Worthen, Helena Harlow
2012-01-01
The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…
Vocational Education and Vocational Skills
DEFF Research Database (Denmark)
Madsen, Erik Skov
, a framework of skills related to process tasks is developed. The paper and the presentation conclude that much more focus is needed on the development of vocational education and vocational skills in Denmark, the U.K, and in the U.S. and in China for employees to be able to handle future automated......Abstract: This paper and presentation is based on case studies in China, Mexico and Denmark. The paper identifies challenges posed to production companies by a lack of vocational skills and vocational education. The study is focusing on different types of production systems i.e. on manual, complex...... and automated production. The paper highlights how both China and Denmark have focused on theoretical rather than vocational education for more than a decade. Based on a combination of a literature review and field studies of cases, including studies of mass production and unmanned and automated production...
Vocational Education and Vocational Skills in Production
DEFF Research Database (Denmark)
Madsen, Erik Skov
2015-01-01
Through case studies in China, Mexico and Denmark, this paper identifies challenges posed to production companies by a lack of vocational skills and vocational education. The study includes manual, complex and automated production procedures. The paper highlights how both China and Denmark have...... focused on theoretical rather than vocational education for more than a decade. Based on a combination of a literature review and field studies of cases, including studies of mass production and unmanned and automated production, a framework of skills related to process tasks is developed. The paper...... concludes that much more focus on the development of vocational education and vocational skills is needed in Denmark, the U.K, the U.S. and in China for employees to be equipped to handle future automated and advanced production systems....
Ensuring Quality Assurance in Vocational Education
Idialu, Ethel E.
2013-01-01
Vocational education emphasises skill acquisition. Quality assurance in vocational education is a concept that is concerned with high performance involving activities with vocational education such as teaching, learning, infrastructures, students' behaviour and the entire academic process. Quality vocational education refers to input and output of…
Vocational education in the Nordic countries
DEFF Research Database (Denmark)
a common heritage in education policy. This volume will help strengthen the knowledge base required for transnational policy learning, and for developing vocational education internationally for the future. As a result, the book will be of interest to researchers, academics and postgraduate students......Vocational Education in the Nordic Countries: Learning from Diversity is the second of two books that disseminates new and systematic knowledge on the strengths and weaknesses of the different models of vocational education and training (VET) in four Nordic countries. Vocational education in Europe...... involved in the study of vocational education, educational studies and educational policy, as well as policy makers....
Vocational Education and Training in Kuwait: Vocational Education versus Values and Viewpoints
Bilboe, Wendy
2011-01-01
Since the opening up of private universities and colleges in the Kuwait education system in the late 1990s, there has been an explosion of tertiary institutions (both domestic and international) established in the country, with many of them offering vocational education and training. The move towards vocational and educational training forms part…
Vocational Education and Equality of Opportunity.
Horowitz, Benjamin; Feinberg, Walter
1990-01-01
Examines the concepts of equality of opportunity and equality of educational opportunity and their relationship to vocational education. Traces the history of vocational education. Delineates the distinction between training and education as enumerated in Aristotelian philosophy. Discusses the role vocational education can play in the educative…
Institute of Scientific and Technical Information of China (English)
Yingjie Zhang[1
2016-01-01
The connection between vocational college education and vocational training is a new way for vocational colleges and enterprises to develop together. At present, vocational college education focusing on the education level of talent training, however, it ignores the needs of workers’ vocational training based on enterprise development planning and training of professional career development. Therefore, we should strengthen the connection between vocational training and vocational education. For the establishment of modern vocational education system, we should enhance the value of human capital of workers in order to adapt to the new economic norm with important practical signifi cance.
EFFICIENCY FINANCIAL RESOURCES IN VOCATIONAL EDUCATION
Directory of Open Access Journals (Sweden)
Nataliia Kovernuk
2016-11-01
Full Text Available The purpose of writing is to research and analyze the effectiveness of financial resources in vocational education in Ukraine and develop practical recommendations for their improvement. To research and analyze the practices of formation and use of financial resources in vocational education. Research conducted by the methods of empirical knowledge, analysis, clustering, comparison, observation, synthesis, graphical analysis. The measures effective use of financial resources in vocational education in Ukraine. Methodology is actual work of scientists and researchers. Results are exploring of the practice of planning expenditures of state and local budgets for vocational education concluded that in planning expenditure dominates the normative method of budget planning. This discrepancy established approaches to the development of standards of employee’s vocational institutions and expenditures of staff, on the one hand, and the required planning spending on vocational education. When planning educational grants for training labor to local budgets is determined by the amount of expenditures that are relevant to the intergovernmental transfers, which include, in particular, spending on vocational education. Although the legislation stipulates the independence of local budgets and calculation of expenditures that are relevant to the intergovernmental transfers should be done only to determine the amount of educational grants for training labor, in practice there is a significant limitation of the autonomy of local governments in the planning of local budgets. Thus, the deterioration of the efficiency of spending on vocational education due to increasing labor costs and labor charges. The reason for this was the dynamics as increased wages and a change in the number of employees engaged in technical and vocational education. Value. The analysis of public expenditure planning practices and local budgets for vocational education concluded that in
Vocational teacher education and vocational didactics
DEFF Research Database (Denmark)
Duch, Henriette
2017-01-01
.e., the same type of issues that newly enrolled students at the vocational college are facing. Our article is based on empirical data from a long-term, qualitative study of the Diploma of Vocational Pedagogy programme. It examines the learning trajectories of vocational teachers who choose to come back as VET...... their pedagogical education as teachers, i.e., transitional coherence, are not the same. The empirical data from the cases were collected via qualitative and ethnography-inspired methods, i.e., observations, focus group interviews, interviews and analyses of diploma projects from the programme......., vocational field at a specific type of college. Due to these factors, the individual teachers will experience different ‘learning trajectories’ (Lave, 2011), depending on vocational field and place of employment. They will gather different experiences, including the experience of going back to school, i...
Understanding Higher Vocational Education in China: Vocationalism vs Confucianism
Xiong, Jie
2011-01-01
The development of higher vocational education in China embodies a global trend of vocationalism that values skills and skilled workers, which is opposite, in some ways, to the Confucian tradition in Chinese education that values theoretical knowledge related to good governance. As the cultural trend supporting the development of higher vocational…
Hands-on creativity in Vocational Education
DEFF Research Database (Denmark)
Tanggaard, Lene
and therefore not well suited for VET comprising production, handcraft and industry. In Europe, vocational education schemes are considered the solid base on which almost all kinds of industry and craft depend. If Europe is to retain its innovative capacity, then vocational education, especially the capacity......This presentation poses the question: what conception of the phenomenon of creativity is best suited to the field of vocational education? VET (Vocational Education and Training) aims to prepare people for employment in craft and industry. In this field, there is an ever-growing requirement...... for creativity and innovation. In response, it is my concern that an understanding of creativity be developed with vocational education and training in mind. It is not enough to import models from other areas, where the distinction between ideas and production or creativity and execution is often relatively hazy...
Work Adjustment of Vocational Education Teachers.
Muncrief, Martha Crawford
To investigate work adjustment of vocational education teachers, a nation-wide study was conducted focusing on vocational needs, job satisfaction, and job success. The study involved 180 secondary teachers from three vocational areas, business, home economics, and industrial education. A multistage sampling process was utilized to select…
General educational disciplines practice-oriented training in intermediate vocational education
Directory of Open Access Journals (Sweden)
Liya G. Skorobogatova
2011-01-01
Full Text Available The article concerns crucial issues of practice-oriented training in Russia's intermediate vocational education, designates directions of general educational disciplines study in intermediate vocational education.
Teaching Reading in Vocational Education.
South Carolina State Dept. of Education, Columbia. Office of Vocational Education.
This handbook on teaching reading in vocational education is designed to provide vocational education teachers with a resource to use in helping students to develop sound reading skills. Provided in the handbook are information sheets, self-checks, practice activities, and suggestions for further reading dealing with the following topics:…
Community Governance and Vocational Education
Martasari, R.; Haryanti, R. H.; Susiloadi, P.
2018-02-01
Vocational education is required to create a design of education and training that is friendly and feasible for disabled people. The state has a responsibility for it, but with all the limitations, the state can not always be present. This article aims to analyze the capacity of community governance in passing vocational education for people with disabilities in Ponorogo, Indonesia. Articles are the results of research for approximately two years by using data collection techniques through interviews, documentation and observation. Source Triangulation with analysis technique using interactive model is used for data validation. The results show that there are two large capacities owned by Organisasi Sosial Rumah Kasih Sayang as community governance in conducting vocational education for the disabled person namely community credibility and community vigilance.
Technical vocational education in India
溝上, 智恵子
1999-01-01
In India, several efforts have been made for the development of skilled manpower during the last twenty years since the launch of formal technical vocational education at school. A huge education infrastructure has developed in India. However, 45~50 percent of the population of India is still illiterate. To solve the mismatch between education and employment, a revolution in education is really needed. Additionally, there is a need for a system of National Vocational Qualifications in India a...
Restrictions and Countermeasures of Rural Vocational Education in Urban-rural Integration
Institute of Scientific and Technical Information of China (English)
2012-01-01
Developing rural vocational education is of great significance to urban-rural integration: developing rural vocational education is helpful to cultivating new farmers for construction of new socialist countryside,favorable to improving farmers’ ability of finding jobs and starting undertaking, and beneficial to transfer of rural surplus labor and acceleration of urbanization. Restrictions on development rural vocational education mainly include: low value cognition of society and social assessment of rural vocational education; out of balance of cost and expected return of rural vocational education; the quality of supply of rural vocational education failure to satisfy demand of socio-economic development; imperfect rural vocational education system. In view of these,following countermeasures and suggestions are put forward: strengthen propaganda and guidance to build environment of public opinion for rural vocational education; push forward rural vocational compulsory education system to lay social foundation for rural vocational education; reinforce policy support to assist in building rural vocational education system; improve education system to build overall framework of rural vocational education; perfect laws and regulations to establish system and norm for development of rural vocational education.
Identity Change during Vocational Teacher Education
DEFF Research Database (Denmark)
Duch, Henriette
where the teacher is employed. Regardless of the teacher’s educational background, he has to attend the same course when he is employed at a vocational school. During that education, the teacher is in transition to become a vocational teacher. It is mandatory to complete the Diploma of Education in four...
Vocational Education and Economic Development in Nigeria | Ekpo ...
African Journals Online (AJOL)
This paper discusses the capability of vocational education in creating jobs to reduce unemployment among the Nigerian youths which will result in sustainable economic development of Nigeria. It also defines Vocational education within the provisions of the National Policy on Education. Philosophy of Vocational ...
Quality Education in English class in vocational college
Institute of Scientific and Technical Information of China (English)
童燕黎
2010-01-01
Quality education in English teaching in elementary education should transit from examination-oriented education to quality education,which is an explicit requirement of CPC Central Committee and the State Council to the education in vocational colleges.Quality education in vocational colleges faces the challenges of the 21st century education and needs to be carried out in-depth reform.This paper collects different kinds of books and information about the Quality education.It tries to answer the following questions:what is the quality education in vocational college? What contents does it include? In the past years,many English teachers and educators have made a great effort in this area,and they have got great achievements in this field.Therefore,to strengthen the quality education in vocational college is the core and the key to the students.The reform and opening up to the world,the rapid economic development and the rapid expansion of foreign exchanges of China today demands the quality education in vocational college as particularly importance in English Teaching.
Education for work: Reflections towards a theory of vocational education
Corson, David J.
1985-12-01
By integrating aspects of a philosophy of work and a sociology of work, this article draws conclusions relevant to framing a theory of vocational education. `Education for work' is accepted in this paper as the common central meaning of the term `vocational education'. The two concepts, `education' and `work', are first examined separately: `work' is seen to include recreational and occupational work, while occupational work is seen to fall on a continuum ranging from constrained to unconstrained occupational work. `Education' and `training' are distinguished. After a discussion of the conceptual links which might be drawn between `education' and `work', recommendations are made about the aims, the place, and the curriculum of vocational education within the general institution of education.
Anderson, B. Harold
The purpose of the study reported in this document was to describe the quantitative and qualitative characteristics of the vocational teacher education programs among institutions that are members of the University Council for Vocational Education. A questionnaire was mailed to representatives of each member institution in October 1985, with a 100…
Alleviating Poverty Through Vocational Education: The Nigerian ...
African Journals Online (AJOL)
The paper concludes that well-articulated vocational education policy and programmes will assist in employment generations and poverty reduction in Nigeria. Keywords: Alleviating Poverty, Vocational Education, Nigerian Experience Journal of Technology and Education in Nigeria Vol. 10 (2) 2005: pp. 10-14 ...
The Dutch vocational education and training system
Verhagen, A.M.C.
2014-01-01
The Dutch educational system is highly stratified from secondary education onwards3, and this also applies to MBO. Each MBO course can be followed in two different learning pathways, called the vocationally educating learning pathway (beroepsopleidende leerweg: BOL) and the vocationally guiding
A cultural turn? Vocational teacher education in Denmark
DEFF Research Database (Denmark)
Duch, Henriette
actors in the field. The actors had different interests, which is also visible in documents. The analysis reveals three main discussions. The first is the loss of ‘situated learning’ or vocational teacher training in vocational colleges. The second is theory of science as a symbol of academization......As part of my Ph.D.-project the field of educational policy is analysed with a focus on the decision process on a change of vocational teacher education (Bourdieu, 1996; Duch and Rasmussen, XX). The process is seen in the light of the Bologna process. Originally, the education of Danish vocational...... teachers was a specialized and non-classified course, now it is classifies as a higher education at level six in the Danish Qualification Framework. The analysis is based on qualitative interviews with representatives of for example vocational teachers and of leaders at vocational colleges – different...
Ayeni, Abiodun Olumide
2015-01-01
This paper compared technical/vocational education in: Germany, Australia, Finland, Hong Kong, Hungary, India, Japan, South Korea, Mexico, and Nigeria, and found that technical/vocational education was given proper attention in countries considered except Nigeria, where it was handled with laissez faire attitude. Set-Up of Technical/Vocational…
The Peripheralisation of the Danish Vocational Education System
DEFF Research Database (Denmark)
Larsen, Karin Topsø
2013-01-01
in the supply of vocationally trained labour. This is especially problematic for labour markets in non-metropolitan areas, where a number of production- and service- firms are still located. At the same time more and more youth are choosing and completing academic education programs, which target work places......In the past decade, the Vocational Education Training System (VET) in Denmark has undergone a downturn in which fewer and fewer students apply for and complete a vocational education. Choosing a vocational education has become synonymous with choosing the losing team. The result is a drastic drop...... in metropolitan areas and support a migration flow of young educated people from rural municipalities toward metropolitan areas....
Challenges to Vocational Teacher Education.
Erickson, Richard C.
1985-01-01
Challenges to vocational teacher education include technological change that is sending large numbers of adults back to school; increasing numbers of women, minorities, and handicapped individuals who are seeking employment in nontraditional occupations; vocational preparation for jobs in the information economy; teacher recruitment; and creative…
Technical and Vocational Education for Zimbabwe's Rural ...
African Journals Online (AJOL)
The main purpose of this paper is to highlight some issues and concerns in the Zimbabwean educational system in general, and in particular, issues and concerns within the purview for technical and vocational education. The paper will further provoke debate within the context of technical and vocational education as a ...
Vocational and Technical Education Performance Standards and Competencies.
Connecticut State Board of Education, Hartford.
These Connecticut vocational and technical performance standards and competencies are a guide for overall quality attainment in these seven vocational and technical program areas: agricultural science technology education; business and finance technology education; cooperative work education; family and consumer sciences education; marketing…
Sex Bias in Vocational Education.
Kalinowski, Edward
Practical information is provided on sexual harassment within the vocational education context. A definition of sexual harassment is followed by examples of practices or behaviors that may be used to determine sexual harassment, including both physical conduct and communication. Possible impacts of sexual harassment in a vocational training…
Technical and Vocational Education and Training in Peace Education: Solomon Islands
Maebuta, Jack
2011-01-01
Technical and vocational education and training programs as a form of peace education are examined in this paper. It explores the notion of educating for a culture of peace through refocusing technical and vocational education and training programs on sustainable community development in the Solomon Islands. It further highlights the policy and…
The Analysis on Emotional Education in Vocational School English Teaching
Institute of Scientific and Technical Information of China (English)
兰州职业技术学院 730070
2015-01-01
In the time of advancing quality education, emotion education has been paid more and more attention. English teaching is both language teaching progress and emotional communication progress. Therefore, emotional education is extremely important and indispensable in vocational school classroom teaching. However, the current application of vocational school emotional education in English classroom teaching is still relatively weak. Based on the theory of emotional education, this paper attempts to explore the methods and strategies of applying emotional education in vocational school English classroom teaching. It has important theoretical significance on promoting the comprehensive development of the vocational school students, improving English teaching effect, promoting the healthy and sustainable development of the vocational school education, and enriching and developing the emotional teaching psychology and cognitive psychology theory.
Reforming vocational didactics by implementing a new VET teacher education
DEFF Research Database (Denmark)
Duch, Henriette; Andreasen, Karen Egedal
2015-01-01
from backgrounds with no tradition for education. Despite historical changes, the education as vocational college teacher also struggles with the interplay between theory and practice in the program and great diversity among vocational college teachers. Based on empirical data from focus group......A new education program, Diploma of Vocational Pedagogy, has recently been implemented in Denmark to upskill vocational college teachers and improve didactics at VET colleges in general. Among many challenges, vocational college teachers have to adapt their pedagogy to a large number of students...... interviews with students from the Diploma of Vocational Pedagogy program and concepts developed by Bernstein and Bourdieu, the article analyzes how these aspects might affect the development of new vocational didactics. We know that it is not easy to change the culture of educational institutions...
Goldrick-Rab, Sara; Kelly, Andrew P.
2016-01-01
In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…
Vocational Education and Zakat: The Case Study of Punjab Vocational Training Council
Directory of Open Access Journals (Sweden)
Iqbal M. KHAN
2014-08-01
Full Text Available The aim of this research is to explore the prospect of teaching Entrepreneurship Education to those who acquire vocational skills at Punjab Vocational Training Council (PVTC. It is also to explore whether PVTC has promoted entrepreneurship through its vocational training institutes located all over Punjab. This study also deals with the concept of utilization of ‘Zakat' for the purpose of vocational education as a mode for possible replication. The research objective has been to follow the progress of this institution. It has also been to record the successes of this model of a public-private ownership, a model of utilizing the ‘Zakat' to fund education projects, a value based organization, a learning organization and a highly innovative institution. The other objective is to explore the evidence of entrepreneurship education and its effectiveness in PVTC. Literature has been reviewed on vocational training and entrepreneurship education. It also reviews experience and evidence of such practice prevailing in other environment. Combined with this is the review and conceptualization of a model based on ‘zakat'. Research Methodology used is basically qualitative; data has been collected through semi structured intensive interviews and from focus groups of stakeholders. The strategies adopted to collect data in this study are “survey”, “case study” and “grounded theory.” The data collected from semi structured interviews were concluded by thematic analysis, analyzing technique of writing reports from data. NVivo software was utilized for triangulation to reduce the data bias and increase validity by comparing primary and secondary data. The findings of this research have been that the pedagogical skills offered by PVTC's are not effective for entrepreneurial potential development. Work is required for entrepreneurial curriculum development and training of PVTCs' instructors, students and practitioners. The research also reveals
Leadership Skills among Technical and Vocational Educators
Zakaria, Nurazyan Zahidah; Jizat, Nor Atikah Md.; Zakaria, Normah
2015-01-01
The purpose of leadership skills among technical and vocational educator are to prepare them towards effective organization. Effective leadership is widely accepted as being a key constituent in achieving organization improvement and to examine. This study aimed to gauge the leadership skills among technical and vocational educators effectiveness…
Students' Views of Learning in Vocational Education.
Eklund-Myrskog, Gunilla
1997-01-01
Conceptions of learning and approaches to learning within vocational education were studied with 30 Finnish students of automotive mechanics. About half the students took a quantitative view of learning and favored a surface approach. Encouraging a qualitative view of learning and deeper approaches in vocational education is discussed. (SLD)
Leimbach, Gale John
The effects of vocational leadership development were studied for 23 Fellows enrolled in the 1992 Ohio Vocational Education Leadership Institute (OVELI). A literature review focused on four components: leadership styles, educational leadership development, vocational leadership development, and visionary leadership development. The Leadership…
Bijlsma, Nienke; Schaap, Harmen; de Bruijn, Elly
2016-01-01
Meaning-making and sense-making are generally assumed to be part of students' personal vocational knowledge development, since they contribute to both students' socialisation in a vocation and students' personalisation of concepts, values and beliefs regarding that vocation. However, how students in vocational education acquire meaning and make…
General Education, Vocational Education, and Labor-Market Outcomes over the Life-Cycle
Eric A. Hanushek; Ludger Woessmann; Lei Zhang
2011-01-01
Policy debates about the balance of vocational and general education programs focus on the school-to-work transition. But with rapid technological change, gains in youth employment from vocational education may be offset by less adaptability and thus diminished employment later in life. To test our main hypothesis that any relative labor-market advantage of vocational education decreases with age, we employ a difference-in-differences approach that compares employment rates across different a...
Distance Education of Vocational High Schools in Turkey
Directory of Open Access Journals (Sweden)
Tuğçe GÜNTER
2012-01-01
Full Text Available The aim of vocational high schools is to teach qualified, high self-sufficient, self-confident, technical staff who have critical and mathematical thinking competence and who can utilize science and technology efficiently. However, because of the limitations of traditional education, students can not take enough education attendance. In this context; along with the advances in science and technology area, “Web- Based Distance Education Programme”, which provides equal education conditions to students, is developed. This programme has got great progresses in abroad, and has also started to practice in Turkish Vocational High Schools. It is determined that some Vocational High Schools have applied Web-Based Distance Education in Medical Documentation and Secretarial (MDS and Medical Laboratory Techniques (MLT Associate Degree Programmes which are also existed in Bülent Ecevit University (BEU Ahmet Erdoğan Health Services Vocational High School. It is observed that the universities, that implemented distance education in these associate degree programmes, have higher technical infrastructure and they design a constructivism-based modules. It is considered that this distance education programme for MDS and MLT Associate Degree Programmes in certain Vocational Schools, can also be implemented for students in Medical Documentation and Secretarial (MDS and Medical Laboratory Techniques (MLT which continues education by computers and overhead projector that is slightly different from traditional education.
van Houten, Maarten Matheus
2018-01-01
The Netherlands has a binary higher education system in which academic education and higher professional education at EQF levels 5-8 co-exist. There is also secondary vocational education at EQF levels 1 up to 4. In this paper, I analyse policy documents resulting from the Bologna Process and argue that under neo-liberal conditions, higher…
Effective Management of Wastages in Vocational Education for ...
African Journals Online (AJOL)
gold
2012-07-26
Jul 26, 2012 ... work. The efficient management of vocational education in Nigeria will. Effective .... For instance it is sheer waste of technical skill where an engineer is appointed to head ... vocational education as a source of wastage, since the available skilled .... The need for funding Business Education programmes in.
Learning How (and How Not) to Weld: Vocational Learning in Technical Vocational Education
Asplund, Stig-Börje; Kilbrink, Nina
2018-01-01
This article focuses on vocational learning in technical vocational education in upper-secondary school, with a special focus on the object of learning to weld. A concrete teaching situation where the learning object to weld is the focus of the interaction between a vocational teacher and an upper-secondary student was documented by a video camera…
Dewey on Educating Vocation: Bringing Adult Learning to the University
Keitges, Mark
2016-01-01
This paper addresses Dewey's complex notion of vocation--particularly his idea of multiple vocational activities--and relates it to educating for vocation in colleges and universities. The author argues that higher educators can best respect a student's autonomy as a chooser--with multiple potential vocations--by giving him or her multiple…
Policy Choices in Vocational Education [and] Technical Appendix.
Institute for the Future, Menlo Park, CA.
This report examines the impact of changes in the vocational education environment that are likely to be important to policymakers over the next fifteen years. It contains forecasts of a number of trends that will be of significance to vocational educators, an analysis of the policy implications of those trends in the education environments, and…
Effects of Welfare Reform on Vocational Education and Training
Dave, Dhaval M.; Reichman, Nancy E.; Corman, Hope; Das, Dhiman
2011-01-01
Exploiting variation in welfare reform across states and over time and using relevant comparison groups, this study estimates the effects of welfare reform on an important source of human capital acquisition among women at risk for relying on welfare: vocational education and training. The results suggest that welfare reform reduced enrollment in full-time vocational education and had no significant effects on part-time vocational education or participation in other types of work-related courses, though there appears to be considerable heterogeneity across states with respect to the strictness of educational policy and the strength of work incentives under welfare reform. In addition, we find evidence of heterogeneous effects by prior educational attainment. We find no evidence that the previously-observed negative effects of welfare reform on formal education (including college enrollment), which we replicated in this study, have been offset by increases in vocational education and training. PMID:22125356
200 Years of Vocational Education, 1776-1976; The Vocational Education Age Emerges, 1876-1926
Barlow, Melvin L.
1976-01-01
The beginnings of vocational education are more readily seen during the period 1876-1926. They are characterized by the rise of manual training, trade schools, home economics movements, and agricultural education. The Smith-Hughes Act was passed in response to the demands of the National Society for the Promotion of Industrial Education. (EC)
Vocational Education in Prison--An Alternative to Recidivism.
Luftig, Jeffrey T.
1978-01-01
A study of the relationship between participation in institutional vocational education programs in Minnesota correctional institutions and employment status during parole supports the theory that correctional vocational education can help to increase the employability of exoffenders. Data on parolees' employment status and reincarceration are…
Students’ Preferred Characteristics of Learning Environments in Vocational Secondary Education
Ingeborg Placklé; Karen D. Könings; Wolfgang Jacquet; Katrien Struyven; Arno Libotton; Jeroen J. G. van Merriënboer; Nadine Engels
2014-01-01
If teachers and teacher educators are willing to support the learning of students, it is important for them to learn what motivates students to engage in learning. Students have their own preferences on design characteristics of powerful learning environments in vocational education. We developed an instrument – the Inventory Powerful Learning Environments in Vocational Education - to measure students’ preferences on characteristics of powerful learning environments in vocational education. W...
Students Preferred Characteristics of Learning Environments in Vocational Secondary Education
Placklé, Ingeborg
2014-01-01
If teachers and teacher educators are willing to support the learning of students, it is important for them to learn what motivates students to engage in learning. Students have their own preferences on design characteristics of powerful learning environments in vocational education. We developed an instrument - the Inventory Powerful Learning Environments in Vocational Education - to measure studentsâ preferences on characteristics of powerful learning environments in voca-tional education. ...
