WorldWideScience

Sample records for vk wni wnk

  1. Small-molecule WNK inhibition regulates cardiovascular and renal function

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Ken; Park, Hyi-Man; Rigel, Dean F.; DiPetrillo, Keith; Whalen, Erin J.; Anisowicz, Anthony; Beil, Michael; Berstler, James; Brocklehurst, Cara Emily; Burdick, Debra A.; Caplan, Shari L.; Capparelli, Michael P.; Chen, Guanjing; Chen, Wei; Dale, Bethany; Deng, Lin; Fu, Fumin; Hamamatsu, Norio; Harasaki, Kouki; Herr, Tracey; Hoffmann, Peter; Hu, Qi-Ying; Huang, Waan-Jeng; Idamakanti, Neeraja; Imase, Hidetomo; Iwaki, Yuki; Jain, Monish; Jeyaseelan, Jey; Kato, Mitsunori; Kaushik, Virendar K.; Kohls, Darcy; Kunjathoor, Vidya; LaSala, Daniel; Lee, Jongchan; Liu, Jing; Luo, Yang; Ma, Fupeng; Mo, Ruowei; Mowbray, Sarah; Mogi, Muneto; Ossola, Flavio; Pandey, Pramod; Patel, Sejal J.; Raghavan, Swetha; Salem, Bahaa; Shanado, Yuka H.; Trakshel, Gary M.; Turner, Gordon; Wakai, Hiromichi; Wang, Chunhua; Weldon, Stephen; Wielicki, Jennifer B.; Xie, Xiaoling; Xu, Lingfei; Yagi, Yukiko I.; Yasoshima, Kayo; Yin, Jianning; Yowe, David; Zhang, Ji-Hu; Monovich, Gang Zheng Lauren (Novartis)

    2016-09-05

    The With-No-Lysine (K) (WNK) kinases play a critical role in blood pressure regulation and body fluid and electrolyte homeostasis. Herein, we introduce the first orally bioavailable pan-WNK-kinase inhibitor, WNK463, that exploits unique structural features of the WNK kinases for both affinity and kinase selectivity. In rodent models of hypertension, WNK463 affects blood pressure and body fluid and electro-lyte homeostasis, consistent with WNK-kinase-associated physiology and pathophysiology.

  2. WNK1 is an unexpected autophagy inhibitor

    Science.gov (United States)

    Gallolu Kankanamalage, Sachith; Lee, A-Young; Wichaidit, Chonlarat; Lorente-Rodriguez, Andres; Shah, Akansha M.; Stippec, Steve; Whitehurst, Angelique W.; Cobb, Melanie H.

    2017-01-01

    ABSTRACT Autophagy is a cellular degradation pathway that is essential to maintain cellular physiology, and deregulation of autophagy leads to multiple diseases in humans. In a recent study, we discovered that the protein kinase WNK1 (WNK lysine deficient protein kinase 1) is an inhibitor of autophagy. The loss of WNK1 increases both basal and starvation-induced autophagy. In addition, the depletion of WNK1 increases the activation of the class III phosphatidylinositol 3-kinase (PtdIns3K) complex, which is required to induce autophagy. Moreover, the loss of WNK1 increases the expression of ULK1 (unc-51 like kinase 1), which is upstream of the PtdIns3K complex. It also increases the pro-autophagic phosphorylation of ULK1 at Ser555 and the activation of AMPK (AMP-activated protein kinase), which is responsible for that phosphorylation. The inhibition of AMPK by compound C decreases the magnitude of autophagy induction following WNK1 loss; however, it does not prevent autophagy induction. We found that the UVRAG (UV radiation resistance associated gene), which is a component of the PtdIns3K, binds to the N-terminal region of WNK1. Moreover, WNK1 partially colocalizes with UVRAG and this colocalization decreases when autophagy is stimulated in cells. The loss of WNK1 also alters the cellular distribution of UVRAG. The depletion of the downstream target of WNK1, OXSR1/OSR1 (oxidative-stress responsive 1) has no effect on autophagy, whereas the depletion of its relative STK39/SPAK (serine/threonine kinase 39) induces autophagy under nutrient-rich and starved conditions. PMID:28282258

