/POE和F401/POE体系的力学性能、流动性能的影响,并研究了POE质量分数为15%的情况下,共聚PP用量对PP/共聚PP/POE共混体系的力学性能、流动性能的影响.结果表明:与T30S/POE相比,F401/POE体系的冲击强度提高比较显著,而两种共混体系的加工性能均较好;共聚PP在PP/共聚PP/POE体系中明显起到了协同增韧作用,其中,F401/EPS30R/POE共混体系的综合性能最好.

  6. B2B virksomheders brug af sociale medier

    OpenAIRE

    Persdatter Gotfredsen, Karoline

    2016-01-01

    Purpose: The aim of this master thesis is to explore how B2B firms perceive their own usage of social media to establish and strengthen successful relational exchanges. Approach: In-depth interviews were carried out with three key informants responsible for social media marketing at large B2B firms. The findings from the three interviews were then analysed case-by-case and finally a cross case analysis was conducted. Findings: In relation to the market B2B firms mainly see social media...

  7. On Weakly P.P. Rings

    Institute of Scientific and Technical Information of China (English)

    Xiang Yue-ming; Ouyang Lun-qun; Wang Shu-gui

    2015-01-01

    We introduce, in this paper, the right weakly p.p. rings as the generaliza-tion of right p.p. rings. It is shown that many properties of the right p.p. rings can be extended onto the right weakly p.p. rings. Relative examples are constructed. As applications, we also characterize the regular rings and the semisimple rings in terms of the right weakly p.p. rings.

  8. El espectro de K2 Vol

    Science.gov (United States)

    Pintado, O. I.; Adelman, S. J.

    Se han obtenido espectros de alta dispersión para la estrella K2 Vol con el espectrógrafo REOSC del CASLEO en un rango de longitudes de ondas comprendido entre 3500 y 5050 Å. El espectro muestra evidencias de que la estrella es binaria. Se determinan las abundancias de los componentes químicos presentes en su atmósfera, como así también algunas características de su compañera.

  9. [SMEAC Newsletters, Science Education, Vol. 1, No. 1--Vol. 2, No. 1, 1967-1968].

    Science.gov (United States)

    ERIC Clearinghouse for Science, Mathematics, and Environmental Education, Columbus, OH.

    Each of these newsletters, produced by the ERIC Information Analysis Center for Science, Mathematics, and Environmental Education, contains information concerning center publications and other items considered of interest to researchers and educators of various education levels. Vol. 1, No. 1 highlights selected bibliographies (no longer produced…

  10. [SMEAC Newsletters, Science Education, Vol. 2, No. 2--Vol. 2, No. 3, 1969].

    Science.gov (United States)

    ERIC Clearinghouse for Science, Mathematics, and Environmental Education, Columbus, OH.

    Each of these newsletters, produced by the ERIC Information Analysis Center for Science, Mathematics, and Environmental Education, Contains information concerning center publications and activities, as well as other items considered of interest to researchers and educators of various educational levels. One of the emphases in Vol. 2, No. 2, is a…

  11. Rf2a and rf2b transcription factors

    Science.gov (United States)

    Beachy, Roger N.; Petruccelli, Silvana; Dai, Shunhong

    2007-10-02

    A method of activating the rice tungro bacilliform virus (RTBV) promoter in vivo is disclosed. The RTBV promoter is activated by exposure to at least one protein selected from the group consisting of Rf2a and Rf2b.

  12. Secretion of human interferon alpha 2b by Streptomyces lividans.

    Science.gov (United States)

    Pimienta, E; Fando, R; Sánchez, J C; Vallin, C

    2002-02-01

    Biologically active human interferon alpha 2b (HuIFNalpha-2b) was secreted into the culture medium by Streptomyces lividans transformed with recombinant plasmids coding for HuIFNalpha-2b fused to the Streptomyces exfoliatus M11 lipase A signal sequence. Levels were low, 15 or 100 ng/ml, depending on the plasmid used. Neither processed nor unprocessed HuIFNalpha-2b was detected in cell lysates of the transformants secreting the recombinant product. However, the secreted recombinant product was found to partially degrade when cultures reached the stationary phase by the action of an, as yet, unidentified mycelium-associated factor. Experimental evidence suggests that the degrading factor is related to mycelium-associated proteolytic activity.

  13. Study on pharmacodynamics of recombinant interferon α-2b suppository

    Institute of Scientific and Technical Information of China (English)

    LIU Miao; LIU Zheng; SUN Liang

    2008-01-01

    Objective To investigate the antiviral activity of recombinant interferona-2b suppository (IFNα-2b) in vivo and in vitro. Methods The cytopathic-effect inhibition assay was applied in this study to investigate the antiviral activity of this drug as well as yingtelong and axiluowei as positive control. The guinea pig model of vaginitis and skin infection caused by HSV-2 infection were established, treated with IFNα-2b suppository at dosages of 60000、180000、540000 IU, using IFNα-2b injection 180000 IU·kg-1 as controls. Score the pathological changes of appearance and skin, the virus activities of vaginal secretion and tissue sections of viginae were assayed after treatment. Results The TD50 of IFN α-2b and yingtelong for Vero cells was ( 100)μg·mL-1 and ( 100000) IU·mL-1, respectively. The IC50 of IFNα-2b and yingtelong and axiluowei for Herpes virus type 1 was (0.29±0.08)μg·mL-1 and (185.0±28.8) IU·mL-1 and (0.19± 0.03)μg·mL-1, respectively. The mean scores for vaginal and skin lesion of the treated groups were lower than those of untreated group. Among these concentrations, the IFNα-2b suppository of 540000 IU·kg-1 group. Showed highest anti-viral activity. The virus activity in vaginal secretion of treated group was lower than that of untreated group too (P<0.01 or P<0.05). Tissue sections of viginae after treatment with IFNα-2b suppository showed significantly therapeutical effects on the degrees of vaginal lesion. At the same dosage, The anti-HSV activity of IFNα-2b suppository was also compared with IFNα-2b injection , the resuits showed that the activity of suppository of 540000 IU·kg-1 group was similar to that of the injection. Conclusions The IFNα-2b suppository has anti-viruses function both in vivo and in vitro.

  14. Branding of electricity in B2B markets

    OpenAIRE

    Rolanda Simenaite 1986

    2013-01-01

    Branding has gained an important role in the B2B (business-to-business) market. Liberation of the energy markets in recent years has increased competition and branding could create a competitive advantage. This thesis analyzes the branding of electricity in a business-to-business context. In depth, this thesis explores the supplier of electricity brand importance for business customers in both Icelandic and Lithuanian B2B markets. The focus of the thesis is to research how much brands matter ...

  15. EPR study of the formation of radicals in PP with antioxidants irradiated with gamma rays

    Energy Technology Data Exchange (ETDEWEB)

    Silva, P. [Instituto Venezolano de Investigaciones Cientificas, Centro de Fisica, Carretera Panamericana Km. 11, Caracas 1020-A (Venezuela)], E-mail: silva@ivic.ve; Albano, C. [Instituto Venezolano de Investigaciones Cientificas, Centro de Quimica, Universidad Central de Venezuela, Facultad de Ingenieria (Venezuela); Perera, R. [Departamento de Mecanica, Universidad Simon Bolivar (Venezuela)

    2007-12-15

    The behavior of different compounds of polypropylene (PP) with stabilizers such as buthyl-hydroxy-toluene (BHT), Chimassorb 944 (Hals) (CHIM), and a copolymer of styrene-butadiene-styrene (SBS) was studied using electron paramagnetic resonance (EPR). A characteristic spectra for pure PP irradiated in air was obtained for all the samples just after being irradiated [M. Dole, The Radiation Chemistry of Macromolecules, Vol. 2, Academic Press, 1973]. A change in the lineshape of the spectra from a pure PP's EPR signal to that of nitroxyl radical as a function of time was observed. The total free radical concentration (TFRC) decayed until approximately 800 h in the PP-HALS and until around 2000 h in all other cases, when the TFRC began to increase in all the cases, except in that of PP-BHT. In this last case, the EPR signal was not detectable after 4000 h. The BHT and the SBS diluted the free radical concentrations, being them smaller when they are present. The behavior observed in all the samples is consistent with the formation of nitroxyl radicals by gamma rays.

  16. Expression of zebrafish nos2b surrounds oral cavity.

    Science.gov (United States)

    Poon, Kar-Lai; Richardson, Michael; Korzh, Vladimir

    2008-06-01

    Inducible nitric oxide synthase (NOS2) catalyzes the production of nitric oxide (NO), and is one of the factors establishing innate immunity. In zebrafish, Nos2 is represented by nos2a and nos2b. Here, we report the cloning and expression pattern of the zebrafish nos2b gene, which does not seem to participate in induced immune response. nos2b was mapped to zebrafish linkage group 15. The spatial and temporal expression pattern of nos2b in embryonic zebrafish was analyzed by whole-mount in situ hybridization. nos2b is expressed constitutively in two primordia located along the ventral midline. The first group of cells contributes to the neurohypophysis. Initially at the level of the ventral hindbrain, the second group of cells migrates closely with the thyroid primordium to its final position at the basihyal by 3 dpf. Thus, the analysis of expression pattern of nos2b reveals complex morphogenetic movements resulting in its expression surrounding the oral cavity.

  17. PTK2b function during fertilization of the mouse oocyte.

    Science.gov (United States)

    Luo, Jinping; McGinnis, Lynda K; Carlton, Carol; Beggs, Hilary E; Kinsey, William H

    2014-08-01

    Fertilization triggers rapid changes in intracellular free calcium that serve to activate multiple signaling events critical to the initiation of successful development. Among the pathways downstream of the fertilization-induced calcium transient is the calcium-calmodulin dependent protein tyrosine kinase PTK2b or PYK2 kinase. PTK2b plays an important role in fertilization of the zebrafish oocyte and the objective of the present study was to establish whether PTK2b also functions in mammalian fertilization. PTK2b was activated during the first few hours after fertilization of the mouse oocyte during the period when anaphase resumption was underway and prior to the pronuclear stage. Suppression of PTK2b kinase activity in oocytes blocked sperm incorporation and egg activation although sperm-oocyte binding was not affected. Oocytes that failed to incorporate sperm after inhibitor treatment showed no evidence of a calcium transient and no evidence of anaphase resumption suggesting that egg activation did not occur. The results indicate that PTK2b functions during the sperm-egg fusion process or during the physical incorporation of sperm into the egg cytoplasm and is therefore critical for successful development. Published by Elsevier Inc.

  18. Comparison of Single Loop and Dual Loop PP Reactors and PP Product Development

    Institute of Scientific and Technical Information of China (English)

    Lu Yunfeng; Jiang Rong; Feng Suogui

    2003-01-01

    The present status of PP technology in China is presented. Through a review of single loop and dual loop PP reactor technology as well as development and utilization of PP products it is concluded that import of PP technology should be based on the demand of PP products and market trend with consideration of local conditions. The existing problems and future development of PP technology in China are discussed.

  19. Pharmacogenetics of Cytochrome P450 2B6 (CYP2B6: Advances on Polymorphisms, Mechanisms, and Clinical Relevance

    Directory of Open Access Journals (Sweden)

    Ulrich M Zanger

    2013-03-01

    Full Text Available Cytochrome P450 2B6 (CYP2B6 belongs to the minor drug metabolizing P450s in human liver. Expression is highly variable both between individuals and within individuals, owing to nongenetic factors, genetic polymorphisms, inducibility and irreversible inhibition by many compounds. Drugs metabolized mainly by CYP2B6 include artemisinin, bupropion, cyclophosphamide, efavirenz, ketamine, and methadone. CYP2B6 is one of the most polymorphic CYP genes in humans and variants have been shown to affect transcriptional regulation, splicing, mRNA and protein expression, and catalytic activity. Some variants appear to affect several functional levels simultaneously, thus, combined in haplotypes, leading to complex interactions between substrate-dependent and -independent mechanisms. The most common functionally deficient allele is CYP2B6*6 [Q172H, K262R], which occurs at frequencies of 15 to over 60% in different populations. The allele leads to lower expression in liver due to erroneous splicing. Recent investigations suggest that the amino acid changes contribute complex substrate-dependent effects at the activity level, although data from recombinant systems used by different researchers are not well in agreement with each other. Another important variant, CYP2B6*18 [I328T], occurs predominantly in Africans (4 to 12% and does not express functional protein. A large number of uncharacterized variants are currently emerging from different ethnicities in the course of the 1000 Genomes Project. The CYP2B6 polymorphism is clinically relevant for HIV-infected patients treated with the reverse transcriptase inhibitor efavirenz, but it is increasingly being recognized for other drug substrates. This review summarizes recent advances on the functional and clinical significance of CYP2B6 and its genetic polymorphism, with particular emphasis on the comparison of kinetic data obtained with different substrates for variants expressed in different recombinant

  20. Lithium insertion in nanostructured TiO(2)(B) architectures.

    Science.gov (United States)

    Dylla, Anthony G; Henkelman, Graeme; Stevenson, Keith J

    2013-05-21

    Electric vehicles and grid storage devices have potentialto become feasible alternatives to current technology, but only if scientists can develop energy storage materials that offer high capacity and high rate capabilities. Chemists have studied anatase, rutile, brookite and TiO2(B) (bronze) in both bulk and nanostructured forms as potential Li-ion battery anodes. In most cases, the specific capacity and rate of lithiation and delithiation increases as the materials are nanostructured. Scientists have explained these enhancements in terms of higher surface areas, shorter Li(+) diffusion paths and different surface energies for nanostructured materials allowing for more facile lithiation and delithiation. Of the most studied polymorphs, nanostructured TiO2(B) has the highest capacity with promising high rate capabilities. TiO2(B) is able to accommodate 1 Li(+) per Ti, giving a capacity of 335 mAh/g for nanotubular and nanoparticulate TiO2(B). The TiO2(B) polymorph, discovered in 1980 by Marchand and co-workers, has been the focus of many recent studies regarding high power and high capacity anode materials with potential applications for electric vehicles and grid storage. This is due to the material's stability over multiple cycles, safer lithiation potential relative to graphite, reasonable capacity, high rate capability, nontoxicity, and low cost (Bruce, P. G.; Scrosati, B.; Tarascon, J.-M. Nanomaterials for Rechargeable Lithium Batteries. Angew. Chem., Int. Ed.2008, 47, 2930-2946). One of the most interesting properties of TiO2(B) is that both bulk and nanostructured forms lithiate and delithiate through a surface redox or pseudocapacitive charging mechanism, giving rise to stable high rate charge/discharge capabilities in the case of nanostructured TiO2(B). When other polymorphs of TiO2 are nanostructured, they still mainly intercalate lithium through a bulk diffusion-controlled mechanism. TiO2(B) has a unique open crystal structure and low energy Li

  1. Cytochrome P450 2B (CYP2B)-mediated activation of methyl-parathion in rat brain extracts.

    Science.gov (United States)

    Albores, A; Ortega-Mantilla, G; Sierra-Santoyo, A; Cebrián, M E; Muñoz-Sánchez, J L; Calderón-Salinas, J V; Manno, M

    2001-10-15

    The role of cytochrome P450 (CYP) and the CYP isoform involved in the activation of the widely used pesticide methyl-parathion (MePA) were investigated in rat brain extracts by measuring the effect of different CYP inhibitors on acetylcholinesterase (AChE) inhibition by MePA. Brain extracts provide a useful tool to study the activation mechanisms of organophosphorus compounds (OP) since they contain both the activating enzyme(s) and the molecular target for OP toxicity. As expected, in incubations of rat brain extract supplemented with NADPH, AChE activity was non-competitively inhibited by the presence of MePA, indicating that MePA was activated to its reactive metabolite methyl-paraoxon (MePO). Indeed, Vmax(app) decreased from 13.4 to 8.7 micromol thionitrobenzoic acid (TNB)/min per mg protein. MePA activation by rat brain extracts, as measured by the AChE inhibition produced by the presence of the pesticide in the incubation, was fully prevented by previously bubbling the incubation mix with CO, by the presence of monoclonal anti-rat CYP2B1/2B2 antibodies and by the addition of phenobarbital (PB), a CYP2B substrate. Interestingly, MePA showed a greater affinity for CYP2B than PB. CYP1A1 antibodies showed no effect on MePA activation. The presence of cytochrome P450 2B (CYP2B) in the rat brain extracts was confirmed by immunoblotting. These results demonstrate indisputably the responsibility of CYP2B in MePA activation in the rat brain in vitro, suggesting that metabolic activation of OP compounds in situ might be crucial for their organ specific toxicity to the central nervous system also in vivo.

  2. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery......, service, configuration and customisation of the products in their company as well as to develop an apposite understanding of the key values and characteristics of the client organisation. Based on a design-ethnographical study of real sales practice in lift truck business the paper draws parallels between...

  3. Substrate Recognition of Histone H2B by DUBm

    Science.gov (United States)

    Henderson, Elizabeth; Berndsen, Christopher; Wolberger, Cynthia

    2011-03-01

    The SAGA complex is a transcriptional coactivator that regulates gene expression in eukaryotes via histone acetylation and deubiquitination, which are crucial for transcription. Our lab is investigating the SAGA-dependent deubiquitination of histone H2B. The deubiquitinating module (DUBm) of SAGA is comprised of a ubiquitin-specific protease, Ubp8, and three other proteins. It is known that Ubp8 cleaves ubiquitin from histone H2B, however, the specific way in which the enzyme binds to the substrate remains elusive. In order to unravel this mechanism, we attempted to determine the crystal structure of the substrate binding complex. We obtained this substrate by exploiting the techniques of intein chemistry to artificially ubiquitinate a histone H2B peptide, which we then co-crystallized with DUBm. Additionally, we synthesized Ub-K63R-linked chains and Ub-K48-linked chains and co-crystallized them with DUBm.

  4. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    sales agent’s work practice and collaborative conceptual design work, i.e. innovation design work. This perception provides a means to understand the value that the use of conceptual design tools could possibly provide for sales negotiation work. We also use the notion of boundary object to elaborate......This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery...

  5. Development of New B2B Venture Corporate Brand Identity

    DEFF Research Database (Denmark)

    Törmälä, Minna; Gyrd-Jones, Richard I.

    2017-01-01

    The development and role of brand identity in new B2B ventures is not well explored despite the challenge for such organisations in establishing reputational legitimacy. Previous research defines corporate brand identity as stable and endogenous to the organisation based either on the reputational...... of interviews and archival data generated during a three-year period to examine the development of corporate brand over time. This study shows that the development of corporate brand identity and the context of the development of new B2B venture are closely intertwined processes and provides a framework...

  6. Customized E-Learning for B2B Companies

    Directory of Open Access Journals (Sweden)

    Tim Thomasma

    2014-06-01

    Full Text Available Business-to-Business (B2B companies have customers that are primarily other corporations. These companies have unique problems in workplace training. They must train their customers and their customers’ employees. A B2B company may operate with only a few dozen employees, but they may need to help thousands of customers learn how to make best use of their product or service. Discussions with industry executives suggest an ideal training solution might include a number of features that are reviewed in this paper.

  7. Comparison of pp and pp interactions at $\\sqrt{s}$=53 GeV

    CERN Document Server

    Alpgard, K; Åsman, B; Berglund, S; Bertrand, D; Böckmann, Klaus; Booth, C N; Buffam, C; Burow, L; Carlson, Per J; Carter, J R; Chevalley, J L; Eckart, B; Ekspong, G; Fabre, Jean-Paul; French, K A; Gaudaen, J; Gijsen, M; Hospes, R; Johnson, D; Jon-And, K; Kokott, T; Leistam, L; MacKenzie, R; Maggs, M N; Meinke, R; Mulkens, H; Müller, T; Munday, D J; Odian, A; Rosenberg, M; Rushbrooke, John G; Saarikko, H; Saarikko, T; Tavernier, Stefaan; Triantis, F A; Von Holt, K; Walck, C; Ward, C P; Ward, D R; Weidberg, A R; White, T O; Wilquet, G; Yamdagni, N

    1982-01-01

    Results are presented from the first pp colliding beam runs at the CERN ISR, using the UA5 streamer chamber detector. pp interactions at \\sqrt{s}=53 GeV are compared with pp data taken in the same experiment. The results are in good agreement with extrapolations of low-energy pp data.

  8. Protein kinase Cα and Src kinase support human prostate-distributed dihydrotestosterone-metabolizing UDP-glucuronosyltransferase 2B15 activity.

    Science.gov (United States)

    Chakraborty, Sunit K; Basu, Nikhil K; Jana, Sirsendu; Basu, Mousumi; Raychoudhuri, Amit; Owens, Ida S

    2012-07-13

    Because human prostate-distributed UDP-glucuronosyltransferase (UGT) 2B15 metabolizes 5α-dihydrotestosterone (DHT) and 3α-androstane-5α,17β-diol metabolite, we sought to determine whether 2B15 requires regulated phosphorylation similar to UGTs already analyzed. Reversible down-regulation of 2B15-transfected COS-1 cells following curcumin treatment and irreversible inhibition by calphostin C, bisindolylmaleimide, or röttlerin treatment versus activation by phorbol 12-myristate 13-acetate indicated that 2B15 undergoes PKC phosphorylation. Mutation of three predicted PKC and two tyrosine kinase sites in 2B15 caused 70-100 and 80-90% inactivation, respectively. Anti-UGT-1168 antibody trapped 2B15-His-containing co-immunoprecipitates of PKCα in 130-140- and >150-kDa complexes by gradient SDS-PAGE analysis. Complexes bound to WT 2B15-His remained intact during electrophoresis, whereas 2B15-His mutants at phosphorylation sites differentially dissociated. PKCα siRNA treatment inactivated >50% of COS-1 cell-expressed 2B15. In contrast, treatment of 2B15-transfected COS-1 cells with the Src-specific activator 1,25-dihydroxyvitamin D(3) enhanced activity; treatment with the Src-specific PP2 inhibitor or Src siRNA inhibited >50% of the activity. Solubilized 2B15-His-transfected Src-free fibroblasts subjected to in vitro [γ-(33)P]ATP-dependent phosphorylation by PKCα and/or Src, affinity purification, and SDS gel analysis revealed 2-fold more radiolabeling of 55-58-kDa 2B15-His by PKCα than by Src; labeling was additive for combined kinases. Collectively, the evidence indicates that 2B15 requires regulated phosphorylation by both PKCα and Src, which is consistent with the complexity of synthesis and metabolism of its major substrate, DHT. Whether basal cells import or synthesize testosterone for transport to luminal cells for reduction to DHT by 5α-steroid reductase 2, comparatively low-activity luminal cell 2B15 undergoes a complex pattern of regulated

  9. Effects of (Cr,Fe){sub 2}B borides on hardness in powder-injection-molded product fabricated with Fe-based alloy powders

    Energy Technology Data Exchange (ETDEWEB)

    Do, Jeonghyeon; Jeon, Changwoo; Paul Kim, Choongnyun; Lee, Byeong-Joo [Center for Advanced Aerospace Material, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Lee, Sunghak, E-mail: shlee@postech.ac.kr [Center for Advanced Aerospace Material, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Lee, Eon-Sik [Advanced Metallic Materials Research Department, Research Institute of Industrial Science and Technology, Pohang 790-330 (Korea, Republic of); Shik Yoon, Tae [Bestner Co., 146-8 Sangdaewon-dong, Sungnam 462-121 (Korea, Republic of); Su Shin, Yang [New Growth Technology Strategy Department, POSCO, Seoul 135-777 (Korea, Republic of)

    2012-10-30

    In the present study, a powder injection molding (PIM) product containing (Cr,Fe){sub 2}B borides was fabricated with Fe-based alloy powders, and its microstructure and hardness were investigated in relation with volume fraction of (Cr,Fe){sub 2}B. In the Fe-based alloys designed by the thermodynamic calculation, the volume fractions of (Cr,Fe){sub 2}B increased with increasing (X{sub Cr}+X{sub B}) value, and were well matched with those obtained from the thermodynamic calculation. The hardness of the Fe-based alloys linearly increased with increasing volume fraction of (Cr,Fe){sub 2}B. When Fe-based alloy powders were injection-molded and sintered at 1165 Degree-Sign C, a densified microstructure with almost no pores was obtained. In the sintered microstructure, 56 vol% of (Cr,Fe){sub 2}B borides, together with a few pores (porosity; 0.5%), were relatively homogeneously distributed in the tempered martensite matrix, which resulted in the very high hardness over 600 VHN. Such a high hardness suggested that the present Fe-based alloy powders could be readily adopted for fabricating PIM products or for replacing conventional stainless steel PIM products.

  10. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    2010-01-01

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The Net

  11. Supporting B2B Business Documents in XML Web Services

    Institute of Scientific and Technical Information of China (English)

    KIM Hyoungdo

    2004-01-01

    While XML web services become recognized as a solution to business-to-business transactions, there are many problems that should be solved. For example, it is not easy to manipulate business documents of existing standards such as RosettaNet and UN/EDIFACT EDI, traditionally regarded as an important resource for managing B2B relationships. As a starting point for the complete implementation of B2B web services, this paper deals with how to support B2B business documents in XML web services. In the first phase, basic requirements for driving XML web services by business documents are introduced. As a solution, this paper presents how to express B2B business documents in WSDL, a core standard for XML web services. This kind of approach facilitates the reuse of existing business documents and enhances interoperability between implemented web services. Furthermore, it suggests how to link with other conceptual modeling frameworks such as ebXML/UMM, built on a rich heritage of electronic business experience.

  12. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The

  13. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    2010-01-01

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The Net

  14. Mechanochemical synthesis and characterization of pure Co$_2$B nanocrystals

    Indian Academy of Sciences (India)

    MUSTAFA BARIS; TUNCAY SIMSEK; ADNAN AKKURT

    2016-08-01

    Cobalt boride (Co$_2$B) is a significant transition metal boride having a wide range of usage area due to its high oxidation, abrasion and corrosion resistance as well as its superior electrochemical, magnetic and anisotropicproperties. In this study, pure Co2B nanocrystals were synthesized with Co, B$_2$O$_3$ and Mg as starting materials via the mechanochemical synthesis (MCS) method by high-energy planetary ball mill in a hardened steel vial withhardened steel balls. All the experiments were conducted under Ar atmosphere at different rotational speeds and at 20:1–30:1–40:1 ball-to-powder ratios. Leaching of Co$_2$B $+$ MgO powder mixtures occurred after milling andpurified with acetic acid and pure Co$_2$B nanocrystals were obtained in solid form. The Co2Bs were characterized through X-ray diffraction, scanning electronmicroscopy, vibrating samplemagnetometer, Brunauer–Emmett–Tellerand specific density analyses, and effects of synthesis parameters on product properties were revealed. Surface areas of the powders synthesized at 40:1 ball-to-powder ratio at different rotational speeds were measured as 21.14,40.36 and 52.33 m$^2$ g$^{−1}$, respectively. Crystallite sizes of Co$_2$B nanocrystals were between 7.27 and 9.84 nm and their specific density varied between 7.61 and 7.78 g cm$^{−3}$. It was determined that all samples were saturated and exhibited hysteresis and ferromagnetic behaviours, and saturation magnetization was between 35 and 50 emu g$^{−1}$.

  15. GRIN2B predicts attention problems among disadvantaged children.

    Science.gov (United States)

    Riva, Valentina; Battaglia, Marco; Nobile, Maria; Cattaneo, Francesca; Lazazzera, Claudio; Mascheretti, Sara; Giorda, Roberto; Mérette, Chantal; Émond, Claudia; Maziade, Michel; Marino, Cecilia

    2015-07-01

    It is well established that adversities and GRIN2B (coding an N-methyl-D-aspartate receptor subunit) are independently associated with behavioral and cognitive impairments in childhood. However, a high proportion of children exposed to adversities have good, long-term outcomes. We hypothesized that among children exposed to adversities, GRIN2B variants would predict the worst cognitive and behavioral outcomes. 6 single nucleotide polymorphisms of GRIN2B were genotyped in 625 children aged 6-11 years from an Italian community-based sample. The interacting effect of GRIN2B variants with 4 measures of adversities [low socioeconomic status (SES), preterm delivery, maternal smoking during pregnancy, and absence of breastfeeding] was investigated upon blindly assessed cognitive abilities (vocabulary, block design, digit spans of Wechsler's Intelligence Scale, and Rey complex figure) and parents-rated behavioral problems (Child Behavior Checklist/6-18). Rs2268119 × SES interaction (Hotelling's Trace = 0.07; F(12,1154) = 3.53; p = 0.00004) influenced behavior, with more attention problems among children in the 'either A/T or T/T genotype and low SES' group, compared to all other groups. This interaction effect was not significant in an independent, replication sample of 475 subjects from an Italian community-based sample. GRIN2B variants predict children with the worst outcome in attention functioning among children exposed to low SES. Our findings, if replicated, could help in the identification of children with the highest risk and may prompt cost-effective preventive/treatment strategies.

  16. PSD-93 deletion inhibits Fyn-mediated phosphorylation of NR2B and protects against focal cerebral ischemia.

    Science.gov (United States)

    Zhang, Meijuan; Li, Qingjie; Chen, Ling; Li, Jie; Zhang, Xin; Chen, Xiang; Zhang, Qingxiu; Shao, Yuan; Xu, Yun

    2014-08-01

    Modification of N-methyl-d-aspartate receptor (NMDAR)-mediated excitotoxicity appears to be a potential target in the treatment of ischemic stroke. Postsynaptic density protein-93 (PSD-93) specifically binds the C-terminal tails of the NMDAR, which is critical to couple NMDAR activity to specific intracellular signaling. This study is to investigate whether PSD-93 disruption displays neuroprotection in a focal ischemic stroke model of adult mice and, if it does, to explore possible mechanisms. It was found that, following middle cerebral artery occlusion (MCAO), PSD-93 knockout (KO) mice manifested significant reductions in infarcted volume, neurological deficits and number of degenerated neurons. PSD-93 deletion also reduced cultured cortical neuronal death caused by glucose and oxygen deprivation (OGD). Ischemic long term potentiation (i-LTP) could not be induced in the PSD-93 KO group and wild type (WT) groups pretreated with either AP-5 (NMDAR inhibitor) or PP2 (Src family inhibitor). PSD-93 KO decreased the phosphorylation of the NR2B at Tyr1472 and the interaction between NR2B and Fyn after MCAO. Together, our study demonstrated that PSD-93 KO confers profound neuroprotection against ischemic brain injury, which probably links to the inhibitory effect on Fyn-mediated phosphorylation of NR2B caused by PSD-93 deletion. These findings may provide a novel avenue for the treatment of ischemic stroke. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Workshop Arboretum Volčji potok

    Directory of Open Access Journals (Sweden)

    Ana Kučan

    2012-01-01

    Full Text Available From its constitution onwards, the Volčji Potok Arboretum has been caught between various conflicting orientations. It is both a scientific, research and educational institution, and a cultural monument with exquisite garden and landscape design features and areas of great natural value and built cultural heritage, as well as commercial venue. At the same time, it functions as a park and an area for mass events, a garden centre and nursery. This variety of functions has helped Arboretum to survive the pressures of time; however, partial and uncoordinated interventions have threatened its original mission and its image and generated a number of conflicting situations. The workshop, organised on the initiative of the Institute for the Protection of Cultural Heritage of Slovenia, which involved students from the Faculty of Architecture and students from the Department of Landscape Architecture of the Biotechnical Faculty in mixed groups, generated eight proposals to solve some of the most urgent problems by introducing optimised development with clearly defined goals and priorities.

  18. Chile menos volátil

    Directory of Open Access Journals (Sweden)

    Felipe Larraín B.

    2008-01-01

    Full Text Available Desde fines de 1998 la economía chilena se desaceleró mucho. Si entre 1988 y 1998 la tasa de crecimiento promedio alcanzó un 7.8%, durante el período postcrisis asiática fue de sólo un 3.7%. Sin embargo, junto con la desaceleración del crecimiento, la volatilidad de la economía se redujo prácticamente a la mitad.Este trabajo investiga, mediante un análisis empírico formal, el papel que tuvieron la introducción de la flotación cambiaria y la utilización de la regla de superávit estructural en transformar a Chile en una economía menos volátil. Nuestros resultados muestran que la introducción de la regla fiscal parece haber reducido en un tercio la volatilidad del crecimiento del PIB. Por su parte, la flotación cambiaria contribuyó a reducir esa volatilidad adicionalmente en alrededor de un cuarto. Así, en conjunto, ambas medidas aparecen como responsables de haber disminuido la volatilidad del crecimiento de la economía chilena en casi 60%. Estos resultados son robustos ante especificaciones y posibles problemas de endogeneidad en algunas de las variables explicativas.

  19. Structured Crowdsourcing: A B2B Innovation Roadmap

    DEFF Research Database (Denmark)

    Edgeman, Rick; Engell, Toke; Jensen, Nik Grewy

    Crowdsourcing is an increasingly popular source of both ideas and funding. Crowdsourcing in a B2B context is less well understood and, as such, much of our discussion will highlight business-to-business crowdsourcing. More generally discussion will address crowdsourcing relative to innovation...... from crowd-sourcing efforts. The roadmap emphasizes on early stages in the overall innovation management activity that is related to development and specification of the task to be crowdsourced, the identification of the crowd, the creation of the environment to connect the crowdsourcer, the task...... and the crowd, motivation of the crowd, and actual activities in reaching the crowd. Managing the input from the crowd is regarded as a later stage in the overall innovation management but also as a focal point in the arguments for improving B2B crowdsourcing. In crowd selection processes this paper aims...

  20. Chemical Reactivity Perspective into the Group 2B Metals Halides.

    Science.gov (United States)

    Özen, Alimet Sema; Akdeniz, Zehra

    2016-06-30

    Chemical reactivity descriptors within the conceptual density functional theory can be used to understand the nature of the interactions between two monomers of the Group 2B metal halides. This information might be valuable in the development of adequate force law parameters for simulations in the liquid state. In this study, MX2 monomers and dimers, where M = Zn, Cd, Hg and X = F, Cl, Br, I, were investigated in terms of chemical reactivity descriptors. Relativistic effects were taken into account using the effective core potential (ECP) approach. Correlations were produced between global and local reactivity descriptors and dimerization energies. Results presented in this work represent the first systematic investigation of Group 2B metal halides in the literature from a combined point of view of both relativistic effects and chemical reactivity descriptors. Steric effects were found to be responsible for the deviation from the chemical reactivity principles. They were introduced into the chemical reactivity descriptors such as local softness.

  1. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...... and is independent of specific implementation technologies. In the next stage of the research the emerging reference model will be extended to create an assessment model for analysing the maturity level of a given company in a specific supply chain....

  2. Inbound-markkinoinnin opas pienille B2B-asiantuntijayrityksille

    OpenAIRE

    Halonen, Tuija

    2016-01-01

    Digitalisaatio on muuttanut asiakkaiden ostokäyttäytymistä, minkä vuoksi myös markkinoinnin on muututtava. Asiakaslähtöinen inbound-markkinointi on vetovoimainen vaihtoehto perinteiselle yksisuuntaiselle markkinoinnille, jonka teho on laskussa. Tämän toiminnallisen opinnäytetyön tarkoituksena oli rakentaa opas, joka auttaa pieniä suomalaisia B2B-asiantuntijayrityksiä suunnittelemaan ja toteuttamaan toimivaa ja kustannustehokasta inbound-markkinointia. Teoreettisen viitekehyksen pohjal...

  3. B2B Models for DoD Acquisition

    Science.gov (United States)

    2008-01-15

    business (B2B) e- commerce refers to transactions between businesses conducted electronically over the Internet, intranets, extranets, or private...types of electronic marketplace participation: 1) Sell-side, 2) Buy- side, 3) Exchanges, and 4) Collaborative commerce . In sell-side commerce , there...types are collectively referred to as company-centric electronic commerce , because they address a single company buying or selling needs. Exchanges

  4. CBERS-2B Monitored Forest Fires In Yunnan Province

    Institute of Scientific and Technical Information of China (English)

    Rain.L

    2008-01-01

    @@ Several forest fires hit Yunnan Province,in the southwest of China from April 6 to 9.Two disastrous fires happened near Shangri-La County,Yunnan Province.According to the requirement of the Land and Surveying Department of Yunnan Province,the China Center for Resources Satellite Data & Application (CRESDA) provided satellite monitoring images to detect the events.The processed CBERS-2B images were delivered to the related departments for decision making and disaster relief.

  5. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  6. African Journal for Physical Activity and Health Sciences - Vol 18 ...

    African Journals Online (AJOL)

    African Journal for Physical Activity and Health Sciences - Vol 18, No 4 ... Physical growth and academic intelligence of rural South African children: ... The influence of exergaming on the functional fitness in overweight and obese children ...

  7. Nigerian Journal of Family Practice - Vol 7, No 3 (2016)

    African Journals Online (AJOL)

    Nigerian Journal of Family Practice - Vol 7, No 3 (2016) ... underweight profile among adolescent secondary school students in Uyo, South-South, Nigeria ... Anthropometric characteristics and blood pressure levels of spouses of hypertensive ...

  8. Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  9. Research in Hospitality Management - Vol 6, No 1 (2016)

    African Journals Online (AJOL)

    Research in Hospitality Management - Vol 6, No 1 (2016) ... Employees, sustainability and motivation: Increasing employee engagement by addressing ... in the host-guest relationship · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  10. Journal of the Nigerian Association of Mathematical Physics - Vol 16 ...

    African Journals Online (AJOL)

    Journal of the Nigerian Association of Mathematical Physics - Vol 16 (2010) ... Construction of A Trial Function In The Variational Procedure of Quantum Mechanics ... of Breakthrough Time in Oil Recovery: Case of Some Niger Delta Reservoirs ...

  11. Nigerian Journal of Technology - Vol 35, No 2 (2016)

    African Journals Online (AJOL)

    Nigerian Journal of Technology - Vol 35, No 2 (2016) ... SENSITIVITY ANALYSIS ON FLEXIBLE ROAD PAVEMENT LIFE CYCLE COST MODEL · EMAIL .... WASTEWATER TREATMENT FACILITY OF A HOTEL IN PORT HARCOURT, RIVERS ...

  12. Journal of Development and Communication Studies - Vol 2, No 1 ...

    African Journals Online (AJOL)

    Journal of Development and Communication Studies - Vol 2, No 1 (2012) ... Project of Kerala State, India · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... on the Chichewa Radio · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  13. Egyptian Journal of Biochemistry and Molecular Biology - Vol 29, No ...

    African Journals Online (AJOL)

    Egyptian Journal of Biochemistry and Molecular Biology - Vol 29, No 1 (2011) ... Resveratrol, a natural phytoalexin: A therapeutic promise for metabolic disorders in ... Biochemical study on some adipocyto-kines in chronic renal failure: Their ...

  14. Information Impact Vol. 6(3) Dec 2015

    African Journals Online (AJOL)

    2015-12-10

    Dec 10, 2015 ... Information Impact Vol. 6(3) Dec 2015 ... The study is on perceived factors influencing heads of libraries' choice of leadership styles in ... the leader rather than on leadership behavior ... effective administration in goal-seeking.

  15. Research in Hospitality Management - Vol 1, No 1 (2011)

    African Journals Online (AJOL)

    Research in Hospitality Management - Vol 1, No 1 (2011) ... Do social media display correct conventional hotel ratings? ... Employer branding: A new approach for the hospitality industry · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  16. International Journal of Engineering, Science and Technology - Vol ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... International Journal of Engineering, Science and Technology - Vol 9, No 4 (2017) ... on MHD flow past a moving plate with Hall current · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  17. Journal of Language, Technology & Entrepreneurship in Africa Vol ...

    African Journals Online (AJOL)

    enewa

    Journal of Language, Technology & Entrepreneurship in Africa Vol. 3. No. ... business skills in an effort to address a gap between theory and practice. ..... All in all more organizations appreciated the students efforts towards the work they had.

  18. African Journal of Environmental Science and Technology - Vol 4 ...

    African Journals Online (AJOL)

    African Journal of Environmental Science and Technology - Vol 4, No 11 (2010) ... Leaves of roadside plants as bioindicator of traffic related lead pollution during different ... Quality assessment of drinking water in Temeke District (part II): ...

  19. Journal of Applied Science, Engineering and Technology - Vol 4, No ...

    African Journals Online (AJOL)

    Journal of Applied Science, Engineering and Technology - Vol 4, No 2 (2004) ... Energy consumption pattern in palm kernel oil processing operations ... An improved solar cabinet dryer with natural convective heat transfer · EMAIL FULL TEXT ...

  20. Journal of Language, Technology & Entrepreneurship in Africa Vol ...

    African Journals Online (AJOL)

    ETSU

    Journal of Language, Technology & Entrepreneurship in Africa Vol. 3. No. 2 .... this, specific effects are created for hearers, which he called implicatures. .... Some speakers address each other by their first-born child's name, but whenever the.

  1. Nigerian Journal of Natural Products and Medicine - Vol 2 (1998)

    African Journals Online (AJOL)

    Nigerian Journal of Natural Products and Medicine - Vol 2 (1998) ... RESEARCH AND DEVELOPMENT INTO HERBAL MEDICINES · EMAIL FULL ... OF BRIDELIA FERRUGUBEA STEM BARK ON BLOOD CHEMISTRY AND HISTOLOGY OF ...

  2. Research in Hospitality Management - Vol 6, No 2 (2016)

    African Journals Online (AJOL)

    Research in Hospitality Management - Vol 6, No 2 (2016) ... Understanding young tourists' preferences for a wildlife tourism package ... Employees' perspectives of service quality in hotels · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  3. Journal of Research in Forestry, Wildlife and Environment - Vol 2 ...

    African Journals Online (AJOL)

    Journal of Research in Forestry, Wildlife and Environment - Vol 2, No 1 (2010) ... Diversity and Abundance of Fish Species in Gbedikere Lake, Bassa, Kogi State · EMAIL ... Fadama Users Group Characteristics that Influence Facilitators' Role ...

  4. African Journal of Biotechnology - Vol 14, No 6 (2015)

    African Journals Online (AJOL)

    African Journal of Biotechnology - Vol 14, No 6 (2015) ... molecular genetics in microbial degradation and decolorization of industrial waste water effluent ... Understanding the efficacy of influent waste water on microbial community structure of ...

  5. Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  6. AFRREV IJAH: An International Journal of Arts and Humanities - Vol ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... AFRREV IJAH: An International Journal of Arts and Humanities - Vol 6, No 2 (2017) ... Taylor and Francis Journals under the critical lens of readability analysis ... Current Issue Atom logo

  7. International Journal of Emotional Psychology and Sport Ethics - Vol ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... International Journal of Emotional Psychology and Sport Ethics - Vol 10 (2008) ... Re-Inventing The Current 'Ss' English Language Curriculum: Implications For Students' Performance In ...

  8. African Research Review - Vol 11, No 3 (2017)

    African Journals Online (AJOL)

    African Research Review - Vol 11, No 3 (2017) ... Targeted or Restrictive: Impact of U.S. and EU Sanctions on Education and ... Revamping Nigerian Economy through Cassava Production · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  9. Mizan Law Review - Vol 11, No 1 (2017)

    African Journals Online (AJOL)

    Mizan Law Review - Vol 11, No 1 (2017) ... Interrogating the economy-first paradigm in 'Sustainable Development': towards ... lessons from the Uniform Commercial Code of the US · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  10. Cloning and sequence analysis of a full-length cDNA of SmPP1cb encoding turbot protein phosphatase 1 beta catalytic subunit

    Science.gov (United States)

    Qi, Fei; Guo, Huarong; Wang, Jian

    2008-02-01

    Reversible protein phosphorylation, catalyzed by protein kinases and phosphatases, is an important and versatile mechanism by which eukaryotic cells regulate almost all the signaling processes. Protein phosphatase 1 (PP1) is the first and well-characterized member of the protein serine/threonine phosphatase family. In the present study, a full-length cDNA encoding the beta isoform of the catalytic subunit of protein phosphatase 1(PP1cb), was for the first time isolated and sequenced from the skin tissue of flatfish turbot Scophthalmus maximus, designated SmPP1cb, by the rapid amplification of cDNA ends (RACE) technique. The cDNA sequence of SmPP1cb we obtained contains a 984 bp open reading frame (ORF), flanked by a complete 39 bp 5' untranslated region and 462 bp 3' untranslated region. The ORF encodes a putative 327 amino acid protein, and the N-terminal section of this protein is highly acidic, Met-Ala-Glu-Gly-Glu-Leu-Asp-Val-Asp, a common feature for PP1 catalytic subunit but absent in protein phosphatase 2B (PP2B). And its calculated molecular mass is 37 193 Da and pI 5.8. Sequence analysis indicated that, SmPP1cb is extremely conserved in both amino acid and nucleotide acid levels compared with the PP1cb of other vertebrates and invertebrates, and its Kozak motif contained in the 5'UTR around ATG start codon is GXXAXXGXX ATGG, which is different from mammalian in two positions A-6 and G-3, indicating the possibility of different initiation of translation in turbot, and also the 3'UTR of SmPP1cb is highly diverse in the sequence similarity and length compared with other animals, especially zebrafish. The cloning and sequencing of SmPP1cb gene lays a good foundation for the future work on the biological functions of PP1 in the flatfish turbot.