Communication Skill Attributes Needed for Vocational Education enter The Workplace
Wahyuni, L. M.; Masih, I. K.; Rejeki, I. N. Mei
2018-01-01
Communication skills are generic skills which need to be developed for success in the vocational education entering the workforce. This study aimed to discover the attributes of communication skill considered important in entering the workforce as perceived by vocational education students. The research was conducted by survey method using questionnaire as data collecting tool. The research population is final year student of D3 Vocational education Program and D4 Managerial Vocational education in academic year 2016/2017 who have completed field work practice in industry. The sampling technique was proportional random sampling. Data were analyzed with descriptive statistics and independent sampel t-test. Have ten communication skills attributes with the highest important level required to enter the workplace as perceived by the vocational education diploma. These results indicate that there was the same need related communication skills to enter the workforce
The vocational education and training system in Denmark
DEFF Research Database (Denmark)
Cort, Pia; Wiborg, Susanne
2009-01-01
Analysis of developments in vocational education and training systems in Australia, Canada, Denmark, France, Germany, Korea, Mexico, Morocco, the UK and the US.......Analysis of developments in vocational education and training systems in Australia, Canada, Denmark, France, Germany, Korea, Mexico, Morocco, the UK and the US....
Dropout in vocational education
DEFF Research Database (Denmark)
Jørgensen, Christian Helms
For the last ten years drop out of vocational education has increased strongly in Denmark. Only half of the students, who take up a vocational programme on upper secondary level, complete it. Like in other European countries the low completion rates has caused considerable alarm on the political...... level (Lamb and Markussen 2011). Continuing high dropout rates will make it very hard for the government to reach its target for educational completion, and the government has launched a series of measures to increase retention including the obligation for all colleges to make plans for retention...... and monitor the progress in achieving the goals. The questions addressed in this paper are why and how dropout in VET takes place. The objective is to provide more detailed and qualified knowledge of the complex processes of dropping out....
Working Partnerships: A Joint Venture in Vocational Education.
Campbell, Clifton P.
Joint Ventures in Vocational Education projects link participating businesses with secondary vocational programs in a cooperative relationship. These are voluntary arrangements between vocational programs and a public or private sector agency that combine the energies and resources of the partners to enrich various aspects of the vocational…
Reflections on Developing Secondary Vocational Education in High-Poverty Areas
Liu, Jiang; Chen, Guofeng
2013-01-01
Developing vocational education is a necessity for the economic and social development of high-poverty areas in China. But vocational education in impoverished areas lacks social recognition and faces funding shortages, along with difficulties in recruiting students. Vocational high schools themselves also have shortcomings. This article considers…
Linear Programming for Vocational Education Planning. Interim Report.
Young, Robert C.; And Others
The purpose of the paper is to define for potential users of vocational education management information systems a quantitative analysis technique and its utilization to facilitate more effective planning of vocational education programs. Defining linear programming (LP) as a management technique used to solve complex resource allocation problems…
Vocational Home Economics Education. Coalition Statement. Second Edition.
Home Economics Education Association, Gainesville, VA.
This pamphlet contains the statement of the Coalition of the American Home Economics Association, American Vocational Association, and Home Economics Education Association regarding the scope and definition of vocational home economics education. It is intended to serve as a basis for professional action. Sections of this statement address the…
Mustapha, Ramlee B.; Greenan, James P.
2002-01-01
Responses from 276 of 300 vocational educators and 53 of 120 employers in Malaysia indicated that both groups believed vocational education contributes to economic development and vocational graduates had good technical skills but needed better employability skills. They wanted more government collaboration with the private sector. (Contains 26…
Factors Influencing Assessment Quality in Higher Vocational Education
Baartman, Liesbeth; Gulikers, Judith; Dijkstra, Asha
2013-01-01
The development of assessments that are fit to assess professional competence in higher vocational education requires a reconsideration of assessment methods, quality criteria and (self)evaluation. This article examines the self-evaluations of nine courses of a large higher vocational education institute. Per course, 4-11 teachers and 3-10…
Liberal Conservatism, Vocationalism and Further Education in England
Fisher, Roy; Simmons, Robin
2012-01-01
Focusing on vocational learning in the English further education (FE) sector and situating it within its social, political and historical context, this paper provides an overview of English attitudes towards the vocational and its subordinate status in relation to "academic" education. It outlines the development of FE in England,…
Miller, Juliet V.; Vetter, Louise
A study examined the relevance of vocational information and guidance for the equal access of girls and women to technical/vocational education in the following countries: Argentina; India; Mexico; Republic of Korea; South Africa; Spain; Sweden; Turkey; United Arab Emirates; and Zambia. Case studies were conducted by using a multiple-strategy…
Physical education candidate teachers' beliefs about vocational self-esteem
OZSAKER, Murat; CANPOLAT, A. Meliha
2014-01-01
The purpose of this study was to determine epistemological belief and vocational self-esteem physical education candidate teachers of Physical Education and Sports Department in 3 different universities, and also to examine effect of epistemological beliefs on vocational self-esteem. A total of 346 candidate teacher respondents (137 female and 209 male) participated in the study. Epistemological Beliefs and Vocational Self-Esteem Scale were used to determine candidate teachers’ epistemologica...
PARENTAL ATTITUDES TOWARDS VOCATIONAL EDUCATION ...
African Journals Online (AJOL)
Elizabeth
by conducting a survey involving 200 parents in Udu Local Government Area of Delta State. The result ... the concept of linkage between education and working life; for instance, ... Parental attitudes towards vocational education: Implications for counselling. Okocha ... and methodically prepared special courses of fairly long.
Curriculum Development and Adaptation in Vocational Education in Taiwan, Republic of China.
Chang, Tien-Jin Frank
Taiwan has recently changed from an agricultural to an industry-intensive society. Vocational education should assume the responsibility of educating students to meet the manpower needs of industry, and vocational education programs have rapidly expanded. The government lists technical and vocational education as one of the top priorities in the…
Modularisation and Vocational Education in Scotland.
Thomson, Sandy
In Scotland, vocational education at the professional level takes place in colleges and universities and at the craft and technician level, in further education colleges. Most of the further education/higher education curriculum has been modularized. The following benefits of modularization are claimed: rationalization of resource provision;…
Collaborative learning in a culturally diverse secondary vocational education
Dr. Rutger van de Sande; Drs. Kennedy Aquilino Tielman; Dr. S. Bolhuis; Prof. dr. Perry den Brok
2010-01-01
Collaborative learning in a culturally diverse secondary vocational education. By K. Tielman (Fontys), P. den Brok (ESoE), S. Bolhuis (Fontys) and R. van de Sande (Fontys) This contribution discusses a descriptive study on the experiences of students and teachers in secondary vocational education
Future Directions for Vocational Education in Australian Secondary Schools.
Gonczi, Andrew
1997-01-01
Critics of vocational education do not recognize its potential to develop outcomes similar to general education. Vocational curriculum should be based on a holistic integrated model of competence, stressing problem solving and workplace learning, that might serve as the model for general curriculum. (SK)
Directory of Open Access Journals (Sweden)
Evgeny M. Dorozhkin
2014-01-01
Full Text Available The study is aimed at investigating a justification of the new approach to the problem of vocational education development through the prism of interdependence research methodology and practice. This conceptual setup allows determining the main directions for teacher training modernization of vocational schools. The authors note that the current socio-economic situation in our country has actualized the problem of personnel training. Politicians, economists and scientists’ speeches are all about the shortage of skilled personnel. They see the main reason of this catastrophic situation in the present system of primary and secondary vocational education. At least they concern over the current practice of pedagogical personnel training of vocational education who are to restore the system of vocational education. Our country, Russia has a great positive experience in solving this problem. Scientific-methodological centre for vocational teacher education is the Russian State Vocational Pedagogical University under the scientific direction of Academician of the Russian Academy of Education, G. M. Romantsev. The reflection of scientifictheoretical bases of this education led the authors to the analysis and designing (formation of existent and new professional and pedagogical methodology. Methods. The fundamental position of A. M. Novikov on the generality of the research (scientific and practical activity methodology has become the theoretical platform of the present study. Conceptual field, conceptual statements and professional model are presented as the whole system (or integrating factor. The theoretical framework has determined the logic of the study and its results. Scientific and educational methodology differentiation in terms of the subject of cognitive activity has allowed identifying the main scientific and practical disciplines of vocational teacher education. The creative concept as the subject ground is instrumental analysis of
Vocational Education in the Third World: Revisiting the Debate.
Abrokwa, Clemente K.
1995-01-01
Since the 1960s, the goals of vocational education in developing countries have not been achieved. Present economic conditions and lack of public sector jobs are causing students to reevaluate occupational aspirations. Vocational education needs to be redefined to suit the current socioeconomic context and student needs. (SK)
2012 SARA Students Technical Report
International Nuclear Information System (INIS)
Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet
2012-01-01
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of
2012 SARA Students Technical Report
Energy Technology Data Exchange (ETDEWEB)
Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory
2012-07-30
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the
Directory of Open Access Journals (Sweden)
E. M. Dorozhkin
2014-01-01
Full Text Available The study is aimed at investigating a justification of the new approach to the problem of vocational education development through the prism of interdependence research methodology and practice. This conceptual setup allows determining the main directions for teacher training modernization of vocational schools.The authors note that the current socio-economic situation in our country has actualized the problem of personnel training. Politicians, economists and scientists’ speeches are all about the shortage of skilled personnel. They see the main reason of this catastrophic situation in the present system of primary andsecondary vocational education. At least they concern over the current practice of pedagogical personnel training of vocational education who are to restore the system of vocational education. Our country, Russia has a great positive experience in solving this problem. Scientific-methodological centre for vocational teacher education is the Russian State Vocational Pedagogical University under the scientific direction of Academicianof the Russian Academy of Education, G. M. Romantsev. The reflection of scientific-theoretical bases of this education led the authors to the analysis and designing (formation of existent and new professional and pedagogical methodology. Methods. The fundamental position of A. M. Novikov on the generality of theresearch (scientific and practical activity methodology has become the theoretical platform of the present study. Conceptual field, conceptual statements and professional model are presented as the whole system (or integrating factor. The theoretical framework has determined the logic of the study and its results.Scientific and educational methodology differentiation in terms of the subject of cogni live activity has allowed identifying the main scientific and practical disciplines of vocational teacher education. The creative concept as the subject ground is instrumental
Rose, Richard; Kaikkonen, Leena; Koiv, Kristi
2007-01-01
This paper presents the findings from research conducted with two samples of teachers from Estonian Vocational Schools. The first sample comprised a group of teachers who had received professional development directly related to the management of students with special educational needs in vocational education settings. Their attitudes and…
Vocational Education: A Social Anarchist Perspective
Suissa, Judith
2004-01-01
This article discusses the social anarchist tradition of educational thought and practice, in order to throw new light on the philosophical discussion of the liberal-vocational distinction. Focusing on the central anarchist idea of integral education, I argue that the political stance of social anarchism is inseparable from the educational ideas…
Students’ Preferred Characteristics of Learning Environments in Vocational Secondary Education
Directory of Open Access Journals (Sweden)
Ingeborg Placklé
2014-12-01
Full Text Available If teachers and teacher educators are willing to support the learning of students, it is important for them to learn what motivates students to engage in learning. Students have their own preferences on design characteristics of powerful learning environments in vocational education. We developed an instrument - the Inventory Powerful Learning Environments in Vocational Education - to measure students’ preferences on characteristics of powerful learning environments in vocational education. We investigated whether student preferences on the design of their learning environments are in line with what is described in the literature as beneficial for learning. Data of 544 students show that the preferences of students support most characteristics of PLEs in vocational education. Looking through the eyes of students, teachers have to challenge their students and encourage them to take their learning in their own hands. Adaptive learning support is needed. Remarkable, students do not prefer having reflective dialogues with teachers or peers.
Philosophical and Sociological Overview of Vocational Technical Education in Nigeria
Kennedy, Odu Oji
2012-01-01
Vocational Technical Education is any kind of education which has the main purpose of preparing one for employment in recognized occupation. The foundation of vocational technical education is based on philosophy which was mainly established for self-employment and self-reliance of the individual(s) who partake in it. Viewing the philosophy and…
Negru-Subtirica, Oana; Pop, Eleonora Ioana
2018-04-01
Education and vocation are core identity domains in adolescence. School is a normative social context in this developmental time frame and the formation of an educational identity is embedded in the goals that youth pursue in school. One of the main goals of education is to prepare young people for their future careers. Hence, educational identity should support the formation of vocational identity during adolescence. Considering the limited evidence on the longitudinal links between these two domain-specific identities, we conducted a three-wave investigation, testing the moderating role of age group, gender, and type of school. Participants (N = 1030; 59.3% female) were adolescents (M age = 16.72 years, SD age = 1.23, age range 14-19 years) who completed self-report measures of educational and vocational identity three times during an academic year. We underscored reciprocal associations between educational identity and vocational identity. The results indicate that strong educational commitments supported the formation of strong vocational commitments across time. Adolescents who were involved in the in-depth exploration of their educational choices also reported more vocational exploration during the school year. In turn, vocational identity processes also supported educational identity formation, especially the reconsideration of educational commitments. In terms of moderators, we underscored that vocational commitment making and vocational flexibility bolstered educational commitment only in early-to-middle adolescents. Educational in-depth exploration fostered the identification with vocational commitments only in girls. Educational reconsideration of commitment promoted vocational self-doubt only in adolescents attending work-bound high-schools. Implications for research and practice are discussed.
What Would Humboldt Say: A Case of General Bildung in Vocational Education?
Directory of Open Access Journals (Sweden)
Ruhi Tyson
2016-12-01
Full Text Available A classic philosopher in the Bildung tradition, Humboldt argued that general Bildung was the opposite of specialist training (vocational education. This has been a matter of contention and the aim here is to revisit the issue through an empirical case study. In the vocational education biography of craft master Wolfgang B. he speaks about aspects of his education that have much in common with Humboldt’s ideal of general Bildung but transposed into the context of vocational education and training (VET. The concept of vocationalism (Beruflichkeit provides context to the present argument which is that the contrast Humboldt made is relevant but not in the sense of there being two categories of education (general and vocational but rather two expressions of pedagogy: one expansive and one exclusive. Furthermore, there are two versions of general or expansive Bildung present in the case. The conclusions are that empirical studies of vocational Bildung expand on the concept of Bildung, increase our understanding of how VET contains affordances of Bildung and of the curriculum-patterns related to this.
Mishra, Arun K.
Education has a place of high priority on India's development agenda. The technical/vocational education (TVE) system is multisectoral with each ministry responsible for labor force development in that sector. The TVE programs in the formal education system are either state delivered or financed. The higher secondary vocational education program…
The Interdependency of Vocational and Liberal Aims in Higher Education
Abowitz, Kathleen Knight
2006-01-01
Many college and university students are zeroed in on their vocational pursuits. Often very narrowly focused, many college students simplistically equate a college education with a vocational education. In situations of advising, teaching, or life coaching, teachers often encounter students who believe that college is largely preparation for a…
34 CFR 403.1 - What is the State Vocational and Applied Technology Education Program?
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false What is the State Vocational and Applied Technology... TECHNOLOGY EDUCATION PROGRAM General § 403.1 What is the State Vocational and Applied Technology Education Program? (a) Under the State Vocational and Applied Technology Education Program, the Secretary makes...
The Development of Non-Formal Technological and Vocational Education in Village Communities
Widaningsih, Lilis; Abdullah, Ade Gafar
2016-01-01
This article presents a preliminary study which was done through a literature review of various scientific references on the development of human resources through non-formal technological and vocational education. Current issues and problems in developing countries are related to the low quality of human resources in villages due to the low education and skills (technological and vocational skills). The development of non-formal technological and vocational education for village communities ...
A Commentary by Chinese Hotel Workers on the Value of Vocational Education.
Huyton, Jeremy R.; Ingold, Anthony
1999-01-01
An adaptation of Kelly's Repertory Grid was completed by Chinese hotel staff. Results showed they revered higher education qualifications for the prestige and respect they commanded; secondary vocational-technical education was viewed very negatively. However, higher education is typically better funded and staffed than vocational education. (SK)
A Study of the Vocational Education Preferences and Interests of the Indian Undergraduate Students
Directory of Open Access Journals (Sweden)
P.A. Reddy
2011-05-01
Full Text Available The study identifies the priorities of vocational educational courses and interests of the Indian undergraduate students. The study was conducted in S.V. University area covering 300 undergraduate students of Arts, Commerce and Science streams. The study identified the more prominent, prominent and less prominent vocational educational courses. Further, studies the association between vocational education interests and the background of the students (sex, caste, stream of study, year of study and area. The difference between various groups of students belonging to above groups in their vocational education interests of the undergraduate students was also identified. The study provided a suggestive list of vocational educational courses for undergraduate students for enhancing their employability.
Standardized Curriculum for Marketing and Cooperative Vocational Education.
Mississippi State Dept. of Education, Jackson. Office of Vocational, Technical and Adult Education.
Standardized course titles and core contents for seven marketing and cooperative vocational education courses in Mississippi are provided: (1) marketing education, part one; (2) marketing education, part two; (3) fashion merchandising; (4) marketing cooperative education, part one; (5) marketing cooperative education, part two; (6) diversified…
Duch, Henriette; Andreasen, Karen E.
2015-01-01
A new education program, Diploma of Vocational Pedagogy, has recently been implemented in Denmark to upskill vocational college teachers and improve didactics at VET colleges in general. Among many challenges, vocational college teachers have to adapt their pedagogy to a large number of students from backgrounds with no tradition for education.…
Bell, T. H.
Half of this paper is the text of a lecture on the role of the university in job-related education in which the author suggests what universities ought to learn from vocational education. Pointing out that the challenge goes deeper than vocational or professional education, he challenges universities to have an eye for theory and practice, an eye…
Wood, M. A.
2003-12-01
The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.
Directory of Open Access Journals (Sweden)
E. M. Dorozhkin
2017-01-01
Full Text Available Introduction. Nowadays, there is no evidence-based strategy of upgrade of system of preparation of pedagogical personnel for continuous professional education in the Russian Federation. At the same time, scientists recognize that smoothly running regular high-quality replenishment of education by the skilled heads and teachers having fundamental psychology and pedagogical knowledge and being specialists in one of economic industries has crucial importance for successful development of post-industrial society. Hence, the need for creation of multichannel system of professional and pedagogical preparation has emerged.The aim of the present publication is to provide the complex overview of problems of reforming of professional pedagogical education and to show possible ways of their decision.Methods. The methodological basis of the study involves the concept of professional development of an individual; the thesis on the integration of the system-based, process and project approaches; the principles for the development of professional pedagogical education. Panoramic approach to the discussed problems of modernization of professional and pedagogical school has defined the logic of our research.Results. Psychological and pedagogical problems of professional education are analysed. Multidimensional metaprofessional qualities of teachers of vocational school are considered. The conceptual model of vocational structure of preparation of pedagogical personnel is developed for the system of continuous professional education.The debatable aspect of the research is reflected in the project of a psychological and pedagogical platform – the autonomous modular educational program including massive open online courses, management systems of educational process, supports of innovative infrastructure of education, humanitarian technologies of high education.Practical significance. The vocational structure of training of teachers of vocational
Vocational Education and Learning in Higher Education
de Carvalho, Cynthia Paes
2012-01-01
This article discusses the relationship of students with learning and the university in the context of current challenges to vocational education and economic development. Inspired by the research of Pierre Bourdieu, this case study focuses on the relationship of students to learning and the university in Brazil. The survey gathered elements that…
The Role of Vocational Education in Agriculture--Economic Efficiency.
McMillion, Martin B.
1982-01-01
Vocational agriculture is education for work. By meeting the needs of the economy and the job market, it can meet the needs of the individual. Although human resource development is important, vocational agriculture should focus on job-relevant competencies and cost effectiveness. (SK)
38 CFR 21.130 - Educational and vocational courses outside the United States.
2010-07-01
... vocational courses outside a State if the case manager determines that such training is in the best interest... vocational courses outside the United States. 21.130 Section 21.130 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation...
Benchmarking Danish Vocational Education and Training Programmes
DEFF Research Database (Denmark)
Bogetoft, Peter; Wittrup, Jesper
This study paper discusses methods whereby Danish vocational education and training colleges can be benchmarked, and presents results from a number of models. It is conceptually complicated to benchmark vocational colleges, as the various colleges in Denmark offer a wide range of course programmes...... attempt to summarise the various effects that the colleges have in two relevant figures, namely retention rates of students and employment rates among students who have completed training programmes....
Forster, Andrea G; Bol, Thijs
2018-02-01
Vocational education is seen as beneficial for the labor market allocation of young people. However, recent studies point to disadvantages later in the life course, where the specific skills that are obtained from vocational education decrease employability. This paper re-evaluates this hypothesis for the Netherlands with an improved measure for the vocational specificity of educational programs, utilizing both vertical (level) and horizontal (field) information on education. More specifically, we use a gradual measure for the linkage strength between education and occupation to predict employment over the life course. Using data from the national Dutch labor force surveys, we show that there is considerable heterogeneity in occupational specificity within the categories of vocational and general educational programs that is masked when using a dichotomous classification of general versus vocational education. In the life course analyses we find that the large early benefits of having vocational education disappear later in the career and turn into a small disadvantage before retirement. Copyright © 2017. Published by Elsevier Inc.
34 CFR 403.18 - What are the membership requirements of a State council on vocational education?
2010-07-01
... and groups within the State having an interest in vocational education. (b) Each State council must... on vocational education? 403.18 Section 403.18 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF VOCATIONAL AND ADULT EDUCATION, DEPARTMENT OF EDUCATION STATE...
Vocational Education and Training: A Major Shift in World Bank Policy.
Foster, Phillip
1992-01-01
Comments on the World Bank's policy paper on vocational and technical education and training. Argues that past failures in establishing effective vocational and technical education were a result of not applying conventional neoclassical economic theory. Asserts that the World Bank's policy paper corrects this approach. (CFR)
Raising the Profile of Career Guidance: Educational and Vocational Guidance Practitioner
Hiebert, Bryan
2009-01-01
In 2007 the International Association for Educational and Vocational Guidance (IAEVG) launched the Educational and Vocational Guidance Practitioner credential (EVGP) as one means of formally acknowledging the knowledge, skills, and personal attributes that practitioners need in order to provide quality career development services to clients. This…
How Vocational Psychologists Can Make a Difference in K-12 Education
Perry, Justin C.; Shannon, Lisa
2017-01-01
In general, vocational psychologists have not been engaged in applied research that demonstrates how career interventions can improve educational problems that matter to relevant decision-makers and stakeholders. This article describes how vocational psychology can make a difference in K-12 education by embracing an interdisciplinary…
Teacher Professionalism in Technical and Vocational Education
Tampang, B. L. L.; Wonggo, D.
2018-02-01
The advancement of a nation is largely determined by the advancement of education, and the field of education is on the teachers’ shoulders. Therefore, professionalism of teachers should be improved in performing their duties as facilitators, initiators, and motivators in achieving the competence of graduates. Teachers should be able to facilitate the learning process and pay attention to the development of learners in its various dimensions, leading to the ownership and development of intelligence, learning skills, attitudes, work skills, and social independence. Vocational education carried by Vocational High School, should not only provide theory, but also be coupled with the application or application of theory. It is time for us to rise up to give birth to professional experts in their fields, in accordance with the needs of the workforce. A professional teacher is required to have a work ethic and a high commitment to his profession, and always through continuous development through professional organizations, the internet, books, seminars, and the like. With the professionalism of teachers, then the future teacher does not appear again only as a teacher (teacher), such a prominent function during this, but switch as coach, counselor, and learning manager. Each Educational Institution of Education Personnel graduate and other college graduates who wish to become teachers are required to have at least the competence of the standard. Thus, teacher professionalism is a life-long and never-ending process. Developing and developing vocational education is an important and absolute thing to do, considering that approximately 80% of the workforce in the field is lower middle-level workforce.
The Financing of Vocational Education and Training in France. Financing Portrait. CEDEFOP Panorama.
Michelet, Valerie
This report examines the financing of the two components of France's vocational education and training (VET) system. They are initial vocational training (IVT), which includes upper secondary and short forms of higher education, and continuing vocational training (CVT), which aims to help workers adapt to changes in working techniques and…
Stratification, School-Work Linkages and Vocational Education
Ainsworth, James W.; Roscigno, Vincent J.
2005-01-01
Building on more classical status attainment and reproduction perspectives, this article examines the extent of class, race and gender inequality in high school vocational education, and the consequences for students' later educational and occupational trajectories. Analyses demonstrate significant class, race and gender disparities in vocational…
Heusdens, W. T.; Bakker, A.; Baartman, L. K. J.; De Bruijn, E.
2016-01-01
The nature of knowledge in vocational education is often described in dichotomies such as theory versus practice or general versus specific. Although different scholars now acknowledge that vocational knowledge is more than putting bits of theoretical and practical knowledge together, it is still unclear how vocational knowledge should be…
Vocational and technical education in Peru
Moock, Peter; Bellew, Rosemary
1988-01-01
The relative costs of and returns to VTE (Vocational and Technical Education) and general education in Peru are investigated here. The paper is composed as follows. Following a brief introduction, section 2 describes the system of education in Peru and changes that have occurred in this system over time. Section 3 surveys the (relatively sparse) literature on comparative rates of return to VTE and general education. Sections 4 and 5 describe, respectively, the data used for this study and the...