  3. SPAK deficiency corrects pseudohypoaldosteronism II caused by WNK4 mutation.

    Directory of Open Access Journals (Sweden)

    Pei-Yi Chu

    Full Text Available Stimulation of the OSR1 (Oxidative stress-responsive kinase-1/SPAK [STE20 (sterile 20/SPS1-related proline/alanine-rich kinase]-NCC (Na(+-Cl(- cotransporter signaling cascade plays an important role in the WNK [With-No-Lysine (K] kinase 4 D561A knock-in mouse model of pseudohypoaldosteronism type II (PHA II characterized by salt-sensitive hypertension and hyperkalemia. The aim of this study was to investigate the respective roles of Osr1 and Spak in the pathogenesis of PHA II in vivo. Wnk4 (D561A/+ mice were crossed with kidney tubule-specific (KSP Osr1 knockout (KSP-Osr1 (-/- and Spak knockout (Spak (-/- mice. Blood pressure, plasma and urine biochemistries, and the relevant protein expression in the kidneys were examined. Wnk4 (D561A/+, KSP-Osr1 (-/-, and Spak (-/- mice recapitulated the phenotypes of PHA II, Bartter-like syndrome, and Gitelman syndrome, respectively. Wnk4 (D561A/+.KSP-Osr1 (-/- remained phenotypically PHA II while Wnk4 (D561A/+.Spak (-/- mice became normotensive and lacked the PHA II phenotype. Phosphorylated Spak and Ncc were similarly increased in both Wnk4 (D561A/+ and Wnk4 (D561A/+.KSP-Osr1 (-/- mice while phosphorylated Ncc normalized in Wnk4 (D561A/+.Spak (-/- mice. Furthermore, Wnk4 (D561A/+.KSP-Osr1 (-/- mice exhibited exaggerated salt excretion in response to thiazide diuretics while Wnk4 (D561A/+.Spak (-/- mice exhibited normal responses. Wnk4(D561A/+.Spak (-/-.KSP-Osr1 (-/- triple mutant mice had low blood pressure and diminished phosphorylated Ncc. Both SPAK and OSR1 are important in the maintenance of blood pressure but activation of SPAK-NCC plays the dominant role in PHA II. SPAK may be a therapeutic target for disorders with salt-sensitive hypertension related to WNK4 activation.

  4. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  5. The Effect of WNK4 on the Na+-Cl- Cotransporter Is Modulated by Intracellular Chloride.

    Science.gov (United States)

    Bazúa-Valenti, Silvana; Chávez-Canales, María; Rojas-Vega, Lorena; González-Rodríguez, Xochiquetzal; Vázquez, Norma; Rodríguez-Gama, Alejandro; Argaiz, Eduardo R; Melo, Zesergio; Plata, Consuelo; Ellison, David H; García-Valdés, Jesús; Hadchouel, Juliette; Gamba, Gerardo

    2015-08-01

    It is widely recognized that the phenotype of familial hyperkalemic hypertension is mainly a consequence of increased activity of the renal Na(+)-Cl(-) cotransporter (NCC) because of altered regulation by with no-lysine-kinase 1 (WNK1) or WNK4. The effect of WNK4 on NCC, however, has been controversial because both inhibition and activation have been reported. It has been recently shown that the long isoform of WNK1 (L-WNK1) is a chloride-sensitive kinase activated by a low Cl(-) concentration. Therefore, we hypothesized that WNK4 effects on NCC could be modulated by intracellular chloride concentration ([Cl(-)]i), and we tested this hypothesis in oocytes injected with NCC cRNA with or without WNK4 cRNA. At baseline in oocytes, [Cl(-)]i was near 50 mM, autophosphorylation of WNK4 was undetectable, and NCC activity was either decreased or unaffected by WNK4. A reduction of [Cl(-)]i, either by low chloride hypotonic stress or coinjection of oocytes with the solute carrier family 26 (anion exchanger)-member 9 (SLC26A9) cRNA, promoted WNK4 autophosphorylation and increased NCC-dependent Na(+) transport in a WNK4-dependent manner. Substitution of the leucine with phenylalanine at residue 322 of WNK4, homologous to the chloride-binding pocket in L-WNK1, converted WNK4 into a constitutively autophosphorylated kinase that activated NCC, even without chloride depletion. Elimination of the catalytic activity (D321A or D321K-K186D) or the autophosphorylation site (S335A) in mutant WNK4-L322F abrogated the positive effect on NCC. These observations suggest that WNK4 can exert differential effects on NCC, depending on the intracellular chloride concentration. Copyright © 2015 by the American Society of Nephrology.