  11. Isothermal reduction kinetics of Panzhihua ilmenite concentrate under 30vol% CO-70vol% N2 atmosphere

    Science.gov (United States)

    Zhang, Ying-yi; Lü, Wei; Lü, Xue-wei; Li, Sheng-ping; Bai, Chen-guang; Song, Bing; Han, Ke-xi

    2017-03-01

    The reduction of ilmenite concentrate in 30vol% CO-70vol% N2 atmosphere was characterized by thermogravimetric and differential thermogravimetric (TG-DTG) analysis methods at temperatures from 1073 to 1223 K. The isothermal reduction results show that the reduction process comprised two stages; the corresponding apparent activation energy was obtained by the iso-conversional and model-fitting methods. For the first stage, the effect of temperature on the conversion degree was not obvious, the phase boundary chemical reaction was the controlling step, with an apparent activation energy of 15.55-40.71 kJ·mol-1. For the second stage, when the temperatures was greater than 1123 K, the reaction rate and the conversion degree increased sharply with increasing temperature, and random nucleation and subsequent growth were the controlling steps, with an apparent activation energy ranging from 182.33 to 195.95 kJ·mol-1. For the whole reduction process, the average activation energy and pre-exponential factor were 98.94-118.33 kJ·mol-1 and 1.820-1.816 min-1, respectively.

  12. High Energy (-p)p and pp Elastic Scatterings in QCD Inspired Model

    Institute of Scientific and Technical Information of China (English)

    LU Juan; MA Wei-Xing; HE Xiao-Rong

    2007-01-01

    We propose QCD inspired model to calculate (p)p and pp elastic scatterings at high energies in this paper.A calculation for total cross section of (p)p and pp is performed in which the contributions from gluon-gluon,quark-quark,and gluon-quark interactions are included.Our results show that the QCD inspired model gives a perfect fit to experimental data of total cross section both for (p)p and pp elastic scatterings at the whole energy region where experimental data existed at FNAL and CERN.

  13. 40 CFR Table 2b to Subpart E of... - Reactivity Factors for Aliphatic Hydrocarbon Solvent Mixtures

    Science.gov (United States)

    2010-07-01

    ... Hydrocarbon Solvent Mixtures 2B Table 2B to Subpart E of Part 59 Protection of Environment ENVIRONMENTAL... Hydrocarbon Solvent Mixtures Bin Averageboiling point * (degrees F) Criteria Reactivityfactor 1 80-205 Alkanes... + Dry Point) / 2 (b) Aromatic Hydrocarbon Solvents...

  14. Long-term exposures to low doses of silver nanoparticles enhanced in vitro malignant cell transformation in non-tumorigenic BEAS-2B cells.

    Science.gov (United States)

    Choo, Wun Hak; Park, Cho Hee; Jung, Shi Eun; Moon, Byeonghak; Ahn, Huiyeon; Ryu, Jung Seok; Kim, Keun-Soo; Lee, Yong Hwa; Yu, Il Je; Oh, Seung Min

    2016-12-01

    To predict carcinogenic potential of AgNPs on the respiratory system, BEAS-2B cells (human bronchial epithelial cells) were chronically exposed to low- and non-cytotoxic dose (0.13 and 1.33μg/ml) of AgNPs for 4months (#40 passages). To assess malignant cell transformation of chronic exposure to AgNPs, several bioassays including anchorage independent agar colony formation, cell migration/invasion assay, and epithelial-mesenchymal transition (EMT) were performed in BEAS-2B cells. Chronic exposure to AgNPs showed a significant increase of anchorage independent agar colony formation and cell migration/invasion. EMT, which is the loss of epithelial markers (E-Cadherin and Keratin) and the gain of mesenchymal marker (N-cadherin and Vimentin), was induced by chronic exposure to AgNPs. These responses indicated that chronic exposure to AgNPs could acquire characteristics of tumorigenic cells from normal BEAS-2B cells. In addition, caspase-3, p-p53, p-p38, and p-JNK were significantly decreased, while p-ERK1/2 was significantly increased. MMP-9 related to cell migration/invasion was upregulated, while a MMP-9 inhibitor, TIMP-1 was down-regulated. These results indicated that BEAS-2B cells exposed to AgNPs could induce anti-apoptotic response/anoikis resistance, and cell migration/invasion by complex regulation of MAPK kinase (p38, JNK, and ERK) and p53 signaling pathways. Therefore, we suggested that long-term exposure to low-dose of AgNPs could enhance malignant cell transformation in non-tumorigenic BEAS-2B cells. Our findings provide useful information needed to assess the carcinogenic potential of AgNPs.

  15. Neoplasia endocrina múltiple tipo-2b

    OpenAIRE

    Lastra, Guido; de Franco, Roberto; Rueda P., Pedro Nel; Pradilla S., Lina P.; Paz C., Óscar

    2014-01-01

    La neoplasia endocrina multiple tipo 2 comprendetres sindromes : la neoplasia endocrina múltiple2A con predisposición genética para desarrollarcarcinoma medular del tiroides,feocromocitoma e hiperplasia primaria deparatiroides. La neoplasia endocrina múltiple 2B,desorden autosómico dominante con feocromocitomay carcinoma medular del tiroides quegeneralmente se presenta a una edad más tempranay es más agresivo que la de tipo 2A, porlo que su diagnóstico precoz es crítico; estospacientes, que t...

  16. Main: 1I2B [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I2B シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Udp-Sulfoquinovose Syntha...Molecule: Sulfolipid Biosynthesis Protein Sqd1; Chain: A; Engineered: Yes; Mutation: Yes Biosynthetic Protein... M.J.Theisen, S.L.Sanda, S.L.Ginell, C.Benning, R.M.Garavito M.J.Theisen, S.L.Sanda, S.L.Gin...ell, C.Benning, R.M.Garavito Characterization Of The Active Site Of Udp-Sulfoquinovose Synthase:... Formation Of The Sulfonic Acid Product In The Crystalline State To Be Published Sdr, Short-Chain Dehydrogen

  17. Study of pp{yields}pp{eta} reaction at threshold; Etude de la reaction pp{yields}pp{eta} au seuil

    Energy Technology Data Exchange (ETDEWEB)

    Taleb, A.

    1994-11-01

    The {eta} production has been studied through the pp {yields} pp{eta} reaction at threshold. Data were taken at the Synchrotron of the ``Laboratoire National Saturne``. The detection in coincidence of the two protons scattered near 0 deg and analysed with the magnetic spectrometer SPES3 allows the reconstruction of missing mass spectra for the {eta} signature. A simulation program which takes into account all the experimental set up characteristics has been realized and tested through the pp {yields} d{pi}{sup +} reaction detected simultaneously with pp {yields} pp{eta}. The generated proton momentum spectra for pp {yields} pp{eta} show a pronounced {eta} mass dependence. This characteristic, connected to the kinematical properties of pp {yields} pp{eta} at threshold, is used to extract the mass of the meson {eta}. The obtained value, m{sub {eta}} = 547.65 {+-} 0.18 MeV, is in good agreement with measurement done recently through the pd {yields} {sup H}e{eta} reaction. The total cross section {sigma}{sub t} of pp {yields} pp{eta} measured at 1260, 1265 and 1300 MeV presents a strong energy dependence. This cross section increases less with energy than the phase-space. The influence of p-p and {eta}-p final state interactions in our measurements is studied. Our results are compared with theoretical predictions and assess the dominant character of the baryonic resonance N{sup *}(1535) in the {eta} mechanism production at threshold. These experimental results give an energy dependence which is not well reproduced by the theoretical predictions. This discrepancy could be an incorrect description of the {eta}-p interaction in the models. (author). 48 refs., 60 figs., 15 tabs.

  18. ppGpp: magic beyond RNA polymerase.

    Science.gov (United States)

    Dalebroux, Zachary D; Swanson, Michele S

    2012-02-16

    During stress, bacteria undergo extensive physiological transformations, many of which are coordinated by ppGpp. Although ppGpp is best known for enhancing cellular resilience by redirecting the RNA polymerase (RNAP) to certain genes, it also acts as a signal in many other cellular processes in bacteria. After a brief overview of ppGpp biosynthesis and its impact on promoter selection by RNAP, we discuss how bacteria exploit ppGpp to modulate the synthesis, stability or activity of proteins or regulatory RNAs that are crucial in challenging environments, using mechanisms beyond the direct regulation of RNAP activity.

  19. USING UML SCENARIOS IN B2B SYSTEMS

    Directory of Open Access Journals (Sweden)

    A. Jakimi

    2010-05-01

    Full Text Available Scenarios has become a popular technique for requirements elicitation and specification building. Since scenarios capture only partial descriptions of the system behavior, an approach for scenario composition and/or integration is needed to produce more complete specifications. The Unified Modeling Language (UML, which has become a standard notation for object-oriented modeling, provides a suitable framework for scenario acquisition using Use Case diagrams and Sequence or Collaboration diagrams. In this paper, we suggest an algorithmic and tool support for composing and integrating scenarios that are represented in form of sequence diagrams. We suggest four operators (;: sequential operator, ||: concurrent operator, ?: conditional operator and  * :iteration operator to compose a set of scenarios that describe a use case of a given system. In this paper, we suggest also to apply the scenario approach to B2B systems (Business to Business. We propose to develop B2B systems as a three activities process deriving formal specifications and code skeletons from UML scenarios. Activities of this proposed process are generally automatic and are supported by a set of developed algorithms and tools.

  20. 2b or Not 2b: Experimental Evolution of Functional Exogenous Sequences in a Plant RNA Virus

    Science.gov (United States)

    Zwart, Mark P.; Ambrós, Silvia; Carrasco, José L.; Elena, Santiago F.

    2017-01-01

    Horizontal gene transfer (HGT) is pervasive in viruses and thought to be a key mechanism in their evolution. On the other hand, strong selective constraints against increasing genome size are an impediment for HGT, rapidly purging horizontally transferred sequences and thereby potentially hindering evolutionary innovation. Here, we explore experimentally the evolutionary fate of viruses with simulated HGT events, using the plant RNA virus Tobacco etch virus (TEV), by separately introducing two functional, exogenous sequences to its genome. One of the events simulates the acquisition of a new function though HGT of a conserved AlkB domain, responsible for the repair of alkylation or methylation damage in many organisms. The other event simulates the acquisition of a sequence that duplicates an existing function, through HGT of the 2b RNA silencing suppressor from Cucumber mosaic virus. We then evolved these two viruses, tracked the maintenance of the horizontally transferred sequences over time, and for the final virus populations, sequenced their genome and measured viral fitness. We found that the AlkB domain was rapidly purged from the TEV genome, restoring fitness to wild-type levels. Conversely, the 2b gene was stably maintained and did not have a major impact on viral fitness. Moreover, we found that 2b is functional in TEV, as it provides a replicative advantage when the RNA silencing suppression domain of HC-Pro is mutated. These observations suggest a potentially interesting role for HGT of short functional sequences in ameliorating evolutionary constraints on viruses, through the duplication of functions. PMID:28137747

  1. Caracterización de compuestos volátiles durante el secado por aspersión de jugo de sandía (Citrullus lanatus ThunB.)

    OpenAIRE

    Héctor Manuel González Sánchez; Salvador González Palomares; Tábata Rosales Reyes

    2011-01-01

    El objetivo del trabajo fue evaluar el efecto de la maltodextrina y goma arábiga en la retención de compuestos volátiles durante el secado por aspersión de jugo de sandía (Citrullus lanatus Thunb.). Se utilizó sandía de la variedad Alena. Se evaluaron tres tratamientos de encapsulantes, T1: 0.5% p/p de maltodextrina, T2: 0.5% p/p de goma arábiga y T3: 0.5% de una mezcla de maltodextrina DE-10 y goma arábiga (1:1) p/p. Las condiciones del secado fueron constantes: flujo de alimentación del 15%...

  2. Encephalomyocarditis virus viroporin 2B activates NLRP3 inflammasome.

    Directory of Open Access Journals (Sweden)

    Minako Ito

    Full Text Available Nod-like receptors (NLRs comprise a large family of intracellular pattern- recognition receptors. Members of the NLR family assemble into large multiprotein complexes, termed the inflammasomes. The NLR family, pyrin domain-containing 3 (NLRP3 is triggered by a diverse set of molecules and signals, and forms the NLRP3 inflammasome. Recent studies have indicated that both DNA and RNA viruses stimulate the NLRP3 inflammasome, leading to the secretion of interleukin 1 beta (IL-1β and IL-18 following the activation of caspase-1. We previously demonstrated that the proton-selective ion channel M2 protein of influenza virus activates the NLRP3 inflammasome. However, the precise mechanism by which NLRP3 recognizes viral infections remains to be defined. Here, we demonstrate that encephalomyocarditis virus (EMCV, a positive strand RNA virus of the family Picornaviridae, activates the NLRP3 inflammasome in mouse dendritic cells and macrophages. Although transfection with RNA from EMCV virions or EMCV-infected cells induced robust expression of type I interferons in macrophages, it failed to stimulate secretion of IL-1β. Instead, the EMCV viroporin 2B was sufficient to cause inflammasome activation in lipopolysaccharide-primed macrophages. While cells untransfected or transfected with the gene encoding the EMCV non-structural protein 2A or 2C expressed NLRP3 uniformly throughout the cytoplasm, NLRP3 was redistributed to the perinuclear space in cells transfected with the gene encoding the EMCV 2B or influenza virus M2 protein. 2B proteins of other picornaviruses, poliovirus and enterovirus 71, also caused the NLRP3 redistribution. Elevation of the intracellular Ca(2+ level, but not mitochondrial reactive oxygen species and lysosomal cathepsin B, was important in EMCV-induced NLRP3 inflammasome activation. Chelation of extracellular Ca(2+ did not reduce virus-induced IL-1β secretion. These results indicate that EMCV activates the NLRP3 inflammasome by

  3. 20 CFR 655.22 - Obligations of H-2B employers.

    Science.gov (United States)

    2010-04-01

    ... required by law that the employer will make from the worker's paycheck. All deductions must be reasonable... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Obligations of H-2B employers. 655.22 Section... States (H-2B Workers) § 655.22 Obligations of H-2B employers. An employer seeking H-2B labor...

  4. Mania associated with interferon α2b treatment

    Directory of Open Access Journals (Sweden)

    Basanth K

    2006-01-01

    Full Text Available Neuropsychiatric side effects are common with Interferon α 2b. Psychosis and depression have been reported. Several cases of mania have been reported but only few have been associated with treatment for hepatitis B. We report a case of mania with psychotic symptoms in a 21-year-old female diagnosed to have hepatitis-B infection, who was receiving interferon. The report supports the view that dose reductions or pauses during interferon treatment can cause mania. Family history of mood disorder could be a risk factor. Atypical presentations are common in interferon-induced mania. Mania induced by interferon responds well to antimanic drugs. Since the use of interferon is increasing in developing countries, the need for awareness of side effects and management issues are important and these are highlighted.

  5. Semantic ETL into i2b2 with Eureka!

    Science.gov (United States)

    Post, Andrew R; Krc, Tahsin; Rathod, Himanshu; Agravat, Sanjay; Mansour, Michel; Torian, William; Saltz, Joel H

    2013-01-01

    Clinical phenotyping is an emerging research information systems capability. Research uses of electronic health record (EHR) data may require the ability to identify clinical co-morbidities and complications. Such phenotypes may not be represented directly as discrete data elements, but rather as frequency, sequential and temporal patterns in billing and clinical data. These patterns' complexity suggests the need for a robust yet flexible extract, transform and load (ETL) process that can compute them. This capability should be accessible to investigators with limited ability to engage an IT department in data management. We have developed such a system, Eureka! Clinical Analytics. It extracts data from an Excel spreadsheet, computes a broad set of phenotypes of common interest, and loads both raw and computed data into an i2b2 project. A web-based user interface allows executing and monitoring ETL processes. Eureka! is deployed at our institution and is available for deployment in the cloud.

  6. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  7. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... services to large Scandinavian corporations. We account for and analyse the process of building a mystery shopping procedure to get strategic insights from engineers delivering temporary consultancy services to these clients. After a successful trial period with three mystery shoppers the experiment (a...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  8. Vortex lattice transitions in YNi2B2C

    Indian Academy of Sciences (India)

    S J Levett; C D Dewhurst; D McK Paul

    2002-05-01

    We have performed extensive small-angle neutron scattering (SANS) diffraction studies of the vortex lattice in single crystal YNi2B2C for $B||c$. High-resolution SANS, combined with a field-oscillation vortex lattice preparation technique, allows us to separate Bragg scattered intensities from two orthogonal domains and accurately determine the unit cell angle, . The data suggest that upon increasing field there is a finite transition width where both low- and high-field distorted hexagonal vortex lattice phases, mutually rotated by 45°, coexist. The smooth variation of diffracted intensity from each phase through the transition corresponds to a redistribution of populations between the two types of domains.

  9. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  10. A RADIOIMMUNOASSAY FOR PLACENTAL PROTEIN PP5

    Institute of Scientific and Technical Information of China (English)

    WANGShui-Long; DUGuo-Guang; ZHENGShu-Rong; LIUXin-Jun; YANRen-Ying

    1989-01-01

    A radioimmunoasay of high sendtivity end smbility was developed For placental proteinPP5 (PP5), a syncytiotrophoblast product oF the human placenta. We measured 94 samples from 17 normal nonpregnant women, 47 normal pregnant women, and 30 samples

  11. No horizons in pp-waves

    CERN Document Server

    Hubeny, V E; Hubeny, Veronika E; Rangamani, Mukund

    2002-01-01

    We argue that pp-wave backgrounds can not admit event horizons. We also comment on pp-wave generalizations which would admit horizons and show that there exists a black string solution which asymptotes to a five dimensional plane wave background.

  12. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    Energy Technology Data Exchange (ETDEWEB)

    Tarvainen, A.-M. (Suomen Malmi Oy, Espoo (Finland))

    2011-08-15

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  13. Structure of human nucleosome containing the testis-specific histone variant TSH2B

    Energy Technology Data Exchange (ETDEWEB)

    Urahama, Takashi; Horikoshi, Naoki; Osakabe, Akihisa; Tachiwana, Hiroaki; Kurumizaka, Hitoshi, E-mail: kurumizaka@waseda.jp [Waseda University, 2-2 Wakamatsu-cho, Shinjuku-ku, Tokyo 162-8480 (Japan)

    2014-03-25

    The crystal structure of human nucleosome containing the testis-specific TSH2B variant has been determined. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, and induces a local structural difference between TSH2B and H2B in nucleosomes. The human histone H2B variant TSH2B is highly expressed in testis and may function in the chromatin transition during spermatogenesis. In the present study, the crystal structure of the human testis-specific nucleosome containing TSH2B was determined at 2.8 Å resolution. A local structural difference between TSH2B and canonical H2B in nucleosomes was detected around the TSH2B-specific amino-acid residue Ser85. The TSH2B Ser85 residue does not interact with H4 in the nucleosome, but in the canonical nucleosome the H2B Asn84 residue (corresponding to the TSH2B Ser85 residue) forms water-mediated hydrogen bonds with the H4 Arg78 residue. In contrast, the other TSH2B-specific amino-acid residues did not induce any significant local structural changes in the TSH2B nucleosome. These findings may provide important information for understanding how testis-specific histone variants form nucleosomes during spermatogenesis.

  14. Glucose-induced posttranslational activation of protein phosphatases PP2A and PP1 in yeast

    Institute of Scientific and Technical Information of China (English)

    Dries Castermans; Ils Somers; Johan Kriel; Wendy Louwet; Stefaan Wera; Matthias Versele; Veerle Janssens; Johan M Thevelein

    2012-01-01

    The protein phosphatases PP2A and PP1 are major regulators of a variety of cellular processes in yeast and other eukaryotes.Here,we reveal that both enzymes are direct targets of glucose sensing.Addition of glucose to glucosedeprived yeast cells triggered rapid posttranslational activation of both PP2A and PP1.Glucose activation of PP2A is controlled by regulatory subunits Rts1,Cdc55,Rrd1 and Rrd2.It is associated with rapid carboxymethylation of the catalytic subnnits,which is necessary but not sufficient for activation.Glucose activation of PP1 was fully dependent on regulatory subunits Reg1 and Shp1.Absence of Gac1,GIc8,Reg2 or Red1 partially reduced activation while Pig1 and Pig2 inhibited activation.Full activation of PP2A and PP1 was also dependent on subunits classically considered to belong to the other phosphatase.PP2A activation was dependent on PP1 subunits Reg1 and Shpl while PP1 activation was dependent on PP2A subunit Rts1.Rts1 interacted with both Pph21 and Glc7 under different conditions and these interactions were Regl dependent.Regl-GIc7 interaction is responsible for PP1 involvement in the main glucose repression pathway and we show that deletion of Shpl also causes strong derepression of the invertase gene SUC2.Deletion of the PP2A subunits Pph21 and Pph22,Rrd1 and Rrd2,specifically enhanced the derepression level of SUC2,indicating that PP2A counteracts SUC2 derepression.Interestingly,the effect of the regulatory subunit Rtsl was consistent with its role as a subunit of both PP2A and PP1,affecting derepression and repression of SUC2,respectively.We also show that abolished phosphatase activation,except by reg1A,does not completely block Snf1 dephosphorylation after addition of glucose.Finally,we show that glucose activation of the cAMP-PKA (protein kinase A)pathway is required for glucose activation of both PP2A and PP1.Our results provide novel insight into the complex regulatory role of these two major protein phosphatases in glucose

  15. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2012-04-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.         JEL Codes: D23, L86Keywords: Cost, Transaction Costs, Transactions

  16. Analysis of Vernier Scans during the PP2PP run in 2009 (pp at 100 GeV/beam)

    Energy Technology Data Exchange (ETDEWEB)

    Drees, A.

    2011-12-13

    At the end of RHIC's 2009 operation a dedicated run for the PP2PP experiment (part of the STAR experiment) took place from Jun 29 to Jul 06 2009. Polarized protons were accelerated to 100 GeV using ramp-file pp100-90pp2pp with a {beta}* = 22 m in IR6. Since only transverse polarization was required no rotator ramp was in use. The PP2PP experiment consists mainly of two Roman Pot detectors (one horizontal and one vertical) on either side of IR6 in the outgoing-beam arms between the Q3 and Q4 magnets. The yellow pots are in sector 5, the blue ones in sector 6. Roman Pot type detectors are installed inside the beampipe causing an accelerator safety concern. To address this concern there is a limit to the allowable total beam current in the machine while Roman Pots are enabled to move closer to the beam. This limit was set to a motion limit of 5 mm from the center of the beampipe and 50 {center_dot} 10{sup 11} beam current per ring. In order to reduce the background in the detectors, beams were scraped using the RHIC collimator system prior to moving the pots closer. This was typically repeated several times throughout a store since beam halo reforms over the course of hours.

  17. Nigerian Journal of Chemical Research 22 Vol,15, 2010 Neutron ...

    African Journals Online (AJOL)

    Hp

    standardization of irradiation and counting facilities for .... herbicides, pesticides and chemical fertilizers. The elements Th, Eu, Hf, ... is recognized as urban air pollutants. It interacts with arsenic ... industrial Hygiene and Toxicology,. 4(1994) pp ...

  18. Technical comparison between Hythane, GNG and gasoline fueled vehicles. [Hythane = 85 vol% natural gas, 15 vol% H[sub 2

    Energy Technology Data Exchange (ETDEWEB)

    1992-05-01

    This interim report documents progress on this 2-year Alternative Fuel project, scheduled to end early 1993. Hythane is 85 vol% compressed natural gas (CNG) and 15 vol% hydrogen; it has the potential to meet or exceed the California Ultra-Low Emission Vehicle (ULEV) standard. Three USA trucks (3/4 ton pickup) were operated on single fuel (unleaded gasoline, CNG, Hythane) in Denver. The report includes emission testing, fueling facility, hazard and operability study, and a framework for a national hythane strategy.

  19. Efficient cell culture system for hepatitis C virus genotype 2B

    DEFF Research Database (Denmark)

    2014-01-01

    The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from...... transfection experiments revealed that 2b/2a was genetically stable. Conclusion: The developed 2b/2a viruses provide a robust in vitro tool for research in HCV genotype 2b, including vaccine studies and functional analysis.......The present inventors developed hepatitis C virus 2b/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced by the corresponding genes of the genotype 2b reference strain J8. Sequence analysis of recovered 2b/2a recombinants from 2...

  20. Phonon linewidths in YNi2B2C

    Indian Academy of Sciences (India)

    L Pintschovius; F Weber; W Reichardt; A Kreyssig; R Heid; D Reznik; O Stockert; K Hradil

    2008-10-01

    Phonons in a metal interact with conduction electrons which give rise to a finite linewidth. In the normal state, this leads to a Lorentzian shape of the phonon line. Density functional theory is able to predict the phonon linewidths as a function of wave vector for each branch of the phonon dispersion. An experimental verification of such predictions is feasible only for compounds with very strong electron–phonon coupling. YN2B2C was chosen as a test example because it is a conventional superconductor with a fairly high c (15.2 K). Inelastic neutron scattering experiments did largely confirm the theoretical predictions. Moreover, they revealed a strong temperature dependence of the linewidths of some phonons with particularly strong electron–phonon coupling which can as yet only qualitatively be accounted for by theory. For such phonons, marked changes of the phonon frequencies and linewidths were observed from room temperature down to 15 K. Further changes were observed on entering into the superconducting state. These changes can, however, not be described simply by a change of the phonon linewidth.

  1. Natural releases from contaminated groundwater, Example Reference Biosphere 2B

    Energy Technology Data Exchange (ETDEWEB)

    Simon, I. [CIEMAT/PIRA, Avda Complutense 22, 28040 Madrid (Spain)]. E-mail: isc@csn.es; Naito, M. [Nuclear Waste Management Organization of Japan (NUMO), 4-1-23 Shiba, Minato-ku, Tokyo, 108-0014 (Japan); Thorne, M.C. [Mike Thorne and Associates Limited, Abbotsleigh, Kebroyd Mount, Ripponden, Halifax, West Yorkshire HX6 3JA (United Kingdom); Walke, R. [Enviros QuantiSci, Building D5, Culham Science Centre, Culham, Oxfordshire OX14 3DB (United Kingdom)

    2005-07-01

    Safety assessment is a tool which, by means of an iterative procedure, allows the evaluation of the performance of a disposal system and its potential impact on human health and the environment. Radionuclides from a deep geological disposal facility may not reach the surface environment until many tens of thousands of years after closure of the facility. The BIOMASS Programme on BIOsphere Modelling and ASSessment developed Examples of 'Reference Biospheres' to illustrate the use of the methodology and to demonstrate how biosphere models can be developed and justified as being fit for purpose. The practical examples are also intended to be useful in their own right. The Example Reference Biosphere 2B presented here involves the consideration of alternative types of geosphere-biosphere interfaces and calculation of doses to members of hypothetical exposure groups arising from a wide range of exposure pathways within agricultural and semi-natural environments, but without allowing for evolution of the corresponding biosphere system. The example presented can be used as a generic analysis in some situations although it was developed around a relatively specific conceptual model. It should be a useful practical example, but the above numerical results are not intended to be understood as prescribed biosphere 'conversion factors'.

  2. Analysis of exoplanet XO-2 b observed with HST NICMOS

    Science.gov (United States)

    Crouzet, Nicolas; McCullough, P. R.; Burke, C.; Long, D.

    2011-09-01

    We present the photometric and spectroscopic analysis of the transiting planet XO-2 b, from HST NICMOS. Three transits of the planet have been observed. The field of view contains not only the XO-2 star but also a second star of very similar properties, which we use as a comparison star. We first perform a white-light photometric analysis of the data. The high signal to noise ratio yields improved parameters for the planet and host star. We then build the spectrum of this system in the range 1.2-1.8 microns with a spectral resolution of R 35, taking into account systematic effects. To investigate the validity of the method and the reliability of NICMOS data, we also build a spectrum for the exoplanet XO-1 b. We find an overall shape close to Tinetti et al. (ApJL 2010), although differences appear for some particular features. In the context of a debate about planetary spectra obtained with NICMOS, this study suggests that NICMOS data, although clearly affected by systematics, contain enough information to derive planetary spectra at least at low resolution.

  3. SH2B1 regulation of energy balance, body weight, and glucose metabolism

    Institute of Scientific and Technical Information of China (English)

    Liangyou; Rui

    2014-01-01

    The Src homology 2B(SH2B)family members(SH2B1,SH2B2 and SH2B3)are adaptor signaling proteins containing characteristic SH2 and PH domains.SH2B1(also called SH2-B and PSM)and SH2B2(also called APS)are able to form homo-or hetero-dimers via their N-terminal dimerization domains.Their C-terminal SH2 domains bind to tyrosyl phosphorylated proteins,including Janus kinase 2(JAK2),TrkA,insulin receptors,insulin-like growth factor-1 receptors,insulin receptor substrate-1(IRS1),and IRS2.SH2B1 enhances leptin signaling by both stimulating JAK2 activity and assembling a JAK2/IRS1/2 signaling complex.SH2B1 promotes insulin signaling by both enhancing insulin receptor catalytic activity and protecting against dephosphorylation of IRS proteins.Accordingly,genetic deletion of SH2B1 results in severe leptin resistance,insulin resistance,hyperphagia,obesity,and type 2 diabetes in mice.Neuronspecific overexpression of SH2B1βtransgenes protects against diet-induced obesity and insulin resistance.SH2B1 in pancreaticβcells promotesβcell expansion and insulin secretion to counteract insulin resistance in obesity.Moreover,numerous SH2B1 mutations are genetically linked to leptin resistance,insulin resistance,obesity,and type 2 diabetes in humans.Unlike SH2B1,SH2B2 and SH2B3 are not required for the maintenance of normal energy and glucose homeostasis.The metabolic function of the SH2B family is conserved from insects to humans.

  4. Shostakovich: The Orchestral Songs Vol. 2 / Michael Tanner

    Index Scriptorium Estoniae

    Tanner, Michael

    1996-01-01

    Uuest heliplaadist "Shostakovich: The Orchestral Songs Vol. 2: Six Romances on texts by Japanese poets, Op. 21. Six Poems on Marina Tsvetayeva, Op. 143. Suite on Verses of Michelangelo, Op. 145. Gothenburg Symphony Orchestra, Neeme Järvi". DG 447 085-2GH (71 minutes:DDD)

  5. Schostakowitsch. Orchesterlieder (Vol. 2), Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1996-01-01

    Uuest heliplaadist "Schostakowitsch. Orchesterlieder (Vol. 2): Sechs Romanzen op. 21, Sechs Gedichte op. 143a, Suite auf Verse von Michelangelo Buonarroti op. 145a. Göteborger Sinfoniker, Neeme Järvi". DG CD 447 085-2 (WD: 71'06") DDD

  6. East and Central African Journal of Pharmaceutical Sciences Vol. 7 ...

    African Journals Online (AJOL)

    East and Central African Journal of Pharmaceutical Sciences. Vol. 7(3) 52-55. Adherence ... any for the rest of hislher life is one of the biggest challenges. While much .... Secondly, 2- and 3-times-daily regimens required for HIV are difficult and ...

  7. Tropical Journal of Pharmaceutical Research - Vol 16, No 2 (2017)

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research - Vol 16, No 2 (2017) ... Bone regeneration potential of sub-microfibrous membranes with osteogenic ... Baicalein and U0126 suppress bladder cancer proliferation via MAPK ... Analysis of the effect of Qizhuyigan on liver function in a mouse model of immunological liver injury ...

  8. Vol 39 2011 Art 5.pub - African Journals Online

    African Journals Online (AJOL)

    p2613611

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 39, 2011 ... The pertinence of status factors in consumers' consideration of major ... ties in terms of consumers' expectations and appli- ... such characteristics serve as pertinent heuristics in ... value and the quality of appliances from their external.

  9. Shostakovich: The Orchestral Songs Vol. 2 / Michael Tanner

    Index Scriptorium Estoniae

    Tanner, Michael

    1996-01-01

    Uuest heliplaadist "Shostakovich: The Orchestral Songs Vol. 2: Six Romances on texts by Japanese poets, Op. 21. Six Poems on Marina Tsvetayeva, Op. 143. Suite on Verses of Michelangelo, Op. 145. Gothenburg Symphony Orchestra, Neeme Järvi". DG 447 085-2GH (71 minutes:DDD)

  10. Schostakowitsch. Orchesterlieder (Vol. 2), Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1996-01-01

    Uuest heliplaadist "Schostakowitsch. Orchesterlieder (Vol. 2): Sechs Romanzen op. 21, Sechs Gedichte op. 143a, Suite auf Verse von Michelangelo Buonarroti op. 145a. Göteborger Sinfoniker, Neeme Järvi". DG CD 447 085-2 (WD: 71'06") DDD

  11. New Egyptian Journal of Microbiology - Vol 17 (2007)

    African Journals Online (AJOL)

    New Egyptian Journal of Microbiology - Vol 17 (2007) ... Detection Of Human Herpes Virus Type-8 Dna In Kaposi\\'s Sarcoma And Other Bullous Skin Diseases · EMAIL ... Of Conventional And Molecular Diagnosis Of Superficial Fungal Infections .... Interference Between Lactobacilli And Group A Streptococcus pyogenes: An ...

  12. African Journal of Infectious Diseases - Vol 10, No 2 (2016)

    African Journals Online (AJOL)

    African Journal of Infectious Diseases - Vol 10, No 2 (2016) ... The strengths, weaknesses, opportunities, and threats (SWOTs) analyses of the Ebola virus ... ducks as potential reservoir of avian influenza virus in post HPAI H5N1 outbreak area, ...

  13. Creative Artist: A Journal of Theatre and Media Studies - Vol 10, No ...

    African Journals Online (AJOL)

    Creative Artist: A Journal of Theatre and Media Studies - Vol 10, No 1 (2016). Journal Home > Archives > Vol 10, No 1 (2016) ... Community theatre and development practices in Nyanza Region, Kenya · EMAIL FREE FULL TEXT EMAIL FREE ...

  14. Lithium decreased NR2B tyrosine phosphorylation and interactions of NR2B and PSD-95 with Src in rat hippocampus following cerebral ischemia

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Objective: To study the effects of chronic lithium on N-methyl-d-aspartate receptor subunit 2B (NR2B) tyrosine phosphorylation and the interactions of NR2B and PSD-95 with Src induced by cerebral ischemia/reperfusion (I/R). Methods: Transient (15 min) cerebral ischemia was induced by four-vessel occlusion procedure in SD rats. Immunoprecipitation (IP) and immunoblotting (IB)were performed to investigate the phosphorylation and interactions of proteins. The effects of lithium on tyrosine phosphorylation of NR2B and its interactions with PSD-95 and Src were examined. Results: Transient cerebral ischemia 15 min followed by reperfusion 6 h (I/R 6h) caused a significant increase in tyrosine phosphorylation of NR2B. Administration of LiCl for 7days before ischemia caused a profound decrease in tyrosine phosphorylation of NR2B. Similiarly, the interactions of NR2B and PSD-95 with Src were also enhanced by I/R 6 h.moreover, these interactions were also inhibited by chronic lithium. Conclusion: Pretreatment with lithium decrease tyrosine phosphorylation of NR2B and interactions of NR2B and PSD-95 with Src during cerebral I/R.

  15. Causal structures of pp-waves

    CERN Document Server

    Hubeny, V E; Hubeny, Veronika E.; Rangamani, Mukund

    2002-01-01

    We discuss the causal structure of pp-wave spacetimes using the ideal point construction outlined by Geroch, Kronheimer, and Penrose. This generalizes the recent work of Marolf and Ross, who considered similar issues for plane wave spacetimes. We address the question regarding the dimension of the causal boundary for certain specific pp-wave backgrounds. In particular, we demonstrate that the pp-wave spacetime which gives rise to the N = 2 sine-Gordon string world-sheet theory is geodesically complete and has a one-dimensional causal boundary.

  16. GluN2B-containing NMDA receptors promote glutamate synapse development in hippocampal interneurons.

    Science.gov (United States)

    Kelsch, Wolfgang; Li, Zhijun; Wieland, Sebastian; Senkov, Oleg; Herb, Anne; Göngrich, Christina; Monyer, Hannah

    2014-11-26

    In postnatal development, GluN2B-containing NMDARs are critical for the functional maturation of glutamatergic synapses. GluN2B-containing NMDARs prevail until the second postnatal week when GluN2A subunits are progressively added, conferring mature properties to NMDARs. In cortical principal neurons, deletion of GluN2B results in an increase in functional AMPAR synapses, suggesting that GluN2B-containing NMDARs set a brake on glutamate synapse maturation. The function of GluN2B in the maturation of glutamatergic inputs to cortical interneurons is not known. To examine the function of GluN2B in interneurons, we generated mutant mice with conditional deletion of GluN2B in interneurons (GluN2B(ΔGAD67)). In GluN2B(ΔGAD67) mice interneurons distributed normally in cortical brain regions. After the second postnatal week, GluN2B(ΔGAD67) mice developed hippocampal seizures and died shortly thereafter. Before the onset of seizures, GluN2B-deficient hippocampal interneurons received fewer glutamatergic synaptic inputs than littermate controls, indicating that GluN2B-containing NMDARs positively regulate the maturation of glutamatergic input synapses in interneurons. These findings suggest that GluN2B-containing NMDARs keep the circuit activity under control by promoting the maturation of excitatory synapses in interneurons.

  17. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  18. Hanstholm phase 2B. Offshore wave energy test 1994 - 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The wave power converter consists of a float 2.5 meter in diameter, connected by a rope to a seabed-mounted piston pump, installed on 25 meter deep water 2,5 km offshore Hanstholm, Denmark. The converter is designed to absorb an average maximum power of 1 kW. Measured data in real sea conditions are compared to results based on computer simulations and previous tank testing. Losses caused by rope elasticity and hysteresis, friction in the pump and back flow through the valves are assessed. The economic perspectives of a large wave power plant are presented, based on a revised prototype incorporating the results and experience gained during the test period. The wave energy conversion test `Hanstholm phase 2B` has showed, that it it technically possible to exploit the offshore wave energy resource. This source of energy could become attractive for commercial enterprise. The wave power converter demonstrated a reliable performance over a period of nine months. It produced energy under all wave conditions and survived storm waves of 9,6 m. A 300 MW wave power plant in the Danish part of the North sea is estimated to produce electricity at a cost between 2,1 - 2,4 DKK/kWh. The electrical transmission to shore contribute to approximately 20% of the cost. New data predict a potential of 23 kW per meter wave front. The energy plan Energy 21 proposed by the Danish Department of Energy, includes a scenario incorporating wave energy in the energy system year 2030. A strategy for the development of wave energy, has been proposed as part of the project OWEC-1 supported by the European Joule R and D programme. A proposal for future Danish initiatives to develop second generation point absorber systems is outlined. (ARW) 29 refs.

  19. COOH-terminal association of human smooth muscle calcium channel Ca(v)1.2b with Src kinase protein binding domains: effect of nitrotyrosylation.

    Science.gov (United States)

    Kang, Minho; Ross, Gracious R; Akbarali, Hamid I

    2007-12-01

    The carboxyl terminus of the calcium channel plays an important role in the regulation of calcium entry, signal transduction, and gene expression. Potential protein-protein interaction sites within the COOH terminus of the L-type calcium channel include those for the SH3 and SH2 binding domains of c-Src kinase that regulates calcium currents in smooth muscle. In this study, we examined the binding sites involved in Src kinase-mediated phosphorylation of the human voltage-gated calcium channel (Ca(v)) 1.2b (hCav1.2b) and the effect of nitrotyrosylation. Cotransfection of human embryonic kidney (HEK)-293 cells with hCa(v)1.2b and c-Src resulted in tyrosine phosphorylation of the calcium channel, which was prevented by nitration of tyrosine residues by peroxynitrite. Whole cell calcium currents were reduced by 58 + 5% by the Src kinase inhibitor PP2 and 64 + 6% by peroxynitrite. Nitrotyrosylation prevented Src-mediated regulation of the currents. Glutathione S-transferase fusion protein of the distal COOH terminus of hCa(v)1.2b (1809-2138) bound to SH2 domain of Src following tyrosine phosphorylation, while binding to SH3 required the presence of the proline-rich motif. Site-directed mutation of Y(2134) prevented SH2 binding and resulted in reduced phosphorylation of hCa(v)1.2b. Within the distal COOH terminus, single, double, or triple mutations of Y(1837), Y(1861), and Y(2134) were constructed and expressed in HEK-293 cells. The inhibitory effects of PP2 and peroxynitrite on calcium currents were significantly reduced in the double mutant Y(1837-2134F). These data demonstrate that the COOH terminus of hCa(v)1.2b contains sites for the SH2 and SH3 binding of Src kinase. Nitrotyrosylation of these sites prevents Src kinase regulation and may be importantly involved in calcium influx regulation during inflammation.

  20. Benzo[1,2-b:4,5-b’]dithiophene-Pyrido[3,4-b]pyrazine Small-Molecule Donors for Bulk Heterojunction Solar Cells

    KAUST Repository

    Wolf, Jannic Sebastian

    2016-01-22

    We report on the synthesis, material properties and BHJ solar cell characteristics of a set of π-conjugated small-molecule (SM) donors composed of benzo[1,2-b:4,5-b′]dithiophene (BDT) and pyrido[3,4-b]pyrazine (PP) units – examining the perspectives of alkyl-substituted PP acceptor motifs in SM designs. In these systems (SM1-4), both the type of side chains derived from the PP motifs and the presence of ring-substituents on BDT critically impact (i) molecular packing, and (ii) thin-film morphologies and charge transport in BHJ solar cells. With the appropriate side-chain pattern, the ring-substituted analogue SM4 stands out: achieving efficiencies of ca. 6.5% with PC71BM, and fine-scale morphologies comparable to those obtained with some of the best-performing polymer donors in BHJ solar cells. 1H-1H DQ-SQ NMR analyses are used to examine the distinct self-assembly pattern of SM4, expected to factor into the development of the BHJ morphology.

  1. Metastable Equilibria for the Quaternary System Li2B4O7+ Na2B4O7+K2B4O7+H2Oat15℃

    Institute of Scientific and Technical Information of China (English)

    SANG,Shi-Hua; YIN,Hui-An; NI,Shi-Jun; DENG,Miao

    2008-01-01

    Metastable equilibrium solubilities and such physico-chemical properties as densities, conductivity, pH, refractive index and viscosity of the solution for the quaternary system Li2B4O7+Na2B4O7+K2B4O7+H2O at 15℃ were determined experimentally. According to the experimental data, the metastable equilibrium phase diagram was plotted. In the metastable phase diagram, there are one invariant point, three univariant curves, and three fields of crystallization: Li2B2O4·16H2O, Na2B4O7·10H2O, and K2B4O7·4H2O. Potassium borate (K2B4O7·4H2O) has the smallest crystallization field and sodium borate (borax) has the biggest one. Also, the relationship diagram between the properties and the ion concentration of solution was constructed. It can be seen from the relationship diagram that the metastable equilibrium solution density values, viscosity values and refractive index values are increased apparently with the rise of lithium borate concentration, reaching the maximum values at invariant point F. Electrical conductivity values and pH values, however, fall down with the rise of ion concentration on the whole.

  2. Data of evolutionary structure change: 1CLMA-2B1UA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-2B1UA 1CLM 2B1U A A LTEEQIAEFKEAFALFD-KDGDGTITTKELGTVMRSLGQ...NPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS 1CLM A 1CLMA FALFD-KDGDG

  3. Data of evolutionary structure change: 1BHNF-2B8PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PB 1BHN 2B8P F B ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------ EVID>EVID> 0 1BHN F 1BHNF FMRAS-ED

  4. Electron Density and Temperature During the CHARGE-2B Sounding Rocket Mission

    Science.gov (United States)

    1997-07-01

    instrument. 13 Horowitz, P., and Hill, W. (1989) The Art of Electronics , Cambridge University Press, New York, pp 192-193. 18 -5 c £ V. 3 ü ■ö...Res., 86:575-584. 13. Horowitz, P., and Hill, W. (1989) The Art of Electronics , Cambridge University Press, New York, pp 192-193. 21 14

  5. Peculiarities of structure state and mechanical characteristics in ion-plasma condensates of quasibinary system borides W2B5-TiB2

    Directory of Open Access Journals (Sweden)

    Sobol O.V.