Collins, Helen
This book describes the 12 vocational education systems conducted by the members of the European Community. The 12 country chapters (Belgium, Denmark, France, Germany, Greece, Ireland, Italy, Luxembourg, The Netherlands, Portugal, Spain, and the United Kingdom) follow the same model and are organized into the following six sections: key facts,…
VOCATIONAL-PEDAGOGICAL EDUCATION IN RUSSIA: HISTORICAL AND LOGICAL PERIODS
Directory of Open Access Journals (Sweden)
V. A. Fedorov
2017-01-01
Full Text Available Introduction. Rapid social and economic changes demand new methods and forms of vocational training, reorganization of content of professional education, i.e. its modernizations which cannot be carried out without existence of the qualified pedagogical staff. Therefore, high-quality professional and pedagogical preparation becomes today not just one of education components, and, without exaggeration, a guarantee of social and economic wellbeing of the country. To provide due functioning of the system of vocational pedagogical education (VPE, it is necessary to understand its specifics and regularities of development; thus, it is necessary to track formation and evolution of the system.The aim of the study is to provide retrospective analysis at the organizational and substantial level of development of VPE in Russia as the social and pedagogical system.Methodology and research methods. The historical and logical approach has become the leading approach while researching the problems of VPE. It allows us to build the accurate sequence of formation of the system of training of teachers of specific disciplines and masters of vocational training; on this basis to reveal its shortcomings and possibilities.Results and scientific novelty. A brief background into history of the Russian and foreign vocational pedagogical education existing prior to the beginning of the 20th century is given. The chronology of development of VPE in Russia since 1920-s till modern period is presented. According to the key changes happening in a target and organizational-content part of VPE, six stages are distinguished and described. It is shown that development of this type of education as a social and pedagogical system is caused by socio-economic factors and administrative decisions; at the same time the VPE system has own regularities, principles of functioning and internal potential for further improvement.The relevance of the appeal to VPE history is emphasized. The
Introduction of a Quality Management System for Vocational Education and Training in Slovakia
Directory of Open Access Journals (Sweden)
Martin Podařil
2013-07-01
Full Text Available The issue of the quality of vocational education, school, teaching and learning of students should be in the interests of all participants in the education process. The quality of secondary school is the critical element in enhancing the attractiveness of vocational education in Slovakia. Finding an offcial scale that would provide such a information in Slovakia is unfortunately impossible. There is no system for evaluating the quality of vocational education and training (VET at vocational schools. There are no clearly defined criterias, rules or any standards. Speaking of an assessing the level of quality of vocational education on the base of existing outcomes in formal education such as monitoring, final exams, graduation exams is resulting in one-sided evaluation and does not address the systematic coherence and complexivity of this issue. An essential step os to create a functional system of evaluation of VET in Slovakia. The article describes importance of VET which can play a central role in preparing young people for work, developing the skills of adults and responding to the labour market needs of the economy and presents the project Model of the quality evaluation of vocational education and training at secondary vocational schools in Slovakia that is currently ongoing on many secondary vocational schools in western Slovakia and Austria. The aim of the project is to develop and apply an open, flexible and adaptable quality management system. The article not only presents indicators for evaluation but also the way how can be evaluated each of them. The effort of this project is also to create specialized portal with support services that provide transparent, clear and specific information from this area of interest. The introduction of the evaluation framework, the selection of indicators that take established criteria into consideration and assembling of the scale is therefore more than relevant and required
Is Adult Reading a Guide to Educational-Vocational Achievement?
Athanasou, James A.
2011-01-01
Reading is theorised as a key aspect of one's educational and vocational adjustment. The reading scores on the "Wide-Range Achievement Test 3" of 465 adult vocational assessment clients were examined. Reading varied across a range of social factors and the overall results were consistent with earlier studies, especially the "Adult…
Vocational Education in Tourism: Conceptual Framework Problems
Directory of Open Access Journals (Sweden)
Galina Shchuka
2012-12-01
Full Text Available This article analyzes the basic concepts that define the essence of the system of vocational education and helps to analyze the problem of tourism staffing support. According to authors’ hypothesis, the personnel problem is related to the imperfection of the tourism conceptual framework. As of all enterprises of travel industry only travel agencies and accommodation facilities work with tourists, the author proves that personnel training for these businesses is the major objective of vocational training in tourism.
Imdorf, Christian; Koomen, Maarten; Murdoch, Jake; Guégnard, Christine
2017-01-01
International audience; Educational policy developments in France and Switzerland have increased eligibility for higher education. This paper explores the extent to which vocationally orientated pathways to higher education reduce social inequalities in France and Switzerland. More specifically, we analyse how the vocational pathway facilitates access to higher education for male and female students from lower cultural capital backgrounds. We refer to gender theory to link young people's subj...
An Empirical Analysis of the Development of China's Higher Vocational Education
Minglun, Wang
2017-01-01
After more than 20 years of practice and construction, China's higher vocational education has developed into an important educational category and become an important force in the development of China's higher education. But in the course of this development, higher vocational education is facing problems such as excessively fast development,…
A Critical Study of Vocational-Industrial Education in Taiwan.
Koo, Po-Ken
This study was concerned with determining the kind of vocational-industrial educational programs that would best suit the needs of Taiwan. The general conditions and provisions of 27 existing vocational-industrial programs were studied to determine their strengths and weaknesses and to provide a set of principles that would serve as guideposts for…
Context-Driven Entrepreneurial Education in Vocational Schools
Sandirasegarane, Sharmila; Sutermaster, Staci; Gill, Alyssa; Volz, Jennifer; Mehta, Khanjan
2016-01-01
Vocational Education and Training (VET) is offered throughout the world to students of various educational backgrounds and career aspirations in an effort to create a skilled workforce. The structure of VET varies greatly across different fields and countries with high-growth, low-growth, and transitional economies. However, a common critique of…
2010-07-01
... council on vocational education? 403.17 Section 403.17 Education Regulations of the Offices of the... Responsibilities? § 403.17 What are the State's responsibilities regarding a State council on vocational education... shall establish a State council on vocational education. The State council must be appointed— (1) By the...
Wenja Heusdens; Arthur Bakker; Dr. Liesbeth Baartman; Prof.Dr. Elly de Bruijn
2016-01-01
In this article the idea of contextualising vocational knowledge is theorised to understand the nature of vocational knowledge and this process of contextualising is illustrated with empirical examples from culinary education.
Moral development and citizenship education in vocational schools
Leenders, H.; Veugelers, W.; de Kat, E.
2012-01-01
We investigate the objectives, practical application, and learning outcomes of moral education and citizenship education at three vocational schools in the Netherlands (VMBO). We explore teachers’ and students’ pedagogical, sociopolitical, and moral development objectives and how they deal with
International Nuclear Information System (INIS)
Belmont, J.L.; Fruneau, M.; Martin, P.
1989-05-01
SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration
Interpreting the SARA and RCRA training requirements
International Nuclear Information System (INIS)
Moreland, W.M.; Wells, S.M.
1987-01-01
The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements
The Genesis and Evolution of Pre-vocational Education: England.
Marshall, Stephanie
1990-01-01
Traces the history of English prevocational education since 1870, examining four pieces of educational legislation. Outlines the recurring debate over the extent utilitarianism should define education. Focuses on political and economic requirements that fostered utilitarianism. Evaluates the act's technical and vocational education initiative. (CH)
2010-07-01
... Coordination in Vocational and Technical Education? 412.1 Section 412.1 Education Regulations of the Offices of... EDUCATION NATIONAL NETWORK FOR CURRICULUM COORDINATION IN VOCATIONAL AND TECHNICAL EDUCATION General § 412.1 What is the National Network for Curriculum Coordination in Vocational and Technical Education? The...
Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.
O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J
2008-04-01
Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.
48 CFR 853.271 - Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs. 853.271 Section 853.271 Federal Acquisition... Guaranty, Education and Vocational Rehabilitation and Counseling Programs. ...
Developments in the Vocational Education and Training Systems of Indonesia and Australia.
Robinson, Chris
For the past 20-30 years, both Indonesia and Australia have placed considerable emphasis on reforming their systems of technical and vocational education and training (TVET). Indonesia has focused on expanding secondary-level TVET, whereas Australia has emphasized provision of postsecondary-level vocational education and training (VET). Two…
Revitalizing Technical and Vocational Education Training for ...
African Journals Online (AJOL)
Administrator
integrating technical and vocational education and training ... A cost sharing agreement was therefore signed in 2000, between. UNESCO and Nigeria Federal Ministry of .... done in the area of the target population, logistic and welfare.
Atkinson, Georgina
2011-01-01
Is vocational education and training (VET) really a technicolour coat that can fulfil many dreams? Does it meet all the training needs of a very diverse group of Australian students, workers and industries? What does it contribute to the economy and society? These were some of the questions asked at the National Centre for Vocational Education…
Gender-Mainstreaming in Technical and Vocational Education and Training
Nurhaeni, I. D. A.; Kurniawan, Y.
2018-02-01
Gender differences should be considered in vocational high schools so women and men can develop their potentials without being inhibited by gender bias. Gender mainstreaming in vocational high schools is a strategy to integrate gender differences at all stages in teaching-learning process for achieving gender equality and equity. This research evaluates the implementation of gender mainstreaming in vocational high schools consisting of seven key components of gender mainstreaming. Four vocational high schools in Sragen Regency Indonesia have been purposively selected. The data were obtained through in-depth interviews and documentation studies. The data were analyzed using Kabeer’s model of gender analysis. The findings show that not all key components of gender mainstreaming have been implemented in vocational high schools. Most vocational high schools have implemented three of seven key components of gender mainstreaming, namely political will and leadership, policy framework and gender statistics. Meanwhile four of seven key components of gender mainstreaming, namely structure and mechanism, resources, infra structures and civil society have not been well-implemented. In conclusion gender mainstreaming has not been implemented effectively in vocational high schools. Accordingly, the government’s education office should continue to encourage and publish guidelines on the implementation of gender-mainstreaming in vocational high schools.
The role and meaning of vocations in the transition from education to work
DEFF Research Database (Denmark)
Jørgensen, Christian Helms
discusses some of the properties of this regime and reports the results of two studies on school to work transition that have followed the former vocational student 6 years after they completed their educations. A special interest was given to the role of vocations both considered as social institutions......Paper for The 6th International Conference Researching Work and Learning Roskilde University, Denmark June 28 to Juli 1, 2009 Symposium 6 Vocational Education and Training - New models of apprenticeship The patterns of transition from education to work have generally become prolonged and more...... complex, and with growing problems of dropout and low retention rates. Secondary vocational education and training based on a Dual System and occupational labour markets are generally noted for having low levels of youth unemployment and a smooth transition to work. This is assumed to be an effect...
Boersma, A.; ten Dam, G.T.M.; Wardekker, W.L.; Volman, M.L.L.
2016-01-01
In this study, the concept of ‘community of learners’ was used to improve initial vocational education. The framework of a ‘community of learners for vocational orientation’ that we present offers both a theoretical understanding of teaching–learning processes in initial vocational education and
Boersma, A.; ten Dam, G.; Wardekker, W.; Volman, M.
In this study, the concept of ‘community of learners’ was used to improve initial vocational education. The framework of a ‘community of learners for vocational orientation’ that we present offers both a theoretical understanding of teaching–learning processes in initial vocational education and
Elffers, L.
2011-01-01
The transition to post-secondary vocational education in the Netherlands appears to be difficult for many students. Dropout rates peak in the first year after the transition to senior vocational education (SVE, or MBO in Dutch). To enhance the school careers of students in SVE, we need to find out
Identifying Learning Preferences in Vocational Education and Training Classroom Settings
Smith, Peter J.
2006-01-01
This research was designed to assess whether teachers and trainers of vocational learners noted and valued differences in individual learning preferences and, if so, how those differences were observed in natural classroom, workshop or other formal learning settings. Data were collected from six vocational education and training (VET) learning…
Directory of Open Access Journals (Sweden)
Brisko B.
2012-10-01
Full Text Available Education is the most significant factor of socialization. Education is the largest sector of modern industry. The socialization functions in education can be defined as availability for work and an ability to make decisions independently so that the individual in his later life period could perform his social roles and integrate in social structures with specific role types. The aim of the publication is to find out what functional significance vocational education learners give to education. The quantitative research method was applied, surveying the respondent groups that comprised 503 vocational education learners from Riga, Liepaja, Daugavpils and Jelgava. According to the research results, most vocational education learners consider that it is necessary to study to get the desired job and be well prepared for the future job, to get a diploma and prestige in society, to ensure better financial situation and personal development, to have a better understanding of global events, to gain respect from friends and acquaintances, to be useful for society and to work abroad. The discussion section of the publication emphasizes that special attention should be paid to the factor that learners in their future vision prefer to work abroad. This can be explained by the current situation of the labour market and considerably high unemployment rate in Latvia.
Yawson, Robert
2011-01-01
In an attempt to inform how to approach nanotechnology vocational education training (nanoVET), this article briefly discusses the history of the development of vocational education training (VET) in the United States during the past century. The history of nanotechnology development and the current advances in this emerging field are discussed in…
Vocational technical and adult education: Status, trends and issues related to electronic delivery
Rothenberg, D.
1973-01-01
Data are analyzed, and trends and issues are discussed to provide information useful to the systems designer who wishes to identify and assess the opportunities for large scale electronic delivery in vocational/technical and adult education. Issues connected with vocational/technical education are investigated, with emphasis on those issues in the current spotlight which are relevant to the possibilities of electronic delivery. The current role of media is examined in vocational/technical instruction.
National Profiles in Technical and Vocational Education in Asia and the Pacific: Nepal.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
One of a series of studies on the development of technical and vocational education in the member states of UNESCO, this report profiles the educational system in Nepal. The four parts of the document provide general information about the following: the country; the history, goals, and structure of the educational system; vocational technical and…
When Work Comes First: Young Adults in Vocational Education and Training in Norway
Tønder, Anna Hagen; Aspøy, Tove Mogstad
2017-01-01
Since reforms implemented in 1994, vocational education and training (VET) in Norway has been integrated and standardized as part of upper-secondary education. When young people enter upper-secondary education at the age of 15 or 16, they can choose either a vocational programme or a general academic programme. The standard model in vocational…
System Analysis and Risk Assessment system (SARA) Version 4.0
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1992-01-01
This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis
Issues in Strategic Planning for Vocational Education: Lessons from Algeria, Egypt, and Morocco.
Salmi, Jamil
1991-01-01
Although Algeria, Egypt, and Morocco have followed substantially different development strategies, they exhibit similar signs of crisis in vocational education. An integrated approach to planning that acknowledges social, financial, technological, and economic constraints could help coordinate general and vocational education and specialized…
Investment in Human Capital: Vocational vs. Academic Education
Orkodashvili, Mariam
2008-01-01
The dilemma of providing effective education particularly in developing countries with limited resources and ambiguous calculations of rates of return due to unstable economies and labour market fluctuations makes it an absolute necessity to consider costs and benefits associated both with academic and vocational education. Through argumentation…
Technical Education and Vocational Training in Developing Nations
Okolie, Ugochukwu Chinonso, Ed.
2017-01-01
Severe economic depression and the difficulty to acquire employment with adequate income have significant impact on a nation's social welfare. The need to provide ample educational opportunities is more imperative than ever, particularly in emerging economies. "Technical Education and Vocational Training in Developing Nations" is a…
Extended Teams in vocational education: Slow starters but worth the wait
Mazereeuw, Marco; McKenney, Susan; Wopereis, Iwan
2015-01-01
This study was undertaken due to the notorious frustrations of vocational educators and workplace supervisors concerning (mis)alignment between school and work contexts. Extended teams, consisting of vocational teachers and workplace supervisors, were established to share responsibility for the
How Has Vocational Culinary Arts Changed as a Result of a Redesign of the Education System.
VanLandingham, Paul G.
Vocational education reforms that followed passage of the Carl D. Perkins Vocational Education Act of 1963 initiated the development of many new vocational culinary arts programs that trained high school students with state-of-the art equipment. When the National Consortium of Competency Based Education was established in 1973, it changed the form…
Directory of Open Access Journals (Sweden)
I Kadek Budi Sandika
2018-01-01
Full Text Available This study aims to: (1 develop a partnership model of vocational education with business sectors in civil engineering expertise program of vocational secondary schools in Bali and (2testing the effectiveness and efficiency of partnership model developed. The study used the design and development model of Richey & Klein (2009, which consists of three main phases, namely the phase of model development, model validation, and model testing. The phase of model development used the qualitative approach, through literature review, observation and interview. Expert review techniques were used in the model validation phase. The model testing used pre-experimental design with one-shot case study. The study found that the partnership model of vocational education with the business sector in civil engineering expertise program of vocational secondary schools in Bali involves several components, such as key stakeholders, the underlying principle of partnership, orientation/common goal, the management of educational resources (teachers and facilities, curriculum development, implementation of learning/training and work practices, competency test of graduates, distribution of learning outcomes/output, as well as monitoring, evaluation and feedback of partnership program. Experimental results show that the partnership model developed has met all of the criteria (effective, practical and efficient.
Vocational and Technical Education in Peru.
Bellew, Rosemary; Moock, Peter
1990-01-01
This cost-benefit analysis of Peruvian vocational and technical education (VTE) partly substantiates previous research suggesting that VTE in developing countries fails to offer a return commensurate with its cost. The costs of academic and VTE streams in Peru are similar, and graduates' monetary returns and occupational profiles are almost…
Lushin, Viktor; Jaccard, James; Ivaniushina, Valeria; Alexandrov, Daniel
2017-07-01
Working-class educational paths tend to be associated with elevated drinking. Little research has examined whether disproportionate alcohol use among vocationally oriented youth begins before or after the start of their vocational education. The present study analyzes a large sample of Russian middle-school students (N=1269; mean age=14.9), comparing the patterns of drinking among middle-schoolers oriented towards vocational educational, and their peers who do not plan a vocational education path. Results suggest that the orientation towards vocational education is associated with disproportionately high alcohol involvement among Russian middle-school students, even before they enter vocational schools. We studied if such difference could be partially explained by how youth orient towards extracurricular activities: discretionary peer time in risky contexts, reading for pleasure, working for pay, and religious activities. Reading demonstrated the strongest (negative) association with alcohol use, while religious activity unexpectedly revealed a positive (though weak) association with drinking. Research and policy implications are discussed. Copyright © 2017 Elsevier B.V. All rights reserved.
Europeanisation and policy change in the Danish vocational education and training system
DEFF Research Database (Denmark)
Cort, Pia
2010-01-01
This article aims to analyse the interrelationship between the Copenhagen Process, EU vocational education and training policy, and Danish initial vocational education and training policies in order to shed light on the role of EU policies in policy and institutional change. The article points...... to the complexity of policy-making and the crisscrossing of policies across the globe. A major change is the acceptance of the EU as a stakeholder in vocational education and training policy-making and thereby an expansion of the policy space. However, the changes taking place at national level are incremental...... and the EU policy is translated in the national context, where it contributes to the re-accentuation of existing conflicts and fissures....
Hanushek, Eric A.; Woessmann, Ludger; Zhang, Lei
2011-01-01
Policy debates about the balance of vocational and general education programs focus on the school-to-work transition. But with rapid technological change, gains in youth employment from vocational education may be offset by less adaptability and thus diminished employment later in life. To test our main hypothesis that any relative labor-market…
2010-07-01
... VOCATIONAL AND ADULT EDUCATION, DEPARTMENT OF EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION... under that award to improve vocational education programs. (2) Projects assisted with funds awarded... 34 Education 3 2010-07-01 2010-07-01 false How must funds be used under the Secondary School...
Directory of Open Access Journals (Sweden)
Beat A. Schwendimann
2018-04-01
Full Text Available Future workplaces require collaboration skills in which members of different work communities use technologies to solve complex problems. Vocational education and training (VET programs need to meet the challenge to prepare students to be part of a competent workforce. Particularly initial vocational education is under pressure to develop learners’ collaboration skills and abilities. To date, however, no attempt has been made to perform a comprehensive review of the use of computer-supported collaborative learning (CSCL technologies across different vocational education settings to account for contextual factors of VET. In this systematic review, 26 published studies were analyzed with respect to their demographics, research methodology, use of technology, and measured outcomes. This review illuminates that research on CSCL still leaves the vocational learning context as an under-represented field of study. At the same time, technologies offer a range of new types of learning possibilities for vocational education. As the direct result of that development, vocational education is increasingly taking place in new technology-enhanced learning settings. Education can benefit from the opportunities of CSCL technologies, but on the other hand, such technologies create new challenges for facilitating vocational learning. Therefore, this review also identifies three topic areas specific to vocational learning (collaborative writing-to-learn, simulations and game-like solutions, and tangible objects and enumerates desirable lines for future research.
Vocational Education and Skills Training in Mainland Tanzania for ...
African Journals Online (AJOL)
The development of any country Tanzania included depends on availability and effective utilization of human resources, which in turn are predicated on the level, quantity and quality of education, especially vocational and technical education and skills attained through formal and informal education, living and working ...
National Research Council Canada - National Science Library
Rasinski, Kenneth
1998-01-01
.... Given the changing nature of employer's demands, one important question is whether those young men and women who take vocational education courses in high school and go to work rather than to college...
Hyland, Terry
2011-01-01
The devaluation and debilitation of education in general and vocational education and training (VET) in particular has been explored and described in recent years by a wide range of critical commentators. Education stands in dire need of therapy, and this paper suggests a therapeutic process for rejuvenating and enhancing VET through attention to…
The role and meaning of vocations in the transition from education to work
DEFF Research Database (Denmark)
Jørgensen, Christian Helms
2013-01-01
The purpose of this paper is to explore current patterns of transition from education to work in the Dual System of VET in Denmark. First it will explore some of the significant changes that have taken place in the transition process. Then it will discuss two dimensions of the role of vocations...... and occupations in the transition process. One dimension is to connect the edu-cational system with the employment system. The other is to offer imagined future identities for young people entering vocational education. The last part of the paper will present some findings from two research projects on the role...... and meaning of vocations in the transition from education to work in the Danish dual system....
Vocational Education and Industrial Relations: Sweden 1910–1975
Directory of Open Access Journals (Sweden)
Tobias Karlsson
2018-02-01
Full Text Available In this article we discuss vocational education in Sweden against the backdrop of the changing nature of industrial relations in the period from ca 1910 to 1975. Drawing upon evidence from official inquiries and case studies of two industries (forest industry and shipbuilding, we show that Sweden in the 1940s and 1950s can be described as a collective skill formation system in the making, where firms, intermediary associations, and the state cooperated around vocational education and training. However, Sweden developed in a very different direction than similar countries. We argue that this remarkable change of trajectory cannot be understood without considering the simultaneous disintegration of the model of industrial relations, along with general changes in the system of education.
Does Vocational Education Model fit to Fulfil Prisoners’ Needs Based on Gender?
Hayzaki, S. H.; Nurhaeni, I. D. A.
2018-02-01
Men and women have different needs, based on their gender or the socio-cultural construction. The government has issued a policy about accelerating the equivalence of gender since 2012 through responsive planning and budgeting. With the policy, every institution (including the institutions under the ministry of law and human rights) must integrate its gender perspective on planning and budgeting, then it can fulfill the different needs between men and women. One of the programs developed in prisons for prisoners is vocational education and technology for preparing the prisoners’ life after being released from the prison cells. This article was made for evaluating the vocational education and training given to the prisoners. Gender perspective is employed as the analyzing tool. The result was then used as the basis of formulating vocational education model integrating gender perspective. The research was conducted at the Prison of Demak Regency, Indonesia. The method used in the research is qualitative descriptive with data collection techniques using by in-depth interviews, observation and documentation. The data analysis uses statistic description of Harvard’s checklist category model and combined with Moser category model. The result shows that vocational education and training given have not considered the differences between men and women. As a result, the prisoners were still not able to understand their different needs which can cause gender injustice when they come into job market. It is suggested that gender perspective must be included as a teaching material in the vocational education and training.
Heusdens, Wenja; Bakker, Arthur|info:eu-repo/dai/nl/272605778; Baartman, L.K.J.|info:eu-repo/dai/nl/261829580; de Bruijn, Elly|info:eu-repo/dai/nl/074460919
2016-01-01
The nature of knowledge in vocational education is often described in dichotomies such as theory versus practice or general versus specific. Although different scholars now acknowledge that vocational knowledge is more than putting bits of theoretical and practical knowledge together, it is still
Kyndt, Eva; Janssens, Ine; Coertjens, Liesje; Gijbels, David; Donche, Vincent; Van Petegem, Peter
2014-01-01
The current study reports on the process of developing a self-assessment instrument for vocational education students' generic working life competencies. The instrument was developed based on a competence framework and in close collaboration with several vocational education teachers and intermediary organisations offering various human…
2010-07-01
... Applied Technology Education Programs? 400.9 Section 400.9 Education Regulations of the Offices of the... VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION PROGRAMS-GENERAL PROVISIONS § 400.9 What additional requirements govern the Vocational and Applied Technology Education Programs? In addition to the Act, applicable...
Determination of Self-Development in the Vocational Educational Environment
Directory of Open Access Journals (Sweden)
E. F. Zeer
2012-01-01
Full Text Available The paper explores the concept of vocational educational environment combining vocational training, professional development and professional world. The research is aimed at the self-determination analysis of an individual in the above environment. The authors observe the two existing trends of self-development analysis, corresponding with the subjective activity and culturally historical approaches. The empirical research results involve the students’ subjective individual characteristics and factors influencing the self-development strategy selection. The research findings prove the earlier hypothesis of the self- development phenomenon being determined by the two mutually conditioned factors: personal self-control ability and interrelation of the above mentioned components of the vocational educational environment. The authors make the conclusion that the self-development prospects are determined by the internal and external motivation, professional mobility and striving for success. The determination specificity of professional self- development, identified by the authors, can provide the psychological basis for future specialists training.
SCIENTIFIC-RESEARCH WORK OF STUDENTS IN ORGANIZATIONS OF SECONDARY VOCATIONAL EDUCATION
Directory of Open Access Journals (Sweden)
Natalya O. Vaganova
2016-01-01
Full Text Available The aim of the study is to reveal features and possibilities of research work in the organizations of secondary professional education. Methods. Theoretical methods involve analysis of legislative, normative documents; comparison and generalization of the findings of scientists on research activities. Empirical methods: pedagogical observation, to study the experience of organization of research work. Results. The definition of «research ability» is proposed; the system of organization of research activity in the organization of secondary vocational education, including the identification of approaches to the concept of «research» is developed; development of a program of research skills formation is given; definition of subjective functional relationships for the implementation of the programmer of research; the development of training programs for teaching staff the organization of the secondary professional education to the organization and conduct of research activities with students; creation of innovative infrastructure as a set of resources and means to ensure the maintenance of research activities. Scientific novelty. An attempt to fill the gaps in the methodology of organization of research activity in organizations of secondary vocational education is taken. Peculiarities of the educational programs of secondary vocational education, defining the forms of research activities are disclosed. Approaches to the concept of «research», the formation of research skills and development of professional-pedagogical competences of teachers as subjects of research activities are proposed. Practical significance. The use of suggested approaches to conducting research in organizations of secondary vocational education can increase the level of students and extend the functionality of teachers.