  6. Chloride sensing by WNK1 kinase involves inhibition of autophosphorylation

    Science.gov (United States)

    Piala, Alexander T.; Moon, Thomas M.; Akella, Radha; He, Haixia; Cobb, Melanie H.; Goldsmith, Elizabeth J.

    2014-01-01

    WNK1 [with no lysine (K)] is a serine-threonine kinase associated with a form of familial hypertension. WNK1 is at the top of a kinase cascade leading to phosphorylation of several cotransporters, in particular those transporting sodium, potassium, and chloride (NKCC), sodium and chloride (NCC), and potassium and chloride (KCC). The responsiveness of NKCC, NCC, and KCC to changes in extracellular chloride parallels their phosphorylation state, provoking the proposal that these transporters are controlled by a chloride-sensitive protein kinase. Here, we found that chloride stabilizes the inactive conformation of WNK1, preventing kinase autophosphorylation and activation. Crystallographic studies of inactive WNK1 in the presence of chloride revealed that chloride binds directly to the catalytic site, providing a basis for the unique position of the catalytic lysine. Mutagenesis of the chloride binding site rendered the kinase less sensitive to inhibition of autophosphorylation by chloride, validating the binding site. Thus, these data suggest that WNK1 functions as a chloride sensor through direct binding of a regulatory chloride ion to the active site, which inhibits autophosphorylation. PMID:24803536

  7. A minor role of WNK3 in regulating phosphorylation of renal NKCC2 and NCC co-transporters in vivo

    Directory of Open Access Journals (Sweden)

    Katsuyuki Oi

    2012-02-01

    Mutations in WNK1 and WNK4 kinase genes have been shown to cause a human hereditary hypertensive disease, pseudohypoaldosteronism type II (PHAII. We previously discovered that WNK kinases phosphorylate and activate OSR1/SPAK kinases that regulate renal SLC12A family transporters such as NKCC2 and NCC, and clarified that the constitutive activation of this cascade causes PHAII. WNK3, another member of the WNK kinase family, was reported to be a strong activator of NCC/NKCC2 when assayed in Xenopus oocytes, suggesting that WNK3 also plays a major role in regulating blood pressure and sodium reabsorption in the kidney. However, it remains to be determined whether WNK3 is in fact involved in the regulation of these transporters in vivo. To clarify this issue, we generated and analyzed WNK3 knockout mice. Surprisingly, phosphorylation and expression of OSR1, SPAK, NKCC2 and NCC did not decrease in knockout mouse kidney under normal and low-salt diets. Similarly, expression of epithelial Na channel and Na/H exchanger 3 were not affected in knockout mice. Na+ and K+ excretion in urine in WNK3 knockout mice was not affected under different salt diets. Blood pressure in WNK3 knockout mice was not lower under normal diet. However, lower blood pressure was observed in WNK3 knockout mice fed low-salt diet. WNK4 and WNK1 expression was slightly elevated in the knockout mice under low-salt diet, suggesting compensation for WNK3 knockout by these WNKs. Thus, WNK3 may have some role in the WNK-OSR1/SPAK-NCC/NKCC2 signal cascade in the kidney, but its contribution to total WNK kinase activity may be minimal.