    2006-01-01

    Full Text Available In order to create high-durable, wear-resistant materials for a wide range of functional applications, comparative investigations of the structure and mechanical characteristics of ion-plasma Ti-W-B nano-crystalline condensates were carried out. The range of condensation rates 0.11÷0.25nm/s was found to be critical for the coatings obtained from the target with 80 vol% W2B5-20 vol% TiB2. Below this, a phase with a cubic lattice (W,TiB0.7…1.2(O,N,C0.3…0.2 formed, while over this range, a solid solution (W,TiB2 with a hexagonal lattice and element composition close to the sputtered target was observed. The structure state of the material changed from cluster-crystalline (under low sputter potentials U=0.6…1.0 kV to textured- crystalline (under U>2.2 kV. Structure perfection improvement with U increase results in higher hardness and elastic modulus of condensates. The conditions of cluster component formation and its effect on hardness and elastic modulus of condensates are discussed. .

  6. GridPP returns to CERN

    CERN Multimedia

    Neasan O'Neill

    2011-01-01

    In early September, GridPP, the collaboration that manages the UK’s contribution to the worldwide LHC Computing Grid (wLCG), celebrated a decade of work by holding its twenty-seventh collaboration meeting at CERN.   Officially launched in September 2001, GridPP was one of the original partners in wLCG, funding much of the early work at CERN. Over the last decade GridPP has gone from a mere proposal to almost 30,000 CPUs working for researchers scattered across the globe. Twice a year, GridPP meets to discuss the progress and future plans of the community and this year, for the first time since 2004, decamped to CERN for this biannual meeting on the theme “GridPP in the International Context”. The main meeting was held over 2 days in the IT auditorium and was the perfect opportunity to have contributions from experts based at CERN, alongside those from within GridPP. Opening with a welcome from Frederic Hemmer, Head of the IT Department at CERN, the meeting began with...

  7. Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology

    DEFF Research Database (Denmark)

    Clayton, Emma L.; Mizielinska, Sarah; Edgar, James R.;

    2015-01-01

    Mutations in the charged multivesicular body protein 2B (CHMP2B) cause frontotemporal dementia (FTD). We report that mice which express FTD-causative mutant CHMP2B at physiological levels develop a novel lysosomal storage pathology characterised by large neuronal autofluorescent aggregates. The a...

  8. Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology

    DEFF Research Database (Denmark)

    Clayton, Emma L.; Mizielinska, Sarah; Edgar, James R.

    2015-01-01

    Mutations in the charged multivesicular body protein 2B (CHMP2B) cause frontotemporal dementia (FTD). We report that mice which express FTD-causative mutant CHMP2B at physiological levels develop a novel lysosomal storage pathology characterised by large neuronal autofluorescent aggregates. The a...

  9. File list: Pol.ALL.50.Polr2b.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.ALL.50.Polr2b.AllCell mm9 RNA polymerase Polr2b All cell types SRX373045,SRX595...04153,SRX119655,SRX318115,SRX373044,SRX119652,SRX318112 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.ALL.50.Polr2b.AllCell.bed ...

  10. TGF- induces Lysyl hydroxylase 2b in human synovial osteoarthritic fibroblasts through ALK5 signaling

    NARCIS (Netherlands)

    Remst, Dennis F. G.; Davidson, Esmeralda N. Blaney; Vitters, Elly L.; Bank, Ruud A.; van den Berg, Wim B.; van der Kraan, Peter M.

    2014-01-01

    Lysyl hydroxylase 2b (LH2b) is known to increase pyridinoline cross-links, making collagen less susceptible to enzymatic degradation. Previously, we observed a relationship between LH2b and osteoarthritis-related fibrosis in murine knee joint. For this study, we investigate if transforming growth fa

  11. File list: His.PSC.50.H2B.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.H2B.AllCell mm9 Histone H2B Pluripotent stem cell SRX1034714,SRX1034721,...SRX1034715,SRX1034720 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.H2B.AllCell.bed ...

  12. Incidence and prevalence of multiple endocrine neoplasia 2B in Denmark

    DEFF Research Database (Denmark)

    Mathiesen, Jes Sloth; Kroustrup, Jens Peter; Vestergaard, Peter

    2017-01-01

    Extract: Multiple endocrine neoplasia 2B (MEN2B) is an autosomal dominant inherited cancer syndrome associating medullary thyroid carcinoma (MTC), pheochromocytoma (PHEO), ganglioneuromatosis of the aerodigestive tract and facial, ophthalmologic and skeletal abnormalities. MEN2B is caused by the M...

  13. Data of evolutionary structure change: 1BHNF-2B8PA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BHNF-2B8PA 1BHN 2B8P F A ANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKF...NWIYE -GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKE-----YFNDNCDFMVSGPIISIVYEGTDAISKIRR...------------- EVID>EVID> 0 ... 1BHN F 1BHNF FMRAS-E...5856934 EVID> 1 2B8P

  14. Protein phosphatase 2B (PP2B, calcineurin) in Paramecium: partial characterization reveals that two members of the unusually large catalytic subunit family have distinct roles in calcium-dependent processes.

    Science.gov (United States)

    Fraga, D; Sehring, I M; Kissmehl, R; Reiss, M; Gaines, R; Hinrichsen, R; Plattner, H

    2010-07-01

    We characterized the calcineurin (CaN) gene family, including the subunits CaNA and CaNB, based upon sequence information obtained from the Paramecium genome project. Paramecium tetraurelia has seven subfamilies of the catalytic CaNA subunit and one subfamily of the regulatory CaNB subunit, with each subfamily having two members of considerable identity on the amino acid level (>or=55% between subfamilies, >or=94% within CaNA subfamilies, and full identity in the CaNB subfamily). Within CaNA subfamily members, the catalytic domain and the CaNB binding region are highly conserved and molecular modeling revealed a three-dimensional structure almost identical to a human ortholog. At 14 members, the size of the CaNA family is unprecedented, and we hypothesized that the different CaNA subfamily members were not strictly redundant and that at least some fulfill different roles in the cell. This was tested by selecting two phylogenetically distinct members of this large family for posttranscriptional silencing by RNA interference. The two targets resulted in differing effects in exocytosis, calcium dynamics, and backward swimming behavior that supported our hypothesis that the large, highly conserved CaNA family members are not strictly redundant and that at least two members have evolved diverse but overlapping functions. In sum, the occurrence of CaN in Paramecium spp., although disputed in the past, has been established on a molecular level. Its role in exocytosis and ciliary beat regulation in a protozoan, as well as in more complex organisms, suggests that these roles for CaN were acquired early in the evolution of this protein family.

  15. Protein Phosphatase 2B (PP2B, Calcineurin) in Paramecium: Partial Characterization Reveals That Two Members of the Unusually Large Catalytic Subunit Family Have Distinct Roles in Calcium-Dependent Processes▿‡

    Science.gov (United States)

    Fraga, D.; Sehring, I. M.; Kissmehl, R.; Reiss, M.; Gaines, R.; Hinrichsen, R.; Plattner, H.

    2010-01-01

    We characterized the calcineurin (CaN) gene family, including the subunits CaNA and CaNB, based upon sequence information obtained from the Paramecium genome project. Paramecium tetraurelia has seven subfamilies of the catalytic CaNA subunit and one subfamily of the regulatory CaNB subunit, with each subfamily having two members of considerable identity on the amino acid level (≥55% between subfamilies, ≥94% within CaNA subfamilies, and full identity in the CaNB subfamily). Within CaNA subfamily members, the catalytic domain and the CaNB binding region are highly conserved and molecular modeling revealed a three-dimensional structure almost identical to a human ortholog. At 14 members, the size of the CaNA family is unprecedented, and we hypothesized that the different CaNA subfamily members were not strictly redundant and that at least some fulfill different roles in the cell. This was tested by selecting two phylogenetically distinct members of this large family for posttranscriptional silencing by RNA interference. The two targets resulted in differing effects in exocytosis, calcium dynamics, and backward swimming behavior that supported our hypothesis that the large, highly conserved CaNA family members are not strictly redundant and that at least two members have evolved diverse but overlapping functions. In sum, the occurrence of CaN in Paramecium spp., although disputed in the past, has been established on a molecular level. Its role in exocytosis and ciliary beat regulation in a protozoan, as well as in more complex organisms, suggests that these roles for CaN were acquired early in the evolution of this protein family. PMID:20435698

  16. ab initio calculation study on vibrational spectra of C2B10H12,NB11H12 and C2B10H11Cl

    Institute of Scientific and Technical Information of China (English)

    于微舟; 张明瑜; 孙家钟

    1996-01-01

    Geometrical optimization and theoretical calculation of the vibrational frequencies have been performed for C2B10H12, NB11H12 and C2B10Cl by using Gaussian 92 program at 6-31G basis set. The results obtained in this work are in agreement with experimental ones. The optimized geometry and vibrational spectra show that the icosahedral configuration remains unchanged upon converting from B12H122- to the title compounds. The vibrational spectrum of C2B10H11Cl features the absence of C-Cl stretching vibration. But the (C2B10H11)-Cl vibration mode in the low frequency region is as the case for two-atom molecules if the group (C2B10H11) is considered as a pseudoatom

  17. Vortex phase diagram studies in the weakly pinned single crystals of YNi2B2C and LuNi2B2C

    Indian Academy of Sciences (India)

    D Jaiswal-Nagar; D Pal; M R Eskildsen; P C Canfield; H Takeya; S Ramakrishnan; A K Grover

    2006-01-01

    We present a study of magnetization measurements performed on the single crystals of YNi2B2C and LuNi2B2C. For both the compounds, we find flux jumps in magnetisation values in the respective field regions, where the structural transitions in the flux line lattice symmetry have been reported in these systems via the small angle neutron scattering experiments. The magnetisation hysteresis loops and the AC susceptibility measurements show pronounced peak effect as well as second magnetisation peak anomaly for both YNi2B2C and LuNi2B2C. Based on these results, a vortex phase diagram has been constructed for YNi2B2C for $H \\Arrowvert c$ depicting different glassy phases of the vortex matter.

  18. Cytomegalovirus pp65 limits dissemination but is dispensable for persistence

    OpenAIRE

    Malouli, Daniel; Hansen, Scott G.; Nakayasu, Ernesto S.; Marshall, Emily E.; Hughes, Colette M.; Ventura, Abigail B.; Gilbride, Roxanne M.; Lewis, Matthew S.; Xu, Guangwu; Kreklywich, Craig; Whizin, Nathan; Fischer, Miranda; Legasse, Alfred W.; Viswanathan, Kasinath; Siess, Don

    2014-01-01

    The most abundantly produced virion protein in human cytomegalovirus (HCMV) is the immunodominant phosphoprotein 65 (pp65), which is frequently included in CMV vaccines. Although it is nonessential for in vitro CMV growth, pp65 displays immunomodulatory functions that support a potential role in primary and/or persistent infection. To determine the contribution of pp65 to CMV infection and immunity, we generated a rhesus CMV lacking both pp65 orthologs (RhCMVΔpp65ab). While ...

  19. Functional role of human NK cell receptor 2B4 (CD244) isoforms.

    Science.gov (United States)

    Mathew, Stephen O; Rao, Krithi K; Kim, Jong R; Bambard, Nowland D; Mathew, Porunelloor A

    2009-06-01

    2B4 (CD244), a member of the signaling lymphocyte-activation molecule (SLAM/CD150), is expressed on all NK cells, a subpopulation of T cells, monocytes and basophils. Human NK cells express two isoforms of 2B4, h2B4-A and h2B4-B that differ in a small portion of the extracellular domain. In the present investigation, we have studied the functions of h2B4-A and h2B4-B. Our study demonstrated that these two isoforms differ in their binding affinity for CD48, which results in differential cytotoxic activity as well as intracellular calcium release by NK cells upon target cell recognition. Analysis of the predicted 3-D structure of the two isoforms showed conformational differences that could account for their differences in binding affinity to CD48. h2B4-A was able to mediate natural cytotoxicity against CD48-expressing K562 target cells and induce intracellular calcium release, whereas h2B4-B showed no effects. NK-92MI, U937, THP-1, KU812, primary monocytes, basophils and NK cells showed expression of both h2B4-A and h2B4-B whereas YT and IL-2-activated NK cells did not show any h2B4-B expression. Stimulation of NK cells through 2B4 resulted in decreased mRNA levels of both h2B4-A and h2B4-B indicating that down-regulation of 2B4 isoforms may be an important factor in controlling NK cell activation during immune responses.

  20. NR2B phosphorylation at tyrosine 1472 in spinal dorsal horn contributed to N-methyl-D-aspartate-induced pain hypersensitivity in mice.

    Science.gov (United States)

    Li, Shuai; Cao, Jing; Yang, Xian; Suo, Zhan-Wei; Shi, Lei; Liu, Yan-Ni; Yang, Hong-Bin; Hu, Xiao-Dong

    2011-11-01

    Calcium influx via N-methyl-D-aspartate (NMDA)-subtype glutamate receptors (NMDARs) regulates the intracellular trafficking of NMDARs, leading to long-lasting modification of NMDAR-mediated synaptic transmission that is involved in development, learning, and synaptic plasticity. The present study investigated the contribution of such NMDAR-dependent synaptic trafficking in spinal dorsal horn to the induction of pain hypersensitivity. Our data showed that direct activation of NMDARs by intrathecal NMDA application elicited pronounced mechanical allodynia in intact mice, which was concurrent with a specific increase in the abundance of NMDAR subunits NR1 and NR2B at the postsynaptic density (PSD)-enriched fraction. Selective inhibition of NR2B-containing NMDARs (NR2BR) by ifenprodil dose dependently attenuated the mechanical allodynia in NMDA-injected mice, suggesting the importance of NR2BR synaptic accumulation in NMDA-induced pain sensitization. The NR2BR redistribution at synapses after NMDA challenge was associated with a significant increase in NR2B phosphorylation at Tyr1472, a catalytic site by Src family protein tyrosine kinases (SFKs) that has been shown to prevent NR2B endocytosis. Intrathecal injection of a specific SFKs inhibitor, PP2, to block NR2B tyrosine phosphorylation eliminated NMDA-induced NR2BR synaptic expression and also attenuated the mechanical allodynia. These data suggested that activation of spinal NMDARs was able to accumulate NR2BR at synapses via SFK signaling, which might exaggerate NMDAR-dependent nociceptive transmission and contribute to NMDA-induced nociceptive behavioral hyperresponsiveness.

  1. Role of adenosine A2b receptor overexpression in tumor progression.

    Science.gov (United States)

    Sepúlveda, Cesar; Palomo, Iván; Fuentes, Eduardo

    2016-12-01

    The adenosine A2b receptor is a G-protein coupled receptor. Its activation occurs with high extracellular adenosine concentration, for example in inflammation or hypoxia. These conditions are generated in the tumor environment. Studies show that A2b receptor is overexpressed in various tumor lines and biopsies from patients with different cancers. This suggests that A2b receptor can be used by tumor cells to promote progression. Thus A2b participates in different events, such as angiogenesis and metastasis, besides exerting immunomodulatory effects that protect tumor cells. Therefore, adenosine A2b receptor appears as an interesting therapeutic target for cancer treatment.

  2. VolP开始走向实用

    Institute of Scientific and Technical Information of China (English)

    Russ Anensman

    2006-01-01

    <正>德州仪器(TI)的Tom Flanagan已为早期基于IP协议的语音(VolP)技术天花乱坠的广告宣传进入实用等待了10年之久。TI VoIP部技术战略总监Flanagan说:“我不可能告诉你实现这一点需要多少时间。”

  3. Copy Number Variation of UGT 2B Genes in Indian Families Using Whole Genome Scans

    Directory of Open Access Journals (Sweden)

    Avinash M. Veerappa

    2016-01-01

    Full Text Available Background and Objectives. Uridine diphospho-glucuronosyltransferase 2B (UGT2B is a family of genes involved in metabolizing steroid hormones and several other xenobiotics. These UGT2B genes are highly polymorphic in nature and have distinct polymorphisms associated with specific regions around the globe. Copy number variations (CNVs status of UGT2B17 in Indian population is not known and their disease associations have been inconclusive. It was therefore of interest to investigate the CNV profile of UGT2B genes. Methods. We investigated the presence of CNVs in UGT2B genes in 31 members from eight Indian families using Affymetrix Genome-Wide Human SNP Array 6.0 chip. Results. Our data revealed >50% of the study members carried CNVs in UGT2B genes, of which 76% showed deletion polymorphism. CNVs were observed more in UGT2B17 (76.4% than in UGT2B15 (17.6%. Molecular network and pathway analysis found enrichment related to steroid metabolic process, carboxylesterase activity, and sequence specific DNA binding. Interpretation and Conclusion. We report the presence of UGT2B gene deletion and duplication polymorphisms in Indian families. Network analysis indicates the substitutive role of other possible genes in the UGT activity. The CNVs of UGT2B genes are very common in individuals indicating that the effect is neutral in causing any suspected diseases.

  4. Impaired ventilatory and thermoregulatory responses to hypoxic stress in newborn Phox2b heterozygous knockout mice

    Directory of Open Access Journals (Sweden)

    Nelina eRamanantsoa

    2011-09-01

    Full Text Available The Phox2b gene is necessary for the development of the autonomic nervous system, and especially, of respiratory neuronal circuits. In the present study, we examined the role of Phox2b in ventilatory and thermoregulatory responses to hypoxic stress, which are closely related in the postnatal period. Hypoxic stress was generated by strong thermal stimulus, combined or not with reduced inspired O2. To this end, we exposed 6-day-old Phox2b+/- pups and their wild-type littermates (Phox2b+/+ to hypoxia (10% O2 or hypercapnia (8% CO2 under thermoneutral (33°C or cold (26°C conditions. We found that Phox2b+/- pups showed less normoxic ventilation (VE in the cold than Phox2b+/+ pups. Phox2b+/- pups also showed lower oxygen consumption (VO2 in the cold, reflecting reduced thermogenesis and a lower body temperature. Furthermore, while the cold depressed ventilatory responses to hypoxia and hypercapnia in both genotype groups, this effect was less pronounced in Phox2b+/- pups. Finally, because serotonin (5-HT neurons are pivotal to respiratory and thermoregulatory circuits and depend on Phox2b for their differentiation, we studied 5-HT metabolism using high-pressure liquid chromatography, and found that it was altered in Phox2b+/- pups. We conclude that Phox2b haploinsufficiency alters the ability of newborns to cope with metabolic challenges, possibly due to 5-HT signaling impairments.

  5. The brain-specific neural zinc finger transcription factor 2b (NZF-2b/7ZFMyt1 suppresses cocaine self-administration in rats

    Directory of Open Access Journals (Sweden)

    Vijay Chandrasekar

    2010-04-01

    Full Text Available Brain-specific neural-zinc-finger transcription factor-2b (NZF2b/7ZFMyt1 is induced in the mesolimbic dopaminergic region after chronic cocaine exposure and lentiviral-mediated expression of NZF2b/7ZFMyt1 in the nucleus accumbens results in decreased locomotor activity (Chandrasekar and Dreyer, 2009. In this study the role of NZF2b/7ZFMyt1 in active cocaine seeking and of its interaction with histone deacetylase on the altered behavior has been observed. Localized expression of NZF2b/7ZFMyt1 in the nucleus accumbens resulted in attenuated cocaine self-administration, whereas silencing this transcription factor with lentiviruses expressing siRNAs increased the animal′s motivation to self-infuse cocaine. Low doses of sodium butyrate, a potent inhibitor of histone deacetylase, were sufficient to reverse the NZF2b/7ZFMyt1-mediated decrease in cocaine self-administration. NZF2b/7ZFMyt1 expression resulted in strong induction of transcription factors REST1 and NAC1 and of the dopamine D2 receptor, with concomitant inhibition of BDNF and its receptor TrkB. We show that NZF2b/7ZFMyt1 colocalizes with histone deacetylase-2 (HDAC2, probably overcoming the suppression of transcriptional activity caused by Lingo1. These findings show that molecular adaptations mediated by NZF2b/7ZFMyt1 expression possibly lead to decreased responsiveness to the reinforcing properties of cocaine and play a prominent role in affecting the behavioral changes induced by the drug.

  6. Nrk2b-mediated NAD+ production regulates cell adhesion and is required for muscle morphogenesis in vivo: Nrk2b and NAD+ in muscle morphogenesis.

    Science.gov (United States)

    Goody, Michelle F; Kelly, Meghan W; Lessard, Kevin N; Khalil, Andre; Henry, Clarissa A

    2010-08-15

    Cell-matrix adhesion complexes (CMACs) play fundamental roles during morphogenesis. Given the ubiquitous nature of CMACs and their roles in many cellular processes, one question is how specificity of CMAC function is modulated. The clearly defined cell behaviors that generate segmentally reiterated axial skeletal muscle during zebrafish development comprise an ideal system with which to investigate CMAC function during morphogenesis. We found that Nicotinamide riboside kinase 2b (Nrk2b) cell autonomously modulates the molecular composition of CMACs in vivo. Nrk2b is required for normal Laminin polymerization at the myotendinous junction (MTJ). In Nrk2b-deficient embryos, at MTJ loci where Laminin is not properly polymerized, muscle fibers elongate into adjacent myotomes and are abnormally long. In yeast and human cells, Nrk2 phosphorylates Nicotinamide Riboside and generates NAD+ through an alternative salvage pathway. Exogenous NAD+ treatment rescues MTJ development in Nrk2b-deficient embryos, but not in laminin mutant embryos. Both Nrk2b and Laminin are required for localization of Paxillin, but not beta-Dystroglycan, to CMACs at the MTJ. Overexpression of Paxillin in Nrk2b-deficient embryos is sufficient to rescue MTJ integrity. Taken together, these data show that Nrk2b plays a specific role in modulating subcellular localization of discrete CMAC components that in turn plays roles in musculoskeletal development. Furthermore, these data suggest that Nrk2b-mediated synthesis of NAD+ is functionally upstream of Laminin adhesion and Paxillin subcellular localization during MTJ development. These results indicate a previously unrecognized complexity to CMAC assembly in vivo and also elucidate a novel role for NAD+ during morphogenesis. Copyright 2010 Elsevier Inc. All rights reserved.

  7. NR2B antagonist CP-101,606 inhibits NR2B phosphorylation at tyrosine-1472 and its interactions with Fyn in levodopa-induced dyskinesia rat model.

    Science.gov (United States)

    Kong, Min; Ba, Maowen; Liu, Chuanyu; Zhang, Yanxiang; Zhang, Hongli; Qiu, Haiyan

    2015-04-01

    The augmented tyrosine phosphorylation of NR2B subunit of N-methyl-d-aspartate receptors (NMDAR) dependent on Fyn kinase has been associated with levodopa (l-dopa)-induced dyskinesia (LID). CP-101,606, one selective NR2B subunit antagonist, can improve dyskinesia. Yet, the accurate action mechanism is less well understood. In the present study, the evidences were investigated. Valid 6-hydroxydopamine-lesioned parkinsonian rats were treated with l-dopa intraperitoneally for 22 days to induce LID rat model. On day 23, rats received either CP-101,606 (0.5mg/kg) or vehicle with each l-dopa dose. On the day of 1, 8, 15, 22, and 23 during l-dopa treatment, we determined abnormal involuntary movements (AIMs) in rats. The levels of NR2B phosphorylation at tyrosine-1472 (pNR2B-Tyr1472) and interactions of NR2B with Fyn in LID rat model were detected by immunoblotting and immunoprecipitation. Results showed that CP-101,606 attenuated l-dopa-induced AIMs. In agreement with behavioral analysis, CP-101,606 reduced the augmented pNR2B-Tyr1472 and its interactions with Fyn triggered during the l-dopa administration in the lesioned striatum of parkinsonian rats. Moreover, CP-101,606 also decreased the level of Ca(2+)/calmodulin-dependent protein kinase II at threonine-286 hyperphosphorylation (pCaMKII-Thr286), which was the downstream signaling amplification molecule of NMDAR overactivation and closely associated with LID. However, the protein level of NR2B and Fyn had no difference under the above conditions. These data indicate that the inhibition of the interactions of NR2B with Fyn and NR2B tyrosine phosphorylation may contribute to the CP-101,606-induced downregulation of NMDAR function and provide benefit for the therapy of LID. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Functional characterization of cytochromes P450 2B from the desert woodrat Neotoma lepida

    Energy Technology Data Exchange (ETDEWEB)

    Wilderman, P. Ross, E-mail: pwilderman@ucsd.edu [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Jang, Hyun-Hee [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Malenke, Jael R. [Department of Biology, University of Utah, Salt Lake City, UT (United States); Salib, Mariam; Angermeier, Elisabeth; Lamime, Sonia [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States); Dearing, M. Denise [Department of Biology, University of Utah, Salt Lake City, UT (United States); Halpert, James R. [Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California, San Diego, La Jolla, CA (United States)

    2014-02-01

    Mammalian detoxification processes have been the focus of intense research, but little is known about how wild herbivores process plant secondary compounds, many of which have medicinal value or are drugs. cDNA sequences that code for three enzymes of the cytochrome P450 (CYP) 2B subfamily, here termed 2B35, 2B36, and 2B37 have been recently identified from a wild rodent, the desert woodrat (Malenke et al., 2012). Two variant clones of each enzyme were engineered to increase protein solubility and to facilitate purification, as reported for CYP2B enzymes from multiple species. When expressed in Escherichia coli each of the woodrat proteins gave the characteristic maximum at 450 nm in a reduced carbon monoxide difference spectrum but generally expressed at lower levels than rat CYP2B1. Two enzymes, 2B36 and 2B37, showed dealkylation activity with the model substrates 7-ethoxy-4-(trifluoromethyl)coumarin and 7-benzyloxyresorufin, whereas 2B35 was inactive. Binding of the monoterpene (+)-α-pinene produced a Type I shift in the absorbance spectrum of each enzyme. Mutation of 2B37 at residues 114, 262, or 480, key residues governing ligand interactions with other CYP2B enzymes, did not significantly change expression levels or produce the expected functional changes. In summary, two catalytic and one ligand-binding assay are sufficient to distinguish among CYP2B35, 2B36, and 2B37. Differences in functional profiles between 2B36 and 2B37 are partially explained by changes in substrate recognition site residue 114, but not 480. The results advance our understanding of the mechanisms of detoxification in wild mammalian herbivores and highlight the complexity of this system. - Highlights: • Three CYP2B enzymes from Neotoma lepida were cloned, engineered, and expressed. • A mix of catalytic and binding assays yields unique results for each enzyme. • Mutational analysis indicates CYP{sub 2}B substrate recognition remains to be clarified. • Reported N. lepida gene

  9. African Journal of Biotechnology - Vol 7, No 7 (2008)

    African Journals Online (AJOL)

    KAtex antigen-detection test as a diagnostic tool for latent visceral leishmaniasis cases · EMAIL FREE ... The ability of T2/B4 primers to detect Leishmania infantum among peripheral blood of visceral leishmaniasis ... Current Issue Atom logo

  10. Journal of Agricultural Extension Vol.17 (2) December, 2013 ISSN ...

    African Journals Online (AJOL)

    ONIKOYI

    Agricultural extension in Turkey, Communication for extension Development. Introduction .... deliver information to farmers but only as social media, that is, for personal communication with ... year in journalism studies or public relations and marketing. There are .... Delhi, India: B. R. Publishing Corporation, pp. 159 – 171.

  11. Overexpression of SULT2B1b Promotes Angiogenesis in Human Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Wen Chen

    2016-03-01

    Full Text Available Background/Aims: Overexpression of cytosolic sulfotransferase 2B1b (SULT2B1b has been commonly found in colorectal and hepatocellular carcinoma, suggesting that SULT2B1b might act as a potential oncogenic protein. However, its clinical significance and biological role in gastric cancer progression remain largely unknown. Methods: Expressions of SULT2B1b in clinical gastric cancer (GC samples were examined using qRT-PCR and Western blot. Results: SULT2B1b was markedly overexpressed in human GC samples, and positively correlated with vessel density and associated with poor clinical features. We also demonstrated that overexpression of SULT2B1b resulted in increased tumor angiogenesis and tumor growth in mouse GC models. In addition, ablation of SULT2B1b in human GC cells lines BGC823 and MKN45 decreased the capability of the cells to recruit endothelial cells. Moreover, depletion of SULT2B1b in GC cells reduced VEGF-A expression by downregulating SP1 and AP2. Conclusion: Our results suggested that the SULT2B1b-mediated angiogenic pathway could serve as biomarkers for GC diagnosis and prognosis, and suppressing SULT2B1b-mediated angiogenic signaling might be a promising strategy for developing novel GC treatment.

  12. X-ray powder diffraction studies and thermal behaviour of NaK 2B 9O 15, Na(Na .17K .83) 2B 9O 15, and (Na .80K .20)K 2B 9O 15

    Science.gov (United States)

    Bubnova, R.; Albert, B.; Georgievskaya, M.; Krzhizhanovskaya, M.; Hofmann, K.; Filatov, S.

    2006-09-01

    The crystal structures of NaK 2B 9O 15 ( a=9.1158(1) Å, b=6.6246(1) Å, c=20.6812(3) Å, β=94.080(1)°, R=0.047, R=0.059, R=0.026), Na(Na .17K .83) 2B 9O 15 ( a=9.0559(1) Å, b=6.6170(1) Å, c=20.5833(3) Å, β=94.228(2)°, R=0.053, R=0.068, R=0.026), and (Na .80K .20)K 2B 9O 15 ( a=9.1534(1) Å, b=6.6296(1) Å, c=20.7422(3) Å, β=94.071(1)°, Z=4, R=0.041, R=0.052, R=0.023) were refined in the monoclinic space groups P2 1/ c(Z=4) using X-ray powder diffraction data and the Rietveld method. These nonaborates are isostructural to K 3B 9O 15. Their crystal structure consists of a three-dimensional open framework built up from three crystallographically independent triborate groups. The alkali metal cations are located on three different sites in the voids of the framework. High-temperature X-ray diffraction studies show that NaK 2B 9O 15 decomposes at about 700 °C in accordance with the peritectic reaction NaK 2B 9O 15↔K 5B 19O 31+liquid. The thermal expansion of NaK 2B 9O 15 and Na(Na .17K .83) 2B 9O 15 is highly anisotropic. A similarity of the thermal and compositional (Na-K substitution) deformations of NaK 2B 9O 15 is revealed: heating of NaK 2B 9O 15 by 1 °C leads to the same deformations of the crystal structure as increasing the amount of K atoms in (Na 1-xK x) 3B 9O 15 by 0.04 at% K.

  13. Studies of 2 b-jet + 2 jet production in proton-proton collisions at 7 TeV

    CERN Document Server

    CMS Collaboration

    2015-01-01

    Measurements are presented of inclusive differential two b- and two-jet production cross sections as a function of the transverse momentum $p_\\text{T}$, pseudorapidity $\\eta$, as well as of correlations in azimuthal angle $\\phi$, pseudorapidity $\\eta$ and $p_\\text{T}$ balance among the jets. The data sample was collected from proton-proton collisions at a centre-of-mass energy of 7~TeV with the CMS detector at the LHC, corresponding to an integrated luminosity of 3.03 pb$^{-1}$. The jets are reconstructed with the anti-$k_T$ jet algorithm with $p_\\text{T}$ $>$ 20 GeV. At least four jets are required: two jets need to be originated by a bottom quark within the range of pseudorapidity $|\\eta|$ $<$ 2.4, while the other two jets are required to be in $|\\eta|$ $<$ 4.7 without any flavour requirement on the initial quark. Only the two leading jets of each selection are considered. The cross section is measured to be $\\sigma$(pp$\\rightarrow$ 2 b + 2 j + X) = 64.6 $\\pm$ 2.4 (stat.) $\\pm$ 21.6 (syst.) nb. Variou...

  14. Killing tensors in pp-wave spacetimes

    Energy Technology Data Exchange (ETDEWEB)

    Keane, Aidan J [87 Carlton Place, Glasgow G5 9TD, Scotland (United Kingdom); Tupper, Brian O J, E-mail: aidan@countingthoughts.co, E-mail: bt32@rogers.co [Department of Mathematics and Statistics, University of New Brunswick, Fredericton, New Brunswick, E3B 5A3 (Canada)

    2010-12-21

    The formal solution of the second-order Killing tensor equations for the general pp-wave spacetime is given. The Killing tensor equations are integrated fully for some specific pp-wave spacetimes. In particular, the complete solution is given for the conformally flat plane wave spacetimes and we find that irreducible Killing tensors arise for specific classes. The maximum number of independent irreducible Killing tensors admitted by a conformally flat plane wave spacetime is shown to be six. It is shown that every pp-wave spacetime that admits an homothety will admit a Killing tensor of Koutras type and, with the exception of the singular scale-invariant plane wave spacetimes, this Killing tensor is irreducible.

  15. Evaluation of NR2B peptide as subunit vaccines against experimental neuropathic pain

    Institute of Scientific and Technical Information of China (English)

    WANG Gong-ming; TIAN Yu-ke; CHEN Jian-ping; TIAN Xu-bi; GAO Feng; YANG Hui; AN Ke; MA Guo-ping

    2007-01-01

    Background NR2B containing N-methyl-D-aspartate (NMDA) receptor plays an important role in the facilitation and maintenance of neuropathic pain. The discrete distribution of NR2B subunit in the central nervous system (CNS) may support reduced side effects of agents that act selectively at this site. Therefore, we investigated the hypothesis that a humoral autoimmune response targeting the NR2B subunit of NMDA receptor relieves pain like behaviours produced by peripheral injury.Methods Rats were immunized subcutaneously with NR2B-Keyhole Limpet Hemocyanin (NR2B-KLH) three times at two-week intervals. NR2B specific IgG titres in sera and cerebrospinal fluid were determined by indirect ELISA. Seven days after the third immunization, 2 of the 3 terminal branches of the sciatic nerve (tibial and common peroneal nerves) were tightly ligated. Behavioural testing was carried out on every other day after surgery, until 7 days after surgery. The lumbar spinal cord (L4-6) was removed on day 7 after ligation. The expression of NR2B protein in the lumbar spinal cord was determined using Western blotting.Results After the second vaccination, NR2B specific IgG in sera was detected to be >0.5 μg/ml in six of nine rats. After the third vaccination, all the immunized rats had >2.2 μg/ml. Titres of NR2B specific IgG in sera peaked 42 days post initial immunization and persisted for over 70 days. No NR2B specific IgG was detected in sera from PBS or KLH group.The behavioural thresholds in NR2B group were significantly higher than those in PBS and KLH groups on day 7 after ligation. NR2B specific IgG in CSF in NR2B group could not be detected on day 1 before spinal dissection; but could be detected on day 7 after surgery. The expression of NR2B protein in group NR2B was significantly lower than in PBS and KLH groups on day 7 after surgery.Conclusion The NR2B peptide could be used as a vaccine against neuropathic pain, which could be associated with reduction of NR2B protein in

  16. Cloning and sequence analysis of a full-length cDNA of SmPP1cb encoding turbot protein phosphatase 1 beta catalytic subunit

    Institute of Scientific and Technical Information of China (English)

    QI Fei; GUO Huarong; WANG Jian

    2008-01-01

    Reversible protein phosphorylation,catalyzed by protein kinases and phosphatases,is an important and versatile mechanism by which eukaryotic cells regulate almost all the signaling processes.Protein phosphatase 1(PP1) is the first and well-characterized member of the protein serine/threoninephosphatase family.In the present study.a full-length cDNA encoding the beta isolorm of the catalytic subunit of protein phosphatase 1(PP1cb).was for the first time isolated and sequenced from the skin tissue of flatfish turbot Scophthalmus maximus,designated SmPP1cb,by the rapid amplification of cDNA ends (RACE) technique.The cDNA sequence of SmPP1cb we obtained contains a 984 bp open reading frame(ORF),flanked by a complete 39 bp 5' untranslated region and 462 bp 3' untranslated region.The ORF encodes a putative 327 amino acid protein.and the N-terminal section of this protein iS highly acidic,Met-Ala-Glu-Gly-Glu-Leu-Asp-Val-Asp.a common feature for PP1 catalytic subunit but absent in protein phosphatase 2B(PP2B).And its calculated molecular mass is 37 193 Da and pI 5.8.Sequence analysis indicated that,SmPP1cb is extremely conserved in both amino acid and nucleotide acid levels compared with the PP1cb of other vertebrates and invertebrates.and its Kozak motif contained in the 5'UTR around ATG start codon is GXXAXXGXXATGG,which is different from mammalian in two positions A-6 and G-3,indicating the possibility of different initiation of translation in turbot,and also the 3'UTR of SmPP1cb is highly diverse in the sequence similarity and length compared with other animals.especially zebrafish.The cloning and sequencing of SmPP1cb gene lays a good foundation for the future work on the biological functions of PP1 in the flatfish turbot.

  17. Genetic loss of SH2B3 in acute lymphoblastic leukemia

    Science.gov (United States)

    Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Hadler, Michael; Rigo, Isaura; LeDuc, Charles A.; Kelly, Kara; Jalas, Chaim; Paietta, Elisabeth; Racevskis, Janis; Rowe, Jacob M.; Tallman, Martin S.; Paganin, Maddalena; Basso, Giuseppe; Tong, Wei; Chung, Wendy K.

    2013-01-01

    The SH2B adaptor protein 3 (SH2B3) gene encodes a negative regulator of cytokine signaling with a critical role in the homeostasis of hematopoietic stem cells and lymphoid progenitors. Here, we report the identification of germline homozygous SH2B3 mutations in 2 siblings affected with developmental delay and autoimmunity, one in whom B-precursor acute lymphoblastic leukemia (ALL) developed. Mechanistically, loss of SH2B3 increases Janus kinase-signal transducer and activator of transcription signaling, promotes lymphoid cell proliferation, and accelerates leukemia development in a mouse model of NOTCH1-induced ALL. Moreover, extended mutation analysis showed homozygous somatic mutations in SH2B3 in 2 of 167 ALLs analyzed. Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of ALL and highlight a possible link between genetic predisposition factors in the pathogenesis of autoimmunity and leukemogenesis. PMID:23908464

  18. Primary structure of the histone 2B gene in the white root rot fungus, Rosellinia necatrix.

    Science.gov (United States)

    Aimi, Tadanori; Taguchi, Hiroyuki; Morinaga, Tsutomu

    2002-12-01

    The nucleotide sequence of the histone 2B (H2B) gene in the white root rot fungus, Rosellinia necatrix, was determined. The gene has two introns in the coding region at positions conserved in the Neurospora crassa and Aspergillus nidulans H2B genes, but the third intron present in the H2B gene from N. crassa and A. nidulans is absent in the R. necatrix H2B gene. The amino acid sequence of the coding region of the R. necatrix gene resembled that of N. crassa and A. nidulans. Therefore, the third intron in the H2B gene of N. crassa and A. nidulans may have been inserted into the present position after species diversification.

  19. Allele and genotype frequencies of CYP2B6 in a Turkish population.

    Science.gov (United States)

    Yuce-Artun, Nazan; Kose, Gulcin; Suzen, H Sinan

    2014-06-01

    Increasing interest in cytochrome P450 2B6 (CYP2B6) genetic polymorphism was stimulated by revelations of a specific CYP2B6 genotype significantly affecting the metabolism of various drugs in common clinical use in terms of increasing drug efficacy and avoiding adverse drug reactions. The present study aimed to determine the frequencies of CYP2B6*4 CYP2B6*5, CYP2B6*6, CYP2B6*7 and CYP2B6*9 alleles in healthy Turkish individuals (n = 172). Frequencies of three single nucleotide polymorphisms were 516G>T (28%), 785A>G (33%), and 1459C>T (12%). The frequencies of CYP2B6*1, *4, *5, *6, *7, and *9 alleles were 54.3 (95% CI 49.04-59.56), 6.4% (95% CI 3.81-8.99), 11% (95% CI 7.69-14.31), 25.3% (95% CI 20.71-29.89), 0.87% (95% CI -0.11-1.85) and 2.0% (95% CI 0.52-3.48), respectively. Allele *6 was more frequent (25.3%) than the other variant alleles in Turkish subjects. The frequencies of CYP2B6*4, *5, *6, *7, and *9 alleles were similar to European populations but significantly different from that reported for Asian populations. This is the first study to document the frequencies of the CYP2B6*4, *5, *6, *7, *9 alleles in the healthy Turkish individuals and our results could provide clinically useful information on drug metabolism by CYP2B6 in Turkish population.

  20. Do self-service technologies affect interfirm relationships? A B2B perspective

    OpenAIRE

    Raechel Johns

    2014-01-01

    While considerable literature examines business-to business (B2B) relationships, the impact of technology on these relationships has lacked attention. IT has impacted the way businesses operate in a B2B context as well as influencing services by altering the way services are delivered. To understand the way in which Internet technology has impacted these B2B services, it is essential to examine its impact not only on business processes but on business relationships too. One technology, enable...

  1. B2B marketingová komunikace společnosti John Deere

    OpenAIRE

    2013-01-01

    The aim of this master's thesis is to evaluate the implementation of the B2B marketing strategy of John Deere on a specific example. The theoretical part of the thesis focuses on defining the basics of modern marketing communications. Next it deals with defining the concept of B2B marketing and related strategies. The practical part focuses on the characterisation of the agricultural machinery industry and the slovak agricultural sector. Further it includes the introduction of other B2B marke...

  2. New boundaries for the "ppK-" production in p+p collisions

    Science.gov (United States)

    Epple, Eliane

    2014-11-01

    The HADES collaboration has searched for the anti-kaonic nuclear cluster "ppK-" in p+p collisions by its decay into pΛ. In the course of this analysis several cross checks had to be performed. This report discusses two examples thereof. In one test it was checked whether the presence of background events could introduce a bias on the applied partial wave analysis. The second item discussed here is the extraction of the total pK+Λ production cross section necessary to derive the absolute upper limit on the "ppK-" production cross section.

  3. New boundaries for the “ppK−” production in p+p collisions

    Directory of Open Access Journals (Sweden)

    Epple Eliane

    2014-01-01

    Full Text Available The HADES collaboration has searched for the anti-kaonic nuclear cluster “ppK−” in p+p collisions by its decay into pΛ. In the course of this analysis several cross checks had to be performed. This report discusses two examples thereof. In one test it was checked whether the presence of background events could introduce a bias on the applied partial wave analysis. The second item discussed here is the extraction of the total pK+Λ production cross section necessary to derive the absolute upper limit on the “ppK−” production cross section.

  4. Insights into CYP2B6-mediated drug–drug interactions

    Directory of Open Access Journals (Sweden)

    William D. Hedrich

    2016-09-01

    Full Text Available Mounting evidence demonstrates that CYP2B6 plays a much larger role in human drug metabolism than was previously believed. The discovery of multiple important substrates of CYP2B6 as well as polymorphic differences has sparked increasing interest in the genetic and xenobiotic factors contributing to the expression and function of the enzyme. The expression of CYP2B6 is regulated primarily by the xenobiotic receptors constitutive androstane receptor (CAR and pregnane X receptor (PXR in the liver. In addition to CYP2B6, these receptors also mediate the inductive expression of CYP3A4, and a number of important phase II enzymes and drug transporters. CYP2B6 has been demonstrated to play a role in the metabolism of 2%–10% of clinically used drugs including widely used antineoplastic agents cyclophosphamide and ifosfamide, anesthetics propofol and ketamine, synthetic opioids pethidine and methadone, and the antiretrovirals nevirapine and efavirenz, among others. Significant inter-individual variability in the expression and function of the human CYP2B6 gene exists and can result in altered clinical outcomes in patients receiving treatment with CYP2B6-substrate drugs. These variances arise from a number of sources including genetic polymorphism, and xenobiotic intervention. In this review, we will provide an overview of the key players in CYP2B6 expression and function and highlight recent advances made in assessing clinical ramifications of important CYP2B6-mediated drug–drug interactions.

  5. Reversal of pathology in CHMP2B-mediated frontotemporal dementia patient cells using RNA interference

    DEFF Research Database (Denmark)

    Nielsen, Troels Tolstrup; Mizielinska, Sarah; Hasholt, Lis;

    2012-01-01

    BACKGROUND: Frontotemporal dementia is the second most common form of young-onset dementia after Alzheimer's disease, and several genetic forms of frontotemporal dementia are known. A rare genetic variant is caused by a point mutation in the CHMP2B gene. CHMP2B is a component of the ESCRT...... role in the pathogenesis of the disease. METHODS: In the present study, we used lentiviral vectors to efficiently knockdown CHMP2B by delivering microRNA embedded small hairpin RNAs. RESULTS: We show that CHMP2B can be efficiently knocked down in patient fibroblasts using an RNA interference approach...