Wang, Dong
2013-01-01
Human resource development is one of the theories guiding China's development of secondary vocational education. Secondary vocational education has always played a role in human resource training and development from the nation's founding to the present. In Chinese society today, however, there is a clear instrumentalist tendency in secondary…
he (UnAttractiveness of Vocational and Technical Education: Theoretical Background
Directory of Open Access Journals (Sweden)
Miha Lovšin
2014-03-01
Full Text Available This paper considers the problem of the lack of attractiveness of vocational and technical education via a review of legislation on counselling practices, implementing documents, and the social factors by means of which the education system can influence the individual’s decision. It is apparent that legislation regulating the organisation and content of career counselling services in educational sector is inadequate. The organisation of career counselling at the level of implementation is also inadequate. Counsellors advise individuals on the basis of their academic results and the results of aptitude tests. Counselling practices deriving from theories that place career planning and management skills in the foreground are more rarely represented. Theories that treat career decisions as a social process show that at the level of the student population the choice of the type of school is a rational decision based primarily on the economic position and level of education to which a specific educational pathway is generally supposed to lead. The lower attractiveness of vocational and technical education coincides with the fact that representatives of lower social classes have a weaker economic position and more frequently have vocational and technical education qualifications than representatives of higher social classes. Nevertheless, the trend of high unemployment among young people with academic qualifications, which opposite of the traditional situation, indicates that it will be necessary to include career planning and management skills in the educational contents of institutionalised and formal education as a whole.
The relationship between SARA fractions and crude oil stability
Directory of Open Access Journals (Sweden)
Siavash Ashoori
2017-03-01
Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.
Extended teams in vocational education : collaboration on the border
Mazereeuw, Marco; Wopereis, Iwan; McKenney, Susan
2016-01-01
Extended Teams (ETs), in which teachers and workplace supervisors are jointly responsible for the quality of education, were established to solve problems concerning school–workplace connections in vocational and professional education. Six ETs were investigated during their 1st year of
Extended teams in vocational education: Collaboration on the border
Mazereeuw, Marco; Wopereis, Iwan; McKenney, Susan
2018-01-01
Extended Teams (ETs), in which teachers and workplace supervisors are jointly responsible for the quality of education, were established to solve problems concerning school–workplace connections in vocational and professional education. Six ETs were investigated during their 1st year of
Towards distributed leadership in vocational education and training schools
Bouwmans, M.H.C.F.; Runhaar, P.R.; Wesselink, R.; Mulder, M.
2017-01-01
Complex educational innovations in vocational education and training (VET) schools require teamwork and distributed leadership so that team members are enabled to contribute based on their expertise. The literature suggests that distributed leadership is affected by formal leaders’ and teachers’
Catalog of Vocational Education and Related Programs Designed for Instruction of American Indians.
McBain, Susan; And Others
To plan a curriculum for a vocationally based community school in Navajo, New Mexico, the Navajo Department of Education (with assistance from the American Institutes for Research) surveyed the nation for vocational education programs which had been developed or adapted specifically for use with American Indians or Alaska Natives. State directors…
Reflection on Quality Assurance System of Higher Vocational Education under Big Data Era
Directory of Open Access Journals (Sweden)
Jiang Xinlan
2015-01-01
Full Text Available Big data has the features like Volume, Variety, Value and Velocity. Here come the new opportunities and challenges for construction of Chinese quality assurance system of higher vocational education under big data era. There are problems in current quality assurance system of higher vocational education, such as imperfect main body, non-formation of internally and externally incorporated quality assurance system, non-scientific security standard and insufficiency in security investment. The construction of higher vocational education under big data era requires a change in the idea of quality assurance system construction to realize the multiple main bodies and multiple layers development trend for educational quality assurance system, and strengthen the construction of information platform for quality assurance system.
Career conversations in senior secondary vocational education
Mittendorff, K.M.
2010-01-01
In the Netherlands, many schools for senior secondary vocational education are implementing competence-based curricula. These curricula start from a constructivist approach and are based on the idea that young people should learn to reflect on their personal ambitions and motives, and to undertake
Layering of life (Sara novel of Peter Sarić
Directory of Open Access Journals (Sweden)
Kostić Dragomir J.
2015-01-01
Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safeguard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.
The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)
Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.
2017-01-01
We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.
Wood, M. A.; Oswalt, T. D.; SARA Collaboration
2000-12-01
We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.
Writing Performance Goals: Strategy and Prototypes. A Manual for Vocational and Technical Educators.
McGraw-Hill Book Co., New York, NY. Gregg Div.
The result of a cooperative project of the Center for Vocational and Technical Education at the Ohio State University and the McGraw-Hill Book Company, this manual was prepared to develop prototypes of performance goals for use by curriculum specialists and developers of instructional materials in vocational and technical education and to provide…
Igbinedion, V. I.; Ojeaga, I. J.
2012-01-01
The major thrust of technical and vocational education (TVE) worldwide is to address issues of youth unemployment, poverty and international competitiveness in skills development towards current and projected opportunities and challenges. The paper posits that despite the evidence of numerous reforms in vocational and technical education programs…
EDUCATION AND VOCATIONAL TRAINING OF TEC CLAIMANTS.
Indiana State Employment Security Div., Indianapolis.
TO COLLECT INFORMATION CONCERNING THE PERSONAL CHARACTERISTICS, FAMILY STATUS, EDUCATION AND VOCATIONAL TRAINING, WORK HISTORY, AND UNEMPLOYMENT EXPERIENCE OF TEMPORARY EXTENDED UNEMPLOYMENT COMPENSATION (TEC) CLAIMANTS IN INDIANA, A QUESTIONNAIRE-INTERVIEW WAS ADMINISTERED TO A 5 PERCENT SAMPLE OF PERSONS FILING CLAIMS DURING 3 SELECTED WEEKS,…
34 CFR 400.1 - What is the purpose of the Vocational and Applied Technology Education Programs?
2010-07-01
... Technology Education Programs? 400.1 Section 400.1 Education Regulations of the Offices of the Department of... APPLIED TECHNOLOGY EDUCATION PROGRAMS-GENERAL PROVISIONS § 400.1 What is the purpose of the Vocational and Applied Technology Education Programs? (a) The purpose of the Vocational and Applied Technology Education...
Articulating with Industry: The Role of Vocational Education in Economic Development.
Bushnell, David S.
The United States Department of Education and the American Vocational Association have undertaken a study to define the role of vocational training in job development. The literature and conversations with people involved in job development programs have shown that regional economic growth, including increases in employment, depends on five key…
2010-07-01
... Applied Technology Education Programs? 400.3 Section 400.3 Education Regulations of the Offices of the... VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION PROGRAMS-GENERAL PROVISIONS § 400.3 What other regulations apply to the Vocational and Applied Technology Education Programs? The following regulations apply to the...
Expansion of Vocational Education in Neoliberal China: Hope and Despair among Rural Youth
Koo, Anita
2016-01-01
The rise of China as the world factory in the last few decades has been accompanied by a rapid expansion in vocational education. A growing number of youth from rural backgrounds now have the chance to receive post-compulsory education in vocational training schools. Using human capital theory as an analytical focus, this study examines their…
Vaughn, Michael S.
1992-01-01
Examined adult and juvenile sex offender academic and vocational education programs. Data were collected from 103 sex offender treatment providers. Findings revealed that both adult and juvenile sex offender education programs provided wide variety of service choices in academic and vocational programs. Adult programs averaged slightly more…
Needs analysis in developing the entrepreneurial interest of vocational education students
Widiyanti
2017-09-01
Vocational education aims to graduates have the ability to work independently. To make it happen, in addition to entrepreneurship education is required also the explicit understanding of factors that can increase entrepreneurial interest. These factors are more dominant in external conditions, which means that to be entrepreneurship can be learned and formed on a person's person start early. The introduction of entrepreneurship can begin with the giving of entrepreneurial materials, which can then be spelled out in the form of concrete actions. In this article is briefly described but detailed about factors that can increase entrepreneurship interest in vocational education students, which can be applied at the secondary level as well as at the level of further education.
Philosophy of Vocational Education in China: A Historical Overview
Schmidtke, Carsten; Chen, Peng
2012-01-01
Historically, Chinese educational philosophy has been dominated by Confucianism and, since 1949, by Marxism. However, rapid industrialization, ideological demands, and loyalty to traditions have now led to a situation where various Western philosophies have been adopted into vocational education in hopes of moving the country forward without…
Gene : CBRC-SARA-01-1996 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL
Reforms and innovations in Nordic vocational education:
DEFF Research Database (Denmark)
Jørgensen, Christian Helms
2018-01-01
The chapter examines policy reforms and innovations in the Nordic vocational education and training systems (VET) related to two challenges. The first is to improve the links of the VET system to the labour market and to ease the students’ transition to employment. It examines three new types...
Directory of Open Access Journals (Sweden)
Robert Akor
2014-10-01
Full Text Available Nigerian government is making frantic efforts to drive her economy by laying emphasis on technical and vocational education to enable her compete favorably in the global market. Emphasis of government is in Polytechnic education where skills for self-reliant and economic growth are a priority. However, women are not embracing this opportunity by participating in the program that will equip them with skills and contribute to national development. In all 14 female participants were purposefully selected from Polytechnic. Phenomenological methodology was adopted and data collected were transcribed and analyzed. Results from the study include math/science phobia, perceived social support, and contextual roles among reasons for misrepresentation of women in technical and vocational education. Unless women have increased access to technical and vocational education in order to build diverse technical skills their vulnerability to unemployment and poverty will be on the rise. The findings of this study will guide stakeholders to develop a framework for improving the enrollment of women in this field. Keywords: women, technical and vocational education, self-reliant and unemployment
Directory of Open Access Journals (Sweden)
Jessica N Snowden
Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.
Paradoxes in Danish Vocational Education and Training
DEFF Research Database (Denmark)
Louw, Arnt Vestergaard; Katznelson, Noemi
2015-01-01
All vocational education and training schools in Denmark are required to launch retention initiatives and report yearly on their efforts to increase retention and the completion rate of their students. This article argues that the structural conditions and incentive structure around VET produces...... teaching practices in VET that create unmotivated, weak students and unintentional push-out effects. Further, it is suggested that the marketization of education has a profound effect on the practice in VET such that good education has come to be more associated with retaining all students in the VET...
The Role of Vocational and Technical Education in Nigeria Economic Development
Ohiwerei, Franklin Ohiole; Nwosu, Basil Ogomeziem
2013-01-01
The researchers tried to ascertain the role of vocational and technical education in the Nigeria economic development using historical survey in analyzing the views of various academic authors in an attempt to inform researchers' on current issues on the field. The research reveals that there was a defect in the curriculum of vocational and…
2012-08-15
... deadline dates for submission of performance and financial reports for the Office of Vocational Adult... DEPARTMENT OF EDUCATION Notice of Proposed Information Collection Requests; Office of Vocational and Adult Education; Perkins Discretionary Grant Performance Report SUMMARY: The Perkins Discretionary...
Rosvall, Per-Åke; Hjelmér, Carina; Lappalainen, Sirpa
2017-01-01
Vocational education has a historical legacy of being low-status and aimed at producing skilled workers. Students with low marks in comprehensive school are still often guided to the vocational educational track. In this article we examine how mathematics teaching in a vocational educational context is framed (henceforth VET). Therefore, our aim…
34 CFR 403.19 - What are the responsibilities of a State council on vocational education?
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false What are the responsibilities of a State council on...? § 403.19 What are the responsibilities of a State council on vocational education? (a)(1) The State council on vocational education shall meet as soon as practical after the Secretary accepts its...
Quality Assurance in the Teaching and Examination of Vocational and Technical Education in Nigeria
Idialu, E. Ethel
2007-01-01
The vital role of Vocational and Technical Education in the production of skilled and competent manpower for economic, industrial and social development cannot be achieved if an efficient and effective teaching and examination is not maintained. Therefore, this paper examines the objectives of Vocational and Technical Education in Nigeria, factors…
Richardson, Donald L.; And Others
The project was designed to provide vocational teacher educators in Colorado with an alternative delivery system for inservice vocational teacher education which would overcome barriers of distance (and difficult winter travel), expense, and low student density. A task force composed of staff members of the State Board for Community Colleges and…
Funding of Vocational and Technical Education in Nigeria in Times ...
African Journals Online (AJOL)
Funding has been the bane of education in Nigeria. The global economic recession eventually came to complicate the matter. This notwithstanding, the focus of Vocational and Technical Education with regard to skills acquisition cannot be compromised. This paper x-rays the education funding pattern in Nigeria, assesses ...
Financial Information 2015. Australian Vocational Education and Training Statistics
National Centre for Vocational Education Research (NCVER), 2016
2016-01-01
This publication provides information on how government-funded vocational education and training (VET) in Australia is financed and where the money is spent. Government-funded VET in the 2015 reporting year is broadly defined as all activity delivered by government providers and government-funded activity delivered by community education providers…
Vocational Education Institutions' Role in National Innovation
Moodie, Gavin
2006-01-01
This article distinguishes research--the discovery of new knowledge--from innovation, which is understood to be the transformation of practice in a community or the incorporation of existing knowledge into economic activity. From a survey of roles served by vocational education institutions in a number of OECD countries the paper argues that…
Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi
Directory of Open Access Journals (Sweden)
M. Sidi Ritau'din
2017-06-01
Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.
User's Manual. Vocational Education Readiness Test (VERT). Revised Edition.
Thomas, Edward L.; And Others
This user's manual provides information suggesting various ways in which educational personnel may wish to utilize the eight modules included in the Vocational Education Readiness Test (VERT). The introductory section presents questions which can be used by school personnel to determine whether or not VERT will be useful in their school system.…
2010-08-06
... DEPARTMENT OF EDUCATION Office of Vocational and Adult Education; Overview Information; Promoting... Preference Priority: For FY 2010, this priority is a competitive preference priority. Under 34 CFR 75.105(c... meets this priority. This priority is: Commitment to the Project The Assistant Secretary for Vocational...
Design of Trigonometry Apps for Vocational Education
DEFF Research Database (Denmark)
Pedersen, Jens Bjarke; Andersen, Steffen; Majgaard, Gunver
2012-01-01
How can smartphones apps enrich the learning of mathematicsin vocational education? This article examines how mathematics teaching can be enriched by apps using smartphone sensors such as gyroscope, compass, camera, and touch screen in a aming context. An iterative and participatory design process.......The combination of competition to unlock exercises, competition for placing on the high-score list, and physical activity proved very motivating for the students and was also approved by their teachers. In this article we describe our design principles, the overall game architecture and the games themselves. We...... talk about our experience in implementing our design process and subsequently summarize the pros and cons of the application and the smartphone platform and how the app developed contributes to vocational mathematics teaching....
SOCIAL DIALOGUE AND PARTNERSHIP IN VOCATIONAL EDUCATION AND TRAINING
Directory of Open Access Journals (Sweden)
Zoran Velkovski
2015-06-01
Full Text Available Vocational education and training systems in the Republic of Macedonia have been put under strong pressure for modernisation in the last decades. In addition to economic and political globalisation, technological innovations brought rapid changes in the type of jobs and the content of labour in the national economies, which lead to change of the demand for qualifications and new skills on an on-going basis; the open market and migration expanded opportunities for work within and between countries, and the complexity of the demand for new skills on the labour market have dramatically begun affecting and shaping the structure, organisation and content of vocational education and training.This report is based on the experiences from the collaborative approach applied in the development of the Strategy for Vocational Education and Training in a Lifelong Learning Context for the Republic of Macedonia, implemented through a process of consultation with a broad stakeholder basis. It addresses the participants in the process, the steps undertaken to ensure involvement of stakeholders and ultimately ownership over the process (or its components, the obstacles encountered and steps undertaken to address them, the problems, their causes and proposals for preventing and/or eliminating them, as well as the lessons learned and recommendations for further development of the social dialogue and partnership.
Complexity in Vocational Education and Training Governance
Oliver, Damian
2010-01-01
Complexity is a feature common to all vocational education and training (VET) governance arrangements, due to the wide range of students VET systems caters for, and the number of stakeholders involved in both decision making and funding and financing. In this article, Pierre and Peter's framework of governance is used to examine complexity in VET…
Rossi Etchelouz, Nelly Yvis
Information services in vocational education should describe for the student the reality of different professions--current characteristics and socio-economic conditions--and the chances for development in particular professions. This document discusses the need for such information in vocational education for making intelligent career choices and…
Organisation for Economic Cooperation and Development, Paris (France).
Changes in the vocational and technical education (VTE) opportunities available for women in Organisation for Economic Cooperation Development (OECD) member countries in response to changing labor markets and job skill requirements were discussed at a June 1994 meeting of experts. The discussions focused on the following issues: gender differences…
Occupational Information and Vocational Education: A Concept Paper.
Drewes, Donald W.; Bice, Garry R.
In order to be maximally effective, an occupational information system (OIS) designed to support vocational education planning, administration, and client services should contain information dealing with energy, women in the work force, productivity, population demographics, equal opportunity, civil rights, coordination and linkage, new and…
Reconstructing Vocational Education and Training for the 21st Century
Directory of Open Access Journals (Sweden)
Terry Hyland
2014-01-01
Full Text Available The unfavorable comparisons between English and European vocational education and training (VET systems made in the Wolf Report—and indeed in many national reviews of VET in Britain since the Royal Commission on Technical Education reported in 1884—point toward the low status of vocational pursuits in the United Kingdom compared with that in Continental Europe and elsewhere. In the light of these cultural differences, it is unlikely that structural, funding, or curriculum reforms alone will succeed in enhancing VET provision without corresponding changes in the value foundation of vocational studies. The reconstruction of VET requires a re-orientation of its foundational values if the reforms proposed by Wolf and others are to have any chance of lasting success. By the same token—although European and other national systems have their own peculiar problems—the global policy agenda concerned only with cognitive outcomes expressed as behaviorist skills and competences is, arguably, unlikely to meet the key challenges. A reconstructed model of VET needs to foreground the values, craft, and aesthetic features of vocationalism if the perennial problems are to be dealt with adequately. A reconstruction plan is suggested below, informed and inspired by the concept of “mindfulness”—non-judgmental, present-moment attention, and awareness—drawn from Buddhist contemplative traditions. Mindfulness-based interventions (MBIs in areas such as psychology, psychotherapy, medical science, and education have grown exponentially over the last decade or so, and interesting work is now emerging in relation to the value of mindfulness in workplace training.
Vocational and Technical Education Reform in Turkey
Kilic, Abdurrahman
2006-01-01
Turkey is a country where individual rights and freedom of people are improving. It is known that a free market economy is in its infancy. There is a strong relationship between developed human resources and the production sector. In this sense, vocational and technical education is very important. It cannot be said that the efforts for…
Vocational Education and Active Citizenship Behavior in Cross-National Perspective
van de Werfhorst, H.G.
2007-01-01
Educational systems should provide students with job-relevant skills as well as prepare students for active citizenship. These two core functions of schools may be in conflict with each other, as diversified and vocationally specific educational systems usually do well in terms of labor market
Toward Self-Regulated Learning in Vocational Education: Difficulties and Opportunities
Jossberger, Helen
2011-01-01
Jossberger, H. (2011). Toward Self-Regulated Learning in Vocational Education: Difficulties and Opportunities. Doctoral Thesis. June, 24, 2011, Heerlen, The Netherlands: Open Universiteit in the Netherlands.
Entrepreneurship in Vocational Education: A Case Study of the Brazilian Context
Stadler, Adriano; Smith, Anne M. J.
2017-01-01
Vocational entrepreneurship education is associated with specific techniques and teaching methods, including face-to-face student contact and knowledge alignment with labour market needs. The authors argue that entrepreneurship education provides particular benefits in different educational conditions and modes because it allows students to…
Regenerating Technical and Vocational Education for Sustainable Youth Empowerment in Nigeria
Ogbuanya, Tessy; Arimonu, Maxwell Onyenwe
2015-01-01
Technical and Vocational Education as enshrined in the Nigeria National Policy on Education is used as a comprehensive term referring to those aspects of the educational process involving, in addition to general education, the study of technologies and related sciences and the acquisition of practical skills, attitudes, understanding and knowledge…
Educating for Vocational Excellence: The Auto/Biographical Exploration of Enacted Craft Pedagogy
Tyson, Ruhi
2015-01-01
The focus of this article is on education for vocational excellence (the combination of virtue and good judgment or phronesis/practical wisdom) through an examination of episodes from the auto/biographical study of master craftsman Wolfgang B. Vocational excellence is an issue sometimes discussed with regard to teacher training for schools and…
When Work Comes First: Young Adults in Vocational Education and Training in Norway
Directory of Open Access Journals (Sweden)
Anna Hagen Tønder
2017-11-01
Full Text Available Since reforms implemented in 1994, vocational education and training (VET in Norway has been integrated and standardized as part of upper-secondary education. When young people enter upper-secondary education at the age of 15 or 16, they can choose either a vocational programme or a general academic programme. The standard model in vocational programmes is 2 years of school-based education, followed by 2 years of apprenticeship training. However, in practice, only a minority follow the standard route and acquire a trade certificate within 4 years. The average age upon completion of a vocational programme in Norway is 28 years, which is among the highest in the OECD. The purpose of this study was to explore personal trajectories within the Norwegian context to gain a better understanding of why people choose to obtain a trade certificate as young adults, instead of following the standardized route, drawn up by policy makers. Qualitative interviews were conducted with 34 people who obtained a trade certificate when they were aged between 25 and 35 years. The study showed that the opportunity to acquire formal VET qualifications through workplace learning provides an important second chance for many young adults in Norway. Based on the findings, we argue that policy makers need to see educational achievement in a long-term perspective and to design institutional structures that support learning opportunities at work, as well as in formal educational settings.
Manuel, Alzira; van der Linden, Josje; Popov, Oleg
2017-01-01
Interest in vocational education and training (VET) is growing. This can be attributed to global socio-economic developments requiring continuously changing knowledge and skills. Adult education and training, particularly in non-formal education (NFE) contributes to provide these skills and
Vocational Education in Corrections. Information Series No. 237.
Day, Sherman R.; McCane, Mel R.
Vocational education programs in America's correctional institutions have been financially handicapped, since security demands the greatest portion of resource allocations. Four eras in the development of the correctional system are generally identified: era of punishment and retribution, era of restraint or reform, era of rehabilitation and…
Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...
Universities' Engagement with Vocationalism: Historical Perspective
Directory of Open Access Journals (Sweden)
Pericles 'asher' Rospigliosi
2016-12-01
Full Text Available The aim of this article is to explore the historical context of vocationalism in universities. It is based on an analysis of the history of the university from a vocational perspective. It looks for evidence of vocational engagement in the activities of universities over time, taking a long view from the birth of the Western University in the Middle Ages to the 1980s with the emergence of current issues of vocationalism in university education. It adopts a chronological perspective initially and then a thematic one. The main findings are: (1 vocationalism in university education is as old as the Western University itself, (2 there is evidence from the start of the Western University of vocational engagement in terms of the provision of vocationally relevant subjects, vocationally relevant skills and the development of vocationally relevant attitudes, (3 whereas most graduate employers used to be concerned with the vocationally relevant knowledge, skills and attitudes students acquired on their degree courses, most are now more concerned with graduate capacity and disposition to learn within their employment after graduation and (4 subject-centred education is compatible with university education that supports the vocational aspirations of students.
North Dakota State Advisory Council for Vocational Education, Fargo.
The third annual evaluation report of the North Dakota Advisory Council for Vocational Education is developed in four phases: (1) recommendations incorporating the rationale for resulting recommendations to the State Board for Vocational Education, (2) evaluation of the State goals and priorities (Goal I), (3) serving people and their needs (Goal…
Messmann, Gerhard; Mulder, Regina H.; Palonen, Tuire
2018-01-01
Purpose: This paper aims to investigate the role of characteristics of vocational education teachers' personal network at the workplace for determining the resources that enable them to cope with innovation-related demands at work. Design/methodology/approach: A survey study with 48 vocational education teachers is carried out. Social network…
LEADERSHIP IN TECHNICAL AND VOCATIONAL EDUCATION
Jamaluddin Hashim; Baharom Mohamad; Kamarolzaman Md. Jidi; Ramlan Zainal Abidin; Hussein Junoh
2010-01-01
Good leadership in the lifelong learning of technical and vocational education exists when the leaders are able to perform either one or combination of transformational leadership characteristics, even though, less emphasis on these characteristics can affect job satisfaction of his or her subordinates. This study investigated transformational of Heads of Departments at the Polytechnics with regards to the job satisfaction of the lecturers. Respondents of this study are made up of 365 lecture...
Expanding Access to Vocational-Technical Education in Massachusetts. White Paper No. 136
Ardon, Ken; Fraser, Alison L.
2015-01-01
It is clear from assessment, graduation, and follow-up data that career-vocational technical education (CVTE), as it is practiced in Massachusetts, is a success. CVTE is becoming so popular that there are up to 5,000 more applicants for places in Massachusetts' vocational technical schools than there are openings, creating waiting lists. This…
López Soblechero, Miguel Vicente; González Gaya, Cristina; Hernández Ramírez, Juan José
2014-01-01
The study discussed in this paper had two principal objectives. The first was to evaluate the distance model of official vocational education and training offered by means of a virtual learning platform. The second was to establish that both on-site classroom and online distance modes of vocational education and training can be seen as complementary in terms of responding to the majority of modern educational needs. We performed a comparative study using data and results gathered over the course of eleven academic years for 1,133 of our students enrolled in an official vocational education and training program, leading to the awarding of a certificate as an Administrative Management Expert. The classes were offered by the Alfonso de Avellaneda Vocational Education and Training School, located in the city of Alcalá de Henares near Madrid, Spain. We offered classes both in traditional classroom mode and through online distance learning. This paper begins with a descriptive analysis of the variables we studied; inferential statistical techniques are subsequently applied in order to study the relationships that help form the basis for the conclusions reached. This study's results provide evidence that a broad offering of vocational education and training opportunities will facilitate access to such learning for students who require it, regardless of their age, employment status, or personal circumstances, with the online distance mode playing a fundamental role while also yielding results equivalent to those observed for classroom instruction.
Directory of Open Access Journals (Sweden)
Miguel Vicente López Soblechero
Full Text Available The study discussed in this paper had two principal objectives. The first was to evaluate the distance model of official vocational education and training offered by means of a virtual learning platform. The second was to establish that both on-site classroom and online distance modes of vocational education and training can be seen as complementary in terms of responding to the majority of modern educational needs. We performed a comparative study using data and results gathered over the course of eleven academic years for 1,133 of our students enrolled in an official vocational education and training program, leading to the awarding of a certificate as an Administrative Management Expert. The classes were offered by the Alfonso de Avellaneda Vocational Education and Training School, located in the city of Alcalá de Henares near Madrid, Spain. We offered classes both in traditional classroom mode and through online distance learning. This paper begins with a descriptive analysis of the variables we studied; inferential statistical techniques are subsequently applied in order to study the relationships that help form the basis for the conclusions reached. This study's results provide evidence that a broad offering of vocational education and training opportunities will facilitate access to such learning for students who require it, regardless of their age, employment status, or personal circumstances, with the online distance mode playing a fundamental role while also yielding results equivalent to those observed for classroom instruction.