  8. WNK4 is an Adipogenic Factor and Its Deletion Reduces Diet-Induced Obesity in Mice

    Directory of Open Access Journals (Sweden)

    Daiei Takahashi

    2017-04-01

    Full Text Available The with-no-lysine kinase (WNK 4 gene is a causative gene in pseudohypoaldosteronism type II. Although WNKs are widely expressed in the body, neither their metabolic functions nor their extrarenal role is clear. In this study, we found that WNK4 was expressed in mouse adipose tissue and 3T3-L1 adipocytes. In mouse primary preadipocytes and in 3T3-L1 adipocytes, WNK4 was markedly induced in the early phase of adipocyte differentiation. WNK4 expression preceded the expression of key transcriptional factors PPARγ and C/EBPα. WNK4-siRNA-transfected 3T3-L1 cells and human mesenchymal stem cells showed reduced expression of PPARγ and C/EBPα and lipid accumulation. WNK4 protein affected the DNA-binding ability of C/EBPβ and thereby reduced PPARγ expression. In the WNK4−/− mice, PPARγ and C/EBPα expression were decreased in adipose tissues, and the mice exhibited partial resistance to high-fat diet-induced adiposity. These data suggest that WNK4 may be a proadipogenic factor, and offer insights into the relationship between WNKs and energy metabolism.

  9. Unique chloride-sensing properties of WNK4 permit the distal nephron to modulate potassium homeostasis.

    Science.gov (United States)

    Terker, Andrew S; Zhang, Chong; Erspamer, Kayla J; Gamba, Gerardo; Yang, Chao-Ling; Ellison, David H

    2016-01-01

    Dietary potassium deficiency activates thiazide-sensitive sodium chloride cotransport along the distal nephron. This may explain, in part, the hypertension and cardiovascular mortality observed in individuals who consume a low-potassium diet. Recent data suggest that plasma potassium affects the distal nephron directly by influencing intracellular chloride, an inhibitor of the with-no-lysine kinase (WNK)-Ste20p-related proline- and alanine-rich kinase (SPAK) pathway. As previous studies used extreme dietary manipulations, we sought to determine whether the relationship between potassium and NaCl cotransporter (NCC) is physiologically relevant and clarify the mechanisms involved. We report that modest changes in both dietary and plasma potassium affect NCC in vivo. Kinase assay studies showed that chloride inhibits WNK4 kinase activity at lower concentrations than it inhibits activity of WNK1 or WNK3. Also, chloride inhibited WNK4 within the range of distal cell chloride concentration. Mutation of a previously identified WNK chloride-binding motif converted WNK4 effects on SPAK from inhibitory to stimulatory in mammalian cells. Disruption of this motif in WNKs 1, 3, and 4 had different effects on NCC, consistent with the three WNKs having different chloride sensitivities. Thus, potassium effects on NCC are graded within the physiological range, which explains how unique chloride-sensing properties of WNK4 enable it to mediate effects of potassium on NCC in vivo. Copyright © 2015 International Society of Nephrology. Published by Elsevier Inc. All rights reserved.

  10. Impaired degradation of WNK by Akt and PKA phosphorylation of KLHL3.

    Science.gov (United States)

    Yoshizaki, Yuki; Mori, Yutaro; Tsuzaki, Yoshihito; Mori, Takayasu; Nomura, Naohiro; Wakabayashi, Mai; Takahashi, Daiei; Zeniya, Moko; Kikuchi, Eriko; Araki, Yuya; Ando, Fumiaki; Isobe, Kiyoshi; Nishida, Hidenori; Ohta, Akihito; Susa, Koichiro; Inoue, Yuichi; Chiga, Motoko; Rai, Tatemitsu; Sasaki, Sei; Uchida, Shinichi; Sohara, Eisei