  6. Mastoplastia reductora en L para grandes volúmenes

    OpenAIRE

    Fernandez, Claudio de Barros

    2013-01-01

    Las primeras descripciones de las mastoplastias fueron atribuidas a Paulus Aegineta en 625-690d.C. 4, con una resección de ginecomastia por el surco sub-mamario. Posteriormente, muchas técnicas fueron descritas para la disminución del órgano. Clásicamente, fueron consideradas mamas grandes aquellas con volúmenes resecados más grandes que 600 gr., siendo la mayoría tratadas tras cicatrices en T invertido. El objetivo de ese estudio es mostrar que es posible tratar mamas grandes con cicatrices ...

  7. Mastoplastia reductora en l para grandes volúmenes

    OpenAIRE

    De Barros Fernandez, Claudio

    2012-01-01

    Las primeras descripciones de las mastoplastias fueron atribuidas a Paulus Aegineta en 625-690d.C. 4, con una resección de ginecomastia por el surco sub-mamario. Posteriormente, muchas técnicas fueron descritas para la disminución del órgano. Clásicamente, fueron consideradas mamas grandes aquellas con volúmenes resecados más grandes que 600 gr., siendo la mayoría tratadas tras cicatrices en T invertido. El objetivo de ese estudio es mostrar que es posible tratar mamas grandes ...

  8. Sensitometria : sistema analògic versus digital. Vol. 2

    OpenAIRE

    Llunas i Pérez, Pere; Mur i Sanabre, Carme de

    2004-01-01

    Aquesta publicació vol ser una ajuda per a totes aquelles persones interessades en el coneixement dels materials fotogràfics fotoquímics i digitals i en el seu processament químic i digital. Al mateix temps pretén que alguns apartats d'aquesta disciplina siguin més propers a la pràctica fotogràfica. L'obra es composa d'il·lustracions que han estat dissenyades amb una finalitat docent; aquestes il·lustracions s'utilitzen a classe per a desenvolupar els temes que configuren el programa de l'ass...

  9. Componentes volátiles de mamey (mammea americana L.)

    OpenAIRE

    Alicia Lucía Morales; William Arguello; Gustavo García; Iván Herrera

    2010-01-01

    Los componentes volátiles del aroma de mamey (Mammea americana L), fueron extraídos utilizando el método de destilación por arrastre con vapor-extracción simultánea con solvente orgánico. El extracto fue prefraccionado por cromatografía en columna en silica gel con gradiente discontinuo Pentano: Éter etílico para obtener tres fracciones que fueron analizadas por CGAR y CGAR-EM. Se detectaron 34 compuestos, de los cuales fueron identificados 22, siendo los componentes mayoritarios: Furfural (7...

  10. Componentes volátiles de mamey (mammea americana l.)

    OpenAIRE

    Morales, Alicia Lucía; Arguello, William; García, Gustavo; Herrera, Iván

    2010-01-01

    Los componentes volátiles del aroma de mamey (Mammea americana L), fueron extraídos utilizando el método de destilación por arrastre con vapor-extracción simultánea con solvente orgánico. El extracto fue prefraccionado por cromatografía en columna en silica gel con gradiente discontinuo Pentano: Éter etílico para obtener tres fracciones que fueron analizadas por CGAR y CGAR-EM. Se detectaron 34 compuestos, de los cuales fueron identificados 22, siendo los componentes mayoritarios: Furfural (7...

  11. Diagramas de flujo y volúmenes de control

    OpenAIRE

    Fernández Torres, María José

    2010-01-01

    En este vídeo se explican los conceptos de DIAGRAMA DE FLUJO y de VOLÚMEN DE CONTROL aplicados a la Ingeniería Química. Se detalla cómo se dibujan correctamente volúmenes de control y las corrientes que deben considerarse en varios casos. Participan: Voz: Dra. María José Fernández Torres; Colaboran: Dra. María Dolores Saquete Ferrándiz y Dr. Francisco Ruiz Beviá.

  12. Theoretical-Experimental Analysis of the Effects of Grain Boundaries on the Electrical Properties of SOI (Silicon-on-Insulator) MOSFETS.

    Science.gov (United States)

    1983-11-01

    Insulating Substrate", IEEE Electron Device Lett., vol. EDL-l, pp. 206-208, Oct. 1980. 2. B.-Y. Tsaur, M. W. Geis, J. C. C. Fan, D. J. Silversmith , and P...Electron Device Lett., vol. EDL-I, pp. 206-208, Oct. 1980. 3. B.-Y. Tsaur, M. W. Geis, J. C. C. Fan, D. J. Silversmith , and P. W. Mountain, "n-Channel Deep...Lett., vol. EDL-I, pp. 206-208, Oct. 1980. 2. B.-Y. Tsaur, M. W. Geis, J. C. C. Fan, D. J. Silversmith , and R. W. Mountain, "n-Channel Deep-Depletion

  13. Anestesia volátil e monitorização anestésica.

    OpenAIRE

    Alexandre, Nuno; Costa, Margarida; Mascarenhas, Ramiro

    2009-01-01

    Os autores apresentam um texto de apoio à disciplina de anestesiologia do curso de Medicina Veterinária .Neste texto são abordadas diversas temáticas da anestesia volátil tais como: equipamentos utilizados em anestesia volátil, farmacologia dos anestésicos voláteis. A monitorização dos pacientes é abordada na vertente mecânica ou intrumental e na componente básica.

  14. Anestesia volátil e monitorização anestésica.

    OpenAIRE

    Alexandre, Nuno; Costa, Margarida; Mascarenhas, Ramiro

    2009-01-01

    Os autores apresentam um texto de apoio à disciplina de anestesiologia do curso de Medicina Veterinária .Neste texto são abordadas diversas temáticas da anestesia volátil tais como: equipamentos utilizados em anestesia volátil, farmacologia dos anestésicos voláteis. A monitorização dos pacientes é abordada na vertente mecânica ou intrumental e na componente básica.

  15. Heavy quark production in pp collisions

    Energy Technology Data Exchange (ETDEWEB)

    McGaughey, P.L. [Los Alamos National Lab., NM (United States); Quack, E. [Gesellschaft fuer Schwerionenforschung, Darmstadt (Germany); Ruuskanen, P.V. [Univ. of Helsinki (Finland)]|[Univ. of Jyvaeskylae (Finland)] [and others

    1995-07-01

    A systematic study of the inclusive single heavy quark and heavy-quark pair production cross sections in pp collisions is presented for RHIC and LHC energies. We compare with existing data when possible. The dependence of the rates on the renormalization and factorization scales is discussed. Predictions of the cross sections are given for two different sets of parton distribution functions.

  16. Regulation of PI-2b Pilus Expression in Hypervirulent Streptococcus agalactiae ST-17 BM110

    Science.gov (United States)

    du Merle, Laurence; Rosinski-Chupin, Isabelle; Gominet, Myriam; Bellais, Samuel; Poyart, Claire; Trieu-Cuot, Patrick

    2017-01-01

    The widely spread Streptococcus agalactiae (also known as Group B Streptococcus, GBS) “hypervirulent” ST17 clone is strongly associated with neonatal meningitis. The PI-2b locus is mainly found in ST17 strains but is also present in a few non ST17 human isolates such as the ST-7 prototype strain A909. Here, we analysed the expression of the PI-2b pilus in the ST17 strain BM110 as compared to the non ST17 A909. Comparative genome analyses revealed the presence of a 43-base pair (bp) hairpin-like structure in the upstream region of PI-2b operon in all 26 ST17 genomes, which was absent in the 8 non-ST17 strains carrying the PI-2b locus. Deletion of this 43-bp sequence in strain BM110 resulted in a 3- to 5-fold increased transcription of PI-2b. Characterization of PI-2b promoter region in A909 and BM110 strains was carried out by RNAseq, primer extension, qRT-PCR and transcriptional fusions with gfp as reporter gene. Our results indicate the presence of a single promoter (Ppi2b) with a transcriptional start site (TSS) mapped 37 bases upstream of the start codon of the first PI-2b gene. The large operon of 16 genes located upstream of PI-2b codes for the group B carbohydrate (also known as antigen B), a major constituent of the bacterial cell wall. We showed that the hairpin sequence located between antigen B and PI-2b operons is a transcriptional terminator. In A909, increased expression of PI-2b probably results from read-through transcription from antigen B operon. In addition, we showed that an extended 5’ promoter region is required for maximal transcription of gfp as a reporter gene in S. agalactiae from Ppi2b promoter. Gene reporter assays performed in Lactococcus lactis strain NZ9000, a related non-pathogenic Gram-positive species, revealed that GBS-specific regulatory factors are required to drive PI-2b transcription. PI-2b expression is up-regulated in the BM110ΔcovR mutant as compared to the parental BM110 strain, but this effect is probably indirect

  17. Acquisition Review Quarterly. Vol. 2, No. 1, Winter 1995

    Science.gov (United States)

    1995-01-01

    then different strategies and tactics may be deemed necessary for each segment that is targeted ( Kotler , 1988). There are a number of plausible...and Co. Kotler , P. (1988). Marketing Management: Analysis and Planning (6th ed.), (pp. 280-284). Englewood Cliffs, NJ: Prentice-Hall, Inc. 40- Winter...James R. Penick, USA F; CAPT John H. Priesel, USN; Joseph M. Rivamonte; William E. Roberson, Jr.; CAPT Dennis L. Ryan, III, USN; Philip H. Spector

  18. ISAJET: a Monte Carlo event generator for pp and anti pp interactions. Version 3

    Energy Technology Data Exchange (ETDEWEB)

    Paige, F.E.; Protopopescu, S.D.

    1982-09-01

    ISAJET is a Monte Carlo computer program which simulates pp and anti pp reactions at high energy. It can generate minimum bias events representative of the total inelastic cross section, high PT hadronic events, and Drell-Yan events with a virtual ..gamma.., W/sup + -/, or Z/sup 0/. It is based on perturbative QCD and phenomeno-logical models for jet fragmentation.

  19. Polarization observables for the reaction pp -> pp. pi. /sup 0/ at 800 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Riley, P.J.; Bachman, M.; Hollas, C.L.; McNaughton, K.H.; Xu Shenwu; Bonner, B.E.; Van Dyck, O.B.; McGill, J.; McNaughton, M.W.; Peng, J.C.

    1987-10-22

    The Wolfenstein polarization observables D/sub NN/, D/sub S..cap omega../ and D/sub L..cap omega../, where ..cap omega.. denotes a mixture of S and L polarization components, the induced polarization P, and the analysing power A have been measured for the reaction pp -> pp..pi../sup 0/ at 800, 733, and 647 MeV. Comparisons are made to theoretical predictions of the model of Dubach, Kloet and Silbar.

  20. A Decompositional Approach to Executing Quality Data Model Algorithms on the i2b2 Platform

    Science.gov (United States)

    Mo, Huan; Jiang, Guoqian; Pacheco, Jennifer A.; Kiefer, Richard; Rasmussen, Luke V.; Pathak, Jyotishman; Denny, Joshua C.; Thompson, William K.

    2016-01-01

    The Quality Data Model (QDM) is an established standard for representing electronic clinical quality measures on electronic health record (EHR) repositories. The Informatics for Integrated Biology and the Bedside (i2b2) is a widely used platform for implementing clinical data repositories. However, translation from QDM to i2b2 is challenging, since QDM allows for complex queries beyond the capability of single i2b2 messages. We have developed an approach to decompose complex QDM algorithms into workflows of single i2b2 messages, and execute them on the KNIME data analytics platform. Each workflow operation module is composed of parameter lists, a template for the i2b2 message, an mechanism to create parameter updates, and a web service call to i2b2. The communication between workflow modules relies on passing keys ofi2b2 result sets. As a demonstration of validity, we describe the implementation and execution of a type 2 diabetes mellitus phenotype algorithm against an i2b2 data repository. PMID:27570665

  1. Genetics Home Reference: RRM2B-related mitochondrial DNA depletion syndrome, encephalomyopathic form with renal ...

    Science.gov (United States)

    ... Munnich A, Rötig A. Mutation of RRM2B, encoding p53-controlled ribonucleotide reductase (p53R2), causes severe mitochondrial DNA depletion. Nat Genet. 2007 Jun;39(6):776-80. Epub 2007 May 7. Citation on PubMed GeneReview: RRM2B-Related Mitochondrial Disease Pontarin G, Ferraro P, Bee L, Reichard P, ...

  2. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2010 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  3. Doc2b synchronizes secretion from chromaffin cells by stimulating fast and inhibiting sustained release

    DEFF Research Database (Denmark)

    da Silva Pinheiro, Paulo César; de Wit, Heidi; Walter, Alexander M;

    2013-01-01

    is still high. We conclude that Doc2b acts to inhibit vesicle priming during prolonged calcium elevations, thus protecting unprimed vesicles from fusing prematurely, and redirecting them to refill the readily releasable pool after relaxation of the calcium signal. In sum, Doc2b favors fast, synchronized...

  4. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2009

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2009 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  5. Disruption of endocytic trafficking in frontotemporal dementia with CHMP2B mutations

    DEFF Research Database (Denmark)

    Urwin, Hazel; Authier, Astrid; Nielsen, Jørgen Erik

    2010-01-01

    Mutations in CHMP2B cause frontotemporal dementia (FTD) in a large Danish pedigree, which is termed FTD linked to chromosome 3 (FTD-3), and also in an unrelated familial FTD patient. CHMP2B is a component of the ESCRT-III complex, which is required for function of the multivesicular body (MVB), a...

  6. Fabrication Report for the AFC-2A and AFC-2B Capsule Irradiations in the ATR

    Energy Technology Data Exchange (ETDEWEB)

    Timothy A. Hyde

    2007-10-01

    This document provides a general narrative description of the AFC-2A and 2B fuel fabrication processes for the AFC 2A and AFC 2B fuel irradiation experiments fabricated at the Idaho National Laboratory’s Materials and Fuels Complex (MFC) for irradiation in the Advanced Test Reactor (ATR).

  7. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2011

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2011 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  8. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2012

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Pool 2B. Water-Data Report 2012 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  9. 76 FR 3451 - Wage Methodology for the Temporary Non-agricultural Employment H-2B Program

    Science.gov (United States)

    2011-01-19

    ..., Refugees, Border Security, and International Law in April 2008, Ross Eisenbrey, Vice President of the...-2B Program: Hearing Before the Subcommittee on Immigration, Citizenship, Refugees, Border Security...- skill H-2B jobs causes an adverse effect because all workers in those job categories perform the same...

  10. Noncanonical sortase-mediated assembly of pilus type 2b in group B Streptococcus.

    Science.gov (United States)

    Lazzarin, Maddalena; Cozzi, Roberta; Malito, Enrico; Martinelli, Manuele; D'Onofrio, Mariapina; Maione, Domenico; Margarit, Immaculada; Rinaudo, C Daniela

    2015-11-01

    Group B Streptococcus (GBS) expresses 3 structurally distinct pilus types (1, 2a, and 2b) identified as important virulence factors and vaccine targets. These pili are heterotrimeric polymers, covalently assembled on the cell wall by sortase (Srt) enzymes. We investigated the pilus-2b biogenesis mechanism by using a multidisciplinary approach integrating genetic, biochemical, and structural studies to dissect the role of the 2 pilus-2b-associated Srts. We show that only 1 sortase (SrtC1-2b) is responsible for pilus protein polymerization, whereas the second one (Srt2-2b) does not act as a pilin polymerase, but similarly to the housekeeping class A Srt (SrtA), it is involved in cell-wall pilus anchoring by targeting the minor ancillary subunit. Based on its function and sequence features, Srt2-2b does not belong to class C Srts (SrtCs), nor is it a canonical member of any other known family of Srts. We also report the crystal structure of SrtC1-2b at 1.9 Å resolution. The overall fold resembles the typical structure of SrtCs except for the N-terminal lid region that appears in an open conformation displaced from the active site. Our findings reveal that GBS pilus type 2b biogenesis differs significantly from the current model of pilus assembly in gram-positive pathogens.

  11. Preparation and application of hydroxyapatite(HA) nanoparticles/NR2B-siRNA complex

    Institute of Scientific and Technical Information of China (English)

    YANG Hui; HUANG Dong; ZHU Shai-hong; YAN Xue-bin; GU Yong-hong; YAN Hui; WU Li-xiang

    2008-01-01

    Hydroxyapatite(HA) nanoparticles were prepared by coprecipitation-hydrothermal synthesis and their exosyndrome was estimated via transmission electron microscopy. Agarose gel electrophoresis and ultraviolet spectrophotometry were used to evaluate the ability of HA to bind NR2B-siRNA at different pH values and at different HA-NR2B-siRNA ratios. And the stability of the complex in saline was also evaluated. The effect of HA/NR2B-siRNA complex on chronic inflammatory pain was evaluated in vivo in mice. Transmission electron microscopy(TEM) reveals that HA nanoparticles are thin strips or short rod in shape and the one-dimensional particle size of HA nanoparticles is 40-50 nm. Under the acid or neutral condition, the Zeta potential of HA is positive; nanoparticles can completely bind NR2B-siRNA when the HA:NR2B-siRNA ratio is at or larger than 35-1; while under the alkaline condition, the affinity of HA to NR2B-siRNA is rather weak. HA/NR2B-siRNA complex is not dissociated when being resuspended in saline. The nociception of the tonic phase induced by formalin is significantly reduced in the HA/NR2B-siRNA treated mice as compared with the controls. Therefore, HA may be a new siRNA nano-vector material.

  12. SRC Inhibition Reduces NR2B Surface Expression and Synaptic Plasticity in the Amygdala

    Science.gov (United States)

    Sinai, Laleh; Duffy, Steven; Roder, John C.

    2010-01-01

    The Src protein tyrosine kinase plays a central role in the regulation of N-methyl-d-aspartate receptor (NMDAR) activity by regulating NMDAR subunit 2B (NR2B) surface expression. In the amygdala, NMDA-dependent synaptic plasticity resulting from convergent somatosensory and auditory inputs contributes to emotional memory; however, the role of Src…

  13. Data of evolutionary structure change: 1ANTI-2B4XL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-2B4XL 1ANT 2B4X I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE...Chain> 1ANT I 1ANTI AASTA----VVIA...14> 1ANT I 1ANTI...ntryChain> 1ANT I 1ANTI

  14. Smoking, alcoholism and genetic polymorphisms alter CYP2B6 levels in human brain.

    Science.gov (United States)

    Miksys, Sharon; Lerman, Caryn; Shields, Peter G; Mash, Deborah C; Tyndale, Rachel F

    2003-07-01

    CYP2B6 metabolizes drugs such as nicotine and bupropion, and many toxins and carcinogens. Nicotine induces CYP2B1 in rat brain and in humans polymorphic variation in CYP2B6 affects smoking cessation rates. The aim of this study was to compare CYP2B6 expression in brains of human smokers and non-smokers and alcoholics and non-alcoholics (n=26). CYP2B6 expression was brain region-specific, and was observed in both neurons and astrocytes. CYP2B6 levels were higher in brains of smokers and alcoholics, particularly in cerebellar Purkinje cells and hippocampal pyramidal neurons, cells known to be damaged in alcoholics. Significantly more (penzyme levels, stability and activity. Preliminary genotyping of this small sample (n=24) suggested that individuals with the CC genotype had higher brain CYP2B6 than those with the CT or TT genotype. Higher brain CYP2B6 activity in smokers and alcoholics may cause altered sensitivity to centrally acting drugs, increased susceptibility to neurotoxins and carcinogenic xenobiotics and contribute to central tolerance to nicotine.

  15. First identification of Porcine Circovirus Type 2b mutant in pigs from Uruguay.

    Science.gov (United States)

    Ramos, Natalia; Mirazo, Santiago; Castro, Gustavo; Arbiza, Juan

    2015-07-01

    Porcine Circovirus Type 2 (PCV2) is a worldwide distributed virus and is considered an important emerging pathogen related to several distinct disease syndromes in pigs. PCV2 strains are classified into three genotypes: PCV2a, with five subtypes (2A-2E), PCV2b with three subtypes (1A-1C) and PCV2c, only found in Denmark. Recently, several reports suggested the circulation of newly emerging PCV2b mutants (mPCV2b) isolated from pigs with PCVAD in cases of suspected vaccine failure. In this work, we report for the first time the identification of mPCV2b in pigs from Uruguay, providing an additional evidence of a global circulation. Complete genome characterization and phylogenetic analysis reveal that Uruguayan strains, as well as mPCV2b previously reported are closely related to other sequences already classified as PCV2b-1C. Furthermore, results showed that mPCV2b presented different genetic markers in the capsid protein compared with classical PCV2a/b strains. Further investigation about antigenic shift of the mPCV2b strains including the Uruguayan isolates is needed.

  16. Data of evolutionary structure change: 2B9RA-2BPMD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B9RA-2BPMD 2B9R 2BPM A D -VKDIYAYLRQLEAAQAVRPKYLLGR-EVTGNMRAILID...line>THR CA 261 GLY CA 332 ASN CA 307 2BPM... D 2BPMD YMKKQPDITNS .../line> ASP CA 206 VAL CA 247 GLU CA 298 2BPM... D 2BPMD

  17. Data of evolutionary structure change: 1BEDA-2B6MA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BEDA-2B6MA 1BED 2B6M A A AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTF---...HHHHHHHHHH EEEE EEEEE HHHHHHHHHHHHHH - 0 1BED... A 1BEDA HCNTF---E...e> ALA CA 306 SER CA 272 1BED... A 1BEDA HTLRKPPKDEQ

  18. XO-2b: a Prograde Planet with a Negligible Eccentricity, and an Additional Radial Velocity Variation

    CERN Document Server

    Narita, Norio; Sato, Bun'ei; Harakawa, Hiroki; Fukui, Akihiko; Aoki, Wako; Tamura, Motohide

    2011-01-01

    We present precise radial velocities of XO-2 taken with the Subaru HDS, covering two transits of XO-2b with an interval of nearly two years. The data suggest that the orbital eccentricity of XO-2b is consistent with zero within 2$\\sigma$ ($e=0.045\\pm0.024$) and the orbit of XO-2b is prograde (the sky-projected spin-orbit alignment angle $\\lambda=10^{\\circ}\\pm72^{\\circ}$). The poor constraint of $\\lambda$ is due to a small impact parameter (the orbital inclination of XO-2b is almost 90$^{\\circ}$). The data also provide an improved estimate of the mass of XO-2b as $0.62\\pm0.02$ $M_{\\rm Jup}$. We also find a long-term radial velocity variation in this system. Further radial velocity measurements are necessary to specify the cause of this additional variation.

  19. Global view of transcriptome in the brains of aged NR2B transgenic mice*****

    Institute of Scientific and Technical Information of China (English)

    Chunxia Li; Men Su; Huimin Wang; Yinghe Hu

    2013-01-01

    NR2B subunits are involved in regulating aging, in particular, age-related learning and memory deficits. We examined 19-month-old NR2B transgenic mice and their littermate controls. First, we detected expression of the NR2B subunit gene, Grin2b, in the neocortex of transgenic mice using real-time PCR. Next, we used microarrays to examine differences in neocortical gene expression. Pathway and signal-net analyses identified multiple pathways altered in the transgenic mice, in-cluding the P53, Jak-STAT, Wnt, and Notch pathways, as wel as regulation of the actin cytoskeleton and neuroactive ligand-receptor interactions. Further signal-net analysis highlighted the P53 and insulin-like growth factor pathways as key regulatory pathways. Our results provide new insight into understanding the molecular mechanisms of NR2B regulated age-related memory storage, normal organismal aging and age-related disease.

  20. Interferon-alpha-2b induces autophagy in hepatocellular carcinoma cells through Beclin1 pathway

    Institute of Scientific and Technical Information of China (English)

    Jun Zhao; Ming-Li Wang; Zeng Li; Dong-Mei Gao; Yu Cai; Jun Chang; Shi-Ping Wang

    2014-01-01

    Objective:To determine whether Interferon-alpha-2b (IFN-α2b) can modulate the autophagic response in hepatocellular carcinoma cells. Methods:Hepatocellular carcinoma cells were treated with IFN-α2b. Autophagy was assessed by acridine orange staining, GFP-LC3 dotted assay, transmission electron microscopy and immunoblotting. Results:Acridine orange staining showed that IFN-α2b triggered the accumulation of acidic vesicular and autolysosomes in HepG2 cells. hTe acridine orange HepG2 cell ratios were (4.3±1.0)%, (6.9±1.4)%, and (13.1±2.3)%, respectively, atfer treatment with 100, 1,000, and 10,000 IU/mL IFN-α2b for 48 h. A markedly punctate pattern was observed in HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h, but only diffuse and weakly lfuorescent GFP-LC3 puncta was observed in control cells. HepG2 cells treated with 10,000 IU/mL IFN-α2b for 48 h developed autophagosome-like characteristics, including single-or double-membrane vacuoles containing intact and degraded cellular debris. The Beclin1 and LC3-II protein expression was up-regulated by IFN-α2b treatment. Conclusion:Autophagy can be induced in a dose-dependent manner by treatment with IFN-α2b in HepG2 cells, and the Beclin1 signaling pathway was stimulated by IFN-α2b.

  1. RET(MEN 2B) is active in the endoplasmic reticulum before reaching the cell surface.

    Science.gov (United States)

    Runeberg-Roos, P; Virtanen, H; Saarma, M

    2007-12-13

    MEN 2B (multiple endocrine neoplasia type 2B) is an autosomal dominant cancer syndrome caused by an oncogenic form of the receptor tyrosine kinase REarranged during transfection (RET). The MEN 2B syndrome is associated with an abnormal autophosphorylation of the mutated receptor even without ligand-stimulation. Here, we characterize the activation of a RET(MEN 2B) variant carrying the point mutation Met918Thr, and show that the 150 kDa precursor of RET(MEN 2B) becomes phosphorylated already during synthesis in the endoplasmic reticulum (ER). At least three different tyrosine residues (Tyr905, Tyr1062, Tyr1096) of the RET(MEN 2B) precursor are phosphorylated before the oncogenic receptor reaches the cell surface. We also demonstrate that the precursor of RET(MEN 2B) interacts with both growth factor receptor-bound protein and Src homology 2 domain-containing already in the ER, and that this interaction is dependent on the kinase activity of RET. With the aid of two RET mutants (RET(MEN 2B/S32L) and RET(MEN 2B/F393L)), which accumulate in the ER, we show that the oncogenic precursor of the receptor has the capacity to activate AKT, extracellular signal-regulated kinase and signal transducer and activator of transcription 3 from the ER. Taken together, our data demonstrate that the oncogenic precursor of RET(MEN 2B) is phosphorylated, interacts with adapter proteins and induces downstream signalling from the ER.

  2. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida).

    Science.gov (United States)

    Malenke, Jael R; Magnanou, Elodie; Thomas, Kirk; Dearing, M Denise

    2012-01-01

    Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida), we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B). We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma) or creosote bush (Larrea tridentata), plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a wild mammalian

  3. Cytochrome P450 2B diversity and dietary novelty in the herbivorous, desert woodrat (Neotoma lepida.

    Directory of Open Access Journals (Sweden)

    Jael R Malenke

    Full Text Available Detoxification enzymes play a key role in plant-herbivore interactions, contributing to the on-going evolution of ecosystem functional diversity. Mammalian detoxification systems have been well studied by the medical and pharmacological industries to understand human drug metabolism; however, little is known of the mechanisms employed by wild herbivores to metabolize toxic plant secondary compounds. Using a wild rodent herbivore, the desert woodrat (Neotoma lepida, we investigated genomic structural variation, sequence variability, and expression patterns in a multigene subfamily involved in xenobiotic metabolism, cytochrome P450 2B (CYP2B. We hypothesized that differences in CYP2B expression and sequence diversity could explain differential abilities of woodrat populations to consume native plant toxins. Woodrats from two distinct populations were fed diets supplemented with either juniper (Juniperus osteosperma or creosote bush (Larrea tridentata, plants consumed by woodrats in their respective desert habitats. We used Southern blot and quantitative PCR to determine that the genomic copy number of CYP2B in both populations was equivalent, and similar in number to known rodent copy number. We compared CYP2B expression patterns and sequence diversity using cloned hepatic CYP2B cDNA. The resulting sequences were very diverse, and clustered into four major clades by amino acid similarity. Sequences from the experimental treatments were distributed non-randomly across a CYP2B tree, indicating unique expression patterns from woodrats on different diets and from different habitats. Furthermore, within each major CYP2B clade, sequences shared a unique combination of amino acid residues at 13 sites throughout the protein known to be important for CYP2B enzyme function, implying differences in the function of each major CYP2B variant. This work is the most comprehensive investigation of the genetic diversity of a detoxification enzyme subfamily in a

  4. Characterization of the A2B adenosine receptor from mouse, rabbit, and dog.

    Science.gov (United States)

    Auchampach, John A; Kreckler, Laura M; Wan, Tina C; Maas, Jason E; van der Hoeven, Dharini; Gizewski, Elizabeth; Narayanan, Jayashree; Maas, Garren E

    2009-04-01

    We have cloned and pharmacologically characterized the A(2B) adenosine receptor (AR) from the dog, rabbit, and mouse. The full coding regions of the dog and mouse A(2B)AR were obtained by reverse transcriptase-polymerase chain reaction, and the rabbit A(2B)AR cDNA was obtained by screening a rabbit brain cDNA library. It is noteworthy that an additional clone was isolated by library screening that was identical in sequence to the full-length rabbit A(2B)AR, with the exception of a 27-base pair deletion in the region encoding amino acids 103 to 111 (A(2B)AR(103-111)). This 9 amino acid deletion is located in the second intracellular loop at the only known splice junction of the A(2B)AR and seems to result from the use of an additional 5' donor site found in the rabbit and dog but not in the human, rat, or mouse sequences. [(3)H]3-Isobutyl-8-pyrrolidinoxanthine and 8-[4-[((4-cyano-[2,6-(3)H]-phenyl)carbamoylmethyl)oxy]phenyl]-1,3-di(n-propyl)xanthine ([(3)H]MRS 1754) bound with high affinity to membranes prepared from human embryonic kidney (HEK) 293 cells expressing mouse, rabbit, and dog A(2B)ARs. Competition binding studies performed with a panel of agonist (adenosine and 2-amino-3,5-dicyano-4-phenylpyridine analogs) and antagonist ligands identified similar potency orders for the A(2B)AR orthologs, although most xanthine antagonists displayed lower binding affinity for the dog A(2B)AR compared with A(2B)ARs from rabbit and mouse. No specific binding could be detected with membranes prepared from HEK 293 cells expressing the rabbit A(2B)AR(103-111) variant. Furthermore, the variant failed to stimulate adenylyl cyclase or calcium mobilization. We conclude that significant differences in antagonist pharmacology of the A(2B)AR exist between species and that some species express nonfunctional variants of the A(2B)AR due to "leaky" splicing.

  5. Development of hemp fibre - PP nonwoven composites

    CSIR Research Space (South Africa)

    Hargitai, H

    2006-01-01

    Full Text Available samples were stored in distilled water at a room temperature for about 450 hours. Every day the samples were dried by paper towel and the increase in weight was measured. The tensile and three point bending test was performed on ZWICK equipment.... F., Jacobson, R. E., Paper and Composites from Agro-Based Resources (Rowell, R. M. et al. Ed.), Lewis Publishers, New York, 377.(1997) [6] Wielage, B., K?hler, E., Odenwald, S., Lampke, Th., Bergner, A., Kunststoffe, Vol. 89: 60-62 (1999) [7...

  6. PP2A: The Wolf in Sheep’s Clothing?

    Energy Technology Data Exchange (ETDEWEB)

    Kiely, Maeve [Department of Life Sciences, and Materials and Surface Science Institute, University of Limerick, Limerick 78666 (Ireland); Kiely, Patrick A., E-mail: Patrick.Kiely@ul.ie [Department of Life Sciences, and Materials and Surface Science Institute, University of Limerick, Limerick 78666 (Ireland); Stokes Institute, University of Limerick 78666, Limerick (Ireland)

    2015-04-13

    Protein Phosphatase 2A (PP2A) is a major serine/threonine phosphatase in cells. It consists of a catalytic subunit (C), a structural subunit (A), and a regulatory/variable B-type subunit. PP2A has a critical role to play in homeostasis where its predominant function is as a phosphatase that regulates the major cell signaling pathways in cells. Changes in the assembly, activity and substrate specificity of the PP2A holoenzyme have a direct role in disease and are a major contributor to the maintenance of the transformed phenotype in cancer. We have learned a lot about how PP2A functions from specific mutations that disrupt the core assembly of PP2A and from viral proteins that target PP2A and inhibit its effect as a phosphatase. This prompted various studies revealing that restoration of PP2A activity benefits some cancer patients. However, our understanding of the mechanism of action of this is limited because of the complex nature of PP2A holoenzyme assembly and because it acts through a wide variety of signaling pathways. Information on PP2A is also conflicting as there are situations whereby inactivation of PP2A induces apoptosis in many cancer cells. In this review we discuss this relationship and we also address many of the pertinent and topical questions that relate to novel therapeutic strategies aimed at altering PP2A activity.

  7. Neutron diffraction studies of magnetic ordering in superconducting ErNi2B2C and TmNi2B2C in an applied magnetic field

    DEFF Research Database (Denmark)

    Toft, Katrine Nørgaard

    along [110], the magnetic structure rotates a small angle of 0.5 degrees away from the symmetrydirection. TmNi2B2C: A magnetic field applied in the [100] direction suppresses the zero field magnetic structure QF = (0.094,0.094,0) (TN = 1.6 K), in favor of the Fermi surface nesting structure QN = (0......The field-induced magnetic structures of ErNi2B2C and TmNi2B2C in are especially interesting because the field suppresses the superconducting order parameter and therefore the magnetic properties can be studied while varying the strength ofsuperconductivity. ErNi2B2C: For magnetic fields along all...... three symmetry directions, the observed magnetic structures have a period corresponding to the Fermi surface nesting structure. The phase diagrams present all the observed magnetic structures.Two results remain unresolved: 1. When applying the magnetic field along [010], the minority domain (QNB = (0,Q...

  8. Psychiatric side effects of pegylated interferon alfa-2b as compared to conventional interferon alfa-2b in patients with chronic hepatitis C

    Institute of Scientific and Technical Information of China (English)

    Michael R Kraus; Arne Sch(a)fer; Herbert Csef; Michael Scheurlen

    2005-01-01

    AIM: To assess systematically the spectrum and extent of depressive symptoms comparing patient groups receiving peginterferon or conventional interferon.METHODS: Ninety-eight patients with chronic hepatitis C and interferon-based therapy (+ribavirin) were consecutively enrolled in a longitudinal study. Patients were treated with conventional interferon alfa-2b (48/98patients; 5 MIU interferon alfa-2b thrice weekly) or peginterferon alfa-2b (50/98 patients; 80-150 μgpeginterferon alfa-2b) in combination with weight-adapted ribavirin (800-1 200 mg/d). Repeated psychometric testing was performed before, three times during and once after antiviral therapy: Depression was evaluated by the Hospital Anxiety and Depression Scale (HADS), anger/hostility by the Symptom Checklist-90 Items Revised (SCL-90-R).RESULTS: Therapy with pegylated interferon alfa-2bproduces comparable scores for depression (ANOVA:P = 0.875) as compared to conventional interferon.Maximums of depression scores were even higher and cases of clinically relevant depression were frequent during therapy with peginterferon. Scores for anger/hostility were comparable for both therapy subgroups.CONCLUSION: Our findings suggest that the extent and frequency of depressive symptoms in total are not reduced by peginterferon. Monitoring and management of neuropsychiatric toxicity especially depression have to be considered as much as in antiviral therapy with unmodified interferon.

  9. Unconventional morphologies in ordered melts of symmetric multiblock copolymers A(mN/2)(B(N/2)A(N/2))B-mN/2

    NARCIS (Netherlands)

    Smirnova, YG; ten Brinke, G; Erukhimovich, IY

    2005-01-01

    In the limit of weak segregation, microphase separation in melts of symmetric multiblock copolymers with the structural formula A(mN/2)(B(N/2)A(N/2))(n)B-mN/2 was theoretically analyzed. It was shown for the first time that, in the case of these two-length-scale block copolymers AB, competition betw

  10. Index to Nuclear Safety. A technical progress review by chronology, permuted title, and author. Vol. 11, No. 1--Vol. 17, No. 6

    Energy Technology Data Exchange (ETDEWEB)

    Cottrell, W.B.; Klein, A.

    1977-02-23

    This index to Nuclear Safety covers articles in Nuclear Safety Vol. 11, No. 1 (Jan.-Feb. 1970), through Vol. 17, No. 6 (Nov.-Dec. 1976). The index includes a chronological list of articles (including abstract) followed by KWIC and Author Indexes. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center, covers all safety aspects of nuclear power reactors and associated facilities. The index lists over 350 technical articles in the last six years of publication.

  11. Differential role of SH2-B and APS in regulating energy and glucose homeostasis.

    Science.gov (United States)

    Li, Minghua; Ren, Decheng; Iseki, Masanori; Takaki, Satoshi; Rui, Liangyou

    2006-05-01

    SH2-B and APS, two members of a pleckstrin homology and SH2 domain-containing adaptor family, promote both insulin and leptin signaling in a similar fashion in cultured cells. In addition, APS mediates insulin-stimulated activation of the c-Cbl/CAP/TC10 pathway in cultured adipocytes. Here we characterized genetically modified mice lacking SH2-B, APS, or both to determine the physiological roles of these two proteins in animals. Disruption of the SH2-B gene resulted in obesity, hyperglycemia, hyperinsulinemia, and glucose intolerance. Conversely, deletion of the APS gene did not alter adiposity, energy balance, and glucose metabolism. Energy intake, energy expenditure, fat content, body weight, and plasma insulin, leptin, glucose, and lipid levels were similar between APS(-/-) and WT littermates fed either normal chow or a high-fat diet. Moreover, deletion of APS failed to alter insulin and glucose tolerance. APS(-/-)/SH2-B(-/-) double knockout mice also developed energy imbalance, obesity, hyperleptinemia, hyperinsulinemia, hyperglycemia, and glucose intolerance; however, plasma leptin and insulin levels were significantly lower in APS(-/-)/SH2-B(-/-) than in SH2-B(-/-) mice. These results suggest that SH2-B, but not APS, is a key positive regulator of energy and glucose metabolism in mice.

  12. Structural characterization and antiviral effect of a novel polysaccharide PSP-2B from Prunellae Spica.

    Science.gov (United States)

    Ma, Feng-Wei; Kong, Si-Yuan; Tan, Hong-Sheng; Wu, Rong; Xia, Bing; Zhou, Yan; Xu, Hong-Xi

    2016-11-05

    In the present study, a novel polysaccharide, PSP-2B, was isolated from aqueous extracts of Prunellae Spica by direct ultrafiltration membrane separation and gel chromatography purification. PSP-2B is a partially sulphated polysaccharide with a molecular weight of approximately 32kDa. Its sulfate content is 10.59% by elemental analysis. The major sugars comprising PSP-2B are arabinose, galactose and mannose, in addition to small amounts of glucose and uronic acids. The framework of PSP-2B is speculated to be a branched arabinogalactomannan, and the side chains are terminated primarily by the Araf residues. PSP-2B also contains 2.98% protein. PSP-2B exhibits activity against herpes simplex virus (HSV), with a half maximal inhibitory concentration (IC50) of approximately 69μg/mL for HSV-1 and 49μg/mL for HSV-2. However, PSP-2B demonstrated no cytotoxicity even when its concentration was increased to 1600μg/mL, suggesting that it has potential as an anti-HSV drug candidate.

  13. The influence of VO2(B nanobelts on thermal decomposition of ammonium perchlorate

    Directory of Open Access Journals (Sweden)

    Zhang Yifu

    2015-09-01

    Full Text Available The influence of vanadium dioxide VO2(B on thermal decomposition of ammonium perchlorate (AP has not been reported before. In this contribution, the effect of VO2(B nanobelts on the thermal decomposition of AP was investigated by the Thermo- Gravimetric Analysis and Differential Thermal Analysis (TG/DTA. VO2(B nanobelts were hydrothermally prepared using peroxovanadium (V complexes, ethanol and water as starting materials. The thermal decomposition temperatures of AP in the presence of I wt.%, 3 wt.% and 6 wt.% of as-obtained VO2<B nanobelts were reduced by 39 °C. 62 °C and 74 °C, respectively. The results indicated that VO2(B nanobelts had a great influence on the thermal decomposition temperature of AP Furthermore, the influence of the corresponding V2Os, which was obtained by thermal treatment of VO2(B nanobelts, on the thermal decomposition of AP was also investigated. The resufs showed that VO2(B nanobelts had a greater influence on the thermal decomposition temperature of AP than that of V2Os.

  14. A functional variant in the UBE2B gene promoter is associated with idiopathic azoospermia.

    Science.gov (United States)

    Mou, Lisha; Zhang, Qiang; Diao, Ruiying; Cai, Zhiming; Gui, Yaoting

    2015-07-30

    A variety of genetic variants lead to abnormal human spermatogenesis. The ubiquitin-conjugating enzyme E2B (UBE2B) plays a significant role in spermatogenesis as Ube2b-knockout male mice are infertile. In this study, we sequenced the exon and promoter region of UBE2B in 776 patients diagnosed with idiopathic azoospermia (IA) and 709 proven fertile men to examine whether UBE2B is involved in the pathogenesis of IA. In the exon region, two novel synonymous variants were detected in the patient group. In the promoter region, four known variants and four novel variants were identified in the patient group. Of the novel variants in the promoter region, three were located at the binding site of specificity protein 1 (SP1) transcription factor analyzed by TRANSFAC software. Luciferase assays demonstrated that one heterozygous variant (Chr5.133706925 A > G) inhibited the transcriptional regulation activity of SP1. A novel variant (Chr5.133706925 A > G) residing in the UBE2B gene promoter region confers a high risk for IA in a Chinese population. These results support a role for UBE2B in the pathogenesis of IA.

  15. The A2B adenosine receptor modulates pulmonary hypertension associated with interstitial lung disease.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Zhong, Hongyan; Acero, Luis; Weng, Tingting; Melicoff, Ernestina; West, James D; Hemnes, Anna; Grenz, Almut; Eltzschig, Holger K; Blackwell, Timothy S; Xia, Yang; Johnston, Richard A; Zeng, Dewan; Belardinelli, Luiz; Blackburn, Michael R

    2012-06-01

    Development of pulmonary hypertension is a common and deadly complication of interstitial lung disease. Little is known regarding the cellular and molecular mechanisms that lead to pulmonary hypertension in patients with interstitial lung disease, and effective treatment options are lacking. The purpose of this study was to examine the adenosine 2B receptor (A(2B)R) as a regulator of vascular remodeling and pulmonary hypertension secondary to pulmonary fibrosis. To accomplish this, cellular and molecular changes in vascular remodeling were monitored in mice exposed to bleomycin in conjunction with genetic removal of the A(2B)R or treatment with the A(2B)R antagonist GS-6201. Results demonstrated that GS-6201 treatment or genetic removal of the A(2B)R attenuated vascular remodeling and hypertension in our model. Furthermore, direct A(2B)R activation on vascular cells promoted interleukin-6 and endothelin-1 release. These studies identify a novel mechanism of disease progression to pulmonary hypertension and support the development of A(2B)R antagonists for the treatment of pulmonary hypertension secondary to interstitial lung disease.

  16. DEVELOPMENT OF THE MODIFIED PP/COPOLYPROPYLENE/POE BLENDS FOR AUTOMOBILE BUMPERS%PP/共聚PP/POE汽车保险杠专用料的研制

    Institute of Scientific and Technical Information of China (English)

    唐忠兴; 苏新

    2003-01-01

    研制了PP/共聚PP/聚烯烃弹性体(POE)汽车保险杠专用料,介绍了POE的结构特点,探讨了POE及共聚PP含量对PP力学等性能的影响.结果表明,POE对PP的增韧优于(乙烯/丙烯/二烯)共聚物(EPDM),共聚PP在PP/共聚PP/POE体系中也起到增韧作用,该共混料可以满足汽车保险杠性能的要求.