Vocational Education and Training in Denmark. First Edition.
Nielsen, Soren P.
This monograph examines vocational education and training (VT) in Denmark. Section 1 presents background information/framework data on the following: Denmark's political and administrative structure; population, employment, and unemployment; and the Danish economy. In section 2, the history of VT in Denmark is traced from before 1870 to the…
Re-Engineering Vocational and Technical Education for Sustainable ...
African Journals Online (AJOL)
Using the case of North Central Geo-Political Zone of Nigeria, this study interrogates the nexus between vocational and technical education (VTE) and sustainable development. Specific attention is put on provision and attainment of basic skills on one hand and job creation, self-employment, utilization of locally available ...
Satellite Telecommunications and Their Potential for Vocational Education.
Grieve, Shelley; Singer, Norman M.
This report summarizes the findings and implications of a study that examined the potential for expanded use of satellite-related telecommunications in vocational education, focusing on the short-term potential of satellites in the areas of instruction, training, administration, and governance. The investigation found that a variety of…
Historical Analysis of Vocational Education in Western Nigeria ...
African Journals Online (AJOL)
It is explained as a process towards the attainment of industrialization and entrepreneurship in Nigeria. Before the ... The conception of vocational education here is concerned about the types of training given to Nigerians and its impact on sustainable self-employment and industrialization in the postcolonial era. The work ...
Directory of Open Access Journals (Sweden)
Mohamed Siala
2014-05-01
Full Text Available Throughout Tunisia, basic education is compulsory. Children are required to enroll for at least 9 years from age 6. This paper examines gender differences in education choice of upper basic education of youths aged 15–24 in Tunisia. To investigate the factors that influence an individual’s choice between vocational education, general education (secondary and high education and leaving school, the paper estimates a multinomial probit model of education choice. We focus on the impact of household income, parental education, sector of economic activity of father, household size, urban location and region of residence on investments in children. These issues are addressed using data from the 2010 National PopulationEmployment Survey that provided information on educational attainment and vocational training of more than 55,000 youths aged 15-24. The findings of this paper suggest that there are gender differences in education choice. Increases in permanent income contribute more to the probabilities of the two types of education of girls than of boys. Parental education has a positive significant effect on their attitudes towards children education and the impact of mother’s higher education was more important for the education of boys than of girls. While, father’s coefficient estimates show the relative benefit to girls general education. Children whose fathers work in agriculture are at disadvantage. The negative effect on girls’ education was larger than on boys’ at the two streams of education. The coefficient estimates on the manufacturing sector increase the probabilities of receiving general education and decrease the probabilities of undertaking vocational education for both girls and boys.
Wu, Robert T. Y.
Taiwan is facing these three challenges: cultivating a world-class work force, preventing shortages of industry-related workers, and increasing industrial competitiveness. To meet them, technological and vocational education (TVE) needs to integrate the curricula among the technical arts programs in junior high schools, senior vocational high…
Directory of Open Access Journals (Sweden)
Demina Svetlana
2016-01-01
Full Text Available In modern times the educational institutions of additional vocational education have to take into account mainly conflicting factors. On the one hand, these are the demands of employers to the quality of the educational process, on the other – the need to cut costs on employee training. This article states the basic features of use of distance technologies that allow to optimize training costs and to solve the problem of development of practical skills of listeners. The demand structure for programs of additional vocational education is presented on the example of several business schools. Besides the application topicality of remote educational technologies to support the learning process on-the-job is substantiated.
Ripper, Chris, Ed.; Russell, Russ, Ed.
A party of vocational educators from the United Kingdom (UK) traveled to the Federal Republic of Germany (FRG) to examine West German vocational education and training for the hotel and catering industry. During the study, the investigators examined the training with respect to regulations, the content of training, and the structure of the…
ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN
Directory of Open Access Journals (Sweden)
Sulistyastuti Sutomo
2015-01-01
Full Text Available Not only does art have self-fullfillment, but it also has axiological benefits both socially, culturally, religiously, and economiclally. So does Sara Douda dance. Sara Douda aesthetics is first contained in its whole dance movements. In addition, it can also be found in the whole dance equipments. Moreover, this dance aesthetics may also be contained in the verbal symbols in the speech forms prior to the dance performance. However, both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and religious values in the Loli community about their honoring their ancestors, having social harmony, and highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance. Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda
United Nations Educational, Scientific, and Cultural Organization, Berlin (Germany).
Following nine introductory papers that explain the work of various organizations involved in vocational training in Europe, the conference papers are organized around five themes: (1) vocational education and training and new technologies; (2) environmental education and training; (3) the changing role of the public and private sectors in…
2010-07-26
... DEPARTMENT OF EDUCATION Office of Vocational and Adult Education; Overview Information; Financial... continuous improvement. For this reason, the Secretary is establishing a competitive preference priority for...). Competitive Preference Priority: This priority is a competitive preference priority. Under 34 CFR 75.105(c)(2...
The Implications of Theory Z for Departments of Vocational Education.
Dillon, Linda S.
1983-01-01
Describes the Theory Z management approach as postulated by William G. Ouchi and presents steps to be considered by postsecondary departments of vocational education attempting to implement this approach. (NRJ)
Students' Preferred Characteristics of Learning Environments in Vocational Secondary Education
Placklé, Ingeborg; Könings, Karen D.; Jacquet, Wolfgang; Struyven, Katrien; Libotton, Arno; van Merriënboer, Jeroen J. G.; Engels, Nadine
2014-01-01
If teachers and teacher educators are willing to support the learning of students, it is important for them to learn what motivates students to engage in learning. Students have their own preferences on design characteristics of powerful learning environments in vocational education. We developed an instrument--the Inventory Powerful Learning…
The (Un)Attractiveness of Vocational and Technical Education: Theoretical Background
Lovšin, Miha
2014-01-01
This paper considers the problem of the lack of attractiveness of vocational and technical education via a review of legislation on counselling practices, implementing documents, and the social factors by means of which the education system can influence the individual's decision. It is apparent that legislation regulating the organisation and…
Impact of vocational and entrepreneurship education on the ...
African Journals Online (AJOL)
This paper reports the findings of a study that delved into the impact of vocational and entrepreneurship education (VEE) on the economic growth of Ogun State, Nigeria. Specifically, the study investigated the extent to which VEE can enhance the economic growth of the state and the factors inhibiting its development.
Fiebig, Jennifer Nepper; Braid, Barbara L.; Ross, Patricia A.; Tom, Matthew A.; Prinzo, Cara
2010-01-01
A multiple logistic regression model was used to determine the associations between the role of acculturation, perception of educational barriers, need for family kin support, vocational planning, and expectations for attaining future vocational goals against the demographic variables (gender, age, being the oldest child, the first to attend…
Assessing the Quality of the Learning Outcome in Vocational Education: The Expero Model
Cervai, Sara; Cian, Luca; Berlanga, Alicia; Borelli, Massimo; Kekale, Tauno
2013-01-01
Purpose: This paper aims to present an innovative model to evaluate the quality of the learning outcome in vocational education and training (VET) considering a wide approach that includes, in particular, stakeholders' expectations and perceptions. Design/methodology/approach: The Expero model was implemented in various kinds of vocational schools…
Student Learning in Competence-Based Pre-Vocational Secondary Education.
Dr P.J. Teune; P. den Brok; prof dr Douwe Beijaard; Dr. M. Koopman
2009-01-01
The purpose of this study was to investigate relations between goal orientations, information processing strategies and development of conceptual knowledge of pre-vocational secondary education students (n=719; 14 schools). Student preferences for certain types of goals and information processing
THE VIRTUAL LEARNING ENVIRONMENTS IN VOCATIONAL EDUCATION: A REPORT OF BLENDED LEARNING EXPERIENCES
Directory of Open Access Journals (Sweden)
Paulo Roberto Prado Constantino
2013-07-01
Full Text Available This paper presents an experiment in uses of virtual learning environments (VLE in the vocational education, evaluated by the Educational Supervision of Vocational and Secondary Schools of Paula Souza Center. The experience occurred in Etec "Jacinto Ferreira de Sá", São Paulo, Brazil, between 2009 and 2011, where the reported activities were organized and developed in the degree of Music, with students of different ages. Using specifics instruments to qualitative research for data collection were selected class record books, the reports to the virtual environment, the records of the participants' personal reflections, interviews and examination of the minutes of class councils involved. The experience has served as a basis for replication in other contexts and vocational courses presented by the institution.
Directory of Open Access Journals (Sweden)
Robert Akor
2015-01-01
Full Text Available Despite the documented benefits to economic and social development of women and the constitutional guarantee for equal right under the law to all citizens, the advancement of the status of women in Nigeria is still far from satisfactory. The participation of women in technical and vocational education is abysmally low. Recent literature describing education of women in technical and vocational education in Nigeria, still need more equality of access to the program. As the Nigerian transition to knowledge economy, information age and vision 20:2020 technologically literate workforce is vital. Likewise the contribution of women to technical and vocational education profession in vital, yet the number of women considering entering historically dominated profession remain at unacceptable level. Employment prospects for women have increased dramatically in the late 20th century. Yet in technical and vocational education profession, a profession that holds promise and opportunity for one to positively impact society-the lack of women in the field seems baffling. In order to examine how Nigerian women foster action to be taken to resolve misrepresentation of women in technical and vocational education in Polytechnic institution a study was important. The purpose of this study was to identify action to be taken so that more women can participate in the program from the perspective of women who are currently enrolled in technical and vocational education program in Polytechnic institution. One major Polytechnic was selected with twelve participants. The descriptive and exploratory research analyzed the interview responses of the participants in order to examine their perceptions. Recommendations made as a result of this study include: a need to formulate specific strategies, policy and program to promote women participation in technical and vocational education, women representation in policymaking bodies; increase number of women lecturers; encourage
Vocational Training in the European Union
Directory of Open Access Journals (Sweden)
Mehmet BALCI
2013-01-01
Full Text Available European Union requires some standards in all areas. Today, the importance of training qualified individuals which holds an important place in the development of countries increases and certain standards are adopted creating common European Union tools in the field of vocational and technical education. In this study, vocational education and training policies system and the standards adopted by the European Union are discussed. Furthermore, this study was accepted as a European Union project in 2010 and the results obtained from the Leonardo Da Vinci Life Learning European Union project called “Web Based Basic Vocational Training” between the years 2010-2012 were presented. Since the partners of these projects are Turkey, Spain and Germany, the structure of vocational education, institutions of public and private vocational education and the diplomas and certificates entitled after these educations are included. As Turkey is on its way to become a European Union member, a number of advices are presented for Turkey to reach its destination about vocational education standards that European Union has aimed. The purpose of the study is not only to be a guide for the young who want to get professional training in the countries that are European Union members or candidates about how and where to have education opportunities but also to give a chance for trainers and training managers, participating in vocational training, so as to glimpse different practices from different countries and compare these practices between the countries of European Union and their countries. The study is also very important as it has the opportunities for training managers to see if their countries' vocational education is close enough to vocational education in European Union.
Robotics and Office Automation: Implications for Vocational Education.
Fraser, Jeannette L.; And Others
Directed to individuals responsible for program planning in vocational education at the national and state levels, this review and synthesis of technological developments in robotics and office automation identifies the potential demand for skills in these technologies in the next 3 to 5 years. The procedures for the study are described in the…
Huang, Hsun-I; Lee, Cheng-Fei
2012-01-01
Higher technical and vocational education institutions in Taiwan face the pressure of an oversupply of student places and fierce competition from domestic and international institutions. To cope with these challenges, higher technical and vocational education institutions that are better equipped to respond to market requirements are expected to…
Manuel, Alzira; van der Linden, Josje; Popov, Oleg
2017-01-01
Interest in vocational education and training (VET) is growing. This can be attributed to global socio-economic developments requiring continuously changing knowledge and skills. Adult education and training, particularly in non-formal education (NFE) contributes to provide these skills and knowledge for youth and adults. This puts pressure not…
Directory of Open Access Journals (Sweden)
Inge PLACKLÉ
2010-01-01
Full Text Available Background: At the end of Vocational Secondary Education students should be able to solve authentic problems individually and in group. Powerful learning environments could enforce these learning processes. Research question: “Which critical desirable design principles can we define to create a powerful learning environment in Secondary Vocational Education ? Method: We combine different perspectives of teachers, students and researchers to build a shared model of learning environments, which will be perceived as more powerful by all stakeholders. Based on literature we selected design principles followed by organizing focus groups with teacher educators and teachers to further adapt these principles. Preliminary results: We determined eight design pr inciples: Authenticity learning environment, differentiation, adapted evaluation, self-directed learning, problem solving, teamwork, shared responsibility design learning environment and (labour identity develop ment. Each principle has been further clarified in indicators. This study is part of a larger research project in developing teacher competences in creating powe rful learning enviro nments in Vocational Secondary Education.
Pilz, Matthias; Berger, Susanne; Canning, Roy
2014-01-01
This paper presents a comparative research project on pre-vocational education in lower secondary schools in seven European countries. The primary aim of the study was to better understand how the formal pre-vocational education curriculum is interpreted and shaped by individual teachers. The countries covered are Austria, Germany, Hungary,…
Ogbunaya, T. C.; Udoudo, Ekereobong S.
2015-01-01
The paper focused on repositioning Technical and Vocational Education and Training (TVET) for youth's employment and national security in Nigeria. It examined briefly the concepts of technical vocational education and training (TVET), youths, unemployment and national security as well as the effects of unemployment on national security in Nigeria.…
Stodden, Robert A.; And Others
1989-01-01
Educational records of 127 secondary students with disabilities were reviewed to assess impact of vocational assessment information in Individualized Education Plan (IEP) development process. Results focus on the impact of information on the number of IEP vocational goals and objectives written, kinds of IEP items written, and number of IEP goals…
"Forging the Fatherland": Work and Vocational Education in Argentina during Peronism (1944-1955)
Oelsner, Veronica
2013-01-01
This article focuses on the reforms in the field of vocational education, as well as on representations related to work, in Argentina during Peron's political leadership. In the framework of far-reaching economic reforms and social transformations, while in the position of secretary of labour (1943-1945) Peron started a vocational education…
System Analysis and Risk Assessment System (SARA), Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.
1992-02-01
This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs
Directory of Open Access Journals (Sweden)
Ramlee Mustapha
2017-07-01
Full Text Available This region of Southeast Asia shares more social and cultural ties with other Austronesian peoples in the Pacific than with the peoples of mainland Southeast Asia. Contemporarily, Asia Pacific is still the fastest growing economic region in the world despite economic turbulence and uncertainties in recent years due to the global economic slow-down. As one of centres of economic power, the region could hardly remain immune to the globalizing impact of economic and technological change. The purpose of this study was to explore the development of Technical and Vocational education in Malaysia and Indonesia by analyzing the history, policies, and its direction. In Malaya, the Technical and Vocational education prior to independence had projected the images of “colonial apprenticeship” with the emphasis on manual agricultural and crafts, which aimed at training the Malay students to fill positions in the Railway department under the Federated Malay States. After independence, Technical and Vocational education in Malaysia continued to grow, and some reforms have been implemented to improve the image of Technical and Vocational education itself. In Indonesia, a similar development occurred but the difference is in terms of Technical and Vocational education funding at the secondary level where there are many private Technical and Vocational schools as compared to Malaysia. There are new concepts introduced in Technical and Vocational education, such as the Tech-Prep, Time Sector Privatization and Vocational Colleges in Malaysia and Link and Match, Dual System, Product-based Curriculum, and Total Performance Management (TPM in Indonesia, but the concepts are yet to be carried out optimally due of some constraints. The implications of this study are to identify the human capital development in the maritime Archipelago countries from the perspectives of the competitiveness and the preparation for dealing with the impact of globalization.
Financial Information 2016: Australian Vocational Education and Training Statistics
National Centre for Vocational Education Research (NCVER), 2017
2017-01-01
This publication provides financial information on the government-funded vocational education and training (VET) system in Australia. Reporting includes VET funds transacted through government accounts of the Australian and state and territory government departments and their controlled training organisation entities such as TAFE institutes and…
Implementing an Holistic Approach in Vocational Education and Training
McGrath, Donna-Louise
2007-01-01
Although the phrase "holistic approach" is increasingly used in reference to vocational education and training (VET) in Australia, there appears to be a paucity of literature which extensively conceptualises or details its practical application. Existing references to an "holistic approach" appear indicative of an integrated…
The role of vocational education in science and technology developement in the era of globalisation
Sudirman
2018-03-01
Globalization refers to a condition by which a world becomes competitive. In such a world, people are urged to do a job properly since they will be the asset to advance their nation further; this is also to strengthen the nation’s capital markets. Both the formal and informal vocational education is proposed to produce well-capable and highly-competitive graduates. This is considered important as one effort to deal with some challenges as well as a rapid advance in science and technology in the globalized world. This present study aims at exploring the contribution of vocational education in response to the development of science and technology in the globalized world. Furthermore, this study is a development of a notion that the vocational education system is proposed as a solution to the highly-competitive situation and challenges due to the globalization. To put it simply, vocational education significantly contributes towards the development of science and technology in a globalized world and how to deal with the situation. Such an education system equips the student with skills needed to become a productive and professional individual. This is also to produce better and competitive human resources that are able to compete with other nations.
Greek Technical-Vocational Education (1870-1940): Intentions and Failed Aspirations
Kiprianos, Pandelis
2013-01-01
From 1870 until the outbreak of the Second World War there were various attempts at educational reform in Greece, one of the most significant being the intention to establish a national technical-vocational education. The aim of this study is to examine why such a reform was deemed necessary and yet failed to be implemented. The first part…
Keeping Young People in (Vocational) Education: What Works? Briefing Note
Cedefop - European Centre for the Development of Vocational Training, 2013
2013-01-01
Too many young people leave education (including vocational education) too soon. Yet early leavers are at greater risk of long-term unemployment, poverty and crime, and now cost the European economy 1.25% of GDP. This brief report looks at the reasons why young people leave and what could be done to end this trend. Considerations for policy-makers…
Ministry of Education, Cairo (United Arab Republic).
This document is an English-language abstract (approximately 1,500 words) of a publication outlining the objectives and problems of vocational education in the United Arab Republic. The data presented include both the general objectives of vocational education and the specific goals of each type. The goal of vocational education is to prepare…
Technical and Vocational Education in Nigeria: Issues, Challenges and a Way Forward
Okoye, Reko; Arimonu, Maxwell Onyenwe
2016-01-01
Technical education, as enshrined in the Nigerian national policy on education, is concerned with qualitative technological human resources development directed towards a national pool of skilled and self reliant craftsmen, technicians and technologists in technical and vocational education fields. In Nigeria, the training of technical personnel…
Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural
Directory of Open Access Journals (Sweden)
Tiara Kharisma
2017-12-01
Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.
Andryukhina, Lyudmila M.; Dneprov, Sergey ?.; Sumina, Tatyana G.; Zimina, Elena Yu.; Utkina, Svetlana N.; Mantulenko, Valentina V.
2016-01-01
The relevance of the researched issue is preconditioned by the strategic changes in the secondary vocational education system taking place not only in Russia, but also in the majority of industrially developed countries. Provision of the system with qualified pedagogical staff is the leading strategic objective of development of the secondary…
Maladaptive social behaviour of students in secondary vocational education
Koerhuis, Marie-José
2007-01-01
The aim of this thesis was twofold: Firstly to create a reliable and valid new instrument to measure maladaptive social behaviour (MSB) of students in secondary vocational education, and secondly to assess which school context variables could predict MSB at school. Three data-waves were conducted
Bliuc, Ana-Maria; Casey, Grant; Bachfischer, Agnieszka; Goodyear, Peter; Ellis, Robert A.
2012-01-01
This paper presents research exploring teachers' experiences of using blended learning in vocational education. Teachers involved in designing and teaching using blended learning from a major Australian vocational education provider participated in the study. They received open-ended questionnaires asking to describe their conceptions of blended…
Typologies in Comparative Vocational Education: Existing Models and a New Approach
Pilz, Matthias
2016-01-01
The ways in which vocational education and training (VET) systems are structured vary significantly from country to country, both because different countries have different objectives for their VET systems and because VET is differently embedded within the education and labour market systems of any individual country. International research in…
Alternative Mechanisms to Encourage Individual Contributions to Vocational Education and Training
Haukka, Sandra; Keating, Jack; Lamb, Stephen
2004-01-01
Financing vocational education and training, as part of Australia's commitment to lifelong learning, will become a greater challenge as increased spending on other public services, such as health and welfare caused by an aging population, constrains government education expenditure. This report examines a range of mechanisms to encourage…
METHODOLOGICAL GUIDELINES FOR THE TRANSPROFESSIONALISM DEVELOPMENT AMONG VOCATIONAL EDUCATORS
Directory of Open Access Journals (Sweden)
E. F. Zeer
2017-01-01
Full Text Available Introduction. Nowadays, regarding the 6thwave of technological innovations and emergence of a phenomenon «transfession», there is a need for modernization of the vocational staff training in our country. Transfession is a type of the labour activity realized on the basis of synthesis and convergence of the professional competences that involve different specialized areas. Thus, the authors of the present article propose to use the professional and educational platform, developed by them, taking into account a specialists’ training specialty. The aims of the article are the following: to describe the phenomenon «transprofessionalism», to determine the initial attitudes towards its understanding; to present the block-modular model of the platform for the formation of the transprofessionalism of the teachers of the vocational school. Methodology and research methods. The research is based on the following theoretical and scientific methods: analysis, synthesis, concretization, generalization; hypothetical-deductive method; project-based method. The projecting of the transprofessionalism platform model was constructed on the basis of multidimensional, transdisciplinary, network and project approaches. Results and scientific novelty. The relevance of the discussed phenomenon in the productive-economic sphere is proved. The transprofessionalism requires a brand new content-informative and technological training of specialists. In particular, the concept «profession» has lost its original meaning as an area of the social division of labour during socio-technological development of the Russian economy. Therefore, transprofessionals are becoming more competitive and demanded in the employment market, being capable to perform a wide range of specialized types of professional activities. The structure, principles and mechanisms of the professional-educational platform functioning for transprofessionalism formation among the members of professional
Schaap, Harmen; De Bruijn, Elly; Van der Schaaf, Marieke; Kirschner, Paul A.
2009-01-01
Schaap, H., De Bruijn, E., Van der Schaaf, M. F., & Kirschner, P. A. (2009). Students' personal professional theories in competence-based vocational education: the construction of personal knowledge through internalisation and socialisation. Journal of Vocational Education & Training, 61(4),
Females in Vocational Education: Reflections of the Labor Market.
Lakes, Richard; Pritchard, Alice M.
1991-01-01
The fact that gender desegregation of vocational programs has not yet been achieved might be related to labor force occupational segregation by gender. Social theorists view schooling inequities as mirrors of social structure, whereby schools track students to maintain social stratification. Mirroring the labor market, education has segregated…
Professional Learning of Instructors in Vocational and Professional Education
Hoekstra, Annemarieke; Kuntz, Jeff; Newton, Paul
2018-01-01
This article presents insights from a study into instructor professional learning in vocational and professional education (VPE) in Canada. While most studies on instructor learning focus on learning through formal professional development programmes, this study specifically focuses on professional learning as it happens in day-to-day practice.…
Schaap, H.; Baartman, L.K.J.; Bruijn, de E.
2012-01-01
Learning in vocational schools and workplaces are the two main components of vocational education. Students have to develop professional competences by building meaningful relations between knowledge, skills and attitudes. There are, however, some major concerns about the combination of learning in
Students' Preferred Characteristics of Learning Environments in Vocational Secondary Education
Placklé, Ingeborg; Könings, Karen D.; Jacquet, Wolfgang; Struyven, Katrien; Libotton, Arno; van Merriënboer, Jeroen J. G.; Engels, Nadine
2014-01-01
If teachers and teacher educators are willing to support the learning of students, it is important for them to learn what motivates students to engage in learning. Students have their own preferences on design characteristics of powerful learning environments in vocational education. We developed an instrument - the Inventory Powerful Learning…
An Evaluation of Taiwan Vocational and Technical Education Programs in Agriculture.
Meaders, O. Donald; Chi-ho, Hu
Presented in both English and Chinese, this study of the system of agricultural education in Taiwan secondary and postsecondary schools resulted from the author's five-month stay in Taiwan and subsequent visits. Focus of the study is on evaluation of Taiwan's vocational agriculture education programs with information about students, faculties,…
Johnson, Mark E.; Reynolds, Grace; Fisher, Dennis G.; Harbke, Colin R.
2011-01-01
Vocational assessment data were collected from 94 low-education adults with severe substance abuse problems not currently in treatment. Participants completed the My Vocational Situation (MVS), Self-Directed Search (SDS), and Reading-Free Vocational Interest Inventory (R-FVII). Lower scores than the normative sample were revealed on all MVS…
System of continuous multilevel vocational education in the town of Seversk
International Nuclear Information System (INIS)
Zhiganov, A.N.; Kerbel', B.M.; Dubov, G.I.; Petlin, V.I.
2001-01-01
Within the framework of the Program of Development for the Seversk scientific center and with the aim to provide the research-industrial complex with a high quality staff it is suggested that the systems of education management, personnel training and updating, school and college vocational guidance are reformed. All vocational education institutions, a number of pre-school and school institutions, the SChP and VNII NM departments of training of personnel are proposed to be united into some association with the aim of training of specialists competitive at labour market. A schematic representation is made for integration of the Seversk Technological Institute and the SChP laboratories into the research-educational complex. The necessity of establishing the highest business school in the town of Seversk is pointed out. Provision is made for performance of periodic in time conferences on problems of nuclear power industry and conversion technologies in Seversk [ru
Wheelahan, Leesa; Buchanan, John; Yu, Serena
2015-01-01
This summary brings together the relevant key findings for industry from the research program "Vocations: The Link between Post-Compulsory Education and the Labour Market." The program was comprised of three different strands: (1) pathways from VET in Schools, (2) pathways within and between vocational education and training (VET) and…
Vocational education and training in the Nordic countries:
DEFF Research Database (Denmark)
Jørgensen, Christian Helms
2018-01-01
countries and the historical development of each of the four VET systems. This is followed by an examination of the role of VET in relation to the Nordic model of education and the Nordic labour market model. Finally, the position of VET in the Nordic transition systems is considered.......The chapter examines the systems of vocational education and training (VET) in four Nordic countries, Sweden, Finland, Norway and Denmark. First, it identifies the common political challenges for VET, which the following chapters of the book examine. Next, it outlines shared qualities of the Nordic...