    2015-11-13

    Mutations in with-no-lysine kinase (WNK) 1, WNK4, Kelch-like 3 (KLHL3), and Cullin3 result in an inherited hypertensive disease, pseudohypoaldosteronism type II. WNK activates the Na-Cl cotransporter (NCC), increasing sodium reabsorption in the kidney. Further, KLHL3, an adapter protein of Cullin3-based E3 ubiquitin ligase, has been recently found to bind to WNK, thereby degrading them. Insulin and vasopressin have been identified as powerful activators of WNK signaling. In this study, we investigated effects of Akt and PKA, key downstream substrates of insulin and vasopressin signaling, respectively, on KLHL3. Mass spectrometry analysis revealed that KLHL3 phosphorylation at S433. Phospho-specific antibody demonstrated defective binding between phosphorylated KLHL3 and WNK4. Consistent with the fact that S433 is a component of Akt and PKA phosphorylation motifs, in vitro kinase assay demonstrated that Akt and PKA can phosphorylate KLHL3 at S433, that was previously reported to be phosphorylated by PKC. Further, forskolin, a representative PKA stimulator, increased phosphorylation of KLHL3 at S433 and WNK4 protein expression in HEK293 cells by inhibiting the KLHL3 effect that leads to WNK4 degradation. Insulin also increased phosphorylation of KLHL3 at S433 in cultured cells. In conclusion, we found that Akt and PKA phosphorylated KLHL3 at S433, and phosphorylation of KLHL3 by PKA inhibited WNK4 degradation. This could be a novel mechanism on how insulin and vasopressin physiologically activate the WNK signal. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. Optimization of Allosteric With-No-Lysine (WNK) Kinase Inhibitors and Efficacy in Rodent Hypertension Models

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Ken; Levell, Julian; Yoon, Taeyong; Kohls, Darcy; Yowe, David; Rigel, Dean F.; Imase, Hidetomo; Yuan, Jun; Yasoshima, Kayo; DiPetrillo, Keith; Monovich, Lauren; Xu, Lingfei; Zhu, Meicheng; Kato, Mitsunori; Jain, Monish; Idamakanti, Neeraja; Taslimi, Paul; Kawanami, Toshio; Argikar, Upendra A.; Kunjathoor, Vidya; Xie, Xiaoling; Yagi, Yukiko I.; Iwaki, Yuki; Robinson, Zachary; Park, Hyi-Man (Novartis)

    2017-08-03

    The observed structure–activity relationship of three distinct ATP noncompetitive With-No-Lysine (WNK) kinase inhibitor series, together with a crystal structure of a previously disclosed allosteric inhibitor bound to WNK1, led to an overlay hypothesis defining core and side-chain relationships across the different series. This in turn enabled an efficient optimization through scaffold morphing, resulting in compounds with a good balance of selectivity, cellular potency, and pharmacokinetic profile, which were suitable for in vivo proof-of-concept studies. When dosed orally, the optimized compound reduced blood pressure in mice overexpressing human WNK1, and induced diuresis, natriuresis and kaliuresis in spontaneously hypertensive rats (SHR), confirming that this mechanism of inhibition of WNK kinase activity is effective at regulating cardiovascular homeostasis.

  12. Protocol for evaluating Epigenetic modulation of the renal β-adrenergic-WNK4 pathway in salt-sensitive hypertension

    OpenAIRE

    sprotocols

    2015-01-01

    Authors: ShengYu Mu, Tatsuo Shimosawa & Toshiro Fujita ### Abstract In the current study, we found that β2 adrenergic receptor (β2AR) stimulation induced histone acetylation through HDAC8 inhibition, and then decreased transcription of the WNK4 gene by enhancing the binding of glucocorticoid receptor (GR) and negative-GR-responsive-element (nGRE) in WNK4 promoter region. Infusion of isoproterenol decreased WNK4 expression and activated the Na+-Cl- co-transporter in mice, which develop...

  13. WNK1 and p38-MAPK distribution in ionocytes and accessory cells of euryhaline teleost fish implies ionoregulatory function

    Directory of Open Access Journals (Sweden)