  17. pp Interaction in Extended Air Showers

    CERN Document Server

    Kohara, A Kendi; Kodama, Takeshi

    2014-01-01

    Applying the recently constructed analytic representation for the pp scattering amplitudes, we present a study of p-air cross sections, with comparison to the data from Extensive Air Shower (EAS) measurements. The amplitudes describe with precision all available accelerator data at ISR, SPS and LHC energies, and its theoretical basis, together with the very smooth energy dependence of parameters controlled by unitarity and dispersion relations, permit reliable extrapolation to higher energies and to asymptotic ranges. The comparison with cosmic ray data is very satisfactory in the whole pp energy interval from 1 to 100 TeV. High energy asymptotic behaviour of cross sections is investigated in view of the geometric scaling property of the amplitudes. The amplitudes predict that the proton does not behave as a black disk even at asymptotically high enegies, and we discuss possible non-trivial consequences of this fact for pA collision cross sections at higher energies.

  18. pp interactions in extended air showers

    Directory of Open Access Journals (Sweden)

    Kendi Kohara A.

    2015-01-01

    Full Text Available Applying the recently constructed analytic representation for the pp scattering amplitudes, we present a study of p-air cross sections, with comparison to the data from Extensive Air Shower (EAS measurements. The amplitudes describe with precision all available accelerator data at ISR, SPS and LHC energies, and its theoretical basis, together with the very smooth energy dependence of parameters controlled by unitarity and dispersion relations, permit reliable extrapolation to higher energies and to asymptotic ranges. The comparison with cosmic ray data is very satisfactory in the whole pp energy interval from 1 to 100 TeV. High energy asymptotic behaviour of cross sections is investigated in view of the geometric scaling property of the amplitudes. The amplitudes predict that the proton does not behave as a black disk even at asymptotically high enegies, and we discuss possible non-trivial consequences of this fact for pA collision cross sections at higher energies.

  19. Vaccination of dogs with canine parvovirus type 2b (CPV-2b) induces neutralising antibody responses to CPV-2a and CPV-2c.

    Science.gov (United States)

    Wilson, Stephen; Illambas, Joanna; Siedek, Elisabeth; Stirling, Catrina; Thomas, Anne; Plevová, Edita; Sture, Gordon; Salt, Jeremy

    2014-09-22

    Since the identification of canine parvovirus type 2, three variants have subsequently been observed differing from the historical CPV-2 and each other by 1-2 amino acids only. As a result there has been considerable research into differential diagnostics, with some researchers indicating there is a need for new vaccines containing different strains of CPV-2. In this study we investigated whether vaccination with a CPV-2b containing vaccine would induce cross-reactive antibody responses to the other CPV-2 variants. Two studies where dogs were vaccinated with a multivalent vaccine, subsequently challenged with CPV-2b and sera samples analysed are presented. Six week old pups with defined serological status were vaccinated twice, three weeks apart and challenged either 5 weeks (MDA override study) or one year after vaccination (duration of immunity study). Sera samples were collected before each vaccination and at periods throughout each study. In each study the antibody profiles were very similar; serological responses against CPV-2a, CPV-2b and CPV-2c were higher than those for CPV-2. Nevertheless, responses against CPV-2 were well above levels considered clinically protective. In each study dogs also showed a rapid increase in antibody titres following vaccination, reached a plateau following second vaccination with a slight decline to challenge after which rapid anamnestic responses were seen. Evaluation of the serological responses suggests vaccination with CPV-2b would cross-protect against CPV-2a and CPV-2c, as well as against CPV-2 which is now extinct in the field. In conclusion we have demonstrated that vaccination of minimum aged dogs with a multivalent vaccine containing the CPV-2b variant strain will induce serological responses which are cross-reactive against all currently circulating field strains, CPV-2a and CPV-2c, and the now extinct field strain CPV-2.

  20. PP: A Lisp Pretty Printing System.

    Science.gov (United States)

    1984-12-01

    level :length :lines :array :radix :circle :case : gensym This function is like PRIN1 except that it does not force ,PRINT-ESCAPE, to be T. The...PRINT-CASE, and ,PRINT- GENSYM , respectively. (’llhe last four of these variables are not supported by release 5 of the I isp Machine System...variables. PP:SET-INTERACTIVE-CONTROL-VARIABLES &key :escape :base :pretty :level :length :lines :array :radix :circle :case : gensym This function specifies

  1. Canonical Formulation of pp-waves

    CERN Document Server

    Balasin, Herbert

    2007-01-01

    We construct a Hamiltonian formulation for the class of plane-fronted gravitational waves with parallel rays (pp-waves). Because of the existence of a light-like Killing vector, the dynamics is effectively reduced to a 2+1 evolution with "time" chosen to be light-like. In spite of the vanishing action this allows us to geometrically identify a symplectic form as well as dynamical Hamiltonian, thus casting the system into canonical form.

  2. $pp$-waves in modified gravity

    CERN Document Server

    Baykal, Ahmet

    2015-01-01

    The family of metrics corresponding to the plane-fronted gravitational waves with parallel propagation, commonly referred to as the family of pp-wave metrics, is studied in the context of various modified gravitational models in a self-contained and coherent manner by using a variant of the null coframe formulation of Newman and Penrose and the exterior algebra of differential forms on pseudo-Riemannian manifolds.

  3. b-flavour tagging in pp collisions

    CERN Multimedia

    Birnkraut, Alex

    2015-01-01

    An essential ingredient of all time-dependent CP violation studies of B mesons is the ability to tag the initial flavour of the B meson. The harsh environment of 7 and 8 TeV pp collisions makes this a particularly difficult enterprise. We report progresses in the flavour tagging of B0 and Bs mesons, including developments of novel techniques like the use of an opposite side charm tagger.

  4. Using service design methods for B2b service brand concept development: Case company

    OpenAIRE

    Molina Escalante, Hugo

    2014-01-01

    A short time before this study was initiated, a small B2b service company had just began op-erating its business without a brand of it’s own. The company owners were looking to design an innovative brand for their business. The purpose of this thesis was to develop the brand for this service Company in the B2b context, using practical service design and Strategic design research methods. This thesis report represents a framework for developing a B2b service brand using research methods c...

  5. Sustained major molecular response on interferon alpha-2b in two patients with polycythemia vera

    DEFF Research Database (Denmark)

    Larsen, Thomas Stauffer; Bjerrum, O W; Pallisgaard, N

    2008-01-01

    chromosome negative chronic myeloproliferative disorders. Reductions in the JAK2 V617F allele burden in patients treated with pegylated interferon alpha-2a (Peg-IFN-2a) have been demonstrated, although follow-up was relatively short. We report here the first profound and sustained molecular responses...... with a JAK2 V617F allele burden below 1.0% in two patients with polycythemia vera treated with interferon alpha-2b (IFN-2b). Discontinuation of IFN-2b in one of the patients was followed by a sustained long-lasting (12 months of follow-up) major molecular response....

  6. I2B is a small cytosolic protein that participates in vacuole fusion

    OpenAIRE

    1997-01-01

    Saccharomyces cerevisiae vacuole inheritance requires two low molecular weight activities, LMA1 and LMA2. LMA1 is a heterodimer of thioredoxin and protease B inhibitor 2 (I2B). Here we show that the second low molecular weight activity (LMA2) is monomeric I2B. Though LMA2/I2B was initially identified as a protease B inhibitor, this protease inhibitor activity is not related to its ability to promote vacuole fusion: (i) Low Mr protease B inhibitors cannot substitute for LMA1 or LMA 2, (ii) LMA...

  7. The U2B'' RNP motif as a site of protein-protein interaction.

    OpenAIRE

    Scherly, D; Dathan, N A; Boelens, W; van Venrooij, W J; Mattaj, I W

    1990-01-01

    The U2 snRNP contains two specific proteins, U2B'' and U2A'. Neither of these proteins, on its own, is capable of specific interactions with U2 RNA. Here, a complex between U2B'' and U2A' that forms in the absence of RNA is identified. Analysis of mutant forms of U2B'' shows that the smallest fragment able to bind specifically U2 RNA (amino acids 1-88) is also the minimal region required for complex formation with U2A', and implies that this region must be largely structurally intact for U2A'...

  8. volBrain: an online MRI brain volumetry system

    Directory of Open Access Journals (Sweden)

    Jose V. Manjon

    2016-07-01

    Full Text Available The amount of medical image data produced in clinical and research settings is rapidly growing resulting in vast amount of data to analyze. Automatic and reliable quantitative analysis tools, including segmentation, allow to analyze brain development and to understand specific patterns of many neurological diseases. This field has recently experienced many advances with successful techniques based on non-linear warping and label fusion. In this work we present a novel and fully automatic pipeline for volumetric brain analysis based on multi-atlas label fusion technology that is able to provide accurate volumetric information at different levels of detail in a short time. This method is available through the volBrain online web interface (http://volbrain.upv.es, which is publically and freely accessible to the scientific community. Our new framework has been compared with current state-of-the-art methods showing very competitive results.

  9. Componentes volátiles de mamey (mammea americana L.

    Directory of Open Access Journals (Sweden)

    Alicia Lucía Morales

    2010-07-01

    Full Text Available Los componentes volátiles del aroma de mamey (Mammea americana L, fueron extraídos utilizando el método de destilación por arrastre con vapor-extracción simultánea con solvente orgánico. El extracto fue prefraccionado por cromatografía en columna en silica gel con gradiente discontinuo Pentano: Éter etílico para obtener tres fracciones que fueron analizadas por CGAR y CGAR-EM. Se detectaron 34 compuestos, de los cuales fueron identificados 22, siendo los componentes mayoritarios: Furfural (7281 ^ig/kg y E-Famesol (2145 ng/kg

  10. String Theory on Parallelizable PP-Waves

    Energy Technology Data Exchange (ETDEWEB)

    Sadri, Darius J

    2003-05-05

    The most general parallelizable pp-wave backgrounds which are non-dilatonic solutions in the NS-NS sector of type IIA and IIB string theories are considered. We demonstrate that parallelizable pp-wave backgrounds are necessarily homogeneous plane-waves, and that a large class of homogeneous plane-waves are parallelizable, stating the necessary conditions. Such plane-waves can be classified according to the number of preserved supersymmetries. In type IIA, these include backgrounds preserving 16, 18, 20, 22 and 24 supercharges, while in the IIB case they preserve 16, 20, 24 or 28 supercharges. An intriguing property of parallelizable pp-wave backgrounds is that the bosonic part of these solutions are invariant under T-duality, while the number of supercharges might change under T-duality. Due to their {alpha}{prime} exactness, they provide interesting backgrounds for studying string theory. Quantization of string modes, their compactification and behavior under T-duality are studied. In addition, we consider BPS Dp-branes, and show that these Dp-branes can be classified in terms of the locations of their world volumes with respect to the background H-field.

  11. String Theory on Parallelizable PP-waves

    CERN Document Server

    Sadri, D; Sadri, Darius; Sheikh-Jabbari, Mohammad M.

    2003-01-01

    The most general parallelizable pp-wave backgrounds which are non-dilatonic solutions in the NS-NS sector of type IIA and IIB string theories are considered. We demonstrate that parallelizable pp-wave backgrounds are necessarily homogeneous plane-waves, and that a large class of homogeneous plane-waves are parallelizable, stating the necessary conditions. Such plane-waves can be classified according to the number of preserved supersymmetries. In type IIA, these include backgrounds preserving 16, 18, 20, 22 and 24 supercharges, while in the IIB case they preserve 16, 20, 24 or 28 supercharges. An intriguing property of parallelizable pp-wave backgrounds is that the bosonic part of these solutions are invariant under T-duality, while the number of supercharges might change under T-duality. Due to their $\\alpha^\\prime$ exactness, they provide interesting backgrounds for studying string theory. Quantization of string modes, their compactification and behaviour under T-duality are studied. In addition, we consider...

  12. Characterization of the morphology of iPP/sPP blends with various compositions

    Directory of Open Access Journals (Sweden)

    S. Bourbigot

    2013-03-01

    Full Text Available The paper investigates the morphology and the structural properties of blends of isotactic polypropylene (iPP and syndiotactic polypropylene (sPP having different compositions using different techniques. Solid-state nuclear magnetic resonance (NMR permits via appropriate sequence to measure the composition, conformation and dynamics, and intimacy of mixing of polymeric materials. Measurement of relaxation times gives information on local structure of phases with different mobility. The morphology is directly related to the structural organization of the blends. The crystallization rate decreases as a function of the sPP content. The minor component is dispersed as a nodule in the main component of the blend and it plays the role of nucleating agent on it. Besides, morphology changes occur for the composition 50/50 (wt/wt of the blend iPP/sPP. Different phases are identified, namely free amorphous, constrained amorphous and crystalline regions which exhibit different molecular mobilities. It is also shown at the interphase matrix-nodules, the nodules create a constrained amorphous zone.

  13. Project Description Advanced Fuel Cycle Initiative AFC-2A and AFC-2B Experiments

    Energy Technology Data Exchange (ETDEWEB)

    AFCI AFC-2A and AFC-2B Experiments Project Executi

    2007-03-01

    The proposed AFC-2A and AFC-2B irradiation experiments are a continuation of the AFC-1 fuel test series currently in progress in the ATR. This document discusses the experiments and the planned activities that will take place.

  14. High performance of solvothermally prepared VO2(B as anode for aqueous rechargeable lithium batteries

    Directory of Open Access Journals (Sweden)

    Milošević Sanja

    2015-01-01

    Full Text Available The VO2 (B was synthesized via a simple solvothermal route at 160oC in ethanol. The initial discharge capacity of VO2 (B anode, in saturated aqueous solution of LiNO3, was 177 mAh g-1 at a current rate of 50 mA g-1. After 50 cycles capacity fade was 4%, but from 20th-50th cycle no capacity drop was observed. The VO2 (B has shown very good cyclability at current rate of even 1000 mA g-1 with initial discharge capacity of 92 mAh g-1. The excellent electrochemical performance of VO2 (B was attributed to the stability of micro-nano structures to repeated intercalation /deintercalation process, very good electronic conductivity as well as the very low charge transfer resistance in the aqueous electrolyte. [Projekat Ministarstva nauke Republike Srbije, br. III45014

  15. Managing Innovation Through Social Media in B2B SME-Context

    DEFF Research Database (Denmark)

    Lutz, Salla; Madsen, Svend Ole; Brink, Tove

    2015-01-01

    This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business model...... innovation. However, social media application is hindered due to lack of specific local knowledge, lack of knowledge on social media technicalities and bewilderedness on leadership approaches within the social media application. A contribution is hereby made to the B2B SME field, to the academic...... understanding an insight on social media application and open business model innovation....

  16. Data of evolutionary structure change: 1DJ2B-1ADIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DJ2B-1ADIA 1DJ2 1ADI B A IGSLSQVSGVLGCQWGDEGKGKLVDILAQHFDIVARCQG...LLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADI...5 PHE CA 263 LYS CA 227 TYR CA 251 1ADI... A 1ADIA 1 1ADI A 1ADI

  17. Targeted Deletion of Titin N2B Region Leads to Diastolic Dysfunction and Cardiac Atrophy

    National Research Council Canada - National Science Library

    Michael H. Radke; Jun Peng; Yiming Wu; Mark McNabb; O. Lynne Nelson; Henk Granzier; Michael Gotthardt

    2007-01-01

    .... Cardiac titin contains a unique N2B region, which has been proposed to modulate elasticity of the titin filament and to be important for hypertrophy signaling and the ischemic stress response through...

  18. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2014

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Crane Creek are described in this report. Water-Data Report 2013 413721083124001 Pool 2B at Ottawa NWR...

  19. Data of evolutionary structure change: 1AW2B-2VENA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AW2B-2VENA 1AW2 2VEN B A --RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDV...RQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEK-SEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAE...ine> 2VEN A 2VENA1 2VEN A 2VENA... A 2VENA YEPVW-----KVATP

  20. B2B SME Management of Antecedents to the Application of Social Media

    DEFF Research Database (Denmark)

    Brink, Tove

    2017-01-01

    2013 to October 2014, with follow-up interviews in October 2015. The findings reveal two important antecedents to the application of social media that overcome the gap between acknowledging the usefulness of social media and its actual limited application in practical B2B contexts. First, open...... application stages and the gaps between them identified in the previous literature. The developed model makes a contribution to the B2B SME field and to academia by recognising the importance of integrating critical antecedents before social media application can enhance business in B2B SMEs......This paper elucidates how business-to-business (B2B) small and medium-sized enterprises (SMEs) can manage antecedents to the application of social media for potential contributions to their business. This in-depth qualitative research study was conducted at four plastic-producing SMEs from October...

  1. Thermoluminescence characteristics of gamma irradiated Li2B4O7:Cu nanophosphor

    Science.gov (United States)

    Chopra, Vibha; Singh, Lakhwant; Lochab, S. P.

    2013-07-01

    Nanocrystals of the Li2B4O7:Cu were synthesized by the combustion method using different concentrations of Cu. X-ray diffraction (XRD) spectra and transmission electron microscopy (TEM) image confirm the nanometric size of synthesized material. The thermal stability of phosphor was obtained by thermogravimetric analysis (TGA). TL characteristics of the synthesized Li2B4O7:Cu material doped with Cu of concentrations 1000 ppm and 2500 ppm were studied. It is observed that Li2B4O7:Cu doped with Cu (both 1000 ppm and 2500 ppm) exhibit a linear response in the range 1×100-5×103 Gy of gamma radiations. Finally the trapping parameters associated with the glow peaks were calculated using the glow curve deconvolution (GCD) glow fit method. Fading and reproducibility of phosphors were also studied and it was found that the Li2B4O7:Cu is quite suitable for radiation dosimetry.

  2. Boriding kinetics of Fe2B layers formed on AISI 1045 steel

    Directory of Open Access Journals (Sweden)

    Zuno-Silva J.

    2014-01-01

    Full Text Available In the present work, a diffusion model was suggested to study the growth kinetics of Fe2B layers grown on the AISI 1045 steel by the pack-boriding treatment. The generated boride layers were analyzed by optical microscopy and X-ray diffraction analysis. The applied diffusion model is based on the principle of mass conservation at the (Fe2B/ substrate interface. It was used to estimate the boron diffusion coefficients of Fe2B in the temperature range of 1123-1273 K. A validation of the model was also made by comparing the experimental Fe2B layer thickness obtained at 1253 K for 5 h of treatment with the predicted value. Basing on our experimental results, the boron activation energy was estimated as 180 kJ mol-1 for the AISI 1045 steel.

  3. A simple method for quantification of interferon-α2b through surface ...

    African Journals Online (AJOL)

    USER

    2010-03-15

    Mar 15, 2010 ... 2Department of Process and Food Engineering, Faculty of ... interferon-α2b and anti-interferon monoclonal antibody was predominantly controlled by mass transfer ..... resonance characterization of drug/liposome interactions.

  4. Data of evolutionary structure change: 3EK2B-3FNFB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 6833343506 EVID> 3 3FNF EVID> 4 3FNF B 3FNF...EVID>EVID> 5 3FNF...3EK2B-3FNFB 3EK2 3FNF B B MGFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTY...VGDRFKDRITEFAAEFGSE-LVFPCDVADDAQIDALFASLKTHWD---SLDGLVHSIGFAPREAIAG-DFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLL

  5. Cytomegalovirus pp65 limits dissemination but is dispensable for persistence

    Energy Technology Data Exchange (ETDEWEB)

    Malouli, Daniel; Hansen, Scott G.; Nakayasu, Ernesto S.; Marshall, Emily E.; Hughes, Colette M.; Ventura, Abigail B.; Gilbride, Roxanne M.; Lewis, Matthew S.; Xu, Guangwu; Kreklywich, Craig; Whizin, Nathan; Fischer, Miranda; Legasse, Alfred W.; Viswanathan, Kasinath; Siess, Don; Camp, David G.; Axthelm, Michael K.; Kahl, Christoph; DeFilippis, Victor R.; Smith, Richard D.; Streblow, Daniel N.; Picker, Louis J.; Früh, Klaus

    2014-04-01

    The tegument phosphoprotein pp65 (UL83) is the most abundant virion protein in human cytomegalovirus (HCMV). Since pp65 is immunodominant in persistently infected individuals, subunit vaccines against HCMV often include pp65 as T cell stimulatory component. Although HCMV pp65 is non-essential for viral growth in vitro it is thought to have an important role in primary and persistent infection since pp65 displays multiple immunomodulatory functions. To determine whether pp65 is required for infection and to evaluate its role in natural and vaccination-induced immunity we generated a rhesus CMV lacking both homologues, pp65a (Rh111) and pp65b (Rh112). Lack of pp65 resulted in a slight growth defect in vitro and an increase of defective particle formation. However, most pp65-deleted virions in the supernatant were phenotypically normal and proteomics analysis revealed that the ratios of the remaining viral proteins were largely unchanged. RhCMV Δpp65ab was able to persistently infect CMV-negative rhesus macaques (RM) and to super-infect RM previously infected with CMV. To determine whether T cells against pp65 are essential for protection against CMV, we challenged Δpp65ab-infected animals with RhCMV ΔUS2-11, a viral recombinant that lacks inhibitors of MHC-I antigen presentation and is thus unable to overcome CMV-specific T cell immunity. Despite a complete lack of pp65-specific T cells, Δpp65ab protected against ΔUS2-11 challenge suggesting that pp65-specific T cells are not essential for T cell immunity against CMV. Using the same approach we further demonstrate that pp65b-specific T cells, induced by heterologous prime/boost vaccination, are not sufficient to protect against ΔUS2-11 challenge. Our data provides a new approach to test the efficacy of subunit vaccine candidates and suggest that pp65 vaccines are insufficient to induce a T cell response that recapitulates the protective effect of natural infection.

  6. Drivers of relationships affecting B2B firms in an e-commerce environment

    Directory of Open Access Journals (Sweden)

    Irene Samanta

    2014-09-01

    Full Text Available The advent of the internet has created numerous opportunities for B2B marketing professionals to enhance current marketing practices, including electronic relationships. However, the investigation of e-relationships and the factors that influence e-relationships in an internet environment is scant. Further, there appears to be no investigation of this phenomenon within the context of Greek B2B Medium-sized firms (MSF. Τhe research problem investigated in this research is: “Which drivers in B2B e-commerce use affect inter-firm relationships in medium-sized B2B firms?”. A framework for B2B e-commerce relationships in a changing and globalized environment was synthesised and integrated with the literature about relationship marketing to arrive at the following research issues: “How do relationship marketing drivers affect the management of B2B e-relationships?”. An explanatory quantitative research approach was used and quantitative data was collected from B2B firms in Greece, which represents a case of e-commerce progress during the last six years. Regarding social exchange, some important differences emerge where cooperation between B2B e-commerce firms is concerned. Suppliers engaged in electronic commerce are more committed and oriented to a long-term relationship than buyers, based on both previous and current experience with them. Confidence in the relationships, consistency and honesty with their obligations and the exchange of reliable, trustworthy information and advisory services between firms are important factors in the development and establishment of their e-relationships. The main contribution of this research is the development of a theoretical framework for e-relationships in medium-sized Β2Β firms. That framework is the first rigorously researched step towards understanding the importance of these powerful streams of relationship drivers in total, and the business activity of e-marketing and electronic relationships.

  7. Framing agenda for business model innovation research from the B2B context

    OpenAIRE

    Neupane, Ganesh Prasad; Haugland, Sven A.

    2016-01-01

    This paper reviews the literature on business models in the business-to-business (B2B) context and proposes a research agenda that can be explored by future studies using various management and organizational theories. We outline four research themes and seven research topics for research on business model innovations in the B2B context. Further studies on these topics can make significant contributions to the business model literature.

  8. An analysis of Common Missile and TOW 2B using the Janus combat simulation

    OpenAIRE

    2002-01-01

    Approved for public release; distribution is unlimited. The US Army is currently developing a new close combat missile system, Common Missile, to replace the aging Tubelaunched, Optically-tracked, Wire-guided (TOW 2B) and HELLFIRE missile systems. The Common Missile will have a greater range and improved target acquisition capability over the current missile systems. The purpose of this thesis is to compare the performance of the Common Missile and the TOW 2B missile in a simulated ground ...

  9. Viroporin Activity of the Foot-and-Mouth Disease Virus Non-Structural 2B Protein.

    Directory of Open Access Journals (Sweden)

    Da Ao

    Full Text Available Viroporins are a family of low-molecular-weight hydrophobic transmembrane proteins that are encoded by various animal viruses. Viroporins form transmembrane pores in host cells via oligomerization, thereby destroying cellular homeostasis and inducing cytopathy for virus replication and virion release. Among the Picornaviridae family of viruses, the 2B protein encoded by enteroviruses is well understood, whereas the viroporin activity of the 2B protein encoded by the foot-and-mouth disease virus (FMDV has not yet been described. An analysis of the FMDV 2B protein domains by computer-aided programs conducted in this study revealed that this protein may contain two transmembrane regions. Further biochemical, biophysical and functional studies revealed that the protein possesses a number of features typical of a viroporin when it is overexpressed in bacterial and mammalian cells as well as in FMDV-infected cells. The protein was found to be mainly localized in the endoplasmic reticulum (ER, with both the N- and C-terminal domains stretched into the cytosol. It exhibited cytotoxicity in Escherichia coli, which attenuated 2B protein expression. The release of virions from cells infected with FMDV was inhibited by amantadine, a viroporin inhibitor. The 2B protein monomers interacted with each other to form both intracellular and extracellular oligomers. The Ca(2+ concentration in the cells increased, and the integrity of the cytoplasmic membrane was disrupted in cells that expressed the 2B protein. Moreover, the 2B protein induced intense autophagy in host cells. All of the results of this study demonstrate that the FMDV 2B protein has properties that are also found in other viroporins and may be involved in the infection mechanism of FMDV.

  10. Studies on the properties of rice-husk-filled-PP composites: effect of maleated PP

    Directory of Open Access Journals (Sweden)

    Simone Maria Leal Rosa

    2009-09-01

    Full Text Available Rice husk is a by-product of rice milling process that usually finds inadequate final disposal (burning, land filling. Thermoplastics composites filled with rice husk flour are materials that offer an alternative for using this agricultural resource viewing the production of low dense materials with some specific properties. In this work composites of polypropylene (PP and rice husk flour (RHF were prepared by melt extrusion. Maleic anhydride-modified PP (MAPP was added as a coupling agent. It was verified that tensile strength decreased with filler loading. The presence of MAPP improved this property showing a strong dependence on the MAPP/RHF ratio (MAPP/RHF = 0.03 produced the best results. The density of the composites slightly increased with filler and coupling agent in comparison to pure PP. The presence of MAPP diminished more than 20% water uptake in highly-loaded composites.

  11. Isothermal Crystallization Kinetics of Dynamically Cured PP/MAH-g-PP/Epoxy Blends%动态固化PP/MAH-g-PP/EP共混物的等温结晶动力学

    Institute of Scientific and Technical Information of China (English)

    江学良; 张隐西

    2009-01-01

    分别用Avrami方程和Hoffman结晶理论研究了马来酸酐接枝聚丙烯(MAH-g-PP)增容的动态固化聚丙烯(PP)/环氧树脂(EP)共混物中PP等温结晶动力学.实验结果表明,动态固化PP/MAH-g-PP/EP共混物中环氧颗粒可作为PP的成核剂,能显著促进PP的结晶.根据Avrami方程,动态固化PP/MAH-g-PP/EP共混物中PP的结晶速率常数K(T) 明显大于纯PP的K(T).依据Hoffman理论研究动态固化PP/MAH-g-PP/EP共混物结晶热动力学,动态固化PP/MAH-g-PP/EP共混物折叠链表面自由能(σe)明显小于PP折叠链表面自由能(σe).

  12. Diagnostic and therapeutic approach to multiple endocrine neoplasia type 2B in pediatric patients.

    Science.gov (United States)

    Torre, M; Martucciello, G; Ceccherini, I; Lerone, M; Aicardi, M; Gambini, C; Jasonni, V

    2002-09-01

    Multiple endocrine neoplasia (MEN) 2B is a hereditary syndrome including medullary thyroid carcinoma (MTC), pheochromocytoma, gastrointestinal (GI) disorders, marfanoid facies, and multiple ganglioneuromas. MTC is the major cause of mortality, and often appears during the 1st decade of life. RET proto-oncogene mutations are responsible for MEN 2B. Other RET mutations cause MEN 2A syndrome, familial MTC, or Hirschsprung's disease. We studied three MEN 2B patients with the aim of delineating the best diagnostic and therapeutic protocol. The gold standards for diagnosis are histochemical study of the rectal mucosa and molecular analysis of RET, which in familial cases detects MEN 2B at a preclinical stage so that early total prophylactic thyroidectomy can be performed. In non-familial cases, the diagnosis can be suggested by the presence of GI symptoms, ganglioneuromas, and/or the typical facies. The intestinal innervation pattern, analyzed with the acetylcholinesterase technique, is pathognomonic for MEN 2B. In our protocol a rectal biopsy is, therefore, the first measure. The surgical treatment of MEN 2B is total thyroidectomy with cervical lymphadenectomy of the central compartment of the neck. When possible, this intervention should be performed prophylactically before 1 year of age.

  13. [Prooxidant and cytotoxic action of N-acetylcysteine and glutathione combined with vitamin Bl2b].

    Science.gov (United States)

    Solov'eva, M E; Solov'ev, V V; Faskhutdinova, A A; Kudriavtsev, A A; Akatov, V S

    2007-01-01

    We studied the prooxidant and cytotoxic action of thiols N-acetylcystein (NAC) and glutathione (GSH) combined with vitamin Bl2b. The synergism of action of the thiols and Bl2b resulted in human carcinoma cell damage was found. It was shown that GSH and NAC in physiological doses combined with Bl2b caused the initiation of apoptosis. It was established that prooxidant action of the thiols combined with vitamin Bl2b, i. e. generation and accumulation of hydrogen peroxide in culture medium, led to intracellular oxidative stress and injury of cell redox system. These effects were completely abolished by nonthiol antioxidants catalase and pyruvate. The chelators of iron phenanthroline and deferoxamine did not suppress the H2O2 accumulation in culture medium but significantly inhibited the cell death induced by the thiols combined with Bl2b. Therefore, the thiols GSH and NAC widely used as antioxidants, in combination with vitamin Bl2b show prooxidant characteristics and induce, with the participation of intracellular iron, apoptotic HEp-2 cell death.

  14. Sperm nuclear histone H2B: correlation with sperm DNA denaturation and DNA stainability

    Institute of Scientific and Technical Information of China (English)

    Armand Zini; Xiaoyang Zhang; Maria San Gabriel

    2008-01-01

    Aim: To examine the relationship between sperm DNA damage and sperm nuclear histone (H2B) staining. Methods:We evaluated sperm samples from 14 consecutive asthenoteratozoospermic infertile men and six consecutive fertile controls. Sperm nuclear histone (H2B) staining and sperm chromatin integrity (assessed by sperm chromatin structure assay and expressed using the percentage of (I) DNA fragmentation index [%DFI] and (ii) high DNA stainability [%HDS)]) were evaluated. Results: Histone H2B immunocytochemistry demonstrated two nuclear staining patterns: (I) focal punctate staining; and (ii) diffuse staining. Infertile men had a higher mean percentage of spermatozoa exhibiting diffuse H2B staining than did fertile men (7.7% ± 4.6% vs. 1.6% ± 1.2%, respectively, P < 0.01). We observed significant relationships between the proportion of spermatozoa with diffuse nuclear histone staining and both sperm %DFI (r= 0.63, P < 0.01) and sperm %HDS (r= 0.63, P < 0.01). Conclusion: The data demonstrate that infertile men have a higher proportion of spermatozoa with diffuse histone H2B than do fertile men and suggest that sperm DNA damage might, at least in part, be due to abnormally high histone H2B levels.

  15. Itga2b regulation at the onset of definitive hematopoiesis and commitment to differentiation.

    Directory of Open Access Journals (Sweden)

    Stephanie Dumon

    Full Text Available Product of the Itga2b gene, CD41 contributes to hematopoietic stem cell (HSC and megakaryocyte/platelet functions. CD41 expression marks the onset of definitive hematopoiesis in the embryo where it participates in regulating the numbers of multipotential progenitors. Key to platelet aggregation, CD41 expression also characterises their precursor, the megakaryocyte, and is specifically up regulated during megakaryopoiesis. Though phenotypically unique, megakaryocytes and HSC share numerous features, including key transcription factors, which could indicate common sub-regulatory networks. In these respects, Itga2b can serve as a paradigm to study features of both developmental-stage and HSC- versus megakaryocyte-specific regulations. By comparing different cellular contexts, we highlight a mechanism by which internal promoters participate in Itga2b regulation. A developmental process connects epigenetic regulation and promoter switching leading to CD41 expression in HSC. Interestingly, a similar process can be observed at the Mpl locus, which codes for another receptor that defines both HSC and megakaryocyte identities. Our study shows that Itga2b expression is controlled by lineage-specific networks and associates with H4K8ac in megakaryocyte or H3K27me3 in the multipotential hematopoietic cell line HPC7. Correlating with the decrease in H3K27me3 at the Itga2b Iocus, we find that following commitment to megakaryocyte differentiation, the H3K27 demethylase Jmjd3 up-regulation influences both Itga2b and Mpl expression.

  16. Magnetic properties of ball-milled TbFe2 and TbFe2B

    Indian Academy of Sciences (India)

    J Arout Chelvane; S Kasiviswanathan; M V Rao; G Markandeyulu

    2004-04-01

    The magnetic properties of ball-milled TbFe2 and TbFe2B were studied by magnetization measurements. X-ray diffraction studies on TbFe2B showed that boron occupied interstitial position in the crystal structure, just as hydrogen did. The value of the saturation magnetization of TbFe2B was found to be smaller than that of TbFe2. This is explained on the basis of a charge transfer between the boron atoms and the 3d band of Fe. The anisotropy of TbFe2B was found to be large compared to that of TbFe2. X-ray diffractograms for the ball milled samples showed that after 80 h of milling, a predominantly amorphous phase was obtained. TbFe2B was found to undergo easy amorphization compared to TbFe2. Magnetization of TbFe2 was found to decrease rapidly with initial milling hours and was found to be constant with further hours of milling. TbFe2B exhibited an anomalous behaviour with an increase in moment with milling hours and this may be due to the segregation of -Fe.

  17. Deletion of ADORA2B from myeloid cells dampens lung fibrosis and pulmonary hypertension.

    Science.gov (United States)

    Karmouty-Quintana, Harry; Philip, Kemly; Acero, Luis F; Chen, Ning-Yuan; Weng, Tingting; Molina, Jose G; Luo, Fayong; Davies, Jonathan; Le, Ngoc-Bao; Bunge, Isabelle; Volcik, Kelly A; Le, Thanh-Thuy T; Johnston, Richard A; Xia, Yang; Eltzschig, Holger K; Blackburn, Michael R

    2015-01-01

    Idiopathic pulmonary fibrosis (IPF) is a lethal, fibroproliferative disease. Pulmonary hypertension (PH) can develop secondary to IPF and increase mortality. Alternatively, activated macrophages (AAMs) contribute to the pathogenesis of both IPF and PH. Here we hypothesized that adenosine signaling through the ADORA2B on AAMs impacts the progression of these disorders and that conditional deletion of ADORA2B on myeloid cells would have a beneficial effect in a model of these diseases. Conditional knockout mice lacking ADORA2B on myeloid cells (Adora2B(f/f)-LysM(Cre)) were exposed to the fibrotic agent bleomycin (BLM; 0.035 U/g body weight, i.p.). At 14, 17, 21, 25, or 33 d after exposure, SpO2, bronchoalveolar lavage fluid (BALF), and histologic analyses were performed. On day 33, lung function and cardiovascular analyses were determined. Markers for AAM and mediators of fibrosis and PH were assessed. Adora2B(f/f)-LysM(Cre) mice presented with attenuated fibrosis, improved lung function, and no evidence of PH compared with control mice exposed to BLM. These findings were accompanied by reduced expression of CD206 and arginase-1, markers for AAMs. A 10-fold reduction in IL-6 and a 5-fold decrease in hyaluronan, both linked to lung fibrosis and PH, were also observed. These data suggest that activation of the ADORA2B on macrophages plays an active role in the pathogenesis of lung fibrosis and PH.

  18. Nuclear Slope Parameter Of pp and (-p)p Elastic Scattering in QCD Inspired Model

    Institute of Scientific and Technical Information of China (English)

    MA Shan-Jun; LU Juan; LU Hai-Liang; MA Wei-Xing; FAN Hong-Yi; HE Xiao-Rong

    2008-01-01

    Based on the quaxk-gluon structure of nucleon and the possible existence of Odderon in strong interaction process due to gluon self-interaction, the elastic scatterings of pp and pp at high energies axe studied. The contributions from individual terms of quark-quark, gluon-gluon interactions, quaxk-gluon interference, and the Odderon terms to the nuclear slope parameter B(s) are analyzed. Our results show that the QCD inspired model gives a good fit to the LHC experimental data of the nucleax slope parameter.

  19. Competency-orientated brand cooperations of power supply companies in the B2B sector; Kompetenzorientierte Markenkooperationen von Energieversorgungsunternehmen im B2B-Kundenbereich

    Energy Technology Data Exchange (ETDEWEB)

    Peuser, M.M.

    2008-07-01

    On the basis of an extensive empirical study with B2B electricity users, the author of the book under consideration examines brand co-operations of power supply companies with companies not working in the area of energy production. Based on the view of various co-operation alternatives, impact relations and success-determining factors of influence in the area of B2B customers are identified. The term of the authority of an energy brand is discussed. Beside this, profiles of concrete brands of current power supply companies from the view of B2B customers are pointed out, and recommendations for the organization of brand co-operation and the structure of mark authority in practice are shown. This contribution is written for lecturers and students of the management economics with the emphasis of marketing and management as well as high-level personnel in the energy industry, who wants to develop strong mark authority by brand co-operation.

  20. Heat and charge transport in YNi{sub 2}B{sub 2}C and HoNi{sub 2}B{sub 2}C single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, M; Gladun, A; Kreyssig, A [Institut fuer Festkoerperphysik, Technische Universitaet Dresden, D-01062 Dresden (Germany); Wosnitza, J [Hochfeld-Magnetlabor Dresden (HLD), Forschungszentrum Dresden-Rossendorf, D-01314 Dresden (Germany); Petzold, V; Rosner, H [Max-Planck-Institut fuer Chemische Physik fester Stoffe, D-01187 Dresden (Germany); Behr, G; Souptel, D; Mueller, K-H; Drechsler, S-L; Fuchs, G [Leibniz-Institut fuer Festkoerper- und Werkstoffforschung Dresden (IFW), D-01171 Dresden (Germany)], E-mail: M.Schneider@ifw-dresden.de, E-mail: G.Fuchs@ifw-dresden.de

    2008-04-30

    For a systematic investigation of the heat- and charge-transport properties of YNi{sub 2}B{sub 2}C and HoNi{sub 2}B{sub 2}C, single-crystal measurements of the electrical resistivity, the thermal conductivity, and the thermoelectric power were performed on the same samples. For HoNi{sub 2}B{sub 2}C, a local maximum of the Lorenz number at 20 K is evidently connected with the occurrence of magnetic fluctuations well above the ordering temperature. For the in-plane thermal conductivity, a kink near the superconducting transition was observed, consistent with an anisotropic gap or a multiband description. For both investigated borocarbides, the electrical resistance is isotropic. In contrast, the thermal conductivity shows a pronounced anisotropy. The thermoelectric power exhibits a minor anisotropy and can be well described by electron-diffusion and phonon-drag contributions over a wide temperature range. Based on an analysis of full-potential local-orbital calculations, a strong influence of the boron z position on the thermoelectric power has been revealed.

  1. PP-O and PP-V, Monascus pigment homologues, production, and phylogenetic analysis in Penicillium purpurogenum.

    Science.gov (United States)

    Arai, Teppei; Kojima, Ryo; Motegi, Yoshiki; Kato, Jun; Kasumi, Takafumi; Ogihara, Jun

    2015-12-01

    The production of pigments as secondary metabolites by microbes is known to vary by species and by physiological conditions within a single strain. The fungus strain Penicillium purpurogenum IAM15392 has been found to produce violet pigment (PP-V) and orange pigment (PP-O),Monascus azaphilone pigment homologues, when grown under specific culture conditions. In this study, we analysed PP-V and PP-O production capability in seven strains of P. purpurogenum in addition to strain IAM15392 under specific culture conditions. The pigment production pattern of five strains cultivated in PP-V production medium was similar to that of strain IAM15392, and all violet pigments produced by these five strains were confirmed to be PP-V. Strains that did not produce pigment were also identified. In addition, two strains cultivated in PP-O production medium produced a violet pigment identified as PP-V. The ribosomal DNA (rDNA) internal transcribed spacer (ITS) region sequences from the eight P. purpurogenum strains were sequenced and used to construct a neighbor-joining phylogenetic tree. PP-O and PP-V production of P. purpurogenum was shown to be related to phylogenetic placement based on rDNA ITS sequence. Based on these results, two hypotheses for the alteration of pigment production of P. purpurogenum in evolution were proposed.

  2. Research on Game Theory of C2B Platform for Recycling%C2B 平台竞价回收博弈研究

    Institute of Scientific and Technical Information of China (English)

    李春发; 刘一非; 王帅

    2016-01-01

    C2B 网络回收平台的竞价回收机制决定了众多回收商之间存在着激烈的竞争,每个网络回收商的回收量不仅取决于自己的回收价格,还取决于其他网络回收商的回收价格。期望利润最大化是每个网络回收商的竞争目标。运用最优化理论与非合作博弈理论证明 C2B 平台竞价回收博弈存在唯一的 Nash 均衡。在完全竞争与串谋合作的不同情况中发现,完全竞争情况下 Nash 均衡的网络回收价格高于串谋合作下的网络回收价格,并通过数值仿真进行验证。%Many recyclers recycle waste products or used fine products and remanufacture for profit in C2B network plat-form.Since the auction collection mechanism of C2B network platform determines there is a fierce competition among the many recyclers,the recycling number of waste products depends on the cost of recycling itself,but also the price of compet-itors.Expected profit maximization is the objective of each network recycler.Firstly the paper studied the operation of the C2B network platform,and proved the bidding games fit the supermodel game by using the theory of optimum and non -co-operative game theory,and the existence of Nash equilibrium.In perfect competition and collusion cooperation cases,we found the recycling price is higher than the conspiracy cooperation network cost under Nash equilibrium,which is verified by using the method of numerical simulation.

  3. An i2b2-based, generalizable, open source, self-scaling chronic disease registry.

    Science.gov (United States)

    Natter, Marc D; Quan, Justin; Ortiz, David M; Bousvaros, Athos; Ilowite, Norman T; Inman, Christi J; Marsolo, Keith; McMurry, Andrew J; Sandborg, Christy I; Schanberg, Laura E; Wallace, Carol A; Warren, Robert W; Weber, Griffin M; Mandl, Kenneth D

    2013-01-01

    Registries are a well-established mechanism for obtaining high quality, disease-specific data, but are often highly project-specific in their design, implementation, and policies for data use. In contrast to the conventional model of centralized data contribution, warehousing, and control, we design a self-scaling registry technology for collaborative data sharing, based upon the widely adopted Integrating Biology & the Bedside (i2b2) data warehousing framework and the Shared Health Research Information Network (SHRINE) peer-to-peer networking software. Focusing our design around creation of a scalable solution for collaboration within multi-site disease registries, we leverage the i2b2 and SHRINE open source software to create a modular, ontology-based, federated infrastructure that provides research investigators full ownership and access to their contributed data while supporting permissioned yet robust data sharing. We accomplish these objectives via web services supporting peer-group overlays, group-aware data aggregation, and administrative functions. The 56-site Childhood Arthritis & Rheumatology Research Alliance (CARRA) Registry and 3-site Harvard Inflammatory Bowel Diseases Longitudinal Data Repository now utilize i2b2 self-scaling registry technology (i2b2-SSR). This platform, extensible to federation of multiple projects within and between research networks, encompasses >6000 subjects at sites throughout the USA. We utilize the i2b2-SSR platform to minimize technical barriers to collaboration while enabling fine-grained control over data sharing. The implementation of i2b2-SSR for the multi-site, multi-stakeholder CARRA Registry has established a digital infrastructure for community-driven research data sharing in pediatric rheumatology in the USA. We envision i2b2-SSR as a scalable, reusable solution facilitating interdisciplinary research across diseases.