Hippach-Schneider, Ute; Schneider, Verena; Ménard, Boris; Tritscher-Archan, Sabine
2017-01-01
Increasing the number of tertiary graduates has been a priority on the political agenda of the EU for some years. The focus has mainly been on academic courses though, with less emphasis on the role of vocational education and training. International educational statistics indeed show a clear increase in the number of persons completing tertiary…
Zholdasbekova, Saule; Nurzhanbayeva, Zhanat; Karatayev, Galymzhan; Akhmet, Laura Smatullaevna; Anarmetov, Bahitzhan
2016-01-01
In the article the author presents the theoretical understanding of research problems of training of the future teachers-organizers of the dual training system in vocational education & training (VET) in the conditions of the credit technology of education. The author's vision of way to solve the problem is discussed in the description of the…
Collaborative Business Planning in Initial Vocational Education and Training
Laine, Kati; Hämäläinen, Raija
2015-01-01
There is a growing demand to enhance entrepreneurship. This study aims at producing knowledge that can assist teachers in designing and supporting collaborative learning of entrepreneurship in vocational education. A qualitative case study approach was adopted. The outcome of this study provides a better understanding of the factors that hinder…
Vocational Education and Training in Italy. Second Edition, 1999.
Alluli, Giorgio
This monograph describes the Italian initial and continuing vocational education and training (VET) system and its qualitative and quantitative development. Chapter 1 outlines the general context of the VET system--both institutions and social and economic aspects. It provides facts and figures on such topics as demographic trends in Italy, the…
Do Graduates of General Education in Uganda possess Vocational ...
African Journals Online (AJOL)
However, majority of students, particularly in the developing countries, enrol for general education programs that prepare them for white-colour jobs. A questionable aspect is whether these students have any vocation skills that would prepare them for job creation upon graduation. In this study, we provide insights into the ...
Collecting "Total" Vocational Education and Training Activity. Position Paper
Karmel, Tom
2011-01-01
In this position paper, NCVER's Managing Director, Dr Tom Karmel, argues that the submission of vocational education and training student data should be mandated as a condition of registration for all registered training organisations, including private providers. This will ensure a comprehensive data collection that gives a realistic view of…
Vocational Education in Algeria, Egypt, and Morocco: The Crisis and its Lessons.
Salmi, Jamil
1990-01-01
Examines developments in vocational and technical education systems in Algeria, Egypt, and Morocco. Argues each system faces critical problems resulting from demographic pressures, educational demand, lack of funding, and job placement difficulties. Recommends programs should reflect industry's needs, urging integration between general and…
Non-Formal Vocational Education in Uganda: Practical Empowerment through a Workable Alternative
Blaak, Marit; Openjuru, George L.; Zeelen, Jacques
2013-01-01
This article reflects on the potential of non-formal vocational education in Uganda to improve the quality of life of those excluded from formal education. Based on an exploration of humanizing development theorists Sen, Freire and Nyerere, together with two case studies, practical empowerment is described as a desirable outcome of education for…
The Role of Vocational and Technical Education in the Industrialization of Malaysia.
Mustapha, Ramlee B.
The Industrialized Needs study identified the perceptions of Malaysian educators and employers regarding the role of vocational and technical education (VTE) in the economic development of Malaysia. The first survey used a random sample of 300 (276 responses) from the population of 4,316 VTE educators in public VT schools and polytechnics in…
The Development of Vocational Education Policy in Greece: A Critical Approach.
Patiniotis, Nikitas; Stavroulakis, Dimitris
1997-01-01
Vocational education in Greece has been slow to develop due to a labor market favoring low-skilled labor and a culture encouraging university education. Lack of continuity in national policy and low state financing have resulted in a system unable to deal with such crucial issues as unemployment and new technologies. (SK)
Business Planning for the Vocational Education and Training in Hong Kong
Chan, Catherine Y. P.; Chan, S. F.; Chan, K.; Ip, W. C.
2006-01-01
Purpose: The purpose of this paper is to develop a thinking model to recommend to the vocational education institutions for planning their educational business in the face of marketization. Design/methodology/approach: The systems approach is adopted for developing the model. It is not only used for the conceptualization of the principles of…
Wu, Gaoling
2010-01-01
Higher vocational education is the product of economic development, scientific and technological progress. If the country does not have a well-developed vocational education, it is impossible to make a good advanced science and technology into productive forces, it is also impossible to achieve economy development in a high speed. In turn, powers…
Berger, Susanne; Canning, Roy; Dolan, Michael; Kurek, Slawomir; Pilz, Matthias; Rachwal, Tomasz
2012-01-01
This paper presents a pilot comparative research project on pre-vocational education in lower secondary schools (ISCED level 2) within regions in three European countries. The primary aim of the study was to better understand how the pre-vocational education curriculum is constructed and taught within schools. A case study methodology was selected…
DEFF Research Database (Denmark)
Kjeldsen, Anne Mette
2012-01-01
Most studies of Public Service Motivation investigate differences in motivation between public and private sector employees, but how these differences emerge and evolve in a pre-entry setting is still puzzling. Based on cross-sectional survey data with 3,521 Danish students enrolled in different...... vocational studies and at different stages (years) of their educational programs, this article investigates the socializing effects of higher education into different levels of public service motivation. The analysis demonstrates that students’ levels of public service motivation at different stages...... of their educational programs depends on the field of study: The level of public service motivation among students in vocational studies aimed at jobs with core public service delivery stays the same during education, whereas the level of public service motivation among students in other fields increases substantively...
System Analysis and Risk Assessment (SARA) system
International Nuclear Information System (INIS)
Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.
1986-01-01
Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable
Towards competence-based technical-vocational education and training in Ethiopia
Solomon, Getachew Habtamu
2016-01-01
In the human development effort, different countries are underscoring the role of technical-vocational education and training (TVET) in providing relevant knowledge and skills to improve productivity, increase access to employment opportunities and raise the standard of living. It is in
Non-formal vocational education in Uganda : Practical empowerment through a workable alternative
Blaak, Marit; Openjuru, George L.; Zeelen, Jacques
This article reflects on the potential of non-formal vocational education in Uganda to improve the quality of life of those excluded from formal education. Based on an exploration of humanizing development theorists Sen. Freire and Nyerere, together with two case studies, practical empowerment is
Systemic Modelling for Relating Labour Market to Vocational Education
Papakitsos, Evangelos C.
2016-01-01
The present study introduces a systemic model that demonstrates a description of the relationship between the labour-market and vocational education from the perspective of systemic theory. Based on the application of the relevant methodology, the two open social systems are identified and analyzed. Their key-features are presented and the points…
Motivation in vocational education: a reform issue in tertiary ...
African Journals Online (AJOL)
Working in a non-motivating environment is a nagging issue in various tertiary institutions in Cross River State .This dampens staff morale a great deal. However, the provision of motivation in work places will be a great boost to staff morale especially in Vocational Education. This paper discusses the meaning of motivation, ...
Malhorta, Man Mohanlal
As part of Project IMPACT's effort to identify and develop procedures for complying with the impact requirements of Public Law 94-482, a field study was conducted to identify and validate variables and their order of importance in predicting and evaluating impact of research and development (R&D) projects in vocational and technical education.…
Moral Development and Citizenship Education in Vocational Schools
Directory of Open Access Journals (Sweden)
Hélène Leenders
2012-01-01
Full Text Available We investigate the objectives, practical application, and learning outcomes of moral education and citizenship education at three vocational schools in the Netherlands (VMBO. We explore teachers’ and students’ pedagogical, sociopolitical, and moral development objectives and how they deal with values, dialogue, and diversity. We continue with how the objectives get materialized in practice and teachers’ and students’ perceptions of the learning outcomes. The study shows that there is a strong agreement between teachers and students about the importance of objectives of moral education and citizenship education. Schools differ in how sharply they focus on social and political aspects, and in how reflective and dialogical their approaches are. The differences revealed in the moral education approaches can be largely linked with differences in their cultural environment.
Wheelahan, Leesa; Buchanan, John; Yu, Serena
2015-01-01
This summary brings together the relevant key findings for tertiary education providers and school educators from the research program "Vocations: The Link between Post-Compulsory Education and the Labour Market." The program was comprised of three different strands: (1) pathways from VET in Schools, (2) pathways within and between…
Secondary Vocational Education in Working Environment
Directory of Open Access Journals (Sweden)
Gvido Melink
2001-12-01
Full Text Available The authors present a successful project of secondary vocational education carried out by our school for the occupation of a toolmaker and a machinist for the companies Domel, Indramat and Niko in Železniki, considering the modern methods of teaching adults and having consistently adjusted timetable of the lectures in accordance with the working hours of the candidates and the production process respectively. Lectures, training and practical work in the workshop were performed in the company and school's workshops and laboratories. In the additional chapter the authors draw attention to the problems of payment for the teachers of technical s ubjects, who enter the education process with great working experience from companies but start here as beginners since the school regulations do not define such cases.
2010-07-01
... dropouts. (7) The assessment of students' needs in relation to vocational education and jobs. (8) Guidance and counseling to assist students with occupational choices and with the selection of a vocational...
Concurrent software system design supported by SARA at the age of one
Energy Technology Data Exchange (ETDEWEB)
Campos, I.M.; Estrin, G.
A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.
The Researcher's Role in the Renewal of Vocational Education.
Asche, F. Marion
1986-01-01
The author argues that the potential effectiveness of researchers in the renewal of vocational education will depend in large measure on their ability to participate in the larger shift from total dependence on physical models of research and their ability to build new interdisciplinary models based in part on emerging practices in business and…
The Cuban Vocational Education and Training System and Its Current Changes
Wolf, Stefan; Penton, Felipe A. Hernandez; Marin, Anna Lidia Beltran; Romero, Osvaldo
2011-01-01
The main purpose of the article is to inform about the Cuban Vocational Education and Training System. Based on the analyse of different studies, on expert interviews and on field experiences the authors give a clear overview of the Cuban VET-System. This description is embedded in the presentation of the general education system in Cuba and in a…
Technical and Vocational Education Transformation in Malaysia: Shaping the Future Leaders
Sauffie, Nur Fatin Binti Mohd
2015-01-01
In accordance with the concept of lifelong education, the Technical and Vocational Education (TVE) system is one flaw of that is recognized or known as a system whose role is to develop individuals with high technical skills as desired by the industry nowadays. Changing times and technology development at this time require changes to the TVET…
National Profiles in Technical and Vocational Education in Asia and the Pacific: Iran.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
One of a series of studies on the development of technical and vocational education in the member states of UNESCO, this report profiles the educational system in Iran. The six parts of the document provide information about the following: the country; the educational system; fundamental change in the new system of secondary school education,…
Hegna, Kristinn
2017-01-01
One in four upper secondary school students in Norway experience nearly single-sex classrooms, an unintended consequence of choosing certain vocational study programmes, such as Health care, childhood and youth development or Building and construction. This raises a question about how female students describe their experiences of social relationships and classroom culture within the context of a gender-segregated vocational education setting. Analyses of educational biography interviews revea...
B'nai B'rith, Washington, DC. Career and Counseling Services.
This quarterly annotated bibliography of current literature on educational and vocational guidance describes various pamphlets, guides and brochures which provide occupational information, educational, vocational and personal guidance, guidance administration and procedures, information on student aids and aids for the teacher. Additional guidance…
Involving the Young: The German Approach to Vocational Education
Hirche, Walter
2012-01-01
Youth unemployment is a huge challenge for sustainable development in our societies. Statistics offer an alarming picture of the involvement of youth in the labour markets on a global scale. Germany, due to a strong tradition in vocational education and training deeply rooted in its culture, has very low rates of youth unemployment. The so-called…
Pilz, Matthias; Krisanthan, Balasundaram; Michalik, Bjoern; Zenner, Lea; Li, Jun
2016-01-01
The role of pre-vocational education in general compulsory education has become increasingly relevant over recent years, with the international debate focussing particularly on its importance in school-to-work transitions. This study considers curriculum design and the implementation of pre-vocational education in four countries with radically…
Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning
Thomas, S. M.; Su, Y. C.; Hummel, P. R.
2016-12-01
Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance
Mohamed Siala; Nehed Ben Ammar
2014-01-01
Throughout Tunisia, basic education is compulsory. Children are required to enroll for at least 9 years from age 6. This paper examines gender differences in education choice of upper basic education of youths aged 15–24 in Tunisia. To investigate the factors that influence an individual’s choice between vocational education, general education (secondary and high education) and leaving school, the paper estimates a multinomial probit model of education choice. We focus on the i...
Schools and Work: Developments in Vocational Education. Cassell Education Series.
Coffey, David
This book assesses the developing vocational functions of schools in Britain, identifies vocational values and policies, and discovers gaps in provision. Chapter 1 gives a summary analysis of school structural and curricular developments between medieval times and the reign of Victoria that were inspired by vocational or economic influences or had…
Globalization and Its Impact on Technical-Vocational Education and Training in Malaysia.
Mustapha, Ramlee; Abdullah, Abu
In Malaysia, vocational education and training (VET) is accorded a high priority in the nation's industrialization agenda. With the vision of becoming an industrialized nation in 2020, Malaysia must prepare a well-educated, skilled, and competitive workforce. The government has placed human resource development as a major emphasis and strategic…
Despite Its Many Benefits, Vocational Education and Training Lacks Esteem. Briefing Note
Cedefop - European Centre for the Development of Vocational Training, 2011
2011-01-01
While the benefits of education have been widely researched, little attention has been paid to the specific benefits of vocational education and training (VET). These benefits are shared by individuals and enterprises as well as the economy and society more generally. Training provided by an enterprise increases workers' satisfaction and increases…
Assessing Environmental Literacy of Pre-Vocational Education Teachers in Jordan
Al-Dajeh, Hesham I.
2012-01-01
This study assesses the environmental literacy (knowledge, attitudes, and concerns) of pre-vocational education teachers. A total of 124 teachers participated in the study. Data was collected through a closed ended questionnaire. Questionnaire validity was established by content and a Cranach's alpha coefficient used to determine reliability. The…
Berryman, Sue E.
A study examined data from literature and from three surveys of high school students to analyze the equity of the way in which high schools assign students to the vocational track and the effectiveness of vocational education in preparing students for work. Data revealed that while students' junior high abilities, achievement, and curricular…
SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS
International Nuclear Information System (INIS)
Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.
2015-01-01
SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index
Clark, Donald M.
1992-01-01
Industry-education councils offer a systematic structure for implementing business-education partnerships, enabling vocational schools to link with the power structure of the employment community. Benefits include materials, equipment, inservice training and internships for teachers, job placement, and career information centers. (SK)
Khan, Md. Shahadat Hossain; Markauskaite, Lina
2017-01-01
This paper presents the results of a study undertaken from a phenomenographic perspective, which examines teachers' approaches to information communication technology (ICT)-enhanced teaching in vocational tertiary education. Twenty-three teachers from three Australian Technical and Further Education (TAFE) institutions participated in…
Inclusiveness in the Vocational Education Policy and Legal Frameworks of Kenya and Tanzania
Malle, Abebe Yehualawork
2016-01-01
This study examines the status of inclusiveness in the education and training policies of Ethiopia in comparison to those of selected East African countries. The focus is on vocational education in terms of the special educational and training needs of students with disabilities. Focus group discussions and interviews conducted in Kenya and…
National Profiles in Technical and Vocational Education in Asia and the Pacific: Malaysia.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
One of a series of studies on the development of technical and vocational education in the member states of UNESCO, this report profiles the educational system in Malaysia. The four parts of the document provide general information about the following: the country; the history, philosophy, and structure of the educational system; vocational…
Truijen, Karin; Sleegers, Peter; Meelissen, Martina; Nieuwenhuis, Loek
2018-01-01
Purpose – At a time when secondary vocational education is implementing competence-based education (CBE) on a large scale, to adapt to the needs of students and of the labour market in a modern society, many vocational schools have recognised that interdisciplinary teacher teams are an important
Truijen, K.J.P.; Sleegers, P.J.C.; Meelissen, Martina R.M.; Nieuwenhuis, Loek
2013-01-01
Purpose – At a time when secondary vocational education is implementing competence-based education (CBE) on a large scale, to adapt to the needs of students and of the labour market in a modern society, many vocational schools have recognised that interdisciplinary teacher teams are an important
Between General Education and Vocational Training or What Claims Future has on Us
Directory of Open Access Journals (Sweden)
Dušana Findeisen
1996-12-01
Full Text Available Dušana Findeisen deals with the relationship between general education and vocational training in the future. White qualifications needed on the labour market in 15 years are not easily predictable, it is possible to predict with certainty only the kind of people needed and which basic qualifications are to be included among the educational goals to be attained by school population and adults. Among basic qualifications or competencies are ranging: managing thinking processes, communication competence, competence of playing an active role in community, attitude towards environment. Further, the author points out the need for different didactic processes and evaluation ensuring a balance of various elements of education and "producing" well balanced people. General education should penetrate "narrow gauge" vocational training of adults, since enterprises do not search only for good professionals but also for people able to adapt and to develop along with them.
Geel, Mitch van
2009-01-01
This thesis deals with the adaptation and acculturation of immigrant adolescents in junior vocational education. The adaptation of immigrant adolescents fits the notion of an 'immigrant paradox'. Maintaining aspects of the ethnic culture was found positively related to immigrant adolescents'
The Changing Roles of Vocational and Academic Education in Future High Schools.
Pucel, David J.
Both the rapid movement to the knowledge/imagination age and a more thorough understanding of how problem-solving skills are developed challenge traditional education to change and adopt a new set of goals. Academic and vocational education are modifying their goals and instructional procedures, and they are blending together. As technology has…
Technical and Vocational Education and Training for Economic Growth in Pakistan
Directory of Open Access Journals (Sweden)
Shirin Nooruddin
2017-06-01
Full Text Available This discussion paper aims to highlight the existing scenario of Technical and Vocational Education and Training (TVET for the economic growth in Pakistan. It specifically analysis the status of vocational training, related policies and practices with reference to the 18th Amendment, which abolishes the concurrent list and grants more provincial autonomy in the matters of education. Article 25A of the Constitution of the Islamic Republic of Pakistan (iv states that the provinces should set priorities for access and quality education based on the provincial needs and develop action plans for its actualization. A developing country like Pakistan needs to devise a systematic, well thought and sophisticated policy for TVET; therefore, this paper proposes a policy following the simple framework of input, process and output. The inputs are predominantly focused on highlighting and matching demand and supply of the TVET. The process thoroughly discusses both the formal and informal education arrangements. Finally, the outputs are deliberated in the form of economic effects such as the manpower structures, technological development, manpower quality and economic behavior leading to the ultimate goal of economic growth and development of the country.
The "Technical and Vocational Education Initiative": Enclaves in British Schools.
Saunders, Murray
The Technical and Vocational Education Initiative (TVEI) is intended as a pilot, on a massive scale, of particular approaches, with a systematic need to identify TVEI effects on students, staff, resources, and curricula. TVEI has a strong tendency toward the development of pilot enclaves in terms of its administrative, curricular,…
Welding. Module 8 of the Vocational Education Readiness Test (VERT).
Thomas, Edward L., Comp.
Focusing on welding, this module is one of eight included in the Vocational Education Readiness Tests (VERT). The module begins by listing the objectives of the module and describing tools and equipment needed. The remainder of the module contains sections on manipulative skills, trade vocabulary, tool identification, trade computational skills,…
Business as a Vocation: Catholic Social Teaching and Business Education
Turkson, Peter K. A.
2012-01-01
Building on "Vocation of the Business Leader," the recently released document from the Pontifical Council for Justice and Peace, along with input from Catholic business and educational leaders from around the world, this essay examines five pillars on which a Catholic business school should build its mission: foundations; the purpose of…
Magisos, Joel H., Comp.; Stakelon, Anne E., Comp.
This annotated bibliography is designed to assist applicants for research grants under part C (section 131a) of the amendments to the Vocational Education Act of 1963 by providing access to documents, journal articles, and current projects related to the individualization and modularization of vocational education instructional materials. The…
UNIVERSITY AND/OR VOCATIONAL SCHOOL – WHEN AND WHY?
Directory of Open Access Journals (Sweden)
Mare Leino
2018-05-01
Full Text Available Since 2013, the university degree is free for everyone in Estonia. Vocational education has always been for free. University degrees have been valued as more academical, and vocational education because of the practical skills gained. There is a new trend in Estonia to enter into a vocational school after the university degree; and/or after one vocational education in to another vocational school. Study eagerness is always nice, but the question here is about the reason(s – is this kind of behaviour rather the sign of lifelong learning, or of wrong choices? In this question the research problem is included also – in case of wrong choices the waste of resources can be considered (from the point of view of society. In 2016, the National Audit Office of Estonia studied the progress of adults aged 25 and over, who had started acquiring vocational education (from 2010/2011 to 2014/2015 academic years before and during their studies, and in working life after the completion of their studies. The focus was on adults, because the decreasing number of young people in the state means that adults are and will remain an important target group for vocational education. The aim of this research is to analyze the background of the fact that many adults in Estonia with vocational education (36% or higher education (20% have started acquiring vocational education alongside adults without any professional education (44%. The subjects/respondents of this research were people who decided to influence the quality of their life through education. The object of the research were shcolars’ opinions about the type of education. In this research I focus on the opinion of students about university and/or vocational education. As an illustration, I discuss one case study of a highly educated person with two master degrees, who is going to start studying in a vocational school. The research question: which background impulses influence the choice of educational
Institute of Scientific and Technical Information of China (English)
Liuhe; JIN
2014-01-01
At present there are many socialized microblog platforms.With powerful mobility,real-time information,fragment of information dissemination,and innovation of interaction,the microblog has become a socialized interaction mode in recent years.Since microblog is very popular with students of agricultural and forestry higher vocational schools,with the rising and development of network education,the microblog as a new information platform will be used by more and more teachers in education.From the perspective of microblog,this paper studied educational reform in management courses of agricultural and forestry higher vocational schools,in the hope of providing certain reference and help for current education practice of agricultural and forestry management courses.
Reasons for Entering College and Academic and Vocational Preferences.
Gordon, Virginia N.
1982-01-01
Explored the relationships between students' (N=305) reasons for enrolling in college as measured by the Educational Participation Scale and their vocational and educational preferences as measured by the Vocational Preference Inventory. Results suggested relationships may exist between students' educational and vocational preferences and…
Lavrijsen, Jeroen; Nicaise, Ides
2017-04-01
An important issue in the design of secondary-level education is the balance between conveying general and occupation-specific (vocational) skills. On the one hand, vocationally oriented programmes, providing occupation-specific skills with immediate labour market relevance, have repeatedly been shown to secure safe pathways into employment. On the other hand, these programmes tend to put less emphasis on developing general knowledge, skills and competencies, including numeracy and literacy, which are foundational to lifelong learning. Hence, when the needs of the labour market change, employees who opted for a vocational track when they were at secondary school risk being less flexible in adapting to such changes later in their career. The authors of this article examine whether this results in a trade-off between short-term gains and long-term losses by considering differences in the labour market careers of vocationally and generally educated respondents in the 2012 Programme for the International Assessment of Adult Competencies (PIAAC). Their results suggest that early labour market benefits of vocational specialisation decrease over time; the authors relate this to its lower ability to equip secondary school students - future employees - with skills for lifelong learning.
Unwelcome Stranger to the System: Vocational Education in Early Twentieth-Century China
Schulte, Barbara
2013-01-01
Both in China and internationally, educators and policy makers claim that vocational education and training (VET) is essential for the sound economic development of a country and the physical and social well-being of its population. However, China looks back upon a century-long history of rejection when it comes to popularising VET, despite…
Learning processes of students in competence based pre-vocational secondary education
Koopman, M.; Teune, P.J.; Beijaard, D.; Brok, den P.J.
2009-01-01
The purpose of this study was to validate a causal and hierarchical model to elaborate on the relation between goal orientations, information processing strategies and development of conceptual knowledge of pre-vocational secondary education-students. This model can be used to describe students'
Learning processes of students in competence-based pre-vocational secondary education
prof dr Douwe Beijaard; Dr. M. Koopman; P. den Brok; Dr P.J. Teune
2008-01-01
The purpose of this study was to validate a causal and hierarchical model that describes the relations between goal orientations, information processing strategies and development of conceptual knowledge of pre-vocational secondary education-students (n=719; 14 schools). Preferences of students for
Proficiency Forms and Vocational Pedagogical Principles
Inglar, Tron
2014-01-01
This article is based on research on experiential learning and vocational teachers. The author describes his analysis of curricula for the vocational teacher education and explains the education´s purpose, content, and methods. In 1975, education dramatically changed from an academic tradition with dissemination of many disciplines to a holistic…
Wheelahan, Leesa; Buchanan, John; Yu, Serena
2015-01-01
This summary brings together the relevant key findings for government and policy-makers from the research program "Vocations: The Link between Post-Compulsory Education and the Labour Market." The program was comprised of three different strands: (1) pathways from VET in Schools, (2) pathways within and between vocational education and…
Directory of Open Access Journals (Sweden)
Mohammad Supriyadi
2015-12-01
Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.
Intercultural Communication Training in Vocational and Industrial Education Training
Hastjarjo, S.; Nuryana, A.
2018-02-01
The globalization and free trade between countries and nations has created demands for the knowledge and skills in the area of intercultural interaction and transaction. Intercultural Communication Competences (ICC) is one of the capabilities that need to be possessed by workers and professionals who want to have a bigger role in the business and industries in international level. Vocational education institutions are demanded to provide their students with a certain degree of competences in multicultural interaction and communication. This paper aims to address the effectiveness of trainings in a vocational education institution in equipping its students with the intercultural communication skills. Using a sample of students from the ISP Cruiseship and Hotel School Surakarta, Central Java, this study will analyses the differences of ICC between groups of students who have undergone various forms of training in intercultural communication, in order to determine the effectiveness of the training in equipping the students with the necessary intercultural communication skills. The study incorporates a quantitative approach, using survey method. The data will be analyzed using descriptive statistics and analysis of variations between groups. The result shows that the intercultural communication training increase the level of ICC especially in the intercultural confidence dimension.