    W. S. Marshall

    2017-07-01

    Full Text Available Ionocytes of euryhaline teleost fish secrete NaCl, under regulation by serine and threonine kinases, including with-no-lysine kinase (WNK1 and p38 mitogen-activated protein kinase (MAPK. Mummichogs (Fundulus heteroclitus L. were acclimated to freshwater (FW, full strength seawater (SW and hypersaline conditions (2SW. Immunocytochemistry of ionocytes in opercular epithelia of fish acclimated to SW and 2SW revealed that WNK1-anti-pT58 phosphoantibody localized strongly to accessory cells and was present in the cytosol of ionocytes, close to cystic fibrosis transmembrane conductance regulator (CFTR in the apical membrane and the sodium potassium 2 chloride cotransporter (NKCC in the basolateral membrane. In FW acclimated fish, WNK1 localized to a sub-apical zone, did not colocalize with apical membrane-located sodium chloride cotransporter (NCC, and typically was present in one cell of paired ionocytes and in some single ionocytes. Forskolin treatment (10 μM, 30 min increased WNK1 immunofluorescence in SW ionocytes only, while hypertonicity had little effect, compared to controls. Anti-p38-MAPK antibody localized to the cytosolic compartment. The distribution of WNK1 and p38MAPK is consistent with a proximal position in regulatory cascades, rather than directly affecting transporters. The strong staining of accessory cells by WNK1 phosphoantibody infers an osmoregulatory function for WNK.

  14. Polymorphisms in the WNK1 gene are associated with blood pressure variation and urinary potassium excretion.

    Directory of Open Access Journals (Sweden)

    Stephen Newhouse

    Full Text Available WNK1--a serine/threonine kinase involved in electrolyte homeostasis and blood pressure (BP control--is an excellent candidate gene for essential hypertension (EH. We and others have previously reported association between WNK1 and BP variation. Using tag SNPs (tSNPs that capture 100% of common WNK1 variation in HapMap, we aimed to replicate our findings with BP and to test for association with phenotypes relating to WNK1 function in the British Genetics of Hypertension (BRIGHT study case-control resource (1700 hypertensive cases and 1700 normotensive controls. We found multiple variants to be associated with systolic blood pressure, SBP (7/28 tSNPs min-p = 0.0005, diastolic blood pressure, DBP (7/28 tSNPs min-p = 0.002 and 24 hour urinary potassium excretion (10/28 tSNPs min-p = 0.0004. Associations with SBP and urine potassium remained significant after correction for multiple testing (p = 0.02 and p = 0.01 respectively. The major allele (A of rs765250, located in intron 1, demonstrated the strongest evidence for association with SBP, effect size 3.14 mmHg (95%CI:1.23-4.9, DBP 1.9 mmHg (95%CI:0.7-3.2 and hypertension, odds ratio (OR: 1.3 [95%CI: 1.0-1.7].We genotyped this variant in six independent populations (n = 14,451 and replicated the association between rs765250 and SBP in a meta-analysis (p = 7 x 10(-3, combined with BRIGHT data-set p = 2 x 10(-4, n = 17,851. The associations of WNK1 with DBP and EH were not confirmed. Haplotype analysis revealed striking associations with hypertension and BP variation (global permutation p10 mmHg reduction and risk for hypertension (OR<0.60. Our data indicates that multiple rare and common WNK1 variants contribute to BP variation and hypertension, and provide compelling evidence to initiate further genetic and functional studies to explore the role of WNK1 in BP regulation and EH.

  15. Mutations in the nervous system--specific HSN2 exon of WNK1 cause hereditary sensory neuropathy type II.

    Science.gov (United States)

    Shekarabi, Masoud; Girard, Nathalie; Rivière, Jean-Baptiste; Dion, Patrick; Houle, Martin; Toulouse, André; Lafrenière, Ronald G; Vercauteren, Freya; Hince, Pascale; Laganiere, Janet; Rochefort, Daniel; Faivre, Laurence; Samuels, Mark; Rouleau, Guy A