  4. Serotonin receptors and heart valve disease--it was meant 2B.

    Science.gov (United States)

    Hutcheson, Joshua D; Setola, Vincent; Roth, Bryan L; Merryman, W David

    2011-11-01

    Carcinoid heart disease was one of the first valvular pathologies studied in molecular detail, and early research identified serotonin produced by oncogenic enterochromaffin cells as the likely culprit in causing changes in heart valve tissue. Researchers and physicians in the mid-1960s noted a connection between the use of several ergot-derived medications with structures similar to serotonin and the development of heart valve pathologies similar to those observed in carcinoid patients. The exact serotonergic target that mediated valvular pathogenesis remained a mystery for many years until similar cases were reported in patients using the popular diet drug Fen-Phen in the late 1990s. The Fen-Phen episode sparked renewed interest in serotonin-mediated valve disease, and studies led to the identification of the 5-HT(2B) receptor as the likely molecular target leading to heart valve tissue fibrosis. Subsequent studies have identified numerous other activators of the 5-HT(2B) receptor, and consequently, the use of many of these molecules has been linked to heart valve disease. Herein, we: review the molecular properties of the 5-HT(2B) receptor including factors that differentiate the 5-HT(2B) receptor from other 5-HT receptor subtypes, discuss the studies that led to the identification of the 5-HT(2B) receptor as the mediator of heart valve disease, present current efforts to identify potential valvulopathogens by screening for 5-HT(2B) receptor activity, and speculate on potential therapeutic benefits of 5-HT(2B) receptor targeting. Copyright © 2011. Published by Elsevier Inc.

  5. Thermal behaviour analysis on ITER component cooling water system loop 2B

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Bin, E-mail: guobin@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Fu, Peng [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Dell’Orco, Giovanni; Liliana, Teodoros; Tao, Jun [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Yang, Lei [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)

    2015-11-15

    Highlights: • Thermal hydraulic analysis model has been developed to perform thermal analysis on the component cooling water system loop 2B. • The cooling water temperature profile at client inlet and outlet during one cycle of the most demanding plasma operation scenario was obtained. • Operation behaviour of the main heat exchanger for CCWS-2B has been depicted. - Abstract: ITER cooling water system is composed by several cooling loops, the primary heat transfer loops that form the Tokamak Cooling Water System (TCWS), the secondary heat transfer loops that form the Component Cooling Water System (CCWS) and the Chilled Water System (CHWS) and a tertiary heat transfer loop which is the Heat Rejection System (HRS). The CCWS is further divided into CCWS-1, CCWS-2A, CCWS-2B, CCWS-2C, CCWS-2D depending on the water chemistry needs of clients and wetted area material. The component cooling water system loop 2B (CCWS-2B) has the function to remove heat load from coil power supply component, Neutral Beam Injectors (NBIs) system component and diagnostic system which are located in different buildings. As the total number of the client connections for the loop is a few hundreds, simplified thermal hydraulic analysis model has been developed to perform thermal analysis on the component cooling water system loop 2B. The curve of the cooling water temperature at client inlet and outlet during one cycle of the most demanding plasma operation scenario was obtained and the cooling water flow rate can meet the thermal removal requirement of client was also confirmed from this analysis. In addition, operation behaviour of the main heat exchanger for CCWS-2B in this thermal analysis was depicted for main heat exchanger selection purposes. This study has been carried out with the AFT Fathom code.

  6. LIM kinase/cofilin dysregulation promotes macrothrombocytopenia in severe von Willebrand disease-type 2B

    Science.gov (United States)

    Poirault-Chassac, Sonia; Adam, Frédéric; Muczynski, Vincent; Aymé, Gabriel; Casari, Caterina; Bordet, Jean-Claude; Soukaseum, Christelle; Rothschild, Chantal; Proulle, Valérie; Pietrzyk-Nivau, Audrey; Berrou, Eliane; Christophe, Olivier D.; Rosa, Jean-Philippe; Lenting, Peter J.; Bryckaert, Marijke; Baruch, Dominique

    2016-01-01

    von Willebrand disease type 2B (VWD-type 2B) is characterized by gain-of-function mutations of von Willebrand factor (vWF) that enhance its binding to platelet glycoprotein Ibα and alter the protein’s multimeric structure. Patients with VWD-type 2B display variable extents of bleeding associated with macrothrombocytopenia and sometimes with thrombopathy. Here, we addressed the molecular mechanism underlying the severe macrothrombocytopenia both in a knockin murine model for VWD-type 2B by introducing the p.V1316M mutation in the murine Vwf gene and in a patient bearing this mutation. We provide evidence of a profound defect in megakaryocyte (MK) function since: (a) the extent of proplatelet formation was drastically decreased in 2B MKs, with thick proplatelet extensions and large swellings; and (b) 2B MKs presented actin disorganization that was controlled by upregulation of the RhoA/LIM kinase (LIMK)/cofilin pathway. In vitro and in vivo inhibition of the LIMK/cofilin signaling pathway rescued actin turnover and restored normal proplatelet formation, platelet count, and platelet size. These data indicate, to our knowledge for the first time, that the severe macrothrombocytopenia in VWD-type 2B p.V1316M is due to an MK dysfunction that originates from a constitutive activation of the RhoA/LIMK/cofilin pathway and actin disorganization. This suggests a potentially new function of vWF during platelet formation that involves regulation of actin dynamics. PMID:27734030

  7. Dysregulated Lysine Acetyltransferase 2B Promotes Inflammatory Bowel Disease Pathogenesis Through Transcriptional Repression of Interleukin-10.

    Science.gov (United States)

    Bai, Alfa H C; Wu, William K K; Xu, Liangliang; Wong, Sunny H; Go, Minnie Y; Chan, Anthony W H; Harbord, Marcus; Zhang, Shenghong; Chen, Minhu; Wu, Justin C Y; Chan, Michael W Y; Chan, Matthew T V; Chan, Francis K L; Sung, Joseph J Y; Yu, Jun; Cheng, Alfred S L; Ng, Siew C

    2016-06-01

    Accumulating evidence supports epigenetic modifications in mediating intestinal immunity in inflammatory bowel disease [IBD] pathogenesis. This study aimed to identify key dysregulated epigenetic modulators and the molecular downstream pathways in IBD. Expression of 116 well-defined epigenetic modulators was profiled and validated in 96 intestinal tissues from patients with Crohn's disease [CD], ulcerative colitis [UC], and healthy controls using quantitative reverse transcriptase polymerase chain reaction [QRT-PCR], western blot, and immunohistochemistry. Dysregulation of histone modifications and IBD-related cytokines were examined by chromatin immunoprecipitation, luciferase activity, and gene expression analyses in normal colonic epithelial cell line, NCM460, upon small-molecule inhibition or RNA interference, followed by validation in primary colonic tissues. Targeted expression profiling uncovered seven differentially expressed epigenetic modulators, of which the down-regulation of lysine acetyltransferase 2B [KAT2B] mRNA and protein was the most significant and was consequently validated in inflamed CD and UC compared with healthy colonic tissues. KAT2B protein localised abundantly in nuclei of normal colonic epithelium but diminished in paired inflamed CD and UC tissues. Pharmacological inhibition of KAT2B by anacardic acid in NCM460 cells reduced the levels of histone H4 lysine 5 acetylation [H4K5ac] and interleukin-10 [IL-10] in a dose-dependent manner. Knockdown of KAT2B reduced the IL-10 promoter occupancy of KAT2B and H4K5ac, resulting in transcriptional silencing. IL-10 level was also diminished in inflamed IBD tissues. Our findings demonstrated a novel epigenetic mechanism of IL-10 dysregulation in IBD. Down-regulation of KAT2B may disrupt the innate and adaptive inflammatory responses due to the suppression of this crucial anti-inflammatory cytokine. Copyright © 2016 European Crohn’s and Colitis Organisation (ECCO). Published by Oxford University

  8. Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome.

    Science.gov (United States)

    Wilson, Gabrielle R; Sunley, Jasmine; Smith, Katherine R; Pope, Kate; Bromhead, Catherine J; Fitzpatrick, Elizabeth; Di Rocco, Maja; van Steensel, Maurice; Coman, David J; Leventer, Richard J; Delatycki, Martin B; Amor, David J; Bahlo, Melanie; Lockhart, Paul J

    2014-06-01

    Borrone Dermato-Cardio-Skeletal (BDCS) syndrome is a severe progressive autosomal recessive disorder characterized by coarse facies, thick skin, acne conglobata, dysmorphic facies, vertebral abnormalities and mitral valve prolapse. We identified a consanguineous kindred with a child clinically diagnosed with BDCS. Linkage analysis of this family (BDCS1) identified five regions homozygous by descent with a maximum LOD score of 1.75. Linkage analysis of the family that originally defined BDCS (BDCS3) identified an overlapping linkage peak at chromosome 5q35.1. Sequence analysis identified two different homozygous mutations in BDCS1 and BDCS3, affecting the gene encoding the protein SH3 and PX domains 2B (SH3PXD2B), which localizes to 5q35.1. Western blot analysis of patient fibroblasts derived from affected individuals in both families demonstrated complete loss of SH3PXD2B. Homozygosity mapping and sequence analysis in a second published BDCS family (BDCS2) excluded SH3PXD2B. SH3PXD2B is required for the formation of functional podosomes, and loss-of-function mutations in SH3PXD2B have recently been shown to underlie 7 of 13 families with Frank-Ter Haar syndrome (FTHS). FTHS and BDCS share some overlapping clinical features; therefore, our results demonstrate that a proportion of BDCS and FTHS cases are allelic. Mutations in other gene(s) functioning in podosome formation and regulation are likely to underlie the SH3PXD2B-mutation-negative BDSC/FTHS patients.

  9. e-Relationships for e-Readiness:culture and corruption in international e-B2B

    OpenAIRE

    Berthon, Pierre; Pitt, Leyland; Berthon, Jean-Paul; Campbell, Colin; Thwaites, Des

    2008-01-01

    The role of electronic networks in B2B relationships has been growing exponentially. From massive internet B2B exchanges to tiny RFID chips, B2B is increasingly becoming e-B2B. Whilst e-B2B has been explored intra-nationally, its international counterpart is less well documented; as has been the role that culture might play in the development of international e-B2B relationships. In this paper we address this important issue of international e-business relationships. Specifically we explore t...

  10. Editor's welcome, PORTAL, Vol. 1, No. 2, July 2004

    Directory of Open Access Journals (Sweden)

    Paul Allatson

    2005-03-01

    Full Text Available Since the highly successful inauguration of PORTAL in January 2004, we have received many kind expressions of support from international studies practitioners in a range of fields, and from such places as Canada, Italy, Mexico, Nigeria, New Zealand, Spain, Trinidad, the U.K., and the U.S.A. Particularly gratifying have been the endorsements of the journal and its publishing aims by people involved in their own electronic publishing enterprises. For their generous responses to PORTAL, the Editorial Committee would like to express its collective appreciation to the following people: Professor Jean-Marie Volet, of the University of Western Australia, and the guiding editor of the ground-breaking e-journal Mots Pluriels (www.arts.uwa.edu.au/MotsPluriels; and Francis Leo Collins, member of the Editorial Committee for the Graduate Journal of Asia Pacific Studies (GJAPS, based in Auckland, New Zealand. PORTAL's readers may be interested in the current call for papers from GJAPS (www.arts.auckland.ac.nz/gjaps, for a special issue on "Imagining the Asia-Pacific" (deadline October 31, 2004. This issue of PORTAL contains essays that cover wide terrain: the Chilean diasporic community in Australia; the world of German intellectuals; contemporary Mexican socio-political movements; rural-urban migration in China; and transnational advocacy networks and election monitoring in the Philippines, Chile, Nicaragua and Mexico. In the cultural section of this issue, we are delighted to present a short story from the noted German Studies scholar Anthony Stephens, and the first half of a beautiful, deeply poetic and haunting novel entitled Son, from the London-based writer and art-critic Jennifer Higgie. The novel’s second and final part will appear in PORTAL vol. 2, no. 1, in January 2005. On a different note, we would like to express our support for the inaugural Ubud Writers and Readers Festival, to be held in Ubud, Bali, from October 11 to 17, 2004. The Festival

  11. Modifikacija PP/SAN mešanic:

    OpenAIRE

    Musil, Vojko; Radonjič, Gregor

    1995-01-01

    Properties of isotactic polypropylene (PP) can be improved with the preparation of PP blends. Polymer blend PP/SAN is immiscible and it shows a decrease in some mechanical properties but processing and some other properties can be improved. Addition of an impact modifier can also change the final properties of the PP/SAN blends. As a modifier we used poly (styrene-b-ethylene-co-butylene-b-styrene) (SEBS) triblock copolymer. Blends were prepared in the melt in a Brabender kneading chamber, coo...

  12. Modifikacija PP/SAN mešanic

    OpenAIRE

    Radonjič, Gregor; Musil, Vojko

    2015-01-01

    Izotaktični polipropilen (PP) je med poliolefini eden od najpogosteje uporabljanih polimerov. Kopolimer stiren/akrilonitril ima nekatere dobre lastnosti , ki skupaj z lastnostmi PP omogočajo doseganje sinergističnih učinkov. Polimerna mešanica PP/SAN je nemešljiva in kaže določeno poslabšanje nekaterih mehanskih lastnosti, vendar pa se izboljšajo predelovalne in nekatere druge lastnosti. Na spremembe lastnosti PP/SAN mešanic lahko vplivamo tudi z dodatkom modifikatorja. Zaradi omenjenih dejst...

  13. Displacement affinity chromatography of protein phosphatase one (PP1 complexes

    Directory of Open Access Journals (Sweden)

    Gourlay Robert

    2008-11-01

    Full Text Available Abstract Background Protein phosphatase one (PP1 is a ubiquitously expressed, highly conserved protein phosphatase that dephosphorylates target protein serine and threonine residues. PP1 is localized to its site of action by interacting with targeting or regulatory proteins, a majority of which contains a primary docking site referred to as the RVXF/W motif. Results We demonstrate that a peptide based on the RVXF/W motif can effectively displace PP1 bound proteins from PP1 retained on the phosphatase affinity matrix microcystin-Sepharose. Subsequent co-immunoprecipitation experiments confirmed that each identified binding protein was either a direct PP1 interactor or was in a complex that contains PP1. Our results have linked PP1 to numerous new nuclear functions and proteins, including Ki-67, Rif-1, topoisomerase IIα, several nuclear helicases, NUP153 and the TRRAP complex. Conclusion This modification of the microcystin-Sepharose technique offers an effective means of purifying novel PP1 regulatory subunits and associated proteins and provides a simple method to uncover a link between PP1 and additional cellular processes.

  14. The electroweak corrections to the process pp(γγ→(tt))pp at the LHC%LHC对撞机上(pp)(γγ→ tt)(pp)过程的电弱修正

    Institute of Scientific and Technical Information of China (English)

    孙衍斌; 刘娜; 胡浩月; 张健; 田佳佳

    2011-01-01

    In this paper the electroweak corrections to the process pp (rr→tt)pp at the LHC are calculated in the equivalent photon approximation. Our results shows that the corrected cross sections for the process pp(rr→tt)pp at the LHC are small relatively to its subprocess (rr→t t), but the electroweak correction effect is large up to -7%. Therefore, for the process pp(rr→tt)pp which has very clean environment, its electroweak corrections have to be included.%在等效光子近似下计算了LHC对撞机上pp(γγ→(tt))pp过程的电弱修正.结果表明:pp(γγ→(tt))pp过程修正后的截面相对较小,但电弱修正效应却高达到-7%左右.所以,对于LHC对撞机上背景非常干净的pp(γγ→(tt))pp过程而育,电弱修正效应是不能忽略的.

  15. Study of baryon and search for dibaryon resonances by the pp{yields}pp{pi}{sup +}{pi}{sup -} reaction

    Energy Technology Data Exchange (ETDEWEB)

    Doroshkevich, E.; Bashkanov, M.; Brodowski, W.; Bilger, R.; Clement, H.; Meier, R. [Physikalisches Institut der Universitaet Tuebingen, Morgenstelle 14, D-72076, Tuebingen (Germany); Calen, H.; Ekstroem, C.; Kupsc, A. [Svedberg Laboratory, S-751 21, Uppsala (Sweden); Fransson, K.; Haeggstroem, S.; Hoeistad, B.; Johanson, J.; Johansson, A.; Johansson, T.; Kullander, S.; Marciniewski, P. [Department of Radiation Sciences, Uppsala University (Sweden); Greiff, J. [I. Institut fuer Experimentalphysik der Universitaet Hamburg, D-22761, Hamburg (Germany); Kilian, K. [IKP - Forschungszentrum Juelich GmbH, D-52425, Juelich (Germany); Morosov, B. [Joint Institute for Nuclear Research Dubna, 101000, Moscow (Russian Federation); Oelert, W.; Paetzold, J.; Ruber, R.J.M.Y.; Scobel, W.; Stepaniak, J.; Sukhanov, A.; Turowiecki, A.; Wagner, G.J.; Wilhelmi, Z.; Zabierowski, J.; Zlomanczuk, J.

    2003-11-01

    Exclusive measurements of the two-pion production channel pp{yields}pp{pi} + {pi}{sup -} have been carried out near threshold at CELSIUS with the PROMICE/WASA detector. They reveal pp{yields}pp{sup *}(1440){yields}pp{sigma}{yields}pp({pi}{sup +}{pi}{sup -}){sub I=l=0} as the dominant process at these energies, however, the data exhibit also significant contributions from p{sup *}(1440){yields}{delta}{pi}{yields}p({pi}{sup +}{pi}{sup -}){sub I=l=0}. From the observed interference of these Roper decay routes their relative branching ratio is derived. The status on the search for NN-decoupled NN{pi}-resonances is reviewed with regard to recent experimental searches in the pionic double charge exchange in nuclei, the two-pion production in nucleon-nucleon collisions, the photo pion-production on the deuteron and the electro pion-production in nuclei. (orig.)

  16. Inhibitory Effects of Garcinia cambogia Extract on CYP2B6 Enzyme Activity.

    Science.gov (United States)

    Yu, Jun Sang; Choi, Min Sun; Park, Jong Suk; Rehman, Shaheed Ur; Nakamura, Katsunori; Yoo, Hye Hyun

    2017-03-13

    This study assessed the inhibitory effects of Garcinia cambogia extract on the cytochrome P450 enzymes in vitro. G. cambogia extract was incubated with cytochrome P450 isozyme-specific substrates in human liver microsomes and recombinant CYP2B6 isozyme, and the formation of the marker metabolites was measured to investigate the inhibitory potential on cytochrome P450 enzyme activities. The results showed that G. cambogia extract has significant inhibitory effects on CYP2B6 activity in a concentration-dependent manner. Furthermore, the inhibition was potentiated following preincubation with NADPH, indicating that G. cambogia extract is a time-dependent inhibitor of CYP2B6. Meanwhile, hydroxycitric acid, the major bioactive ingredient of G. cambogia extract, did not exhibit significant inhibition effects on cytochrome P450 enzyme activities. G. cambogia extract could modulate the pharmacokinetics of CYP2B6 substrate drugs and lead to interactions with those drugs. Therefore, caution may be required with respect to concomitant intake of dietary supplements containing G. cambogia extract with CYP2B6 substrates.

  17. Presymptomatic generalized brain atrophy in frontotemporal dementia caused by CHMP2B mutation

    DEFF Research Database (Denmark)

    Rohrer, Jonathan D; Ahsan, R Laila; Isaacs, Adrian M;

    2009-01-01

    BACKGROUND/AIMS: CHMP2B mutations are a rare cause of familial frontotemporal dementia (FTD). The clinical syndrome is dominated by personality change and behavioural symptoms, but language, memory, calculation and praxis impairments are also seen early in the course of the disease. There are no ......BACKGROUND/AIMS: CHMP2B mutations are a rare cause of familial frontotemporal dementia (FTD). The clinical syndrome is dominated by personality change and behavioural symptoms, but language, memory, calculation and praxis impairments are also seen early in the course of the disease....... There are no detailed studies of brain imaging in CHMP2B mutation-associated FTD. This study aimed to investigate whether there were early or presymptomatic changes in this group of patients. METHODS: Subjects comprised 16 members of a Danish family with CHMP2B mutation-associated FTD. Nine subjects were presymptomatic...... mutation carriers with a control group of 7 mutation-negative family members. Volumetric MRI brain scans were performed on all subjects at two time points, and rates of volume change were compared between the two groups. RESULTS: We demonstrate that generalized atrophy occurs presymptomatically in CHMP2B...

  18. Involvement of CYP2B6 in the biotransformation of propofol by human liver microsomes

    Institute of Scientific and Technical Information of China (English)

    TANG Bing; WANG Jun-ke; FENG Wan-yu

    2008-01-01

    Objective To determine whether the cytochrome P4502B6 (CYP2B6) is involved in the oxidation of propofol by human liver microsomes. Methods The change of propofol concentration in an incubation mixture with human liver microsomes was monitored by the high performance liquid chromatography (HPLC), in order to calculate the rate constants of metabolism of propofol. The correlation between the rate constants and the rate of metabolism of CYP2B6 selective substrate bupropion, and the effect of two different CYP2B6 specific inhibitors on the propofol metabolism were examined. Results The mean rate constant of propofol metabolism by liver microsomes obtained from twelve individuals was 3.9 (95 % confidence intervals 3.3, 4.5) nmol·min-1·mg-1 protein. The rate constants of propofol metabolism by liver microsomes were significantly correlated with bupropion hydroxylation (r=0.888, P<0.001). Both selective chemical inhibitors of CYP2B6, orphenadrine and N, N′, N″-triethylenethiophosphoramide (thioTEPA), reduced the rate constants of propofol metabolism by 37.596 (P<0.001) and 42.796 (P<0.001)in liver microsomes, respectively. Conclusions CYP2B6 is predominantly involved in the oxidation of propofol by human liver microsomes.

  19. Structure and sequence based functional annotation of Zika virus NS2b protein: Computational insights.

    Science.gov (United States)

    Aguilera-Pesantes, Daniel; Méndez, Miguel A

    2017-02-08

    While Zika virus (ZIKV) outbreaks are a growing concern for global health, a deep understanding about the virus is lacking. Here we report a contribution to the basic science on the virus- a detailed computational analysis of the non structural protein NS2b. This protein acts as a cofactor for the NS3 protease (NS3Pro) domain that is important on the viral life cycle, and is an interesting target for drug development. We found that ZIKV NS2b cofactor is highly similar to other virus within the Flavivirus genus, especially to West Nile Virus, suggesting that it is completely necessary for the protease complex activity. Furthermore, the ZIKV NS2b has an important role to the function and stability of the ZIKV NS3 protease domain even when presents a low conservation score. In addition, ZIKV NS2b is mostly rigid, which could imply a non dynamic nature in substrate recognition. Finally, by performing a computational alanine scanning mutagenesis, we found that residues Gly 52 and Asp 83 in the NS2b could be important in substrate recognition.

  20. 5-HT2B Receptor Antagonists Inhibit Fibrosis and Protect from RV Heart Failure

    Directory of Open Access Journals (Sweden)

    Wiebke Janssen

    2015-01-01

    Full Text Available Objective. The serotonin (5-HT pathway was shown to play a role in pulmonary hypertension (PH, but its functions in right ventricular failure (RVF remain poorly understood. The aim of the current study was to investigate the effects of Terguride (5-HT2A and 2B receptor antagonist or SB204741 (5-HT2B receptor antagonist on right heart function and structure upon pulmonary artery banding (PAB in mice. Methods. Seven days after PAB, mice were treated for 14 days with Terguride (0.2 mg/kg bid or SB204741 (5 mg/kg day. Right heart function and remodeling were assessed by right heart catheterization, magnetic resonance imaging (MRI, and histomorphometric methods. Total secreted collagen content was determined in mouse cardiac fibroblasts isolated from RV tissues. Results. Chronic treatment with Terguride or SB204741 reduced right ventricular fibrosis and showed improved heart function in mice after PAB. Moreover, 5-HT2B receptor antagonists diminished TGF-beta1 induced collagen synthesis of RV cardiac fibroblasts in vitro. Conclusion. 5-HT2B receptor antagonists reduce collagen deposition, thereby inhibiting right ventricular fibrosis. Chronic treatment prevented the development and progression of pressure overload-induced RVF in mice. Thus, 5-HT2B receptor antagonists represent a valuable novel therapeutic approach for RVF.

  1. 5-HT2B receptor antagonists inhibit fibrosis and protect from RV heart failure.

    Science.gov (United States)

    Janssen, Wiebke; Schymura, Yves; Novoyatleva, Tatyana; Kojonazarov, Baktybek; Boehm, Mario; Wietelmann, Astrid; Luitel, Himal; Murmann, Kirsten; Krompiec, Damian Richard; Tretyn, Aleksandra; Pullamsetti, Soni Savai; Weissmann, Norbert; Seeger, Werner; Ghofrani, Hossein Ardeschir; Schermuly, Ralph Theo

    2015-01-01

    The serotonin (5-HT) pathway was shown to play a role in pulmonary hypertension (PH), but its functions in right ventricular failure (RVF) remain poorly understood. The aim of the current study was to investigate the effects of Terguride (5-HT2A and 2B receptor antagonist) or SB204741 (5-HT2B receptor antagonist) on right heart function and structure upon pulmonary artery banding (PAB) in mice. Seven days after PAB, mice were treated for 14 days with Terguride (0.2 mg/kg bid) or SB204741 (5 mg/kg day). Right heart function and remodeling were assessed by right heart catheterization, magnetic resonance imaging (MRI), and histomorphometric methods. Total secreted collagen content was determined in mouse cardiac fibroblasts isolated from RV tissues. Chronic treatment with Terguride or SB204741 reduced right ventricular fibrosis and showed improved heart function in mice after PAB. Moreover, 5-HT2B receptor antagonists diminished TGF-beta1 induced collagen synthesis of RV cardiac fibroblasts in vitro. 5-HT2B receptor antagonists reduce collagen deposition, thereby inhibiting right ventricular fibrosis. Chronic treatment prevented the development and progression of pressure overload-induced RVF in mice. Thus, 5-HT2B receptor antagonists represent a valuable novel therapeutic approach for RVF.

  2. Supporting the Health Quality Measures Format in i2b2.

    Science.gov (United States)

    Klann, Jeffrey G; Murphy, Shawn N

    2013-01-01

    The Health Quality Measures Format (HQMF) is an HL7 standard for expressing computable queries of clinical data. It is becoming increasingly consequential for both quality measurement and population health research. A variety of national leadership is involved in its development and deployment, including the Meaningful Use incentive program, the Query Health initiative, the Joint Commission, the National Quality Forum (NQF), and the Food and Drug Administration. Here we analyze the structure of HQMF and apply this to computation of HQMF on Informatics for Integrating Biology and the Bedside (i2b2). i2b2 is a widely used, modular, open-source clinical research data repository. We implement a translator to convert between HQMF and i2b2-XML format that covers the subset of HQMF supported in i2b2-XML, which will be expanded in the next release of i2b2. This translator is part of the freely-available reference implementation of the QueryHealth initiative.

  3. Molecular level interaction of inositol hexaphosphate with the C2B domain of human synaptotagmin I.

    Science.gov (United States)

    Joung, Meng-Je; Mohan, Sepuru K; Yu, Chin

    2012-05-01

    Synaptotagmin I is a synaptic vesicle membrane protein that serves as a multifunctional regulator during the exocytosis of neurotransmitter release. It contains C2A and C2B domains. The binding of Ca(2+) to the C2A domain activates the exocytosis of secretory vesicles, while the binding of inositol polyphosphates (IP4-IP6) to the C2B domain inhibits this process. To understand the IP6-induced inhibition of exocytosis of secretory vesicles, we determined the three-dimensional structure of the C2B-IP6 complex by nuclear magnetic resonance (NMR). In this study, we have determined the binding constant by isothermal titration calorimetry. The circular dichroism measurements demonstrated that IP6 can stabilize the C2B molecule. We identified the binding site using (1)H-(15)N heteronuclear single-quantum coherence spectroscopy titration data and determined the structure of the C2B-IP6 complex using multidimensional NMR studies. This information will aid in the design of better pharmacological treatments for neurological disorders.

  4. Serotonin 2B receptor: upregulated with age and hearing loss in mouse auditory system.

    Science.gov (United States)

    Tadros, Sherif F; D'Souza, Mary; Zettel, Martha L; Zhu, XiaoXia; Lynch-Erhardt, Martha; Frisina, Robert D

    2007-07-01

    Serotonin (5-HT) is a monoamine neurotransmitter. Serotonin may modulate afferent fiber discharges in the cochlea, inferior colliculus (IC) and auditory cortex. Specific functions of serotonin are exerted upon its interaction with specific receptors; one of those receptors is the serotonin 2B receptor. The aim of this study was to investigate the differences in gene expression of serotonin 2B receptors with age in cochlea and IC, and the possible correlation between gene expression and functional hearing measurements in CBA/CaJ mice. Immunohistochemical examinations of protein expression of IC in mice of different age groups were also performed. Gene expression results showed that serotonin 2B receptor gene was upregulated with age in both cochlea and IC. A significant correlation between gene expression and functional hearing results was established. Immunohistochemical protein expression studies of IC showed more serotonin 2B receptor cells in old mice relative to young adult mice, particularly in the external nucleus. We conclude that serotonin 2B receptors may play a role in the pathogenesis of age-related hearing loss.

  5. Damping of forward neutrons in pp collisions

    Science.gov (United States)

    Kopeliovich, B. Z.; Potashnikova, I. K.; Schmidt, Ivan; Soffer, J.

    2008-07-01

    We calculate absorptive corrections to single pion exchange in the production of leading neutrons in pp collisions. Contrary to the usual procedure of convolving the survival probability with the cross section, we apply corrections to the spin amplitudes. The nonflip amplitude turns out to be much more suppressed by absorption than the spin-flip one. We identify the projectile proton Fock state responsible for the absorptive corrections as a color octet-octet 5-quarks configuration. Calculations within two very different models, color-dipole light-cone description, and in hadronic representation, lead to rather similar absorptive corrections. We found a much stronger damping of leading neutrons than in some of previous estimates. Correspondingly, the cross section is considerably smaller than was measured at ISR. However, comparison with recent measurements by the ZEUS collaboration of neutron production in deep-inelastic scattering provides a strong motivation for challenging the normalization of the ISR data. This conjecture is also supported by preliminary data from the NA49 experiment for neutron production in pp collisions at SPS.

  6. Strangeness production in AA and pp collisions

    Energy Technology Data Exchange (ETDEWEB)

    Castorina, Paolo [Universita di Catania, Dipartimento di Fisica ed Astronomia, Catania (Italy); INFN, Catania (Italy); Satz, Helmut [Universitaet Bielefeld, Fakultaet fuer Physik, Bielefeld (Germany)

    2016-07-15

    Boost-invariant hadron production in high-energy collisions occurs in causally disconnected regions of finite space-time size. As a result, globally conserved quantum numbers (charge, strangeness, baryon number) are conserved locally in spatially restricted correlation clusters. Their size is determined by two time scales: the equilibration time specifying the formation of a quark-gluon plasma, and the hadronization time, specifying the onset of confinement. The expected values for these scales provide the theoretical basis for the suppression observed for strangeness production in elementary interactions (pp, e{sup +}e{sup -}) below LHC energies. In contrast, the space-time superposition of individual collisions in high-energy heavy-ion interactions leads to higher energy densities, resulting in much later hadronization and hence much larger hadronization volumes. This largely removes the causality constraints and results in an ideal hadronic resonance gas in full chemical equilibrium. In the present paper, we determine the collision energies needed for that; we also estimate when pp collisions reach comparable hadronization volumes and thus determine when strangeness suppression should disappear there as well. (orig.)

  7. Strangeness production in AA and pp collisions

    Science.gov (United States)

    Castorina, Paolo; Satz, Helmut

    2016-07-01

    Boost-invariant hadron production in high-energy collisions occurs in causally disconnected regions of finite space-time size. As a result, globally conserved quantum numbers (charge, strangeness, baryon number) are conserved locally in spatially restricted correlation clusters. Their size is determined by two time scales: the equilibration time specifying the formation of a quark-gluon plasma, and the hadronization time, specifying the onset of confinement. The expected values for these scales provide the theoretical basis for the suppression observed for strangeness production in elementary interactions ( pp , e^+e^- below LHC energies. In contrast, the space-time superposition of individual collisions in high-energy heavy-ion interactions leads to higher energy densities, resulting in much later hadronization and hence much larger hadronization volumes. This largely removes the causality constraints and results in an ideal hadronic resonance gas in full chemical equilibrium. In the present paper, we determine the collision energies needed for that; we also estimate when pp collisions reach comparable hadronization volumes and thus determine when strangeness suppression should disappear there as well.

  8. 77 FR 24225 - Information Collection Approval; Temporary Non-Agricultural Employment of H-2B Aliens in the...

    Science.gov (United States)

    2012-04-23

    ... of H-2B Aliens in the United States AGENCY: Employment and Training Administration, Department of... Employment of H-2B Aliens in the United States; Final Rule. See 77 FR 10038, Feb. 21, 2012. DATES: On April 8...

  9. Peginterferon alpha-2a versus peginterferon alpha-2b for chronic hepatitis C

    DEFF Research Database (Denmark)

    Hauser, Goran; Awad, Tahany; Thorlund, Kristian

    2014-01-01

    BACKGROUND: A combination of weekly pegylated interferon (peginterferon) alpha and daily ribavirin still represents standard treatment of chronic hepatitis C infection in the majority of patients. However, it is not established which of the two licensed peginterferon products, peginterferon alpha-2......a or peginterferon alpha-2b, is the most effective and has a better safety profile. OBJECTIVES: To systematically evaluate the benefits and harms of peginterferon alpha-2a versus peginterferon alpha-2b in head-to-head randomised clinical trials in patients with chronic hepatitis C. SEARCH METHODS...... literature. SELECTION CRITERIA: We included randomised clinical trials comparing peginterferon alpha-2a versus peginterferon alpha-2b given with or without co-intervention(s) (for example, ribavirin) for chronic hepatitis C. Quasi-randomised studies and observational studies as identified by the searches...

  10. Uso de una conantokina y anticuerpos policlonales para identificar la subunidad NR2B del receptor

    OpenAIRE

    2010-01-01

    Objetivo. Proponer una metodología de identificación de la subunidad NR2B, mediante el uso de conantokina G, así como una adecuada extracción de la subunidad NR2B. Materiales y métodos. Se ensayaron dos metodologías para la extracción de la subunidad NR2B de cerebro de rata adulta, la primera buscó la extracción de la subunidad a partir de la membrana mediante la utilización del detergente deoxicolato de sodio y la segunda, garantizó primero la solubilización y eliminación de proteínas citopl...

  11. The Importance of Brand on B2B Markets: Expert Interviews with Hilti AG Managers

    Directory of Open Access Journals (Sweden)

    Martin Konečný

    2013-12-01

    Full Text Available This paper investigates the importance of brand building in the business-to-business world. Not only B2C companies must take branding into account and put it among their top priorities in order to survive and succeed on the market. The first part of the article deals with the theoretical background of brand importance and market specifics of B2B markets and results in the setting of two hypotheses. The following research has to find out how the managers of a pure business-to-business company perceive the importance of a brand; moreover, it has to evaluate the importance of eight specific brand building factors. Fourteen expert interviews document the growing of brands in the B2B market and their main aspects. At the end of the article, we will focus on future implications for B2B management.

  12. Magnetic properties of Y1- xGdxCo2B2C series of borocarbides

    Science.gov (United States)

    Bud'ko, S. L.; Giordanengo, B.; Sulpice, A.; Fontes, M. B.; Baggio-Saitovitch, E. M.

    1995-04-01

    Magnetic properties of Y1- xGdxCo2B2C series of compounds were studied. Two magnetically ordered phases were observed for 0.7 ≤ x ≤ 1. Change of the magnetic ordering temperatures T 1 and T 2 with the Gd concentration is argued to be related to the dilution of magnetic Gd by nonmagnetic Y and to the reduction of the distance between ( Y1- xGdx) C planes. However, significant contribution to the changes in T 1 between pure GdNi2B2C and GdCo2B2C samples is suggested to be due to the different 3 d band filling in these compounds.

  13. A new natural naphtho[1,2-b]furan from the leaves of Cassia fistula.

    Science.gov (United States)

    Wang, Li-Qin; Tang, Zheng-Rong; Mu, Wei-Hua; Kou, Jun-Feng; He, Dong-Yang

    2013-11-01

    A new naphtho[1,2-b]furan, 2,9-dihydroxy-7-methoxy-4-methylnaphtha[1,2-b]furan-3(2H)-one (1), along with 10 known compounds vanillic acid (2), naringenin (3), glyceryl-1-tetracosanoate (4), moracin J (5), 1,3,8-trihydroxyanthraquinone (6), esculetin (7), mauritianin (8), kaempferol 3-neohesperidoside (9), β-sitosterol (10), and β-daucosterol (11), was isolated from the leaves of Cassia fistula. The structure of the new compound was determined by NMR and X-ray analysis. Compounds 1, 3, 5-9 were isolated from this plant for the first time. The naphtha[1,2-b]furan was firstly isolated from the natural resources.

  14. Contributions of PHOX2B in the pathogenesis of Hirschsprung disease.

    Directory of Open Access Journals (Sweden)

    Raquel María Fernández

    Full Text Available Hirschsprung disease (HSCR is a congenital malformation of the hindgut resulting from a disruption of neural crest cell migration during embryonic development. It has a complex genetic aetiology with several genes involved in its pathogenesis. PHOX2B plays a key function in the development of neural crest derivatives, and heterozygous mutations cause a complex dysautonomia associating HSCR, Congenital Central Hypoventilation Syndrome (CCHS and neuroblastoma (NB in various combinations. In order to determine the role of PHOX2B in isolated HSCR, we performed a mutational screening in a cohort of 207 Spanish HSCR patients. Our most relevant finding has been the identification of a de novo and novel deletion (c.393_410del18 in a patient with HSCR. Results of in silico and functional assays support its pathogenic effect related to HSCR. Therefore our results support that PHOX2B loss-of-function is a rare cause of HSCR phenotype.

  15. Neuropsychiatric complications associated with interferon - alpha -2b treatment of malignant melanoma.

    LENUS (Irish Health Repository)

    Enudi, W

    2012-02-01

    Several adverse effects have been associated with interferon alpha 2b treatment and neuropsychiatric effects have also been commonly reported. Psychosis and mood disorders have been described in the literature. This case report is of a 30 year old man with malignant melanoma stage 3a who was receiving adjuvant alpha 2b interferon and developed a manic episode two weeks post switching after one month of treatment on a high dose to a low dose. There was no previous psychiatric illness and no known family history of mental illness. This is in keeping with previous reports that mania has been observed in patients undergoing interferon treatment especially after significant dose-reduction or treatment breaks. Mania induced by interferon responds well to antimanic drugs .Since interferon alpha 2b is now commonly used in the treatment of malignant melanoma and other conditions, the need to be aware of its neuropsychiatric complications is essential.

  16. Laboratory Study of O2(b1Σ g+, υ = 1) Collisional Removal at Thermospheric Temperatures

    Science.gov (United States)

    Wouters, E. R.; Pejaković, D. A.; Phillips, K. E.; Kalogerakis, K. S.

    2003-12-01

    In the Earth's thermosphere, energy transfer from O(1D) to O2 generates oxygen molecules in the υ = 0 and 1 levels of the O2(b1Σg+) state. The emissions in the O2(b1Σ g+ - X3Σ g-) system (Atmospheric Band) present a major component of the Earth's airglow. Interpretation of the measured intensities of O2 Atmospheric Band emissions can yield altitude profiles of oxygen atom density and local temperature in the lower thermosphere. To achieve this goal accurate laboratory measurements of the collisional removal rate coefficients of O2(b, υ = 1) and their temperature dependence are essential. Atmospheric observations suggest that the relevant colliders for the removal of O2(b, υ = 1) in the lower thermosphere are O2 and O(3P). We report measurements of the rate coefficients for the collisional removal of O2(b, υ = 1) by O2, N2, and CO2, at temperatures in the range 300--1000 K. A state-specific two-laser technique is used, in which the visible output of the first laser directly excites O2 to O2(b, υ = 1), and the ultraviolet output of the second laser probes the O2(b, υ = 1) population by resonantly enhanced multiphoton ionization via the υ= 4 level of the d1Π g Rydberg state. The temporal evolution of the O2(b, υ = 1) population is monitored by varying the time delay between the two laser pulses. The rate coefficient of the collisional removal of O2(b, υ = 1) by O2 increases monotonically with temperature from about 1.5 x 10-11 cm3 s-1 to about 6*E-11 cm3 s-1 in the range 300--1000 K. Experiments with colliders N2 and CO2 determine the upper limits for the removal rate coefficients of O2(b, υ = 1) by N2 and CO2 to be 2 orders of magnitude smaller. This work extends previous studies of O2(b, υ = 1) at room and low temperatures.1,2 We are currently planning experiments to investigate the collisional removal of O2(b, υ = 1) by O atoms. This study was supported by the NSF's Grant ATM-0209229. The participation of K. Phillips in this project was funded by

  17. Possible coexistence of superconductivity and magnetic order in NdPt2B2C

    Indian Academy of Sciences (India)

    S K Dhar; A D Chinchure; E Alleno; C Godart; L C Gupta; R Nagarajan

    2002-05-01

    Coexistence of superconductivity and magnetic order has been one of the exciting aspects of the quaternary borocarbide superconductors. So far, RNi2B2C (R=Tm, Er, Ho and Dy) are the only known magnetic superconductors in this family. Here, we present our resistivity, magnetization and heat capacity studies on NdPt2B2C (nominal composition, NdPt1.5Au0.6B2C and NdPt2.1B2.4C1.2). We find superconductivity in both samples with c,onset∼ 3 K. Bulk magnetic order is found to occur below 1.7 K. We suggest that NdPt2B2C is a possible magnetic superconductor.

  18. Reciprocal interactions of Fgf10/Fgfr2b modulate the mouse tongue epithelial differentiation.

    Science.gov (United States)

    Sohn, Wern-Joo; Jung, Hye-In; Choi, Min-A; Han, Jin-Hyun; Gwon, Gi-Jeong; Yamamoto, Hitoshi; Lee, Sanggyu; Ryoo, Zae Young; Park, Eui-Kyun; Shin, Hong-In; Jung, Han-Sung; Kim, Jae-Young

    2011-08-01

    The molecular mechanisms for epithelial differentiation have been studied by observing skin development in embryogenesis, but the early signaling modulations involved in tongue epithelial differentiation are not completely understood. Based on the gene expression patterns of the Fgf signaling molecules and previous results from Fgf10 and Fgfr2b knockout mice, it was hypothesized that there would be fundamental signaling interactions through the epithelial Fgfr2b and its mesenchymal ligand Fgf10 to regulate tongue epithelium differentiation. To elucidate these reciprocal interactions in tongue epithelial differentiation, this study employed an in vitro tongue organ culture system with antisense-oligodeoxynucleotides (AS-ODNs) and recombinant protein-soaked bead implantation for the loss-of-function and gain-of-function studies. Functional analysis of Fgf signaling revealed precise reciprocal interactions, which showed that mesenchymal Fgf10 rather than Fgf7 modulates tongue epithelial differentiation via Fgfr2b in a temporal- and spatial-specific manner.

  19. Sustained major molecular response on interferon alpha-2b in two patients with polycythemia vera

    DEFF Research Database (Denmark)

    Larsen, T.S.; Pallisgaard, N.; Andersen, M.T.

    2008-01-01

    Quantitative assessment of the JAK2 V617F allele burden during disease evolution and ongoing myelosuppressive treatment is likely to be implemented in the future clinical setting. Interferon alpha has demonstrated efficacy in treatment of both chronic myeloid leukemia and the Philadelphia...... chromosome negative chronic myeloproliferative disorders. Reductions in the JAK2 V617F allele burden in patients treated with pegylated interferon alpha-2a (Peg-IFN-2a) have been demonstrated, although follow-up was relatively short. We report here the first profound and sustained molecular responses...... with a JAK2 V617F allele burden below 1.0% in two patients with polycythemia vera treated with interferon alpha-2b (IFN-2b). Discontinuation of IFN-2b in one of the patients was followed by a sustained long-lasting (12 months of follow-up) major molecular response Udgivelsesdato: 2008/10...

  20. Neuropsychiatric complications associated with interferon - alpha -2b treatment of malignant melanoma.

    LENUS (Irish Health Repository)

    Enudi, W

    2009-08-01

    Several adverse effects have been associated with interferon alpha 2b treatment and neuropsychiatric effects have also been commonly reported. Psychosis and mood disorders have been described in the literature. This case report is of a 30 year old man with malignant melanoma stage 3a who was receiving adjuvant alpha 2b interferon and developed a manic episode two weeks post switching after one month of treatment on a high dose to a low dose. There was no previous psychiatric illness and no known family history of mental illness. This is in keeping with previous reports that mania has been observed in patients undergoing interferon treatment especially after significant dose-reduction or treatment breaks. Mania induced by interferon responds well to antimanic drugs .Since interferon alpha 2b is now commonly used in the treatment of malignant melanoma and other conditions, the need to be aware of its neuropsychiatric complications is essential.