Lavrijsen, Jeroen; Nicaise, Ides
2017-01-01
An important issue in the design of secondary-level education is the balance between conveying general and occupation-specific (vocational) skills. On the one hand, vocationally oriented programmes, providing occupation-specific skills with immediate labour market relevance, have repeatedly been shown to secure safe pathways into employment. On…
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...
Thomas, Ruth G.; And Others
One of the four case studies addressing access of rural students to vocational education through inter-school district cooperation, the Heartland case study represents the decentralized variation of the center cooperative school pattern, identifies essential features of this form of cooperation, details factors facilitating/impeding the…
A Critical Reflection on Codes of Conduct in Vocational Education
Bagnall, Richard G.; Nakar, Sonal
2018-01-01
The contemporary cultural context may be seen as presenting a moral void in vocational education, sanctioning the ascendency of instrumental epistemology and a proliferation of codes of conduct, to which workplace actions are expected to conform. Important among the purposes of such codes is that of encouraging ethical conduct, but, true to their…
The envisaged dual system of vocational education and training in ...
African Journals Online (AJOL)
The aim of this research was to assess the potential of the envisaged dual system of vocational education and training in South Africa from a comparative perspective, namely, the German prototype and the many attempts to transplant this to other countries. The dual system in Germany is outlined and assessed, followed by ...
Entrepreneurship as a Competitive Development of Vocational Education: Theory and Practice
Directory of Open Access Journals (Sweden)
A. G. Mokronosov
2013-01-01
Full Text Available The paper considers the complex of economic processes in the sphere of the higher vocational education. The research is aimed at investigating, clarifying and systemizing the theoretical concepts of entrepreneur- ship in the context of the knowledge economy and rising competitiveness in the market of scientific and educational services. The research methodology basis involves the works of domestic and foreign scholars in the fields of competitive development, entrepreneurship, quasi-markets theories and self- developing organizations. The paper presents the author’s interpretation of the university entrepreneurship as the integrated and systematic process generated by the dramatic changes of socio-economic development, increasing global trends of economy intellectualization, significant proportion of scientific and educational services, and increasing role of modernization in sustaining the state welfare and stability. The university entrepreneurship is regarded as a synthesis of creative, innovative, commercial and managerial activities in the market of scientific and educational services, labor market, industrial and financial markets. The interrelation of economic and social aspects of university business is revealed including the links between the government, universities, scientific educational institutions, business community, households and other subjects of educational service market. The application of the main theoretical principles of the research concerning the higher school business vector is demonstrated by the practical activity of the Russian Vocational Pedagogical University.
Owoh, Titus M.
2016-01-01
This article describes the development of curriculum as it relates to vocational education in Nigeria Upper Basic Education Curriculum. The definition of Curriculum development was highlighted to reflect contemporary concepts of curriculum integration. Curriculum development was stressed to include the rudiments necessary in its stages of…
Vocational training for students with a drop out risk: An alternative educational approach
Directory of Open Access Journals (Sweden)
Klara Rokkones
2016-09-01
Full Text Available A dropout discourse has emerged; highlighting the economic risk that leaving secondary school before graduation poses to those who drop out and to society as a whole. Many initiatives aim to reduce the dropout rate. One such project, “The Third Way”, was established in 2012 with the aim of reducing dropouts in one secondary school among students on a vocational track - particularly in the programs Restaurant and food-processing and Health care, childhood and youth development. We have followed this project for two years through classroom observation and interviews with teachers and school management. "The Third Way" works at the interfaces of students, teachers, schools, and in cooperation with workplaces connected to the students’ vocational training in practical studies. Based on our analyses we see that flexibility among all actors in alternative vocational education, both in school and workplace practice, is crucial for the reduction of dropout rates. By adapting the curriculum within these alternative structures, we see that at-risk students have an increased likelihood of finishing their secondary education.
NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...
Using AHP Method for Educational and Vocational Guidance
Essaid EL HAJI; Abdellah Azmani; Mohamed El Harzli
2017-01-01
This work focuses on the use of multi-criteria decision-making method AHP for using in educational and vocational guidance. Analytical Hierarchy Process (AHP), proposed by the mathematician Thomas Saaty in 1980, is a method of analysis greatly used in the context of a multi-criteria analysis; it allows the comparison and the choice between the preset options. To achieve this goal, a vital work, preceded the use of the AHP method, which consists in doing a prototyping o...
Two Rival Conceptions of Vocational Education: Adam Smith and Friedrich List.
Winch, Christopher
1998-01-01
Examines and discusses two views of political economy: (1) the classical model of Adam Smith; and (2) the social capitalist model associated with Friedrich List. Explores two varieties of vocational education and training that emerge from a comparison of Smith's and List's ideas. (CMK)
Students' personal professional theories in vocational education : developing a knowledge base
Schaap, H.
2011-01-01
Senior secondary vocational education needs to deliver reflective practitioners who possess an adequate knowledge base, who are able to solve complex problems and who have the ability to acquire and develop new knowledge during their further professional career. It is assumed that all types of
Weigel, T.M.; Mulder, M.; Collins, K.M.
2007-01-01
This contribution reviews how four European countries - England, Germany, France and the Netherlands - use the concept of competence in the process of developing vocational education and training. Competence in England is set in the context of the National Vocational Qualifications; in Germany
Status of Technical and Vocational Education in Rural Institutions in ...
African Journals Online (AJOL)
This study was aimed at assessing the state of technical and vocational education in rural institutions in Delta State. Three research questions guided the study. A sample size of fifty (50) principals from 50 rural institutions in Delta State was used for the study. Data were collected using a questionnaire. The study reveals that ...
NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...
Forming personal brand of the head of vocational education institution
Directory of Open Access Journals (Sweden)
Lunev Alexander
2016-01-01
Full Text Available The article topicality is conditioned by the increase of competitiveness of professional education institutions at the international and regional markets of services. Selection of management personnel for institutions of vocational education, ensuring its competitiveness, is one of the main challenges facing the education authorities. The article reveals the essence of competitiveness of professional education institutions as its advantage in relation to other similar objects, characterized by the ability to meet the educational needs of the population, by providing it with appropriate services to update its activity in accordance with comprehensive security. The article describes the stages of formation of the personal brand of the head of professional education institution. The article can be useful to managers of professional educational institutions and specialists of education management bodies.
Vocational education in the Netherlands: in search of a new identity
Dr. Jan Geurts; dr. Frans Meijers
2007-01-01
When the Netherlands developed a national system of vocational education at the end of the 19th century, it was a direct answer to obvious shortcomings in the technical and trade professions (De Jonge, 1968). It concentrated on training craftsmen for the traditional, mainly agrarian economy, and
Building Capability in Vocational Education and Training Providers: The TAFE Cut. Occasional Paper
Guthrie, Hugh; Clayton, Berwyn
2010-01-01
This paper focuses on issues which affect the capability of technical and further education (TAFE) providers to meet their clients' and stakeholders' needs and draws extensively on the reports of the consortium research program which examined ways to help build vocational education and training (VET) provider and workforce capability. The paper…
Directory of Open Access Journals (Sweden)
X. Y. Jiang
2014-08-01
Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...
Diagnostic Vocational Assessment for Special Needs Student Candidates for Vocational Training.
Blackstone Valley Regional Vocational School District, Upton, MA.
A project was conducted to bridge the gap between the coneptualized model of vocational evaluation within a rehabilitation framework and the needs of a changing career development model within an educational setting. The project focus was on ascertaining the state of the art of vocational assessment of special needs individuals, then building a…
Nienke Bijlsma; Harmen Schaap; Prof.Dr. Elly de Bruijn
2016-01-01
Meaning-making and sense-making are generally assumed to be part of students’ personal vocational knowledge development, since they contribute to both students’ socialisation in a vocation and students’ personalisation of concepts, values and beliefs regarding that vocation. However, how students in
Mawer, Giselle; Jackson, Elaine
2006-01-01
This report provides an analysis of data gathered from vocational education and training (VET) policy-makers, industry representatives, resource development managers and practitioners about their experiences and views on the uptake and implementation of equity learning resources. These resources are aimed at supporting trainers in teaching their…
McLaughlin, Patricia; Mills, Anthony
2010-01-01
Australian post-compulsory vocational or technical education and higher education (university) has traditionally been delivered separately. Attempts to collaborate on curriculum development and delivery have mostly been at the margins of articulation and educational pathways. This study examines a pilot project in construction management education…
A Model for Vocational Education Program Development in Entrepreneurship. Evaluation Report.
Andrew, Dean C.
The overall purpose of this project was to expand the vocational education curriculum to provide adults with entrepreneurial competencies which will facilitate self-employment. More specifically, the project goals were to (1) develop and implement modules of instruction in entrepreneurship for adults in self-employment and potential entrepreneurs;…
Transitions from vocational education to employment in the Nordic countries
DEFF Research Database (Denmark)
Jørgensen, Christian Helms; Tønder, Anna Hagen
2018-01-01
, market-based regulation and institutionalised negotiation. In addition, it compares the organisation of young peoples’ educational choice and the selection process in the students’ transitions to work and examines employment protection in the four countries. Finally, it compares attempts to revive......This chapter examines how the systems of initial vocational education and training (VET-systems) in four Nordic countries connect to the labour market, and how they support the students’ transition to employment. It employs a conceptual lens of three different coordination regimes: state planning...
National Profiles in Technical and Vocational Education in Asia and the Pacific: Bhutan.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
This technical and vocational education (TVE) profile on Bhutan is one in a series of profiles of UNESCO member countries. It is intended to be a handy reference on TVE systems, staff development, technical cooperation, and information networking. Part I, Policy Concern, provides general information on the education delivery system, the role of…
A Master Plan for the Development of Vocational-Technical Education In New Mexico.
Sterling Inst., Washington, DC.
This master plan for vocational education in New Mexico is the result of a study conducted by professional education consultants. The following areas were examined during the study: (1) New Mexico's present manpower problems, (2) market trends of future industrial potential, (3) state resources capable of attracting new industry, (4) adequacy of…
Powers, Jane Bernard
This book analyzes the history of vocational education for girls in the United States since about 1900. The analysis is developed from the larger issues raised by what turn-of-the-century educators called "the woman question," or "What ought woman to be?" The book analyzes competing ideologies and correlates prescriptions with…
Enhancing teaching and learning in the Dutch vocational education system : Reforms enacted
Elly de Bruijn; Stephen Billett; Jeroen Onstenk
2017-01-01
This book discusses how the Dutch vocational education system has undergone significant waves of reform driven by global imperatives, national concerns and governmental policy goals. Like elsewhere, the impetuses for these reforms are directed to generating a more industry-responsive,
2012-04-06
... (Educational/Vocational Counseling Application) Activity: Comment Request AGENCY: Veterans Benefits... information needed to determine an applicant's entitlement to counseling services. DATES: Written comments and... may be viewed online through FDMS. FOR FURTHER INFORMATION CONTACT: Nancy J. Kessinger at (202) 461...
NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...
Aksit, Adnan; Arpat, Bulent; Kalfa, Veli Riza
2017-01-01
A well-educated and qualified workforce is one of the most important outputs in vocational and technical education. Vocational schools constitute the last circle in Turkey for the preparing students about the vocational and technical education in order to meet the need for the intermediate staff needed by the labor market. The educational model…
Said, Alison
2018-01-01
The purpose of this study is to develop a deeper understanding of the teaching qualities of effective lecturers that vocational students desire, students assessment preferences and preferred learning environments. This study gives a voice to higher vocational students as it is important for vocational educators to learn what attracts students to…
Directory of Open Access Journals (Sweden)
T.L. Adepoju
2017-06-01
Full Text Available Vocational and technology education (VTE is widely recognized as agent of technological development, industrial revolution, economic growth and voca-tional independence all over the world. In Nigeria, attempts have been made by various governments to restructure the system so as to keep pace with what operates in developed countries and to meet global competitions and best prac-tices. However, in this paper, the need for the renewal and paradigm shift in the curriculum contents of vocational and technological education is empha-sized. The paper e-rays the historical development of vocational and technolo-gy education in Nigeria from the colonial era. The paper further examines is-sues associated with implementation of a reviewed curriculum and the partici-pation of VTE in industrial revolution and vocational independence. A curvi-linear model and two equations are developed in the paper to explain the as-sumed linear correlation between curriculum renewal and technological break-through (technological development, industrial revolution, economic growth and vocational independence. The challenges facing VTE in Nigeria and the implications of the proposed curriculum renewal for stakeholders are highlight-ed in the paper.
Robert Akor; Ab Rahim Bin Bakar; Azim B.Hj Hamzah; Abdullah Bin Mat Rashid
2015-01-01
Despite the documented benefits to economic and social development of women and the constitutional guarantee for equal right under the law to all citizens, the advancement of the status of women in Nigeria is still far from satisfactory. The participation of women in technical and vocational education is abysmally low. Recent literature describing education of women in technical and vocational education in Nigeria, still need more equality of access to the program. As the Nigerian transition ...
People with Disability in Vocational High Schools: between School and Work
Haryanti, R. H.
2018-02-01
Vocational education is positioned within the framework of Vocational Education for All. Therefore, the alignment between the world of education and the world of work is an issue that is always actual within the framework of vocational education, including being an actual issue for people with disabilities. This article aims to map how the state frames disability and vocational education issues within the framework of public policy. The research was conducted using qualitative research method in which the data obtained from the study of documentation. Analysis of the data using content analysis. The results of the study show that the State Policy has not fully framed the issue of vocational education for the disabled into special policies. The vocational education policy for the disabled is still integrated in the major policies in certain institutions. No policy innovations have yet significantly provided a special place for the disabled.
Evolving Conceptualization of Leadership and Its Implication for Vocational Technical Education
Boateng, Christina
2012-01-01
Leadership has been conceptualized variedly in the literature with various implications for those who lead and the people and organizations they lead. In this paper a thorough appraisal of the literature on the evolving conceptualization of leadership and its specific implication for leadership in vocational technical education is presented. A…
Measuring Technical Vocational Education and Training (TVET) Efficiency: Developing a Framework
Liu, Guimei; Clayton, John
2016-01-01
The growing demand for an increasingly skilled competitive workforce and the associated demand for change and responsiveness in the provision of technical vocational education and training (TVET) has led to the development of stronger links between New Zealand and the People's Republic of China. A collaborative model programme project aims to…
NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...
Wang, Yonglin; Wang, Zhanjun
2016-01-01
Education evaluation should be based on human development and revolve around educational institutions integrating two dimensions, the development needs of the nation and society, and the logic and laws of self-development. The value orientation of higher vocational education evaluation in China is actually expressed through enhancing quality…
Closing the Gap. SREB Program Blends Academic Standards, Vocational Courses.
Bottoms, Gene
1992-01-01
Southern Regional Education Board's State Vocational Education Consortium developed a model for integrating vocational and academic education that includes at least three credits each in math and science; four English courses; and four credits in a vocational major and two in related fields. Eight sites implementing the model have narrowed gap…
DEVELOPMENT TRENDS OF VOCATIONAL EDUCATION IN THE CONTEXT OF SOCIO-ECONOMIC CHANGES
Directory of Open Access Journals (Sweden)
Y. M. Dorozhkin
2013-01-01
Full Text Available The paper explores the current development trends of primary, secondary and higher education. The authors emphasize the crisis of professionalism in various spheres of national economy caused by the crisis of Russian education. The vocational teaching and managerial staff are facing the global task of training the specialists demanded by the modern economy and capable of adapting to the increasingly changing life and information environment. The main emphasis is on the ability to foresee the production needs by analyzing the industrial enterprise from the socio-technological perspective. The authors outline the key factors affecting the above functions along with the resulting requirements for employees’ professional levels. To train the vocational university graduates in accordance with the above requirements, the authors suggest the project method implementation providing the accumulation of methodological, social and professional competences and facilitation of cross-disciplinary knowledge.
Crisis in the Restructuring of China's Vocational Education System, 1980-2010
Luo, Yan
2013-01-01
This article examines the origins of China's vocational education system and the restructuring of the system since 1980, finding that this thirty-year systemic restructuring was based on a framework of instrumental rationalism, but did not connect effectively with the building of a modern enterprise system. During this critical period in upgrading…
Promoting Equal Access of Girls/Women to Technical and Vocational Education.
Mishra, Arun; Khanna, Pinki; Shrivastava, Nalini
Despite United Nations' efforts, inequality of access for girls and women to technical and vocational education (TVE) persists in India. Challenges of the 21st century with regard to ensuring equal access of girls and women to TVE include: increasing the participation of girls (especially rural girls) in TVE; overcoming gender bias and…
University and Vocational Education, and Youth Labour Market Outcomes in Australia
Marks, Gary N.
2017-01-01
The purpose of this study is to examine the effects of university and vocational education, and other influences on a variety of labour market outcomes for Australian youths aged between 16 and 25. The six labour market outcomes investigated are: occupational status, hourly and weekly earnings, employment, unemployment and full-time work. The…
Shaw, Angela Joy; Shaw, Kieron John; Blake, Suzanne
2016-01-01
In a global society, all educational sectors need to recognise internationalism as a core, foundational principle. Whilst most educational sectors are taking up that challenge, vocational education and training (VET) is still being pulled towards the national agenda in terms of its structures and systems, and the policies driving it,…
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
Tarrant, Iona; Tarrant, James
2004-01-01
This paper proposes a new interpretation of John Stuart Mill's notion of utility, which is used to provide a utilitarian justification for an eclectic, rather than a vocational, education. Vocational education is strongly promoted in recent policy documents, which makes it important to raise the question of justification. Many existing…
Hee, Tieng Fok
The economic profile of Malaysia has changed from an economy mainly based on agriculture and the production of tin ore to a more balanced economy with continuing growth in the manufacturing and industrial sectors. Educational programs need to be upgraded and improved, particularly the direction and development of technical and vocational education…
Cockriel, Irvin W.
1972-01-01
Occupational scales of the Vocational Preference Inventory were correlated with the Basic Interest scales of the Strong Vocational Interest Blank. The 285 subjects were women freshmen in a College of Education. The results indicate that the scales are not highly correlated. (Author)
Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion
Energy Technology Data Exchange (ETDEWEB)
Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS
2009-07-01
Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench
Baqadir, Abdullah; Patrick, Fiona; Burns, George
2011-01-01
This article reports the findings of data drawn from doctoral research on the extent to which recent changes in vocational training have addressed a perceived skills gap between the needs of private sector employers and potential workers in Saudi Arabia. While the Saudi government has made efforts to enhance the quality of vocational education,…
Ekamper, P.; Lipinska, P.; Tessaring, M.
2009-01-01
This report presents short-, medium- and longterm projections (with focus on the period up to 2030) of the future number of vocational education and training students and graduates, aged 15-24, in the 27 Member States of the European Union. The analysis is based on Eurostat population projections
Entomology Specialist 1-1. Military Curriculum Materials for Vocational and Technical Education.
Jones, Jimmie L.
This individualized, self-paced course for training an entomology specialist was adapted from military curriculum materials for use in vocational and technical education. Completion of the course should provide students with basic information needed to accomplish the following duties of an entomology specialist: perform entomological work, apply…
Kendall, Elizabeth L.
Nontraditional and traditional secondary vocational education program completers in West Virginia were surveyed to determine their attitudes toward their school preparation, work, and encountered work barriers. A questionnaire was mailed to 100 nontraditional and 100 traditional program completers, and a 10 percent sample was contacted by…
Calculations for the design and modification of the 2 cyclotrons of S.A.R.A
International Nuclear Information System (INIS)
Albrand, P.S.; Belmont, J.L.; Ripouteau, F.
1983-09-01
S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron
Zhao, Bryan M; Hoffmann, F Michael
2006-09-01
Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.
National Profiles in Technical and Vocational Education in Asia and the Pacific: Papua New Guinea.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
One of a series of studies on the development of technical and vocational education in the member states of UNESCO, this report profiles the educational system in Papua New Guinea. The four parts of the document provide information about the following: the geography, the history, and the economy of the country; the educational system; technical…
Midwifery in Iceland: From vocational training to university education.
Olafsdottir, Olof A; Kristjansdottir, Hildur; Halfdansdottir, Berglind; Gottfredsdottir, Helga
2018-04-03
Midwifery education is a foundation for health professionals' competence in providing quality healthcare for the benefit of women, their families and society. This paper describes midwifery and the development of midwifery education in Iceland. It examines policy and extensive reforms, from hospital-based vocational training in midwifery to an academic university education, and the impact on the scope of midwifery practice in Iceland. The university-based programme, with its emphasis on autonomy of the midwife, seems to have affected the context of home birth and strengthened midwives' role in primary healthcare. Education reform with a focus on evidence-based practice and midwife-led continuity of care has had limited influence within the hospital system, where the structure of care is fragmented and childbirth is under threat of increasing interventions. Research is needed on the role of education in supporting evidence-based practice, normal childbirth and reproductive health in the Icelandic context. Copyright © 2018 Elsevier Ltd. All rights reserved.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...
Vocational Education and Training. Review of Experience. Latin America and the Caribbean.
Herschbach, Dennis R.; And Others
This report examines the problem of implementing and sustaining vocational education and training (VET) programs in developing countries. It is intended to provide U.S. Agency for International Development (USAID) officers with operational guidelines for the development of future projects. In conducting the study, over 50 projects conducted by…
Fitzgerald, Brian; Harmon, Lisa
Beginning in October 1987, Pelavin Associates conducted an exploratory study of consumer rights and accountability in postsecondary vocational-technical (PVT) programs for the U.S. Department of Education. The study focused on how effectively the governance structure--accreditation and federal and state regulation--ensures that consumer rights are…
From vocational training to academic education: the situation of the schools of nursing in Sweden.
Andersson, E P
1999-01-01
As a consequence of a college reform in 1993, nursing education in Sweden is changing from vocational training to academic education. Teacher competence is considered to be of strategic importance to the quality of education for nurses, and nurse educators are expected to have a doctorate or master's degree in nursing or social science. This article focuses on teaching competence as it is perceived by teachers and describes the strategies used by nurse educators to meet the educational changes. The data for this ethnographic study were collected by participant observations at three Swedish nursing schools and interviews with 59 nurse educators. Results indicate that nurse educators use three different strategies to cope with changing demands and to keep their knowledge and competence as faculty at a desirable level. A good nurse educator must: (a) be a "real" nurse; (b) be well prepared in different subject matters; or (c) have an academic degree (master's degree or PhD). The success of the change from vocational training of nurses to an academic education depends on the faculty composition and the culture of the school. As a result of the increased demands for competence, traditional strategies to cope with change are no longer appropriate. Nonacademic-educated faculty risk losing their identity as good educators.
Food for thought : Understanding students' vocational knowledge
Heusdens, W.T.
2018-01-01
The focus of the thesis is an exploration into students’ vocational knowledge in the context of Dutch vocational education and training (VET). The reason students’ vocational knowledge requires exploration is because there is no consensus among scholars in the field of VET about how to theorise the
Vocational Literacy in Mozambique: Historical Development, Current Challenges and Contradictions
Directory of Open Access Journals (Sweden)
Oleg Popov
2016-03-01
Full Text Available The study analyses the historical development of vocational literacy in basic education and Non-Formal Vocational Education (NFVE in Mozambique, as well as current challenges and contradictions. The theoretical lens of Cultural-Historical Activity Theory (CHAT is employed in the study. Methodologically the study was executed through an analysis of oral, printed and e-resources produced by the main stakeholders and also the reflective experiences of the authors in their extensive educational work in the country. The findings reveal poorly developed vocational literacy education in schools and non-formal settings in spite of recurrent political declarations about its importance. There is a strong dependence by formal and particularly NFVE sectors on the technical and financial support provided by international organisations. Vocational literacy courses are characterized by a lack of adequate equipment and poor practice. As a consequence, theoretical or elementary forms of vocational knowledge are dominant in the courses, resulting in the dissatisfaction of both learners and educators. Vocational literacy development proved to be a complex field that faces many challenges and ischaracterised by diverse internal contradictions.
试论职业教育的制度环境%Institutional Environment for Vocational Education
Institute of Scientific and Technical Information of China (English)
许竞
2014-01-01
Based on the system theory, this paper examines the impacts of institutions on vocational education in three approaches, viz, the societal foundations for education system, the role of vocational education within the education system, and the division of labor and the job market. Education itself functioning as a social institution, has a strong influence on individuals, t education are divided into different categories according to the diversified and professionalized nature of occupations. Vocational education is not valued originates from the dual track stratifying teenager students into vocational education and academic/general education, leading to inequality and inequity within the education system. The defect of vocational schooling lies in the fact that it fails to create a real working environment employment relationship as the reality in the workplace, which makes an effective skills-learning dependent on educational resources in a real world of work where the availability of such resources relies on a more flexible employment of labour force.%本文以系统论为理论基础,主要从教育的社会性、学校教育制度以及社会劳动分工和用工制度等角度分析了各种制度因素对职业教育的影响。文章认为,教育体系本身就是一种社会制度,它能够在个人身上产生不可抗拒的影响力;教育类型的分化是以社会职业的多样化和专业化为前提;将教育类型狭隘地二分为普通教育与职业教育是导致职业教育受鄙薄的观念性根源,以这种观念上的偏见为支撑的教育分流制度造成了教育系统内部的不平等;学校职业教育不可弥补的缺陷在于,它无法模拟或复制真实的工作氛围与工作关系,因此有效的职业学习必须依赖于现实工作世界的教育性资源,然而工作场所职业学习资源的可得性则得益于趋向扁平化的用工制度。
Production-Based Education Model for Improving Technical and Vocational Teachers Ability
Saputro, H.; Suharno; Widiastuti, I.; Harjanto, B.
2018-02-01
The vocational high schools (SMK) in Surakarta have applied the Production-Based Education (PBE) in order to improve the student skills. On the other hand, the implementation of PBE model is needed the professional teachers who have the skill qualifications in the production and learning. This study focuses on strengthening of teacher’s behavior related to the implementation of PBE model at vocational high schools in Surakarta, especially on teacher’s Organizational Citizenship Behavior. This research conducted based on the observational research method that employed 134 teachers of SMK Warga Surakarta as respondents. The data of teachers OCB were analyzed by using the descriptive analysis. The result showed that the PBE model had strengthened the teachers OCB at SMK Warga Surakarta. The measurements of OCB level of SMK teachers had shown the high (H) level and some of the teachers’ OCB characters show very high (VH) levels such as altruism and civic virtue. OCB or “good soldier syndrome” could be manifested by the teacher’s interaction at school such as loyalty, volunteering and helping others. Therefore, teacher’s OCB behavior became important due to the organizational effectiveness at vocational high school (SMK).