    2008-07-01

    Hereditary sensory and autonomic neuropathy type II (HSANII) is an early-onset autosomal recessive disorder characterized by loss of perception to pain, touch, and heat due to a loss of peripheral sensory nerves. Mutations in hereditary sensory neuropathy type II (HSN2), a single-exon ORF originally identified in affected families in Quebec and Newfoundland, Canada, were found to cause HSANII. We report here that HSN2 is a nervous system-specific exon of the with-no-lysine(K)-1 (WNK1) gene. WNK1 mutations have previously been reported to cause pseudohypoaldosteronism type II but have not been studied in the nervous system. Given the high degree of conservation of WNK1 between mice and humans, we characterized the structure and expression patterns of this isoform in mice. Immunodetections indicated that this Wnk1/Hsn2 isoform was expressed in sensory components of the peripheral nervous system and CNS associated with relaying sensory and nociceptive signals, including satellite cells, Schwann cells, and sensory neurons. We also demonstrate that the novel protein product of Wnk1/Hsn2 was more abundant in sensory neurons than motor neurons. The characteristics of WNK1/HSN2 point to a possible role for this gene in the peripheral sensory perception deficits characterizing HSANII.

  16. Mutations in the nervous system–specific HSN2 exon of WNK1 cause hereditary sensory neuropathy type II

    Science.gov (United States)

    Shekarabi, Masoud; Girard, Nathalie; Rivière, Jean-Baptiste; Dion, Patrick; Houle, Martin; Toulouse, André; Lafrenière, Ronald G.; Vercauteren, Freya; Hince, Pascale; Laganiere, Janet; Rochefort, Daniel; Faivre, Laurence; Samuels, Mark; Rouleau, Guy A.

    2008-01-01

    Hereditary sensory and autonomic neuropathy type II (HSANII) is an early-onset autosomal recessive disorder characterized by loss of perception to pain, touch, and heat due to a loss of peripheral sensory nerves. Mutations in hereditary sensory neuropathy type II (HSN2), a single-exon ORF originally identified in affected families in Quebec and Newfoundland, Canada, were found to cause HSANII. We report here that HSN2 is a nervous system–specific exon of the with-no-lysine(K)–1 (WNK1) gene. WNK1 mutations have previously been reported to cause pseudohypoaldosteronism type II but have not been studied in the nervous system. Given the high degree of conservation of WNK1 between mice and humans, we characterized the structure and expression patterns of this isoform in mice. Immunodetections indicated that this Wnk1/Hsn2 isoform was expressed in sensory components of the peripheral nervous system and CNS associated with relaying sensory and nociceptive signals, including satellite cells, Schwann cells, and sensory neurons. We also demonstrate that the novel protein product of Wnk1/Hsn2 was more abundant in sensory neurons than motor neurons. The characteristics of WNK1/HSN2 point to a possible role for this gene in the peripheral sensory perception deficits characterizing HSANII. PMID:18521183

  17. Novel Association of WNK4 Gene, Ala589Ser Polymorphism in Essential Hypertension, and Type 2 Diabetes Mellitus in Malaysia

    Directory of Open Access Journals (Sweden)

    Nooshin Ghodsian

    2016-01-01

    Full Text Available With-no-lysine (K Kinase-4 (WNK4 consisted of unique serine and threonine protein kinases, genetically associated with an autosomal dominant form of hypertension. Argumentative consequences have lately arisen on the association of specific single nucleotide polymorphisms of WNK4 gene and essential hypertension (EHT. The aim of this study was to determine the association of Ala589Ser polymorphism of WNK4 gene with essential hypertensive patients in Malaysia. WNK4 gene polymorphism was specified utilizing mutagenically separated polymerase chain reaction (PCR and restriction fragment length polymorphism (RFLP method in 320 subjects including 163 cases and 157 controls. Close relation between Ala589Ser polymorphism and elevated systolic and diastolic blood pressure (SBP and DBP was recognized. Sociodemographic factors including body mass index (BMI, age, the level of fasting blood sugar (FBS, low density lipoprotein (LDL, and triglyceride (TG in the cases and healthy subjects exhibited strong differences (p<0.05. The distribution of allele frequency and genotype of WNK4 gene Ala589Ser polymorphism showed significant differences (p<0.05 between EHT subjects with or without type 2 diabetes mellitus (T2DM and normotensive subjects, statistically. The WNK4 gene variation influences significantly blood pressure increase. Ala589Ser probably has effects on the enzymic activity leading to enhanced predisposition to the disorder.