  1. Properties of a New Nonlinear Optical Crystal CdZn2B2O6

    Institute of Scientific and Technical Information of China (English)

    ZHANG Fan; SHEN De-Zhong; SHEN Guang-Qiu; WANG Xiao-Qing

    2008-01-01

    @@ Cadmium dizinc diborate (CdZn2B2O6) single crystals have been grown for the first time. The crystal structure of CdZn2B2O6 is the same as that of the Cd3Zn3B4O12. The x-ray diffraction, infrated and Raman spectra,differential scanning calorimetry analysis and density indicate that the physical and chemical properties of both crystals are very similar. Especially, the nonlinear optical coefficients of CdZn2B2O6 and Cd3ZnaB4O12 crystals are 2.6 and 2.4 times as large as that of KH2PO4 crystal respectively. Chemical etching experiments indicated that these crystals are very stable in neutral solution and not hygroscopic in air at room temperature.

  2. Standards-Based Procedural Phenotyping: The Arden Syntax on i2b2.

    Science.gov (United States)

    Mate, Sebastian; Castellanos, Ixchel; Ganslandt, Thomas; Prokosch, Hans-Ulrich; Kraus, Stefan

    2017-01-01

    Phenotyping, or the identification of patient cohorts, is a recurring challenge in medical informatics. While there are open source tools such as i2b2 that address this problem by providing user-friendly querying interfaces, these platforms lack semantic expressiveness to model complex phenotyping algorithms. The Arden Syntax provides procedural programming language construct, designed specifically for medical decision support and knowledge transfer. In this work, we investigate how language constructs of the Arden Syntax can be used for generic phenotyping. We implemented a prototypical tool to integrate i2b2 with an open source Arden execution environment. To demonstrate the applicability of our approach, we used the tool together with an Arden-based phenotyping algorithm to derive statistics about ICU-acquired hypernatremia. Finally, we discuss how the combination of i2b2's user-friendly cohort pre-selection and Arden's procedural expressiveness could benefit phenotyping.

  3. Genes for resistance to stripe rust on chromosome 2B and their application in wheat breeding

    Institute of Scientific and Technical Information of China (English)

    Peigao Luo; Xueyun Hu; Huaiyu Zhang; Zhenglong Ren

    2009-01-01

    Stripe rust,caused by Puccinia striiformis f.sp.tritici,is one of the most damaging diseases of wheat worldwide.Growing resistant cultivars is the most economic and environmental friendly way to control the disease.There are many resistance genes to stripe rust located on wheat chromosome 2B.Here,we propose a strategy to construct the recombinant wheat chromosome 2B with multiple resistances to stripe rust by making crosses between wheat lines or cultivars carrying Yr genes and using marker-assisted selection,based on the reported information about resistance spectrum,chromosomal location,and linked markers of the genes.Pyramiding the resistance genes on 2B would afford a valuable strategy to control the disease by cultivating varieties with durable resistance.The possibility,efficiency,and prospect of the suggested strategy are reviewed in the paper.

  4. Association Study of N-Methyl-D-Aspartate Receptor Subunit 2B (GRIN2B Polymorphisms and Schizophrenia Symptoms in the Han Chinese Population.

    Directory of Open Access Journals (Sweden)

    Yongfeng Yang

    Full Text Available Schizophrenia (SZ is a common and complex psychiatric disorder that has a significant genetic component. The glutamatergic system is the major excitatory neurotransmitter system in the central nervous system, and is mediated by N-methyl-D-aspartate (NMDA receptors. Disturbances in this system have been hypothesized to play a major role in SZ pathogenesis. Several studies have revealed that the NMDA receptor subunit 2B (GRIN2B potentially associates with SZ and its psychiatric symptoms. In this study, we performed a case-control study to identify polymorphisms of the GRIN2B gene that may confer susceptibility to SZ in the Han Chinese population. Thirty-four single nucleotide polymorphisms (SNPs were genotyped in 528 paranoid SZ patients and 528 control subjects. A significant association was observed in allele and genotype between SZ and controls at rs2098469 (χ2 = 8.425 and 4.994; p = 0.025 and 0.014, respectively. Significant associations were found in the allele at rs12319804 (χ2 = 4.436; p = 0.035, as well as in the genotype at rs12820037 and rs7298664 between SZ and controls (χ2 = 11.162 and 38.204; p = 0.003 and 4.27×10(-8, respectively. After applying the Bonferroni correction, rs7298664 still had significant genotype associations with SZ (p = 1.71×10(-7. In addition, rs2098469 genotype and allele frequencies, and 12820037 allele frequencies were nominally associated with SZ. Three haplotypes, CGA (rs10845849-rs12319804-rs10845851, CC (rs12582848-rs7952915, and AAGAC (rs2041986-rs11055665-rs7314376-rs7297101-rs2098469, had significant differences between SZ and controls (χ2 = 4.324, 4.582, and 4.492; p = 0.037, 0.032, and 0.034, respectively. In addition, three SNPs, rs2098469, rs12820037, and rs7298664, were significantly associated with cognition factors PANSS subscores in SZ (F = 16.799, 7.112, and 13.357; p = 0.000, 0.017, and 0.000, respectively. In conclusion, our study provides novel evidence for an association between GRIN2B

  5. Association Study of N-Methyl-D-Aspartate Receptor Subunit 2B (GRIN2B) Polymorphisms and Schizophrenia Symptoms in the Han Chinese Population

    Science.gov (United States)

    Zhang, Hongxing; Yang, Ge; Wang, Xiujuan; Ding, Minli; Jiang, Tianzi; Lv, Luxian

    2015-01-01

    Schizophrenia (SZ) is a common and complex psychiatric disorder that has a significant genetic component. The glutamatergic system is the major excitatory neurotransmitter system in the central nervous system, and is mediated by N-methyl-D-aspartate (NMDA) receptors. Disturbances in this system have been hypothesized to play a major role in SZ pathogenesis. Several studies have revealed that the NMDA receptor subunit 2B (GRIN2B) potentially associates with SZ and its psychiatric symptoms. In this study, we performed a case–control study to identify polymorphisms of the GRIN2B gene that may confer susceptibility to SZ in the Han Chinese population. Thirty-four single nucleotide polymorphisms (SNPs) were genotyped in 528 paranoid SZ patients and 528 control subjects. A significant association was observed in allele and genotype between SZ and controls at rs2098469 (χ2 = 8.425 and 4.994; p = 0.025 and 0.014, respectively). Significant associations were found in the allele at rs12319804 (χ2 = 4.436; p = 0.035), as well as in the genotype at rs12820037 and rs7298664 between SZ and controls (χ2 = 11.162 and 38.204; p = 0.003 and 4.27×10-8, respectively). After applying the Bonferroni correction, rs7298664 still had significant genotype associations with SZ (p = 1.71×10-7). In addition, rs2098469 genotype and allele frequencies, and 12820037 allele frequencies were nominally associated with SZ. Three haplotypes, CGA (rs10845849—rs12319804—rs10845851), CC (rs12582848—rs7952915), and AAGAC (rs2041986—rs11055665—rs7314376—rs7297101—rs2098469), had significant differences between SZ and controls (χ2 = 4.324, 4.582, and 4.492; p = 0.037, 0.032, and 0.034, respectively). In addition, three SNPs, rs2098469, rs12820037, and rs7298664, were significantly associated with cognition factors PANSS subscores in SZ (F = 16.799, 7.112, and 13.357; p = 0.000, 0.017, and 0.000, respectively). In conclusion, our study provides novel evidence for an association between

  6. Structural Basis for Host Membrane Remodeling Induced by Protein 2B of Hepatitis A Virus

    Science.gov (United States)

    Vives-Adrián, Laia; Garriga, Damià; Buxaderas, Mònica; Fraga, Joana; Pereira, Pedro José Barbosa

    2015-01-01

    ABSTRACT The complexity of viral RNA synthesis and the numerous participating factors require a mechanism to topologically coordinate and concentrate these multiple viral and cellular components, ensuring a concerted function. Similarly to all other positive-strand RNA viruses, picornaviruses induce rearrangements of host intracellular membranes to create structures that act as functional scaffolds for genome replication. The membrane-targeting proteins 2B and 2C, their precursor 2BC, and protein 3A appear to be primarily involved in membrane remodeling. Little is known about the structure of these proteins and the mechanisms by which they induce massive membrane remodeling. Here we report the crystal structure of the soluble region of hepatitis A virus (HAV) protein 2B, consisting of two domains: a C-terminal helical bundle preceded by an N-terminally curved five-stranded antiparallel β-sheet that displays striking structural similarity to the β-barrel domain of enteroviral 2A proteins. Moreover, the helicoidal arrangement of the protein molecules in the crystal provides a model for 2B-induced host membrane remodeling during HAV infection. IMPORTANCE No structural information is currently available for the 2B protein of any picornavirus despite it being involved in a critical process in viral factory formation: the rearrangement of host intracellular membranes. Here we present the structure of the soluble domain of the 2B protein of hepatitis A virus (HAV). Its arrangement, both in crystals and in solution under physiological conditions, can help to understand its function and sheds some light on the membrane rearrangement process, a putative target of future antiviral drugs. Moreover, this first structure of a picornaviral 2B protein also unveils a closer evolutionary relationship between the hepatovirus and enterovirus genera within the Picornaviridae family. PMID:25589659

  7. UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men

    Science.gov (United States)

    Yatsenko, Alexander N.; Georgiadis, Andrew P.; Murthy, Lata J.; Lamb, Dolores J.; Matzuk, Martin M.

    2013-01-01

    Oligozoospermia (low sperm count) is a common semen deficiency. However, to date, few genetic defects have been identified to cause this condition. Moreover, even fewer molecular genetic diagnostic tests are available for patients with oligozoospermia in the andrology clinic. Based on animal and gene expression studies of oligozoospermia, several molecular pathways may be disrupted in post-meiotic spermatozoa. One of the disrupted pathways is protein ubiquitination and cell apoptosis. A critical protein involved in this pathway is the ubiquitin-conjugating enzyme 2B, UBE2B. Absence of Ube2b in male mice causes spermatogenic meiotic disruption with increased apoptosis, leading to infertility. To examine the association between messenger RNA defects in UBE2B and severe oligozoospermia (0.1–10 × 106 cells/ml), sequencing of sperm cDNA in 326 oligozoospermic patients and 421 normozoospermic men was performed. mRNA alterations in UBE2B were identified in sperm in 4.6% (15 out of 326) of the oligozoospermic patients, but not found in control men, suggesting strong association between mRNA defects and oligozoospermia (χ2 = 19, P = 0.0001). Identified UBE2B alterations include nine splicing, four missense and two nonsense alterations. The follow-up screen of corresponding DNA regions did not reveal causative DNA mutations, suggesting a post-transcriptional nature of identified defects. None of these variants were reported in the dbSNP database, although other splicing abnormalities with low level of expression were present in 11 out of 421 (2.6%) controls. Our findings suggest that two distinct molecular mechanisms, mRNA editing and splicing processing, are disrupted in oligozoospermia. We speculate that the contribution of post-transcriptional mRNA defects to oligozoospermia could be greater than previously anticipated. PMID:23378580

  8. Common PHOX2B poly-alanine contractions impair RET gene transcription, predisposing to Hirschsprung disease.

    Science.gov (United States)

    Di Zanni, Eleonora; Adamo, Annalisa; Belligni, Elga; Lerone, Margherita; Martucciello, Giuseppe; Mattioli, Girolamo; Pini Prato, Alessio; Ravazzolo, Roberto; Silengo, Margherita; Bachetti, Tiziana; Ceccherini, Isabella

    2017-07-01

    HSCR is a congenital disorder of the enteric nervous system, characterized by the absence of neurons along a variable length of the gut resulting from loss-of-function RET mutations. Congenital Central Hypoventilation Syndrome (CCHS) is a rare neurocristopathy characterized by impaired response to hypercapnia and hypoxemia caused by heterozygous mutations of the PHOX2B gene, mostly polyalanine (polyA) expansions but also missense, nonsense, and frameshift mutations, while polyA contractions are common in the population and believed neutral. HSCR associated CCHS can present in patients carrying PHOX2B mutations. Indeed, RET expression is orchestrated by different transcriptional factors among which PHOX2B, thus suggesting its possible role in HSCR pathogenesis. Following the observation of HSCR patients carrying in frame trinucleotide deletions within the polyalanine stretch in exon 3 (polyA contractions), we have verified the hypothesis that these PHOX2B variants do reduce its transcriptional activity, likely resulting in a down-regulation of RET expression and, consequently, favouring the development of the HSCR phenotype. Using proper reporter constructs, we show here that the in vitro transactivation of the RET promoter by different HSCR-associated PHOX2B polyA variants has resulted significantly lower compared to the effect of PHOX2B wild type protein. In particular, polyA contractions do induce a reduced transactivation of the RET promoter, milder compared to the severe polyA expansions associated with CCHS+HSCR, and correlated with the length of the deleted trait, with a more pronounced effect when contractions are larger. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Journal of Fundamental and Applied Sciences - Vol 4, No 1 (2012)

    African Journals Online (AJOL)

    Journal of Fundamental and Applied Sciences - Vol 4, No 1 (2012) ... Spectroscopic Proprieties of Crystals Mf2 (M=Cd, Sr, Ba) Doped to Rare Earth Ions ... of Borovanadate Glass of Sodium by Raman Spectroscopy Low Frequencies · EMAIL ...

  10. Science, Technology and Arts Research Journal - Vol 2, No 4 (2013)

    African Journals Online (AJOL)

    Science, Technology and Arts Research Journal - Vol 2, No 4 (2013) ... Synteny Approach of Drug Target Prediction among Unique Hypothetical Proteins ... Family's regarding Child Nutrition (under 5 years of age) in Nekemte Town, Ethiopia ...

  11. Siim Nestor soovitab : Tallinn Doom Night vol.1. Odessa Pop / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2006-01-01

    Soome doom-metal ansambel Reverend Bizarre üritusel "Tallinn Doom Night vol.1" 8. dets. klubis Rockstar's. Indipoppi viljelev Rootsi duo My Darling Yoy! üritusel "Odessa Pop" 9. dets. Tallinnas klubis KuKu

  12. Arvustuse piirid ja auhinnad : mõtteid kirjanduskriitikast vol 2 / Jan Kaus

    Index Scriptorium Estoniae

    Kaus, Jan, 1971-

    2007-01-01

    Tänapäeva eesti kirjanduskriitikast. Vt. ka vol. 1: Kaus, Jan. Eetika, taburetiefekt ja jätkuv objektivisatsioon, Sirp, 15. juuni., lk. 7. Vastukaja: Raudam, Toomas. Arvustuse piiritused //Sirp (2007) 10. aug., lk. 9

  13. Arvustuse piirid ja auhinnad : mõtteid kirjanduskriitikast vol 2 / Jan Kaus

    Index Scriptorium Estoniae

    Kaus, Jan, 1971-

    2007-01-01

    Tänapäeva eesti kirjanduskriitikast. Vt. ka vol. 1: Kaus, Jan. Eetika, taburetiefekt ja jätkuv objektivisatsioon, Sirp, 15. juuni., lk. 7. Vastukaja: Raudam, Toomas. Arvustuse piiritused //Sirp (2007) 10. aug., lk. 9

  14. Journal of Research in National Development - Vol 10, No 3 (2012)

    African Journals Online (AJOL)

    Journal of Research in National Development - Vol 10, No 3 (2012) .... Marketing and 21 Century Technological Challenges: The Need for Curricula ... Trade Blocs and the Future of Global Marketing · EMAIL FULL TEXT EMAIL FULL TEXT

  15. African Journal of Range and Forage Science - Vol 13, No 1 (1996)

    African Journals Online (AJOL)

    African Journal of Range and Forage Science - Vol 13, No 1 (1996) ... on Lolium perenne L. pastures under subtropical conditions: herbage quality ... AU Triumph, Johnstone and Kentucky 31 tall fescue pastures versus maize silage in diets for ...

  16. 02 Inkanyiso Vol4N2 Akintayo and BabalolaFM.fm

    African Journals Online (AJOL)

    ian

    involvement, satisfaction and commitment among the workforce in Nigeria. ..... education institution in Malaysia', Journal of Management and Social Sciences, vol. 5, no. ... 'Diversity and emotion: the new frontiers in organizational behaviour.

  17. Inkanyiso: Journal of Humanities and Social Sciences - Vol 8, No 2 ...

    African Journals Online (AJOL)

    Inkanyiso: Journal of Humanities and Social Sciences - Vol 8, No 2 (2016) ... and health promotion · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Maximising the potential of social media to deliver academic library services to students: ...

  18. Siim Nestor soovitab : Tallinn Doom Night vol.1. Odessa Pop / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2006-01-01

    Soome doom-metal ansambel Reverend Bizarre üritusel "Tallinn Doom Night vol.1" 8. dets. klubis Rockstar's. Indipoppi viljelev Rootsi duo My Darling Yoy! üritusel "Odessa Pop" 9. dets. Tallinnas klubis KuKu

  19. East and Central African Journal of Surgery - Vol 12, No 2 (2007)

    African Journals Online (AJOL)

    East and Central African Journal of Surgery - Vol 12, No 2 (2007) ... Africa: Implication for training · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Breast fine needle aspiration cytology in a Nigerian tertiary hospital · EMAIL FREE FULL ...

  20. African Journal for the Psychological Study of Social Issues - Vol 5 ...

    African Journals Online (AJOL)

    African Journal for the Psychological Study of Social Issues - Vol 5, No 2 (2000) ... Influence of locus of control on conformity to authority in a multicultural ... Psychology and the increasing crime rate in Nigeria · EMAIL FULL TEXT EMAIL FULL ...

  1. Science, Technology and Arts Research Journal - Vol 4, No 2 (2015)

    African Journals Online (AJOL)

    Science, Technology and Arts Research Journal - Vol 4, No 2 (2015) ..... The Perception of Prospective Teachers toward Stakeholders' Experience in Practicum: The ... Analysis of Factors Affecting Watermelon Production in Ekiti State, Nigeria ...

  2. South African Journal of Geomatics, Vol. 4, No. 3, August 2015 ...

    African Journals Online (AJOL)

    EEUSER

    This research outlines a methodology of GIS analysis for Informal ... all households have facilities like toilets, running water and proper refuse ..... Decision Support System for Planning Wind Farms in Tuscany (Italy)',Renewable Energy, Vol.

  3. Index to Nuclear Safety: a technical progress review by chronology, permuted title, and author. Vol. 11(1)--Vol. 18(6)

    Energy Technology Data Exchange (ETDEWEB)

    Cottrell, W.B.; Klein, A.

    1978-04-11

    This index to Nuclear Safety covers articles published in Nuclear Safety, Vol. 11, No. 1 (January-February 1970), through Vol. 18, No. 6 (November-December 1977). It is divided into three sections: a chronological list of articles (including abstracts) followed by a permuted-title (KWIC) index and an author index. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center (NSIC), covers all safety aspects of nuclear power reactors and associated facilities. Over 450 technical articles published in Nuclear Safety in the last eight years are listed in this index.

  4. Index to Nuclear Safety. A technical progress review by chronology, permuted title, and author. Vol 11, No. 1 through Vol. 16, No. 6

    Energy Technology Data Exchange (ETDEWEB)

    Cottrell, W.B.; Klein, A.

    1976-04-01

    This index to Nuclear Safety covers articles in Nuclear Safety Vol. 11, No. 1 (Jan.-Feb. 1970) through Vol. 16, No. 6 (Nov.-Dec. 1975). Included in the index is a chronological list of articles (including abstract) followed by both a KWIC index and an Author Index. Nuclear Safety is a bimonthly technical progress review prepared by the Nuclear Safety Information Center and covers all safety aspects of nuclear power reactors and associated facilities. The index lists over 300 technical articles in the last six years of publication.

  5. Refined Sellmeier and thermo-optic dispersion formulas for Li2B4O7

    Science.gov (United States)

    Umemura, Nobuhiro; Watanabe, Jun; Matsuda, Daisuke; Kamimura, Tomosumi

    2017-03-01

    We report the high-accuracy Sellmeier and thermo-optic dispersion formulas for Li2B4O7, which provide an excellent reproduction of the temperature-dependent phase-matching conditions for second-harmonic generation (SHG) and sum-frequency generation (SFG) in the 0.2093–1.5352 µm range. In addition, Li2B4O7 was found to be nearly 90° phase-matchable for fifth-harmonic generation (5HG) of an Yb-doped fiber laser at 1.031 µm.

  6. 5-HT2B Receptor Antagonists Inhibit Fibrosis and Protect from RV Heart Failure

    OpenAIRE

    Wiebke Janssen; Yves Schymura; Tatyana Novoyatleva; Baktybek Kojonazarov; Mario Boehm; Astrid Wietelmann; Himal Luitel; Kirsten Murmann; Damian Richard Krompiec; Aleksandra Tretyn; Soni Savai Pullamsetti; Norbert Weissmann; Werner Seeger; Hossein Ardeschir Ghofrani; Ralph Theo Schermuly

    2015-01-01

    Objective. The serotonin (5-HT) pathway was shown to play a role in pulmonary hypertension (PH), but its functions in right ventricular failure (RVF) remain poorly understood. The aim of the current study was to investigate the effects of Terguride (5-HT2A and 2B receptor antagonist) or SB204741 (5-HT2B receptor antagonist) on right heart function and structure upon pulmonary artery banding (PAB) in mice. Methods. Seven days after PAB, mice were treated for 14 days with Terguride (0.2 mg/kg b...

  7. The Importance of Brand on B2B Markets: Case Study of Hilti

    OpenAIRE

    Konečný, Martin

    2012-01-01

    The brand is mostly associated with business-to-customer markets and environment. People would first think of such a brand, because we see marketing and advertising of those brands every day. But business-to-business brands are for companies also very important. The overall goal of my thesis would be to find out how the managers of a pure B2B company perceive the importance of brand in the B2B environment where the company operates. Theoretical part will, in the first chapter, characterize B2...

  8. The role of transcriptional coactivator ADA2b in Arabidopsis abiotic stress responses.

    Science.gov (United States)

    Vlachonasios, Konstantinos E; Kaldis, Athanasios; Nikoloudi, Adriana; Tsementzi, Despoina

    2011-10-01

    Plant growth and crop production can be greatly affected by common environmental stresses such as drought, high salinity and low temperatures. Gene expression is affected by several abiotic stresses. Stress-inducible genes are regulated by transcription factors and epigenetic mechanisms such as histone modifications. In this Mini-Review, we have explored the role of transcriptional adaptor ADA2b in Arabidopsis responses to abiotic stress. ADA2b is required for the expression of genes involved in abiotic stress either by controlling H3 and H4 acetylation in the case of salt stress or affecting nucleosome occupancy in low temperatures response.

  9. Examination of dioxin degradation conditions for geobacillus midousuji SH2B-J2

    Energy Technology Data Exchange (ETDEWEB)

    Hoshina, S. [Jikei Univ., School of Medicine, Tokyo (Japan); Ohtsuka, Y. [Forestry and Forest Products Research Instiute; Goda, H. [Towa Kagaku Co., Ltd.

    2004-09-15

    Cellular membrane degradation capability of SH2B-J2 strains for dioxin mixtures that are greater than tetra-chlorinated have been examined. Optimal temperature, reaction time, optimal pH, and heavy metal resistance of cellular membrane enzyme were investigated, to examine dioxin degradation characteristics of SH2B-J2 strains. For chlorinated dioxins, a mixture (PCDD/PCDF mix) containing 7 species of dibenzo-p-dioxins greater than tetra-chlorinated, as well as 10 isomers of dibenzofurans, was used. Using GC/MS, decrease of 17 species of dioxin isomer/congener was measured.

  10. An Inter-enterprise Workflow Model for Supply Chain and B2B E-commerce

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The goals of B2B electronic commerce and supply chain management system are to implement interoperability of independent enterprises, to smooth the information flow between them and to deploy business processes over multiple enterprises. The inherent characteristics of workflow system make it suitable to implement the cross organization management. This paper, firstly, proposes an inter-enterprises workflow model based on the agreement to support the construction of supply chain management system and B2B electronic commerce. This model has extended the standard workflow model. After that, an architecture which supports the model has been introduced, especially it details the structure and implementation of interfaces between enterprises.

  11. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  12. How to successfully present a solution in a B2B sales meeting

    OpenAIRE

    Klemola, Mari

    2013-01-01

    This thesis contains research on presenting a solution in a B2B (business-to-business) sales meeting. This thesis is planned to complement the existing course material in the solution selling course at HAAGA-HELIA University of Applied Sciences’ Degree Programme in Sales. The objective of this thesis was to create a handbook to students about how to successfully present a solution in a B2B sales meeting. This is the main research question. The secondary research questions are: (1) how to ...

  13. H2B ubiquitination regulates meiotic recombination by promoting chromatin relaxation

    OpenAIRE

    Xu, Zhiliang; Song,Zhenhua; Li, Guoping; Tu, Huayu; Liu, Weixiao; Liu, Yujiao; Wang, Pan; Wang, Yuanting; Cui, Xiuhong; Liu, Chao; Shang, Yongliang; de Rooij, Dirk G.; Gao, Fei; Li, Wei

    2016-01-01

    Meiotic recombination is essential for fertility in most sexually reproducing species, but the molecular mechanisms underlying this process remain poorly understood in mammals. Here, we show that RNF20-mediated H2B ubiquitination is required for meiotic recombination. A germ cell-specific knockout of the H2B ubiquitination E3 ligase RNF20 results in complete male infertility. The Stra8-Rnf20−/− spermatocytes arrest at the pachytene stage because of impaired programmed double-strand break (DSB...

  14. Competence Neworks: Effects on Corporate Branding in B2B SMEs

    OpenAIRE

    2015-01-01

    The purpose of this thesis is to investigate the effects of competence networks on corporate branding in B2B SMEs and to develop a conceptual model of these effects. After reviewing the relevant literature that explores the field, eight components of corporate branding in an effective growth stage of an SME have been identified. Founders Alliance is a competence network in Sweden that was chosen as a case for our study. Representatives of five B2B SMEs within Founders Alliance were interviewe...

  15. Progressive dysphagia in limb-girdle muscular dystrophy type 2B.

    LENUS (Irish Health Repository)

    Walsh, Richard

    2012-02-01

    Dysphagia has not been reported in genetically confirmed limb-girdle muscular dystrophy type 2B (LGMD2B). A 40-year-old woman reported exercise-induced calf pain at age 34, followed by progressive lower and upper limb weakness. At age 38, progressive dysphagia for solids, and subsequently liquids, ensued. Endoscopic and videofluoroscopic-radiological findings indicated a myopathic swallowing disorder. Molecular genetic analysis confirmed two dysferlin gene mutations consistent with a compound heterozygote state. Progressive dysphagia should be considered as part of the expanding dysferlinopathy phenotype.

  16. TiO2(B) nanoparticle-functionalized WO3 nanorods with enhanced gas sensing properties.

    Science.gov (United States)

    Zhang, Hongxin; Wang, Shurong; Wang, Yanshuang; Yang, Jiedi; Gao, Xueling; Wang, Liwei

    2014-06-14

    In this work, TiO2(B) nanoparticle (NP)-functionalized WO3 nanorods (NRs) were synthesized by a two-step solution strategy, with a hydrothermal process for WO3 NRs and hydrolyzation of Ti(OBu)4 for the functionalization of TiO2(B) NPs. Various techniques, including scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), and X-ray photoelectron spectroscopy (XPS), were employed to investigate the morphology, microstructure, crystalline nature and chemical composition of the prepared TiO2(B) NP-functionalized WO3 NRs. SEM and TEM results revealed that the TiO2(B)-WO3 composite showed a rod-like nanostructure with a diameter in the range from 93 to 154 nm and a rough surface, which could increase the accessible surface area and the amount of surface active sites, thus improving the properties or performance of the as-prepared composite NRs. XRD and XPS analysis clearly verified that monoclinic TiO2(B) NPs, a metastable polymorph of TiO2, were successfully supported on the WO3 NRs. Gas sensing measurement results for several common reductive organic gases such as acetone, ethanol, ether, methanol and formaldehyde demonstrated that the sensor based on the as-obtained TiO2(B) NP-functionalized WO3 NRs exhibited obviously enhanced responses compared with a pure WO3 NR based sensor, as well as fast response-recovery speeds, good reproducibility and good stability, indicating their promising application in gas sensors. The excellent gas sensing performance could be attributed to the unique 1D rod-like nanostructure with a rough surface, the existence of TiO2-WO3 heterojunctions and the catalytic effect of the TiO2(B) NPs. The as-prepared TiO2(B) NP-functionalized WO3 NRs will also have very good prospects in electrochromic devices and catalysis applications.

  17. Jusbetonin, the first indolo[3,2-b]quinoline alkaloid glycoside, from Justicia betonica.

    Science.gov (United States)

    Subbaraju, Gottumukkala V; Kavitha, Jakka; Rajasekhar, Dodda; Jimenez, Jorge I

    2004-03-01

    A new indolo[3,2-b]quinoline alkaloid glycoside, jusbetonin (1), and three known alkaloids, namely, 10H-quindoline (2), 6H-quinindoline (3), and 5H,6H-quinindolin-11-one (4), have been isolated from the leaves of Justicia betonica. The structure of 1 was established on the basis of 1D and 2D NMR ((1)H-(1)H COSY, HMQC, and HMBC) and HRFABMS data. Compound 1 is the first example of a glycosylated indolo[3,2-b]quinoline alkaloid, while compound 4 was isolated for the first time from a natural source.

  18. A New Evolution Mechanism Model for B2B E-Commerce Network

    OpenAIRE

    Zhihong Tian; Zhenji Zhang; Xiaolan Guan

    2013-01-01

    To study the structure and evolution mechanism of B2B e-commerce network, the authors propose a network with several layers description of B2B e-commerce market. The empirical analysis from Alibaba.com shows that degree distribution of the network structure follows power-law. Based on modified BA (Barabasi-Albert) model, a new model is proposed, adding layers, fitness parameters, and more reasonable growth mechanism. The model reveals that, the structure of the network is stable, and the aver...

  19. Anisotropic Multiband Many-Body Interactions in LuNi2B2C

    Energy Technology Data Exchange (ETDEWEB)

    Bergk, B.; Petzold, V.; Rosner, H.; Drechsler, S.-L.; Bartkowiak, M.; Ignatchik, O.; Bianchi, A. D.; Sheikin, I.; Canfield, P. C.; Wosnitza, J.

    2008-06-27

    We present a comprehensive de Haas-van Alphen study on the nonmagnetic borocarbide superconductor LuNi{sub 2}B{sub 2}C. The analysis of the angular-dependent effective masses for different bands in combination with full-potential density functional calculations allowed us to determine the mass-enhancement factors, {lambda}, for the different electronic bands and their wave-vector dependences. Our data clearly show the anisotropic multiband character of the superconductivity in LuNi{sub 2}B{sub 2}C.

  20. Efficient 266 nm Ultraviolet Beam Generation in K2Al2B2O7 Crystal

    Institute of Scientific and Technical Information of China (English)

    吕军华; 王桂玲; 许祖彦; 陈创天; 王继扬; 张承乾; 刘耀岗

    2002-01-01

    The ultraviolet beam at 266 nm was obtained by fourth harmonic generation of 1064 nm Nd:YAG laser radiation through a nonlinear crystal K2Al2 B2O7 (KABO). The fundamental frequency of a Hash-lamp pumped Nd: YAG laser was doubled in a β-Ba2B2O4 crystal to generate a second harmonic output at the wavelength of 532 nm,and then doubled again in the KABO crystal to generate the fourth harmonic output at 266 nm. The optical conversion efficiency from 532 to 266 nm was investigated for the first time, and 13% was achieved.

  1. Molecular and functional characterization of the first tick CAP2b (periviscerokinin) receptor from Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    The cDNA of the receptor for CAP2b/periviscerokinin (PVK) neuropeptides, designated Rhimi-CAP2b-R, was cloned from synganglia of tick Rhipicephalus (Boophilus) microplus. This receptor is the ortholog of the insect CAP2b/PVK receptor, as concluded from analyses of the predicted protein sequence, ph...

  2. Medullær thyroideacancer hos et ti måneder gammelt barn med multipel endokrin neoplasi 2B

    DEFF Research Database (Denmark)

    Mathiesen, Jes Sloth; Døssing, Helle; Bender, Lars;

    2014-01-01

    In infants at risk of multiple endocrine neoplasia type 2B (MEN2B) the American Thyroid Association recommends genetic testing as soon as possible after birth and that thyroidectomy should be performed in MEN2B RET-mutation positive individuals as soon as possible and if possible within the first...

  3. Molecular basis for positive and negative signaling by the natural killer cell receptor 2B4 (CD244).

    Science.gov (United States)

    Eissmann, Philipp; Beauchamp, Lisa; Wooters, Joe; Tilton, John C; Long, Eric O; Watzl, Carsten

    2005-06-15

    Triggering of 2B4 (CD244) can induce natural killer (NK)-cell activation, costimulation, or even inhibition of NK-cell activity. Here, we investigate the molecular basis for the different signals generated by 2B4. We show that the first immunoreceptor tyrosine-based switch motif (ITSM) within the cytoplasmic tail of 2B4 is sufficient for 2B4-mediated NK-cell activation, whereas the third ITSM can negatively influence 2B4 signaling. We further identify signaling molecules that associate with 2B4. Signaling lymphocyte activation molecule-associated protein (SAP) can bind to all 4 ITSMs of 2B4 in a phosphorylation-dependent manner. The phosphorylated third ITSM can additionally recruit the phosphatases SHP-1, SHP-2, SHIP, and the inhibitory kinase Csk. SAP acts as an inhibitor of interactions between 2B4 and these negative regulatory molecules, explaining how 2B4 inhibits NK-cell activation in the absence of functional SAP, as occurs in cells from patients with X-linked lymphoproliferative syndrome (XLP). Recently, another function for SAP was proposed: SAP can recruit the kinase Fyn to the SLAM (CD150) immune receptor. We now show that Fyn can also associate with phosphorylated 2B4. Finally, we demonstrate that Fyn and Csk can both phosphorylate 2B4, suggesting a possible mechanism of 2B4 phosphorylation.

  4. Early microgliosis precedes neuronal loss and behavioural impairment in mice with a frontotemporal dementia-causing CHMP2B mutation

    DEFF Research Database (Denmark)

    Clayton, Emma L; Mancuso, Renzo; Nielsen, Troels Tolstrup

    2017-01-01

    Frontotemporal dementia (FTD)-causing mutations in the CHMP2B gene lead to the generation of mutant C-terminally truncated CHMP2B. We report that transgenic mice expressing endogenous levels of mutant CHMP2B developed late-onset brain volume loss associated with frank neuronal loss and FTD...

  5. 26 CFR 301.6103(p)(2)(B)-1 - Disclosure of returns and return information by other agencies.

    Science.gov (United States)

    2010-04-01

    ... other agencies. 301.6103(p)(2)(B)-1 Section 301.6103(p)(2)(B)-1 Internal Revenue INTERNAL REVENUE... Information and Returns Returns and Records § 301.6103(p)(2)(B)-1 Disclosure of returns and return information... regulations thereunder, including, if applicable, safeguards imposed by section 6103(p)(4). (d) Records...

  6. 76 FR 2930 - International Product Change-Global Plus 1B and 2B Negotiated Service Agreements

    Science.gov (United States)

    2011-01-18

    ... Product Change--Global Plus 1B and 2B Negotiated Service Agreements AGENCY: Postal Service \\TM\\. ACTION... add Global Plus 1B and 2B Negotiated Service Agreements to the Competitive Products List pursuant to... Service to Add Global Plus 1B and 2B Negotiated Service Agreements to the Competitive Product List, and...

  7. Reseña: Critical Studies on Corporate Responsibility, Governance and Sustainability, Vol. 4 y 6

    Directory of Open Access Journals (Sweden)

    Adrián Zicari

    2014-10-01

    Full Text Available Corporate Social Irresponsibility: A Challenging Concept. Series: Critical Studies on Corporate Responsibility, Governance and Sustainability, Vol. 4. Ralph Tench, William Sun and Brian Jones, 2012, Emerald Group Publishing Limited, 315 pages. Communicating Corporate Social Responsibility Perspectives and Practice. Series: Critical Studies on Corporate Responsibility, Governance and Sustainability, Vol. 6. Ralph Tench, William Sun and Brian Jones, 2014, Emerald Group Publishing Limited, 456 pages

  8. Li4Ge2B as a new derivative of the Mo2B5 and Li5Sn2 structure types.

    Science.gov (United States)

    Pavlyuk, Volodymyr; Ciesielski, Wojciech; Rozdzynska-Kielbik, Beata; Dmytriv, Grygoriy; Ehrenberg, Helmut

    2016-07-01

    Binary and multicomponent intermetallic compounds based on lithium and p-elements of Groups III-V of the Periodic Table are useful as modern electrode materials in lithium-ion batteries. However, the interactions between the components in the Li-Ge-B ternary system have not been reported. The structure of tetralithium digermanium boride, Li4Ge2B, exhibits a new structure type, in the noncentrosymmetric space group R3m, in which all the Li, Ge and B atoms occupy sites with 3m symmetry. The title structure is closely related to the Mo2B5 and Li5Sn2 structure types, which crystallize in the centrosymmetric space group R-3m. All the atoms in the title structure are coordinated by rhombic dodecahedra (coordination number = 14), similar to the atoms in related structures. According to electronic structure calculations using the tight-binding-linear muffin-tin orbital-atomic spheres approximation (TB-LMTO-ASA) method, strong covalent Ge-Ge and Ge-B interactions were established.

  9. Structural basis for transcription regulation by alarmone ppGpp.

    Science.gov (United States)

    Artsimovitch, Irina; Patlan, Vsevolod; Sekine, Shun-ichi; Vassylyeva, Marina N; Hosaka, Takeshi; Ochi, Kozo; Yokoyama, Shigeyuki; Vassylyev, Dmitry G

    2004-04-30

    Guanosine-tetraphosphate (ppGpp) is a major regulator of stringent control, an adaptive response of bacteria to amino acid starvation. The 2.7 A resolution structure of the Thermus thermophilus RNA polymerase (RNAP) holoenzyme in complex with ppGpp reveals that ppGpp binds to the same site near the active center in both independent RNAP molecules in the crystal but in strikingly distinct orientations. Binding is symmetrical with respect to the two diphosphates of ppGpp and is relaxed with respect to the orientation of the nucleotide base. Different modes of ppGpp binding are coupled with asymmetry of the active site configurations. The results suggest that base pairing of ppGpp with cytosines in the nontemplate DNA strand might be an essential component of transcription control by ppGpp. We present experimental evidence highlighting the importance of base-specific contacts between ppGpp and specific cytosine residues during both transcription initiation and elongation.

  10. Rapidity dependence of particle densities in pp and AA collisions

    CERN Document Server

    Bautista, Irais; Milhano, Jose Guilherme; Dias de Deus, Jorge

    2012-01-01

    We use multiple scattering and energy conservation arguments to describe $dn/d\\eta_{NANA}$ as a function of $dn/d\\eta_{pp}$ in the framework of string percolation. We discuss the pseudo-rapidity $\\eta$? and beam rapidity Y dependence of particle densities. We present our results for pp, Au- Au, and Pb-Pb collisions at RHIC and LHC.

  11. Editor's welcome, PORTAL, Vol. 3, No. 1, January 2006

    Directory of Open Access Journals (Sweden)

    Paul Allatson

    2006-02-01

    Full Text Available Welcome to the first appearance of PORTAL for 2006 (vol. 3, no. 1, a special issue entitled ‘Other Worlds’ guest edited by James Goodman and Christina Ho from the Faculty of Humanities and Social Sciences, University of Technology Sydney (UTS. The papers collected in this special issue focus on what the guest editors call “the transformative power of social movements” that respond to the processes and discourses of globalization and globalism by generating alternative sites and spaces of agency, or ‘other worlds.’ The contributors to the issue originally presented papers at a conference held in April 2005 in Sydney, with the title ‘Other Worlds: Social Movements and the Making of Alternatives.’ That conference was organized by the Research Initiative on International Activism at UTS, and supported by the Research Committee on Social Movements and Collective Action of the International Sociological Association. The Editorial Committee of PORTAL would like to thank both institutions for their support of the event that led to this special issue. I would also like to thank Wayne Peake, Kate Barclay, and Murray Pratt for their editorial efforts in seeing this issue through to publication. The Editorial Committee is pleased to showcase in the Cultural Works Section a short meditative piece by local writer Joel Scott, who is currently undertaking studies in Pamplona, Spain. When considered in the context of the special issue’s discussions of ‘other worlds’ that precede it, Scott’s ‘God, We’re Not Immigrants! A Reflection on Moving and Staying,’ provides an evocative insight into the sociocultural and imaginative limits that may preclude the construction of alternative ‘worlds.’

  12. Noether gauge symmetry classes for pp-wave spacetimes

    CERN Document Server

    Camci, U

    2016-01-01

    The Noether gauge symmetries of geodesic Lagrangian for the pp-wave spacetimes are determined in each of the Noether gauge symmetry classes of the pp-wave spacetimes. It is shown that a type N pp-wave spacetime can admit at most three Noether gauge symmetry, and furthermore the number of Noether gauge symmetries turn out to be four, five, six, seven and eight. We found that all conformally flat plane wave spacetimes admit the maximal, i.e. ten, Noether gauge symmetry. Also it is found that if the pp-wave spacetime is non-conformally flat plane wave, then the number of Noether gauge symmetry is nine or ten. By means of the obtained Noether constants the search of the exact solutions of the geodesic equations for the pp-wave spacetimes is considered and we found new exact solutions of the geodesic equations in some special Noether gauge symmetry classes.

  13. CYP2B6*6 and CYP2B6*18 Predict Long-Term Efavirenz Exposure Measured in Hair Samples in HIV-Positive South African Women.

    Science.gov (United States)

    Röhrich, Carola R; Drögemöller, Britt I; Ikediobi, Ogechi; van der Merwe, Lize; Grobbelaar, Nelis; Wright, Galen E B; McGregor, Nathaniel; Warnich, Louise

    2016-06-01

    Long-term exposure to efavirenz (EFV) measured in hair samples may predict response to antiretroviral treatment (ART). Polymorphisms in CYP2B6 are known to alter EFV levels. The aim of this study was to assess the relationship between CYP2B6 genotype, EFV levels measured in hair, and virological outcomes on ART in a real-world setting. We measured EFV levels in hair from HIV-positive South African females who had been receiving EFV-based treatment for at least 3 months from the South African Black (SAB) (n = 81) and Cape Mixed Ancestry (CMA) (n = 53) populations. Common genetic variation in CYP2B6 was determined in 15 individuals from each population using bidirectional Sanger sequencing. Prioritized variants (n = 16) were subsequently genotyped in the entire patient cohort (n = 134). The predictive value of EFV levels in hair and selected variants in CYP2B6 on virological treatment outcomes was assessed. Previously described alleles (CYP2B6*2, CYP2B6*5, CYP2B6*6, CYP2B6*17, and CYP2B6*18), as well as two novel alleles (CYP2B6*31 and CYP2B6*32), were detected in this study. Compared to noncarriers, individuals homozygous for CYP2B6*6 had ∼109% increased EFV levels in hair (p = .016) and CYP2B6*18 heterozygotes demonstrated 82% higher EFV hair levels (p = .0006). This study confirmed that alleles affecting CYP2B6 metabolism and subsequent EFV exposure are present at significant frequencies in both the SAB and CMA populations. Furthermore, this study demonstrated that the use of hair samples for testing EFV concentrations may be a useful tool in determining long-term drug exposure in resource-limited countries.

  14. MOLECULAR CLONING AND HETEROLOGOUS EXPRESSION OF HUMAN INTERFERON ALPHA2b GENE

    Directory of Open Access Journals (Sweden)

    I. Made Artika

    2013-01-01

    Full Text Available Human alpha Interferons (hIFNα have been shown to have antiviral, antiproliferative and immunomodulatory activities. The human interferon alpha2b (hIFNα2b, is one of the human interferon alpha2 sub variants, naturally synthesized as a polypeptide of 188 amino acid residues, the first 23 residues of which represents a signal peptide. In the present study, the hIFNα2b gene was expressed after being fused with Glutathione S-Transferase (GST gene. The hIFNα2b gene was amplified from human genomic DNA by using a pair of specific primers, cloned into an Escherichia coli expression vector and expressed in E. coli cells under the direction of the tac promoter. The expressed protein was purified using a one-step affinity chromatography column containing immobilized gluthatione-bound resin. The purified protein was shown to react specifically with anti-human-interferon-alpha antibody, confirming that the protein was the human interferon alpha molecule. This strategy has the potential to be used as an alternative mean for production of pure human interferon α proteins for therapeutic purposes and for further studies on their molecular characterization and mechanism of action.