The European Dimensions of Vocational Training
Directory of Open Access Journals (Sweden)
Sós Tamás
2015-12-01
Full Text Available The research examined the connection between vocational education, training and the world of work, and the social situation in Hungary in a European outlook. The accentual issues of the analysis disclosing the problem are: youth unemployment, the tendencies of secondary vocational education, proportions of enrollment and the features of training tendencies, the growing number of early dropouts, the effect of family background on student performance. This work tried to find the answer to the question: What variations have the changes in the regulations of vocational training, encouraging dual education brought on in the connection between trainers and work places? The research did not prove that the central vocational training system would be more effective than a varied, flexible, permeable, transparent decentralized operation with parts built on each other. The introduction of the complex exam overshadowed the evaluation of the competency areas, and fits less to the modularity of the framework curricula. With the legal regulation of vocational training in force the modular system has become a formality. Taking prior knowledge into account has become more difficult. The efficiency of professional structural decisions is questionable, it has not triggered the extension of employment among career starters, and does not mean a guarantee of finding a job either. Creating the motivation of economic role players may bring on steps forward to take up bigger tasks in vocational training. The research has confirmed the importance of improving the basic competency areas when planning vocational training, of life-long learning, of practice orientation, and also of the continuous connection with the labor market.
Directory of Open Access Journals (Sweden)
Novi Trisnawati
2017-09-01
Full Text Available This article aims to examine the efforts that need to be done in facing the readiness of the working world for vocational education by developing self-concept and self efficacy. The increasingly intense work competition in the current era makes vocational education graduates should prepare themselves to be better prepared in facing the world of work. This is done by developing self-concept that can be formed through the planting of strong religious values, self-confidence, self-acceptance. The more we have a positive self-concept then success will be as expected. Self-efficacy is a physiological and emotional condition, expected to increase the ability to work and adapt to the work environment more easily, because self efficacy shows the implementation of processes that have been done during the previous learning process.
Development of an E-Learning Platform for Vocational Education Systems in Germany
Schober, Andreas; Müller, Frederik; Linden, Sabine; Klois, Martha; Künne, Bernd
2014-01-01
This paper describes an existing web-based learning platform named "Third Place of Learning" (TPL)--"Dritter Lernort". This project's aim is to connect the system of vocational education with digital media by a web-based learning platform. TPL supports student's digital learning by means of interactive examples and exercises.…
Dualism and Vocational Education and Training: Creating the People Who Require Training
Zoellner, Don
2012-01-01
Governments in advanced liberal democracies have assigned Vocational Education and Training (VET) a critical role in preparing a productive workforce for the broader economy. This linkage opens the way to use economic theories to expand the understanding of VET. Noted economic theorists have described the use of one economic reductionist technique…
Trends in Vocational Education in the Arts 1980. Fast Response Survey System.
Wright, Douglas A.; Farris, Elizabeth
A study examined the nature and extent of vocational arts education programs throughout the 50 states. During the study, data were sought concerning those programs designed to prepare students for occupations in 14 arts areas: dance; vocal music; instrumental music; theater; radio, television, and video; cinematography; photography; graphic arts;…
Safety Standards Plan for Middlesex County Vocational & Technical High Schools.
Sommer, Cy
This vocational education safety standards plan outlines rules and regulations adopted by the Board of Education of Middlesex County Vocational and Technical High Schools. The first of eleven chapters presents demographics and a safety organization table for Middlesex County Vocational and Technical Schools. In chapter 2, six safety program…
Biemans, Harm; Marien, Hans; Fleur, Erik; Tobi, Hilde; Nieuwenhuis, Loek; Runhaar, Piety
2018-01-01
To improve students’ transitions between successive educational levels, continuing learning pathways are being designed and implemented in many countries. This study was carried out to examine the effects of the Green Lycea (GL) as critical cases of continuing learning pathways in vocational
DEFF Research Database (Denmark)
Vestergaard, Arnt Louw
2011-01-01
The subject of this paper focuses on classroom/workshop teaching in the Danish Vocational Educational and Training (VET) from the perspectives of the students. The paper will deal with how the students´ actions, interests and experiences are related to the teaching space and the way the teaching...... the students. The purpose of the project is to point to successful learning processes and to shed light on the challenges the students as well as the teachers face in relation to the student’s requirement of professional vocational skills. The paper will investigate the term: strangeness to the vocations...... thick description anthropology, Jean Lave and Etienne Wenger theories of social relations and learning and Bronwyn Davies & Rom Harré’s theories of identities and positioning. Key Words: Learning outcome, social relations, organization of learning-processes, vocational skills, identity, anthropological...
SarA is a negative regulator of Staphylococcus epidermidis biofilm formation
DEFF Research Database (Denmark)
Martin, Christer; Heinze, C.; Busch, M.
2012-01-01
Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...
Smith, Andy; Bell, Sheena
2015-01-01
Twenty years after UNESCO's Salamanca Statement enshrined international action for provision for children, youth and adults with special educational needs within the regular educational system, this article presents the current underpinning international and national UK context for developing inclusion in vocational education and training and…
NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...
Truijen, Karin; Sleegers, Peter; Meelissen, Martina; Nieuwenhuis, Loek
2018-01-01
Purpose – At a time when secondary vocational education is implementing competence-based education (CBE) on a large scale, to adapt to the needs of students and of the labour market in a modern society, many vocational schools have recognised that interdisciplinary teacher teams are an important condition for this implementation. In order to provide students with the right competences for the labour market, different subject teachers should work and learn together and, by doing so, should be ...
The Inculcation of Generic Skills among Juveniles through Technical and Vocational Education
Wan-Mohamed, Wan Azlinda; Yunus, Mohamed Hafis
2009-01-01
Generic skills are skills which contribute towards individual's effective and successful participation in the workplace. For juveniles, Technical and Vocational Education (TVE) is one of the platforms that provide them generic skills which enable them to compete for job market. The purpose of this study is to investigate the level of generic…
A View of Aesthetic Labour Practice in Higher Technical and Vocational Education
Yang, Cheng-Hua
2017-01-01
Even though aesthetic labour has gradually revealed social and economic value in the employment market, little research has been carried out on the connection and practice of aesthetic labour in technical and vocational education. Front-line ground staffs account for the largest proportion of the employees of airlines and can provide colleges with…
Buli, Bereket Mamo; Yesuf, Wasihun Mohammed
2015-01-01
Purpose: The purpose of this paper is to examine factors that could explain the difference in entrepreneurial intention (EI) among technical-vocational education and training (TVET) program students. Centered on the theory of planned behavior (TPB), the paper aims to contribute to the understanding of factors that affect EIs of students and offer…
Albashiry, Nabeel; Voogt, Joke; Pieters, Julius Marie
2016-01-01
Maintaining the quality and relevance of Technical Vocational Education and Training (TVET) curricula is a great challenge for TVET institutions in developing countries. One major challenge lies in the lack of curriculum design expertise of TVET academics. The purpose of this multiplecase study is
Said, Alison
2018-01-01
The purpose of this study is to develop a deeper understanding of the teaching qualities of effective lecturers that vocational students desire, students assessment preferences and preferred learning environments. This study gives a voice to higher vocational students as it is important for vocational educators to learn what attracts students to effective learning. Due to the inquiry's exploratory nature, an interpretivist approach was used, and a constructivist grounded approach using qualit...
Alazzam, Abu-Obaideh; Bakar, Ab Rahim; Hamzah, Ramlah; Asimiran, S.
2012-01-01
The aim of this study was to examine ICT readiness and the effects of demographic characteristics, educational background, and support factors on the ICT readiness of technical and vocational teachers in Malaysia. The questionnaire was administered to 329 technical and vocational teachers who are teaching engineering subjects in Malaysian…
Wheelahan, Leesa; Buchanan, John; Yu, Serena
2015-01-01
This summary pulls together the relevant key findings for qualification and approval bodies from the research program "Vocations: The Link between Post-Compulsory Education and the Labour Market." The program was comprised of three different strands: (1) pathways from VET in Schools, (2) pathways within and between vocational education…
Growing up with a chronic illness: social success, educational/vocational distress.
Maslow, Gary R; Haydon, Abigail; McRee, Annie-Laurie; Ford, Carol A; Halpern, Carolyn T
2011-08-01
We compared adult educational, vocational, and social outcomes among young adults with and without childhood-onset chronic illness in a nationally representative U.S. sample. We used data from Wave IV (2008) of the National Longitudinal Study of Adolescent Health. We compared respondents who reported childhood-onset cancer, heart disease, diabetes, or epilepsy with young adults without these chronic illnesses in terms of marriage, having children, living with parents, romantic relationship quality, educational attainment, income, and employment. Multivariate models controlled for sociodemographic factors and adult-onset chronic illness. As compared with those without childhood chronic illness, respondents with childhood chronic illness had similar odds of marriage (odds ratios [OR] = .89, 95% CI: .65-1.24), having children (OR = .99, 95% CI: .70-1.42), and living with parents (OR = 1.49, 95% CI .94-2.33), and similar reports of romantic relationship quality. However, the chronic illness group had lower odds of graduating college (OR = .49, 95% CI: .31-.78) and being employed (OR = .56, 95% CI: .39-.80), and higher odds of receiving public assistance (OR = 2.13, 95% CI: 1.39-3.25), and lower mean income. Young adults growing up with chronic illness succeed socially, but are at increased risk of poorer educational and vocational outcomes. Copyright © 2011 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.
Vocational teacher career planning : needs and problems
Sajienė, Laima
2009-01-01
The article analyses a contradiction between vocational teacher ability to plan his/her career and requirements for the teacher professional development set by the system of education. It aims at providing theoretical and empirical justification for vocational teacher need to develop career planning skills and identify problems. The concept and objectives of vocational teacher career planning as well as career planning skills that vocational teachers should develop are defined in the article.
Misbah, Zainun; Gulikers, Judith; Maulana, Ridwan; Mulder, Martin
2015-01-01
Competence-based education requires changing teacher roles probably affecting teacher–student interactions and student motivation. This study examines how students (N = 1469) from competence-based and less-competence-based vocational schools perceive their teachers' interpersonal behaviour and its
Bio Yara, O.G.J.P.
2008-01-01
This research sets out to identify the factors that are enforcing gender inequality and influencing the increase of access of female students to vocational education. The study specifically sought to explore the external and internal factors influencing access of girls to agricultural education in
Martini and Associates, Ltd., Anchorage, AK.
The State of Alaska Department of Education, through management consultants, conducted a study in eight selected school districts to ascertain the following: (1) effectiveness of vocational education programs offered at the secondary level, (2) adequacy of special education services provided to exceptional children at all levels, and (3)…
USING DIDACTIC EQUIPMENT IN VOCATIONAL SUBJECTS TEACHING
JIROUT, Jiří
2011-01-01
Baccalaureate Work ?Using Didactic Equipment In Vocational Subjects Teaching? describes various methods of teaching and using didactic engineering in education. Theoretic part describes general aspects of using didactic engineering, teaching methods a and ways how to use didactic engineering in teaching vocational subjects. Practical part finds how students appreciate using modern didactic aids and engineering in education.
Alison Said
2018-01-01
The purpose of this study is to develop a deeper understanding of the teaching qualities of effective lecturers that vocational students desire, students assessment preferences and preferred learning environments. This study gives a voice to higher vocational students as it is important for vocational educators to learn what attracts students to effective learning. Due to the inquiry’s exploratory nature, an interpretivist approach was used, and a constructivist grounded approach using qualit...
Said, Alison
2018-01-01
The purpose of this study is to develop a deeper understanding of the teaching qualities of effective lecturers that vocational students desire, students assessment preferences and preferred learning environments. This study gives a voice to higher vocational students as it is important for vocational educators to learn what attracts students to effective learning. Due to the inquiry’s exploratory nature, an interpretivist approach was used, and a constructivist grounded approach using qualit...
2010-07-01
... Applied Technology Education Program? 403.63 Section 403.63 Education Regulations of the Offices of the... VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION PROGRAM What Kinds of Activities Does the Secretary Assist Under... Technology Education Program? (a) Unless otherwise indicated in the regulations in this part, a State board...
Entrepreneurship Education in Vocational Agriculture.
Williams, Jamie C.; Powell, Ronald
1988-01-01
The authors address the need for instruction in entrepreneurship within the vocational agriculture curriculum. They list various competencies and skills needed by agricultural entrepreneurs and discucss available curriculum materials. (CH)
Dr. Bertha Vallejo; Dr. S. Bolhuis; Prof. dr. Perry den Brok; Drs. Kennedy Aquilino Tielman
2011-01-01
Abstract This research presents a descriptive study regarding collaborative learning in a multicultural classroom at a vocational education school in The Netherlands. The study bridges two domains of research: research on culturally diverse learning environments - which has mostly concerned primary
Tielman, K.A.; Brok, den P.J.; Bolhuis, S.M; Vallejo, B.
2012-01-01
This research presents a descriptive study regarding collaborative learning in a multicultural classroom at a vocational education school in The Netherlands. The study bridges two domains of research: research on culturally diverse learning environments – which has mostly concerned primary and
Jones, Christine S.; Timpson, William M., Comps.
1991-01-01
Abstracts of 25 articles and documents provide examples of the delivery of science, math, and vocational education via such media as interactive television, communications satellites, videodiscs, and electronic mail. Studies of instructional effectiveness and design issues are also represented. (SK)
Twenty Years of Basic Vocational Education Provision in Spain: Changes and Trends
Marhuenda-Fluixá, Fernando; Salvà, Francesca; Saurin, Almudena A. Navas; López, Miriam Abiétar
2015-01-01
Our contribution attempts to review basic vocational education programmes in Spain over the past 25 years. We intend to compare the evolution of these programmes in terms of conception and conditions of delivery in order to find out how different they are as skill-formation and remedial systems, as well as analysing how different political views…
Ombugus, Danjuma A.; Angbre, Francis Adams
2015-01-01
The study focused on evolving policy initiatives for effective Vocational Technical Education (VTE) on sustainable development. The study adopted a descriptive survey research design and was carried out in North Central Geopolitical Zone of Nigeria. The population for the study was 450 respondents (VTE teachers/lecturers, government officials,…
The Social Benefits of Initial Vocational Education and Training for Individuals in Europe
Sabates, Ricardo; Salter, Emma; Obolenskaya, Polina
2012-01-01
This article investigates the social benefits of initial vocational education and training (VET) for individuals in different European contexts. Drawing on data from the European Community Household Panel, results show that initial VET is associated with positive changes in social outcomes for individuals across Europe. Health benefits were mainly…
Consumer Dynamics Inc., Rockville, MD.
This module, one of 25 on vocational education training for careers in environmental health occupations, contains self-instructional materials on using ionizing radiation detectors. Following guidelines for students and instructors and an introduction that explains what the student will learn are three lessons: (1) naming and telling the function…
Directory of Open Access Journals (Sweden)
Jorge A. Orrego-Ruiz
2014-06-01
Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.
Van der Vlis, Madelon K; Lugtenberg, Marjolein; Vanneste, Yvonne T M; Berends, Wenda; Mulder, Wico; Bannink, Rienke; Van Grieken, Amy; Raat, Hein; de Kroon, Marlou L A
2017-06-29
School absenteeism, including medical absenteeism, is associated with early school dropout and may result in physical, mental, social and work-related problems in later life. Especially at intermediate vocational education schools, high rates of medical absenteeism are found. In 2012 the Dutch intervention 'Medical Advice for Sick-reported Students' (MASS), previously developed for pre-vocational secondary education, was adjusted for intermediate vocational education schools. The aim of the study outlined in this paper is to evaluate the effectiveness of the MASS intervention at intermediate vocational education schools in terms of reducing students' medical absenteeism and early dropping out of school. Additionally, the extent to which biopsychosocial and other factors moderate the effectiveness of the intervention will be assessed. A controlled before-and-after study will be conducted within Intermediate Vocational Education schools. Schools are allocated to be an intervention or control school based on whether the schools have implemented the MASS intervention (intervention schools) or not (control schools). Intervention schools apply the MASS intervention consisting of active support for students with medical absenteeism provided by the school including a consultation with the Youth Health Care (YHC) professional if needed. Control schools provide care as usual. Data will be collected by questionnaires among students in both groups meeting the criteria for extensive medical absenteeism (i.e. 'reported sick four times in 12 school weeks or for more than six consecutive school days' at baseline and at 6 months follow-up). Additionally, in the intervention group a questionnaire is completed after each consultation with a YHC professional, by both the student and the YHC professional. Primary outcome measures are duration and cumulative incidence of absenteeism and academic performances. Secondary outcome measures are biopsychosocial outcomes of the students. It
Pirttimaa, Raija; Hirvonen, Maija
2016-01-01
Following the development of inclusive education in vocational education and training (VET), the discussion about the prevention of marginalisation and dropouts has increased. At the same time, the formal education system has strengthened the position of support services, such as special educational needs (SEN) teachers, social workers and…
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...
Youth Unemployment in Nigeria: The Relevance of Vocational and ...
African Journals Online (AJOL)
Youth Unemployment in Nigeria: The Relevance of Vocational and Technical Education. ... Vocational/technical education has been an integral part of national development strategies in many societies because of its impact on human resource development, productivity, and economic ... NESG Economic Indicators Vol.
Murray, Denis
2015-01-01
The case of Higher Education provision in Further Education: Leadership in the evolution of Higher Education in the Post Leaving Certificate sector of the City of Dublin Vocational Education Committee. (Denis Murray, BA, MBS.) This research investigates evolutionary change in Further Education (FE) within the Post Leaving Certificate (PLC) sector with a particular emphasis on the development of Higher Education (HE) courses within the CDVEC. The objective of the study is to understand what...
Directory of Open Access Journals (Sweden)
Fredy Alberto Reyes
2012-06-01
Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p
Foley, Annette
2011-01-01
This article looks at how the neoliberal reform process is affecting the professional identity of frontline managers in the Australian vocational education and training sector. The article examines how frontline managers are required to negotiate their working practices between their understandings and experiences as educators and the new…
Vocational training in pre-university education: trends that have prevailed in Cuba
Directory of Open Access Journals (Sweden)
Noemí Dueñas Bravo
2017-12-01
Full Text Available The formation of the new generations to respond to the needs of the labor force that society requires is a responsibility of all and vocational training plays an important role in this endeavor. The present article aims to present a theoretical review about the positions that have been assumed on this subject. The documentary review of articles, books and other information supports were used as a fundamental method to obtain as an essential result an overview of the antecedents and trends in the formation of this concept, as well as of its relations with education. It was possible to conclude that until now there are ambiguities in the national scientific community about the process to form vocations and the ages in which it must occur.
National Profiles in Technical and Vocational Education in Asia and the Pacific: Australia.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
This technical and vocational education (TVE) profile on Australia is one in a series of profiles of UNESCO member countries. It is intended to be a handy reference on TVE systems, staff development, technical cooperation, and information networking. Chapter 1 describes the demography, government, and economy of Australia. Chapter 2 provides…
Benefits of Vocational Education and Training in Europe for People, Organisations and Countries
Russo, Giovanni; Bainbridge, Steve; Dunkel, Torsten
2013-01-01
People, organisations and governments invest in vocational education and training (VET) because of its positive outcomes, such as higher wages, improved productivity and economic growth. But VET also brings non-economic benefits, such as lower absenteeism and less crime. Research on VET's benefits has focused on specific relationships, such its…
Cognitive Styles and Educational-Vocational Preferences and Selection
Osipow, Samuel H.
1969-01-01
Vocational Preference Inventory (VPI) and other instruments administered to 365 students, both undecided and in various interest fields, revealed several differences in cognitive style. No differences regarding cognitive style variations and VPI high-point codes or ease of vocational selection were observed. (Author/CJ)
20 CFR 411.167 - What is an educational institution or a technical, trade or vocational school?
2010-04-01
... Education. (e) Approval by a State agency or subdivision of the State includes approval of a school, college... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What is an educational institution or a technical, trade or vocational school? 411.167 Section 411.167 Employees' Benefits SOCIAL SECURITY...
Grundy, Lynne
2001-01-01
The movement in British nursing education from nursing schools to higher education has been criticized for deficiencies in skills-based training. Adding a competency-based approach using National Vocational Qualifications is a way to ensure that nurses have practical competence as well as knowledge and understanding. (Contains 24 references.) (SK)
Hispanic Vocational Exploration Project. Final Report.
Centro De La Comunidad, Inc., New London, CT.
During its second year, the Hispanic Vocational Exploration Project recruited eighth and ninth grade Hispanic youth for a four-week cycle, after-school, career exploratory program at Southeastern Regional Vocational Technical School, Groton, Connecticut. A series of career education workshops was the other major project activity. Supportive…
Rajadurai, Jegatheesan; Sapuan, Noraina Mazuin; Daud, Salina; Abidin, Nurazariah
2018-01-01
Technical, Vocational Education and Training has been viewed as a means of developing a nation. The marketability of technical graduates is reliant on whether these graduates possess the attributes demanded by their respective industries. Hence, this study aims to investigate the gap between the key attributes of Higher Education Institutions'…
National Profiles in Technical and Vocational Education in Asia and the Pacific: Fiji.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
This technical and vocational education (TVE) profile on Fiji is one in a series of profiles of UNESCO member countries. It is intended to be a handy reference on TVE systems, staff development, technical cooperation, and information networking. Part I, General Information, covers the following: location, area, and physical features; economic and…
National Profiles in Technical and Vocational Education in Asia and the Pacific: Bangladesh.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
This technical and vocational education (TVE) profile on Bangladesh is one in a series of profiles of UNESCO member countries. It is intended to be a handy reference on TVE systems, staff development, technical cooperation, and information networking. An overview of the report appears first. Part I provides general information on the physical…
Gray, James R.
Research identified and evaluated the level of applied mathematics and science used in selected trade and industrial (T&I) subjects taught in the Kentucky Vocational Education System. The random sample was composed of 52 programs: 21 carpentry, 20 electricity/electronics, and 11 machine shop. The 96 math content items that were identified as…
Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy
2011-09-01
The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.
Directory of Open Access Journals (Sweden)
P. Balamurugan
2017-07-01
Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.
Malamud, Ofer; Pop-Eleches, Cristian
2008-01-01
This paper examines the relative benefits of general education and vocational training in Romania, a country which experienced major technological and institutional change during its transition from Communism to a market economy. To avoid the bias caused by non-random selection, we exploit a 1973 educational reform that shifted a large proportion…
Barriers to participation in vocational orientation programmes among prisoners
Directory of Open Access Journals (Sweden)
Dorien Brosens
2015-11-01
Full Text Available This study investigates the barriers to prisoners’ participation in vocational education, as well as the predictors of different types of barriers. Survey data derived from a project in a remand prison in Belgium (N=468 provided the empirical evidence for the analyses. The results indicate that facing situational and informational barriers are most common. Based on the different kinds of barriers, various types of non-participants can be distinguished and multinomial logistic regression analyses are conducted to identify in what way participants of vocational education differ from various types of non-participants. For instance, prisoners with a poor understanding of the Dutch language and those who never/rarely receive visitors participate less in vocational education as they are more likely to be confronted with informational barriers. We conclude this article by discussing paths for future research and implications for policy and practice to anticipate the barriers for those who want to participate in vocational education.
Game play in vocational training and engineering education
Directory of Open Access Journals (Sweden)
Bjarne A. Foss
2007-04-01
Full Text Available Educational games may create a new and improved learning culture by drawing advantage of the new knowledge and skills of today’s students obtained from extensive use of interactive game software. This paper presents a design basis and online learning resources taking advantage of game-related features like a high degree of interactivity, attractive graphics, a dynamical virtual universe, and an incentive system to promote prolonged and more advanced use. The educational resources, denoted PIDstop, are targeted towards the engineering domain. Feedback from over 2000 users clearly indicates that PIDstop has a positive learning effect. Training packages for vocational training of Automation Technicians is emphasized in this paper. Such learning resources must have a limited mathematical complexity; hence, the representation should be rather descriptive. Evaluation of learning resources to assess the actual learning effect is important, and a two-step procedure based on formative and summative evaluation is proposed for this purpose.
Bailey, Thomas R.; Matsuzuka, Yukari
A study examined the impact of the Advanced Technological Education (ATE) program on efforts in academic and vocational integration. A case study of 10 community colleges housing ATE-funded projects collected data through interviews with administrators, faculty, ATE program practitioners, and faculty and administrators at collaborating high…
The Effects of Digital Learning Material on Students' Mathematics Learning in Vocational Education
Zwart, Diana P.; Van Luit, Johannes E. H.; Noroozi, Omid; Goei, Sui Lin
2017-01-01
This study investigates the effects of Digital Learning Material (DLM) including instructional clips, online guidance, structuring of content, and a collaboration tool on students' mathematics learning in Dutch vocational education. A pretest-posttest design was used. Apprenticeship students were asked to complete assignments and to discuss them…
Ethics: The Role of Adult and Vocational Education. Trends and Issues Alert No. 24.
Wonacott, Michael E.
Ethics and social responsibility are the subject of both curriculum materials and research in adult and vocational education. State academic standards and curriculum frameworks address citizenship and personal and social responsibility. Ethical and legal issues for specific occupations are addressed in curricula issued by states, professional…
Heikkila, Eila
2013-01-01
This article presents a comparative study of innovation in vocational education and training (VET) in three innovative European countries: England, Finland and Germany. The focus is on innovation emerging from VET practitioners' (directors, teachers, project coordinators, etc.) participation in inter-organisational networks with local, regional,…
Bijsterbosch, Erik; van der Schee, Joop; Kuiper, Wilmad; Beneker, T.
2016-01-01
To start a teacher professional development programme on the relationship between classroom summative assessment and learning, the current practices and dispositions of geography teachers towards internal school-based examinations in pre-vocational education in the Netherlands were investigated. A
National Profiles in Technical and Vocational Education in Asia and the Pacific: Indonesia.
United Nations Educational, Scientific and Cultural Organization, Bangkok (Thailand). Principal Regional Office for Asia and the Pacific.
This technical and vocational education (TVE) profile on Indonesia is one in a series of profiles of UNESCO member countries. It is intended to be a handy reference on TVE systems, staff development, technical cooperation, and information networking. A two-page overview lists TVE goals, outlines the structure and governance, and lists the six…
Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows
DEFF Research Database (Denmark)
Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.
2015-01-01
BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...
Lester, Stan
2018-01-01
Purpose: The purpose of this paper is to review three international frameworks, including the International Standard Classification of Education (ISCED), in relation to one country's higher professional and vocational education system. Design/methodology/approach: The frameworks were examined in the context of English higher work-related…