  15. Johnston Atoll Site 2B-P 6/30/2000 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 7 and 8 meters along a permanent transect.

  16. Johnston Atoll Site 2B-P 6/30/2000 24-25M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 24 and 25 meters along a permanent transect.

  17. Johnston Atoll Site 2B-P 6/30/2000 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 37 and 38 meters along a permanent transect.

  18. Johnston Atoll Site 2B-P 6/30/2000 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 38 and 39 meters along a permanent transect.

  19. Improved Serodiagnosis of Cystic Echinococcosis Using the New Recombinant 2B2t Antigen

    Science.gov (United States)

    Hernández-González, Ana; Santivañez, Saúl; García, Héctor H.; Rodríguez, Silvia; Muñoz, Santiago; Ramos, Guillermo; Orduña, Antonio; Siles-Lucas, Mar

    2012-01-01

    A standardized test for the serodiagnosis of human cystic echinococcosis (CE) is still needed, because of the low specificity and sensitivity of the currently available commercial tools and the lack of proper evaluation of the existing recombinant antigens. In a previous work, we defined the new ELISA-B2t diagnostic tool for the detection of specific IgGs in CE patients, which showed high sensitivity and specificity, and was useful in monitoring the clinical evolution of surgically treated CE patients. Nevertheless, this recombinant antigen gave rise to false-negative results in a percentage of CE patients. Therefore, in an attempt to improve its sensitivity, we constructed B2t-derived recombinant antigens with two, four and eight tandem repeat of B2t units, and tested them by ELISA on serum samples of CE patients and patients with related parasites. The best diagnostic values were obtained with the two tandem repeat 2B2t antigen. The influence of several clinical variables on the performance of the tests was also evaluated. Finally, the diagnostic performance of the 2B2t-ELISA was compared with that of an indirect haemagglutination commercial test. The 2B2t recombinant antigen performed better than the HF and B2t antigens, and the IHA commercial kit. Therefore, this new 2B2t-ELISA is a promising candidate test for the serodiagnosis of CE in clinical settings. PMID:22802975

  20. One-pot synthesis of acenaphtho[1,2-b]furan derivatives

    Institute of Scientific and Technical Information of China (English)

    Mohammad Taghi Goldani; Reza Sandaroos; Saman Damavandi

    2012-01-01

    New 9-(alkyl or aryl)acenaphtho[ 1,2-b]furan-8-(alky or aryl)amine compounds has herein been reported by one-pot reaction of (acenaphthylen-l-yloxy)trimethylsilane,alkyl and aryl aldehydes,and aryl and alky isocyanides in refluxing DMF.

  1. 14 CFR Special Federal Aviation... - Mitsubishi MU-2B Series Special Training, Experience, and Operating Requirements

    Science.gov (United States)

    2010-01-01

    ... Balance A. Aircraft Loading Procedures B. Limitations 1. Weight Limits 2. C.G. Limits C. Plotter 1..., runway length, surface conditions, wind direction and velocity, brake heat energy, and any other... conditions. (c) No person may operate a Mitsubishi MU-2B series airplane unless a copy of the appropriate...

  2. Data of evolutionary structure change: 1DJ2B-1ADIB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DJ2B-1ADIB 1DJ2 1ADI B B IGSLSQVSGVLGCQWGDEGKGKLVDILAQHFDIVARCQG...LLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADI...LY CA 195 PHE CA 263 LYS CA 227 TYR CA 251 1ADI B 1ADIB 1 1ADI B 1ADI

  3. A Cross-Industry Review of B2B Critical Success Factors.

    Science.gov (United States)

    Eid, Riyad; Trueman, Myfanwy; Ahmed, Abdel Moneim

    2002-01-01

    Presents a comprehensive review of B2B (business-to- business) international Internet marketing and identifies 21 critical success factors in five categories: marketing strategy, including management support, strategic goals, and collaboration; Web site factors, including Web site design; global factors, including multilanguage sites and cultural…

  4. The 4W framework for B2B e-contracting

    NARCIS (Netherlands)

    Angelov, Samuil; Grefen, Paul

    2003-01-01

    Contracts are fundamental to the engagement of companies in commercial relations. B2B electronic contracting aims to improve the efficiency and effectiveness of the contracting process and to provide new opportunities for the contracting parties. Virtual enterprises, for example, can be dynamically

  5. A process-stakeholder analysis of B2B industry standardisation

    NARCIS (Netherlands)

    Rodon, J.; Ramis-Pujol, J.; Christiaanse, E.

    2007-01-01

    Purpose - Interoperability standards are a crucial aspect in the development of B2B e-business. The aim of this paper is to understand how standardisation evolves by analysing the interplay between activities and stakeholders within the process. Unlike most of the IS research that focuses on the und

  6. Using the Internet for B2B Activities: A Review and Future Directions for Research.

    Science.gov (United States)

    Gattiker, Urs E.; Perlusz, Stefano; Bohmann, Kristoffer

    2000-01-01

    Illustrates some of the challenges that electronic commerce practitioners and researchers face, focusing on business to business (B2B) transactions. Highlights include a conceptual framework of Web user behavior; purchasing context; socio-demographic characteristics; cultural factors; economic factors; attitudes toward information technology;…

  7. On the critical success factors for B2B e-marketplace

    Directory of Open Access Journals (Sweden)

    Sareh Ahmad Khan Beige

    2015-01-01

    Full Text Available Advancement of network technology, quick growth of Internet and Internet based solutions lead many firms to apply online processes as well as electronic businesses. Internet based B2B E-C requires applying Internet and affiliated technologies for exchanging products, services and information. Implementation of business to business (B2B requires long-term commitment of organizations. Carrying out research in this field is regarded as very important issue for recognizing effective factors on successful implementation and execution of B2B and determining current status of organization. This research deals with studying effective critical factors on successful implementation and execution of B2B. Factors are recognized through studying literature review and IT experts. Then, through case study (studying a vehicle manufacturing firm and by using analytical network process (ANP, the importance of factor and their rank are determined. The factors that are regarded at this research are including: culture, commitment and support of senior management, government support, purposes, organizational strategies, trust, partial advantage and technical infrastructure. Results of research show that support and commitment of senior management are the highest priority factors.

  8. Enabling low cost biopharmaceuticals: high level interferon alpha-2b production in Trichoderma reesei.

    Science.gov (United States)

    Landowski, Christopher P; Mustalahti, Eero; Wahl, Ramon; Croute, Laurence; Sivasiddarthan, Dhinakaran; Westerholm-Parvinen, Ann; Sommer, Benjamin; Ostermeier, Christian; Helk, Bernhard; Saarinen, Juhani; Saloheimo, Markku

    2016-06-10

    The filamentous fungus Trichoderma reesei has tremendous capability to secrete over 100 g/L of proteins and therefore it would make an excellent host system for production of high levels of therapeutic proteins at low cost. We have developed T. reesei strains suitable for production of therapeutic proteins by reducing the secreted protease activity. Protease activity has been the major hindrance to achieving high production levels. We have constructed a series of interferon alpha-2b (IFNα-2b) production strains with 9 protease deletions to gain knowledge for further strain development. We have identified two protease deletions that dramatically improved the production levels. Deletion of the subtilisin protease slp7 and the metalloprotease amp2 has enabled production levels of IFNα-2b up to 2.1 and 2.4 g/L, respectively. With addition of soybean trypsin protease inhibitor the level of production improved to 4.5 g/L, with an additional 1.8 g/L still bound to the secretion carrier protein. High levels of IFNα-2b were produced using T. reesei strains with reduced protease secretion. Further strain development can be done to improve the production system by reducing protease activity and improving carrier protein cleavage.

  9. An oxazolo[3,2-b]indazole route to 1H-indazolones.

    Science.gov (United States)

    Oakdale, James S; Solano, Danielle M; Fettinger, James C; Haddadin, Makhluf J; Kurth, Mark J

    2009-07-02

    The novel heterocycle 2,3-dihydrooxazolo[3,2-b]indazole has been synthesized and utilized to provide easy access to 1H-indazolones, particularly the previously unreported 2-(2-alkoxyethyl)-1H-indazol-3(2H)-ones. Mechanistic as well as optimization and reaction scope studies are reported.

  10. Johnston Atoll Site 2B-P 6/30/2000 14-15M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 14 and 15 meters along a permanent transect.

  11. Johnston Atoll Site 2B-P 6/30/2000 8-9M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 8 and 9 meters along a permanent transect.

  12. Johnston Atoll Site 2B-P 6/30/2000 6-7M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 6 and 7 meters along a permanent transect.

  13. Johnston Atoll Site 2B-P 6/30/2000 13-14M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 13 and 14 meters along a permanent transect.

  14. Johnston Atoll Site 2B-P 6/30/2000 27-28M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 27 and 28 meters along a permanent transect.

  15. Johnston Atoll Site 2B-P 6/30/2000 29-30M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 29 and 30 meters along a permanent transect.

  16. Johnston Atoll Site 2B-P 6/30/2000 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 2 and 3 meters along a permanent transect.

  17. Johnston Atoll Site 2B-P 6/30/2000 33-34M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 33 and 34 meters along a permanent transect.

  18. Johnston Atoll Site 2B-P 6/30/2000 26-27M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 26 and 27 meters along a permanent transect.

  19. Johnston Atoll Site 2B-P 6/30/2000 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 11 and 12 meters along a permanent transect.

  20. Johnston Atoll Site 2B-P 6/30/2000 3-4M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 3 and 4 meters along a permanent transect.

  1. Johnston Atoll Site 2B-P 6/30/2000 17-18M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 17 and 18 meters along a permanent transect.

  2. Johnston Atoll Site 2B-P 6/30/2000 5-6M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 5 and 6 meters along a permanent transect.

  3. Johnston Atoll Site 2B-P 6/30/2000 32-33M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 32 and 33 meters along a permanent transect.

  4. Johnston Atoll Site 2B-P 6/30/2000 35-36M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 35 and 36 meters along a permanent transect.

  5. Johnston Atoll Site 2B-P 6/30/2000 41-42M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 41 and 42 meters along a permanent transect.

  6. Hysteresis in the field-induced magnetic structure in TmNi2B2C

    DEFF Research Database (Denmark)

    Eskildsen, M.R.; Harada, K.; Gammel, P.L:

    1999-01-01

    Using small-angle neutron scattering we have studied the flux line lattice and the magnetic structure in TmNi2B2C. With an applied field parallel to the crystalline c-axis several magnetic and flux line lattice symmetry transitions have been reported. The subject of this paper is the held-induced...

  7. Structure and assembly of group B streptococcus pilus 2b backbone protein.

    Science.gov (United States)

    Cozzi, Roberta; Malito, Enrico; Lazzarin, Maddalena; Nuccitelli, Annalisa; Castagnetti, Andrea; Bottomley, Matthew J; Margarit, Immaculada; Maione, Domenico; Rinaudo, C Daniela

    2015-01-01

    Group B Streptococcus (GBS) is a major cause of invasive disease in infants. Like other Gram-positive bacteria, GBS uses a sortase C-catalyzed transpeptidation mechanism to generate cell surface pili from backbone and ancillary pilin precursor substrates. The three pilus types identified in GBS contain structural subunits that are highly immunogenic and are promising candidates for the development of a broadly-protective vaccine. Here we report the X-ray crystal structure of the backbone protein of pilus 2b (BP-2b) at 1.06Å resolution. The structure reveals a classical IgG-like fold typical of the pilin subunits of other Gram-positive bacteria. The crystallized portion of the protein (residues 185-468) encompasses domains D2 and D3 that together confer high stability to the protein due to the presence of an internal isopeptide bond within each domain. The D2+D3 region, lacking the N-terminal D1 domain, was as potent as the entire protein in conferring protection against GBS challenge in a well-established mouse model. By site-directed mutagenesis and complementation studies in GBS knock-out strains we identified the residues and motives essential for assembly of the BP-2b monomers into high-molecular weight complexes, thus providing new insights into pilus 2b polymerization.

  8. Structure and assembly of group B streptococcus pilus 2b backbone protein.

    Directory of Open Access Journals (Sweden)

    Roberta Cozzi

    Full Text Available Group B Streptococcus (GBS is a major cause of invasive disease in infants. Like other Gram-positive bacteria, GBS uses a sortase C-catalyzed transpeptidation mechanism to generate cell surface pili from backbone and ancillary pilin precursor substrates. The three pilus types identified in GBS contain structural subunits that are highly immunogenic and are promising candidates for the development of a broadly-protective vaccine. Here we report the X-ray crystal structure of the backbone protein of pilus 2b (BP-2b at 1.06Å resolution. The structure reveals a classical IgG-like fold typical of the pilin subunits of other Gram-positive bacteria. The crystallized portion of the protein (residues 185-468 encompasses domains D2 and D3 that together confer high stability to the protein due to the presence of an internal isopeptide bond within each domain. The D2+D3 region, lacking the N-terminal D1 domain, was as potent as the entire protein in conferring protection against GBS challenge in a well-established mouse model. By site-directed mutagenesis and complementation studies in GBS knock-out strains we identified the residues and motives essential for assembly of the BP-2b monomers into high-molecular weight complexes, thus providing new insights into pilus 2b polymerization.

  9. Johnston Atoll Site 2B-P 6/30/2000 4-5M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 4 and 5 meters along a permanent transect.

  10. Do self-service technologies affect interfirm relationships? A B2B perspective

    Directory of Open Access Journals (Sweden)

    Raechel Johns

    2014-11-01

    Full Text Available While considerable literature examines business-to business (B2B relationships, the impact of technology on these relationships has lacked attention. IT has impacted the way businesses operate in a B2B context as well as influencing services by altering the way services are delivered. To understand the way in which Internet technology has impacted these B2B services, it is essential to examine its impact not only on business processes but on business relationships too. One technology, enabled by modern Internet technologies, which is changing the nature of business relationships is the increased use of self-service technologies (SSTs or technology-enabled services, however, there is a shortage of research in the area in a B2B context. The discussion in this paper provides an overview of the impact of IT on business relationships, using Relationship Marketing theory to provide a theoretical framework. A qualitative study in the Australian banking industry provides findings relating to the theory. The findings of this study provide evidence that while traditional Relationship Marketing theory is still applicable for some business customers, new theory is required for business customers who do not seek relationships. With both practical and theoretical implications, the research detailed in this paper makes a useful contribution to the literature and indicates the necessity for further research to be developed which explores business customers who prefer to remain transaction-oriented, rather than develop interpersonal relationships.

  11. Graft-derived anti-HPA-2b production after allogeneic bone-marrow transplantation

    DEFF Research Database (Denmark)

    Taaning, E; Jacobsen, N; Morling, N

    1994-01-01

    We report on a male who received a bone-marrow allograft from his HLA identical sister for acute myelogenous leukaemia. After transplantation, the patient suffered from refractoriness to the transfusions of HLA-matched platelets and a strong platelet-specific antibody, anti-HPA-2b, of IgG1 subcla...

  12. Johnston Atoll Site 2B-P 6/30/2000 12-13M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 12 and 13 meters along a permanent transect.

  13. Designing the marketing-sales interface in B2B firms

    NARCIS (Netherlands)

    Biemans, W.G.; Makovec Brencic, M.

    2007-01-01

    Purpose - This paper explores the marketing-sales interface in Dutch and Slovenian B2B firms. Design/methodology/approach - The study included 11 Dutch firms and ten Slovenian firms, with both samples as closely matched as possible. The firms were all manufacturers of physical products that operate

  14. Johnston Atoll Site 2B-P 6/30/2000 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Johnston Atoll, site 2B-P (16 45.606N, 169 30.705W), between 10 and 11 meters along a permanent transect.

  15. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2013

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Crane Creek. Water-Data Report 2013 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  16. Water‐Data Report 413721083124001 Pool 2B at Ottawa NWR-2014

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Water levels and water quality parameters recorded on Crane Creek. Water-Data Report 2014 413721083124001 Pool 2B at Ottawa NWR LOCATION: Lat. 41°37'21.08"N, long...

  17. New High-Pressure Gallium Borate Ga2B3O7(OH) with Photocatalytic Activity.

    Science.gov (United States)

    Vitzthum, Daniela; Schauperl, Michael; Strabler, Christof M; Brüggeller, Peter; Liedl, Klaus R; Griesser, Ulrich J; Huppertz, Hubert

    2016-01-19

    The new high-pressure gallium borate Ga2B3O7(OH) was synthesized in a Walker-type multianvil apparatus under high-pressure/high-temperature conditions of 10.5 GPa and 700 °C. For the system Ga-B-O-H, it is only the second known compound next to Ga9B18O33(OH)15·H3B3O6·H3BO3. The crystal structure of Ga2B3O7(OH) was determined by single-crystal X-ray diffraction data collected at room temperature. Ga2B3O7(OH) crystallizes in the orthorhombic space group Cmce (Z = 8) with the lattice parameters a = 1050.7(2) pm, b = 743.6(2) pm, c = 1077.3(2) pm, and V = 0.8417(3) nm(3). Vibrational spectroscopic methods (Raman and IR) were performed to confirm the presence of the hydroxyl group. Furthermore, the band gap of Ga2B3O7(OH) was estimated via quantum-mechanical density functional theory calculations. These results led to the assumption that our gallium borate could be a suitable substance to split water photocatalytically, which was tested experimentally.

  18. A Cross-Industry Review of B2B Critical Success Factors.

    Science.gov (United States)

    Eid, Riyad; Trueman, Myfanwy; Ahmed, Abdel Moneim

    2002-01-01

    Presents a comprehensive review of B2B (business-to- business) international Internet marketing and identifies 21 critical success factors in five categories: marketing strategy, including management support, strategic goals, and collaboration; Web site factors, including Web site design; global factors, including multilanguage sites and cultural…

  19. Rapid protocol for visualization of rust fungi structures using fluorochrome Uvitex 2B.

    Science.gov (United States)

    Dugyala, Sheshanka; Borowicz, Pawel; Acevedo, Maricelis

    2015-01-01

    Histological examination using fluorochromes is one of the standard methods for observation of microorganisms in tissues and other compartments. In the study of fungi, especially those that cannot be cultured in axenic media such as biotrophic fungi, histological examination of processes associated with the fungal growth, differentiation, infection and other cellular functions can lead to the better understanding of host-parasite interactions. Fluorescence microscopy coupled with Fluorochrome Uvitex 2B have been extensively utilized to study rust fungi structures and host-pathogen interactions. In this study, we report development of a rapid staining protocol of the rust fungus Puccinia triticina using fluorochrome Uvitex 2B. The newly developed rapid procedure was compared with a standard staining technique to observe in planta fungal infection structures development during the wheat-Puccinia triticina interaction. While significantly reducing the time for staining, the rapid protocol described here was equally efficient or better compared to standard procedure in detecting fungal infection structures using Uvitex 2B. In the rapid staining procedure, pre-heating of the stain increased efficiency to detect all the infection structures including haustoria with highly reduced background noise from plant tissue. This staining process described here is simple and quick. It can be completed in 4 h, which is of 6 times faster than the standard Uvitex 2B staining procedure.

  20. genetic overexpression of NR2B subunit enhances social recognition memory for different strains and species.

    Directory of Open Access Journals (Sweden)

    Stephanie A Jacobs

    Full Text Available The ability to learn and remember conspecifics is essential for the establishment and maintenance of social groups. Many animals, including humans, primates and rodents, depend on stable social relationships for survival. Social learning and social recognition have become emerging areas of interest for neuroscientists but are still not well understood. It has been established that several hormones play a role in the modulation of social recognition including estrogen, oxytocin and arginine vasopression. Relatively few studies have investigated how social recognition might be improved or enhanced. In this study, we investigate the role of the NMDA receptor in social recognition memory, specifically the consequences of altering the ratio of the NR2B:NR2A subunits in the forebrain regions in social behavior. We produced transgenic mice in which the NR2B subunit of the NMDA receptor was overexpressed postnatally in the excitatory neurons of the forebrain areas including the cortex, amygdala and hippocampus. We investigated the ability of both our transgenic animals and their wild-type littermate to learn and remember juvenile conspecifics using both 1-hr and 24-hr memory tests. Our experiments show that the wild-type animals and NR2B transgenic mice preformed similarly in the 1-hr test. However, transgenic mice showed better performances in 24-hr tests of recognizing animals of a different strain or animals of a different species. We conclude that NR2B overexpression in the forebrain enhances social recognition memory for different strains and animal species.

  1. Construction of a 3D model of cytochrome P450 2B4.

    Science.gov (United States)

    Chang, Y T; Stiffelman, O B; Vakser, I A; Loew, G H; Bridges, A; Waskell, L

    1997-02-01

    A three-dimensional structural model of rabbit phenobarbital-inducible cytochrome P450 2B4 (LM2) was constructed by homology modeling techniques previously developed for building and evaluating a 3D model of the cytochrome P450choP isozyme. Four templates with known crystal structures including cytochrome P450cam, terp, BM-3 and eryF were used in multiple sequence alignments and construction of the cytochrome P450 2B4 coordinates. The model was evaluated for its overall quality using available protein analysis programs and found to be satisfactory. The model structure was stable at room temperature during a 140 ps unconstrained full protein molecular dynamics simulation. A putative substrate access channel and binding site were identified. Two different substrates, benzphetamine and androstenedione, that are metabolized by cytochrome P450 2B4 with pronounced product specificity were docked into the putative binding site. Two orientations were found for each substrate that could lead to the observed preferred products. Using a geometric fit method three regions on the surface of the model cytochrome P450 structure were identified as possible sites for interaction with cytochrome b5, a redox partner of P450 2B4. Residues that may interact with the substrates and with cytochrome b5 have been identified and mutagenesis studies are currently in progress.

  2. Lung injury pathways: Adenosine receptor 2B signaling limits development of ischemic bronchiolitis obliterans organizing pneumonia.

    Science.gov (United States)

    Densmore, John C; Schaid, Terry R; Jeziorczak, Paul M; Medhora, Meetha; Audi, Said; Nayak, Shraddha; Auchampach, John; Dwinell, Melinda R; Geurts, Aron M; Jacobs, Elizabeth R

    2017-02-01

    Purpose/Aim of the Study: Adenosine signaling was studied in bronchiolitis obliterans organizing pneumonia (BOOP) resulting from unilateral lung ischemia. Ischemia was achieved by either left main pulmonary artery or complete hilar ligation. Sprague-Dawley (SD) rats, Dahl salt sensitive (SS) rats and SS mutant rat strains containing a mutation in the A2B adenosine receptor gene (Adora2b) were studied. Adenosine concentrations were measured in bronchoalveolar lavage (BAL) by HPLC. A2A (A2AAR) and A2B adenosine receptor (A2BAR) mRNA and protein were quantified. Twenty-four hours after unilateral PA ligation, BAL adenosine concentrations from ischemic lungs were increased relative to contralateral lungs in SD rats. A2BAR mRNA and protein concentrations were increased after PA ligation while miR27a, a negatively regulating microRNA, was decreased in ischemic lungs. A2AAR mRNA and protein concentrations remained unchanged following ischemia. A2BAR protein was increased in PA ligated lungs of SS rats after 7 days, and 4 h after complete hilar ligation in SD rats. SS-Adora2b mutants showed a greater extent of BOOP relative to SS rats, and greater inflammatory changes. Increased A2BAR and adenosine following unilateral lung ischemia as well as more BOOP in A2BAR mutant rats implicate a protective role for A2BAR signaling in countering ischemic lung injury.

  3. Flexibility in crosstalk between H2B ubiquitination and H3 methylation in vivo

    NARCIS (Netherlands)

    Vlaming, Hanneke; van Welsem, Tibor; de Graaf, Erik L; Ontoso, David; Altelaar, A F Maarten; San-Segundo, Pedro A; Heck, Albert J R; van Leeuwen, Fred

    2014-01-01

    Histone H2B ubiquitination is a dynamic modification that promotes methylation of histone H3K79 and H3K4. This crosstalk is important for the DNA damage response and has been implicated in cancer. Here, we show that in engineered yeast strains, ubiquitins tethered to every nucleosome promote H3K79 a

  4. Flexibility in crosstalk between H2B ubiquitination and H3 methylation in vivo (Corrigendum)

    NARCIS (Netherlands)

    Vlaming, Hanneke; van Welsem, Tibor; de Graaf, Erik L; Ontoso, David; Altelaar, A F Maarten; San-Segundo, Pedro A; Heck, Albert J R; van Leeuwen, Fred

    2014-01-01

    Histone H2B ubiquitination is a dynamic modification that promotes methylation of histone H3K79 and H3K4. This crosstalk is important for the DNA damage response and has been implicated in cancer. Here, we show that in engineered yeast strains, ubiquitins tethered to every nucleosome promote H3K79 a

  5. An expedient and new synthesis of pyrrolo[1,2-b]pyridazine derivatives

    Directory of Open Access Journals (Sweden)

    Rajeshwar Reddy Sagyam

    2009-11-01

    Full Text Available The reaction of 2-[2-(4-fluorophenyl-2-oxo-1-phenylethyl]-4-methyl-3-oxo-pentanoic acid phenylamide with tertiary butyl carbazate and subsequent condensation of the resulting carbamate derivative with a chalcone provided a facile new approach to pyrrolo[1,2-b]pyridazine derivatives.

  6. Mutation screening of GRIN2B in schizophrenia and autism spectrum disorder in a Japanese population

    Science.gov (United States)

    Takasaki, Yuto; Koide, Takayoshi; Wang, Chenyao; Kimura, Hiroki; Xing, Jingrui; Kushima, Itaru; Ishizuka, Kanako; Mori, Daisuke; Sekiguchi, Mariko; Ikeda, Masashi; Aizawa, Miki; Tsurumaru, Naoko; Iwayama, Yoshimi; Yoshimi, Akira; Arioka, Yuko; Yoshida, Mami; Noma, Hiromi; Oya-Ito, Tomoko; Nakamura, Yukako; Kunimoto, Shohko; Aleksic, Branko; Uno, Yota; Okada, Takashi; Ujike, Hiroshi; Egawa, Jun; Kuwabara, Hitoshi; Someya, Toshiyuki; Yoshikawa, Takeo; Iwata, Nakao; Ozaki, Norio

    2016-01-01

    N-methyl-d-aspartate receptors (NMDARs) play a critical role in excitatory synaptic transmission and plasticity in the central nervous systems. Recent genetics studies in schizophrenia (SCZ) show that SCZ is susceptible to NMDARs and the NMDAR signaling complex. In autism spectrum disorder (ASD), several studies report dysregulation of NMDARs as a risk factor for ASD. To further examine the association between NMDARs and SCZ/ASD development, we conducted a mutation screening study of GRIN2B which encodes NR2B subunit of NMDARs, to identify rare mutations that potentially cause diseases, in SCZ and ASD patients (n = 574 and 152, respectively). This was followed by an association study in a large sample set of SCZ, ASD, and normal healthy controls (n = 4145, 381, and 4432, respectively). We identified five rare missense mutations through the mutation screening of GRIN2B. Although no statistically significant association between any single mutation and SCZ or ASD was found, one of its variant, K1292R, is found only in the patient group. To further examine the association between mutations in GRIN2B and SCZ/ASD development, a larger sample size and functional experiments are needed. PMID:27616045

  7. The A2B adenosine receptor impairs the maturation and immunogenicity of dendritic cells.

    Science.gov (United States)

    Wilson, Jeffrey M; Ross, William G; Agbai, Oma N; Frazier, Renea; Figler, Robert A; Rieger, Jayson; Linden, Joel; Ernst, Peter B

    2009-04-15

    The endogenous purine nucleoside adenosine is an important antiinflammatory mediator that contributes to the control of CD4(+) T cell responses. While adenosine clearly has direct effects on CD4(+) T cells, it remains to be determined whether actions on APC such as dendritic cells (DC) are also important. In this report we characterize DC maturation and function in BMDC stimulated with LPS in the presence or absence of the nonselective adenosine receptor agonist NECA (5'-N-ethylcarboxamidoadenosine). We found that NECA inhibited TNF-alpha and IL-12 in a concentration-dependent manner, whereas IL-10 production was increased. NECA-treated BMDC also expressed reduced levels of MHC class II and CD86 and were less effective at stimulating CD4(+) T cell proliferation and IL-2 production compared with BMDC exposed to vehicle control. Based on real-time RT-PCR, the A(2A) adenosine receptor (A(2A)AR) and A(2B)AR were the predominant adenosine receptors expressed in BMDC. Using adenosine receptor subtype selective antagonists and BMDC derived from A(2A)AR(-/-) and A(2B)AR(-/-)mice, it was shown that NECA modulates TNF-alpha, IL-12, IL-10, and CD86 responses predominantly via A(2B)AR. These data indicate that engagement of A(2B)AR modifies murine BMDC maturation and suggest that adenosine regulates CD4(+) T cell responses by selecting for DC with impaired immunogencity.

  8. Graft-derived anti-HPA-2b production after allogeneic bone-marrow transplantation

    DEFF Research Database (Denmark)

    Taaning, E; Jacobsen, N; Morling, N

    1994-01-01

    We report on a male who received a bone-marrow allograft from his HLA identical sister for acute myelogenous leukaemia. After transplantation, the patient suffered from refractoriness to the transfusions of HLA-matched platelets and a strong platelet-specific antibody, anti-HPA-2b, of IgG1 subcla...

  9. Data of evolutionary structure change: 3EK2B-3FNFD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available rmsd> 3.226280927658081 EVID> 4 3FNF...3EK2B-3FNFD 3EK2 3FNF B D MGFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTY...VGDRFKDRITEFAAEFGSE-LVFPCDVADDAQIDALFASLKTHWD---SLDGLVHSIGFAPREAIAG-DFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLL.../ss_2> EVID> 0 3EK2 3FNF D 3FNFD

  10. Textbook Evaluation: An Analysis of Listening Comprehension Parts in Top Notch 2A & 2B

    Science.gov (United States)

    Soori, Afshin; Haghani, Elham

    2015-01-01

    Textbooks are the instruments that assist both teachers and learners in process of second language learning. With respect to the importance of textbooks in a language course, evaluation of course books is a significant issue for most researchers. The present study investigated and analyzed Listening Comprehension parts in Top Notch 2A & 2B 2nd…

  11. First detection of canine parvovirus type 2b from diarrheic dogs in Himachal Pradesh

    Science.gov (United States)

    Sharma, Shalini; Dhar, Prasenjit; Thakur, Aneesh; Sharma, Vivek; Sharma, Mandeep

    2016-01-01

    Aim: The present study was conducted to detect the presence of canine parvovirus (CPV) among diarrheic dogs in Himachal Pradesh and to identify the most prevalent antigenic variant of CPV based on molecular typing and sequence analysis of VP2 gene. Materials and Methods: A total of 102 fecal samples were collected from clinical cases of diarrhea or hemorrhagic gastroenteritis from CPV vaccinated or non-vaccinated dogs. Samples were tested using CPV-specific polymerase chain reaction (PCR) targeting VP2 gene, multiplex PCR for detection of CPV-2a and CPV-2b antigenic variants, and a PCR for the detection of CPV-2c. CPV-2b isolate was cultured on Madin-Darby canine kidney (MDCK) cell lines and sequenced using VP2 structural protein gene. Multiple alignment and phylogenetic analysis was done using ClustalW and MEGA6 and inferred using the Neighbor-Joining method. Results: No sample was found positive for the original CPV strain usually present in the vaccine. However, about 50% (52 out of 102) of the samples were found to be positive with CPV-2ab PCR assay that detects newer variants of CPV circulating in the field. In addition, multiplex PCR assay that identifies both CPV-2ab and CPV-2b revealed that CPV-2b was the major antigenic variant present in the affected dogs. A PCR positive isolate of CPV-2b was adapted to grow in MDCK cells and produced characteristic cytopathic effect after 5th passage. Multiple sequence alignment of VP2 structural gene of CPV-2b isolate (Accession number HG004610) used in the study was found to be similar to other sequenced isolates in NCBI sequence database and showed 98-99% homology. Conclusion: This study reports the first detection of CPV-2b in dogs with hemorrhagic gastroenteritis in Himachal Pradesh and absence of other antigenic types of CPV. Further, CPV-specific PCR assay can be used for rapid confirmation of circulating virus strains under field conditions. PMID:27733797

  12. First detection of canine parvovirus type 2b from diarrheic dogs in Himachal Pradesh

    Directory of Open Access Journals (Sweden)

    Shalini Sharma

    2016-09-01

    Full Text Available Aim: The present study was conducted to detect the presence of canine parvovirus (CPV among diarrheic dogs in Himachal Pradesh and to identify the most prevalent antigenic variant of CPV based on molecular typing and sequence analysis of VP2 gene. Materials and Methods: A total of 102 fecal samples were collected from clinical cases of diarrhea or hemorrhagic gastroenteritis from CPV vaccinated or non-vaccinated dogs. Samples were tested using CPV-specific polymerase chain reaction (PCR targeting VP2 gene, multiplex PCR for detection of CPV-2a and CPV-2b antigenic variants, and a PCR for the detection of CPV-2c. CPV-2b isolate was cultured on Madin-Darby canine kidney (MDCK cell lines and sequenced using VP2 structural protein gene. Multiple alignment and phylogenetic analysis was done using ClustalW and MEGA6 and inferred using the Neighbor-Joining method. Results: No sample was found positive for the original CPV strain usually present in the vaccine. However, about 50% (52 out of 102 of the samples were found to be positive with CPV-2ab PCR assay that detects newer variants of CPV circulating in the field. In addition, multiplex PCR assay that identifies both CPV-2ab and CPV-2b revealed that CPV-2b was the major antigenic variant present in the affected dogs. A PCR positive isolate of CPV-2b was adapted to grow in MDCK cells and produced characteristic cytopathic effect after 5th passage. Multiple sequence alignment of VP2 structural gene of CPV-2b isolate (Accession number HG004610 used in the study was found to be similar to other sequenced isolates in NCBI sequence database and showed 98-99% homology. Conclusion: This study reports the first detection of CPV-2b in dogs with hemorrhagic gastroenteritis in Himachal Pradesh and absence of other antigenic types of CPV. Further, CPV-specific PCR assay can be used for rapid confirmation of circulating virus strains under field conditions.

  13. /bar p/p collider physics

    Energy Technology Data Exchange (ETDEWEB)

    Green, D.

    1989-03-01

    This note encompasses a set of six lectures given at the summer school held at Campos Do Jordao in January of 1989 near Sao Paulo, Brazil. The intent of the lectures was to describe the physics of /bar p/p at CERN and Fermilab. Particular attention has been paid to making a self contained presentation to a prospective audience of graduate students. Since large Monte Carlo codes might not be available to all members of this audience, great reliance was placed on ''back of the envelope estimates.'' Emphasis was also placed on experimental data rather than theoretical speculation, since predictions for, for example, supersymmetric particle production are easily obtained by transcription of formulae already obtained. 9 refs., 67 figs., 2 tabs.

  14. Strangeness Production in AA and pp Collisions

    CERN Document Server

    Satz, P Castorina ad H

    2016-01-01

    Boost-invariant hadron production in high energy collisions occurs in causally disconnected regions of finite space-time size. As a result, globally conserved quantum numbers (charge, strangeness, baryon number) are conserved locally in spatially restricted correlation clusters. Their size is determined by two time scales: the equilibration time specifying the formation of a quark-gluon plasma, and the hadronization time, specifying the onset of confinement. The expected values for these scales provide the theoretical basis for the suppression observed for strangeness production in elementary interactions ($pp$, $e^+e^-$) below LHC energies. In contrast, the space-time superposition of individual collisions in high energy heavy ion interactions leads to higher energy densities, resulting in much later hadronization and hence much larger hadronization volumes. This largely removes the causality constraints and results in an ideal hadronic resonance gas in full chemical equilibrium. In the present paper, we det...

  15. PR65A phosphorylation regulates PP2A complex signaling.

    Directory of Open Access Journals (Sweden)

    Kumar Kotlo

    Full Text Available Serine-threonine Protein phosphatase 2 A (PP2A, a member of the PPP family of phosphatases, regulates a variety of essential cellular processes, including cell-cycling, DNA replication, transcription, translation, and secondary signaling pathways. In the heart, increased PP2A activity/signaling has been linked to cardiac remodeling, contractile dysfunction and, in failure, arrythmogenicity. The core PP2A complex is a hetero-trimeric holoenzyme consisting of a 36 kDa catalytic subunit (PP2Ac; a regulatory scaffold subunit of 65 kDa (PR65A or PP2Aa; and one of at least 18 associated variable regulatory proteins (B subunits classified into 3 families. In the present study, three in vivo sites of phosphorylation in cardiac PR65A are identified (S303, T268, S314. Using HEK cells transfected with recombinant forms of PR65A with phosphomimetic (P-PR65A and non-phosphorylated (N-PR65A amino acid substitutions at these sites, these phosphorylations were shown to inhibit the interaction of PR65A with PP2Ac and PP2A holoenzyme signaling. Forty-seven phospho-proteins were increased in abundance in HEK cells transfected with P-PR65A versus N-PR65A by phospho-protein profiling using 2D-DIGE analysis on phospho-enriched whole cell protein extracts. Among these proteins were elongation factor 1α (EF1A, elongation factor 2, heat shock protein 60 (HSP60, NADPH-dehydrogenase 1 alpha sub complex, annexin A, and PR65A. Compared to controls, failing hearts from the Dahl rat had less phosphorylated PR65A protein abundance and increased PP2A activity. Thus, PR65A phosphorylation is an in vivo mechanism for regulation of the PP2A signaling complex and increased PP2A activity in heart failure.

  16. Electron spin resonance studies on PS, PP and PS/PP blends under gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Reyes, Jacobo E-mail: reyesj@camelot.rect.ucv.ve; Albano, Carmen E-mail: calbano@ivic.vealbanoc@camelot.rect.ucv.ve; Claro, Marjorie; Moronta, Delfin

    2003-06-01

    Electron spin resonance studies on polystyrene (PS), polypropylene (PP) and on 80/20 PS/PP blends with and without compatibilizer (block SBS), at 7.5 wt%, irradiated with gamma rays from a {sup 60}Co source at a dose rate of 4.8 kGy/h and at integral irradiation doses of 10, 25, 50, 60, 70, 400, 800 and 1300 kGy in the presence of air and at room temperature are reported. Dependence of resonance line width, Hpp, resonance line shapes, K, and resonance line intensity, Ipp, on the integral dose of irradiation is investigated. Nature of free radicals after 10 days of air storage is discussed.

  17. Study on 'soft' and 'hard' interactions in (-p)p (pp) collisions using HIJING and PYTHIA

    Institute of Scientific and Technical Information of China (English)

    Zhang Yi-Fei; Huang Sheng-Li; Zhang Zi-Ping; Wu Jian

    2007-01-01

    This paper presents a study on 'hard' and 'soft' interactions in (-p)p (pp) collisions using a phenomenological model of HIJING, the jet-cone reconstruction method is employed to select the 'hard' and 'soft' event sub-samples from minimum bias events. It is found that the HIJING model can reproduce the energy scaling behaviour of mean transverse momentum (〈pT〉) distributions of charged hadrons versus multiplicity (Nch) in 'soft' events. From the PYTHIA simulation comparing with the HIJING model, the enhancement of the kaon and proton yields from 'hard'interactions comparing with 'soft' interactions is observed to be due to the mini-jets effect. These mechanisms responsible for the increase of charged hadron's 〈pT〉 are different in 'soft' and 'hard' interactions.

  18. Chiral Perturbation Theory and the $pp \\to pp \\pi^0$ Reaction Near Threshold

    CERN Document Server

    Sato, T; Myhrer, F; Kubodera, K

    1997-01-01

    A chiral-perturbative consideration of the near-threshold pp -> pp pi0 reaction indicates that the pion-rescattering term has a substantial energy and momentum dependence. The existing calculations that incorporate this dependence give pion rescattering contributions significantly larger than those of the conventional treatment, and this enhanced rescattering term interferes destructively with the one-body impulse term, leading to theoretical cross sections that are much smaller than the observed values. However, since the existing calculations are based on coordinate-space representation, they involve a number of simplifying assumptions about the energy-momentum flow in the rescattering diagram, even though the delicate interplay between the one-body and two-body terms makes it desirable to avoid these kinematical assumptions. We carry out here a momentum-space calculation that retains the energy-momentum dependence of the vertices as predicted by chiral perturbation theory. Our improved treatment increases ...

  19. Equine cytochrome P450 2B6 — Genomic identification, expression and functional characterization with ketamine

    Energy Technology Data Exchange (ETDEWEB)

    Peters, L.M.; Demmel, S. [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland); Pusch, G.; Buters, J.T.M. [ZAUM — Center of Allergy and Environment, Helmholtz Zentrum München/Technische Universität München, Biedersteiner Str. 29, 80802 München (Germany); Thormann, W. [Clinical Pharmacology Laboratory, Institute for Infectious Diseases, University of Bern, Murtenstrasse 35, 3010 Bern (Switzerland); Zielinski, J. [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland); Leeb, T. [Institute of Genetics, Vetsuisse Faculty, University Bern, Bremgartenstr. 109, 3012 Bern (Switzerland); Mevissen, M. [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland); Schmitz, A., E-mail: andrea.schmitz@vetsuisse.unibe.ch [Division Veterinary Pharmacology and Toxicology, Vetsuisse Faculty, University Bern, Laenggassstr. 124, 3012 Bern (Switzerland)

    2013-01-01

    Ketamine is an anesthetic and analgesic regularly used in veterinary patients. As ketamine is almost always administered in combination with other drugs, interactions between ketamine and other drugs bear the risk of either adverse effects or diminished efficacy. Since cytochrome P450 enzymes (CYPs) play a pivotal role in the phase I metabolism of the majority of all marketed drugs, drug–drug interactions often occur at the active site of these enzymes. CYPs have been thoroughly examined in humans and laboratory animals, but little is known about equine CYPs. The characterization of equine CYPs is essential for a better understanding of drug metabolism in horses. We report annotation, cloning and heterologous expression of the equine CYP2B6 in V79 Chinese hamster fibroblasts. After computational annotation of all CYP2B genes, the coding sequence (CDS) of equine CYP2B6 was amplified by RT-PCR from horse liver total RNA and revealed an amino acid sequence identity of 77% and a similarity of 93.7% to its human ortholog. A non-synonymous variant c.226G>A in exon 2 of the equine CYP2B6 was detected in 97 horses. The mutant A-allele showed an allele frequency of 82%. Two further variants in exon 3 were detected in one and two horses of this group, respectively. Transfected V79 cells were incubated with racemic ketamine and norketamine as probe substrates to determine metabolic activity. The recombinant equine CYP2B6 N-demethylated ketamine to norketamine and produced metabolites of norketamine, such as hydroxylated norketamines and 5,6-dehydronorketamine. V{sub max} for S-/and R-norketamine formation was 0.49 and 0.45 nmol/h/mg cellular protein and K{sub m} was 3.41 and 2.66 μM, respectively. The N-demethylation of S-/R-ketamine was inhibited concentration-dependently with clopidogrel showing an IC{sub 50} of 5.63 and 6.26 μM, respectively. The functional importance of the recorded genetic variants remains to be explored. Equine CYP2B6 was determined to be a CYP

  20. Interrelationships of morphology, thermal and mechanical properties in uncrosslinked and dynamically crosslinked PP/EOC and PP/EPDM blends

    Directory of Open Access Journals (Sweden)

    2010-04-01

    Full Text Available Thermoplastic vulcanizates (TPVs based on polypropylene (PP with ethylene octene copolymer (EOC and ethylene propylene diene rubber (EPDM have been developed by coagent assisted dicumyl peroxide crosslinking system. The study was pursued to explore the influence of two dissimilar polyolefin polymers (EOC and EPDM having different molecular architectures on the state and mode of dispersion of the blend components and their effects with special reference to morphological, thermal and mechanical characteristics. The effects of dynamic crosslinking of the PP/EOC and PP/EPDM have been compared by varying the concentration of crosslinking agent and ratio of blend components. The results suggested that the uncrosslinked and dynamically crosslinked blends of PP/EOC exhibit superior mechanical properties over PP/EPDM blends. From the hystersis experiments it was found that PP/EOC blends also perform better fatigue properties over PP/EPDM based blends. It was demonstrated that, the origin of the improved mechanical properties of EOC based blends is due to the combined effect of the unique molecular architecture with the presence of smaller crystals and better interfacial interaction of EOC phase with PP as supported by the results of thermal and fatigue analyses.