  18. Extracting the Data From the LCM vk4 Formatted Output File

    Energy Technology Data Exchange (ETDEWEB)

    Wendelberger, James G. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2018-01-29

    These are slides about extracting the data from the LCM vk4 formatted output file. The following is covered: vk4 file produced by Keyence VK Software, custom analysis, no off the shelf way to read the file, reading the binary data in a vk4 file, various offsets in decimal lines, finding the height image data, directly in MATLAB, binary output beginning of height image data, color image information, color image binary data, color image decimal and binary data, MATLAB code to read vk4 file (choose a file, read the file, compute offsets, read optical image, laser optical image, read and compute laser intensity image, read height image, timing, display height image, display laser intensity image, display RGB laser optical images, display RGB optical images, display beginning data and save images to workspace, gamma correction subroutine), reading intensity form the vk4 file, linear in the low range, linear in the high range, gamma correction for vk4 files, computing the gamma intensity correction, observations.

  19. Two novel kinetic techniques for determining relative V/K values for alternate substrates

    International Nuclear Information System (INIS)

    Anderson, V.; Kannan, B.

    1986-01-01

    The equilibrium perturbation method of determining kinetic isotope effects has been extended to permit the accurate measurement of relative V/K values for alternate substrates. In the Enoyl-CoA hydratase reaction at pH 8.0 the V/K for trans-2-pentenoyl-CoA (5:1(2t)-CoA) less than 10% greater than V/K for crotonyl-CoA while at pH 4.6 V/K for 5:1(2t)-CoA is over twice the V/K for crotonyl-CoA. This change in the ratio of V/K values indicates that there must be a pKa in the V/K pH profile for 5:1(2t)-CoA that is not characteristic of the free enzyme, a simple interpretation being 5:1(2t)-CoA is a sticky substrate. The pseudoequilibrium perturbation method is inaccurate when the ratio of V/K values exceeds 3. A companion pseudoequilibrium method is introduced where the initial conditions are constrained to produce an initial velocity of zero, rather than requiring the initial and final concentrations of the chromophoric substrate to be identical. The ratio of V/K values is simply the ratio of the concentration of the perturbant molecule to the equilibrium concentration of the nonperturbing analogue. This method combines the advantages of both the equilibrium perturbation method and of initial steady state measurements. The kinetic mechanism of L-3-hydroxyacyl-CoA dehydrogenase, an enzyme whose severe substrate inhibition and small primary 2 H isotope effect have made routine kinetic studies impractical, has been investigated by this method

  20. The V-K colours of the nuclei of bright galaxies

    Science.gov (United States)

    Penston, M. V.

    1973-01-01

    Photometric observations of the nuclei of the galaxies M32, M33, M51, NGC5195 and M101 are reported. These give U-B, B-V, H-K and V-K colours for each object and the K-L colour for M32. No short-wavelength infra-red excesses are found. For M32, published population models (Spinrad & Taylor) predict a V-K colour too red to be compatible with the observations.

  1. Snit af målinger: VK afhængig af DF og NA

    DEFF Research Database (Denmark)

    Thomsen, Søren Risbjerg

    2007-01-01

    ANALYSE: Ekstra Risbjerg-snit af meningsmålinger grundet fortsat valgrummel - VK-regeringen vil blive afhængig af både DF og NA. Udgivelsesdato: 21. august 2007......ANALYSE: Ekstra Risbjerg-snit af meningsmålinger grundet fortsat valgrummel - VK-regeringen vil blive afhængig af både DF og NA. Udgivelsesdato: 21. august 2007...

  2. Neuroprotection of brain-permeable iron chelator VK-28 against intracerebral hemorrhage in mice.

    Science.gov (United States)

    Li, Qian; Wan, Jieru; Lan, Xi; Han, Xiaoning; Wang, Zhongyu; Wang, Jian

    2017-09-01

    Iron overload plays a key role in the secondary brain damage that develops after intracerebral hemorrhage (ICH). The significant increase in iron deposition is associated with the generation of reactive oxygen species (ROS), which leads to oxidative brain damage. In this study, we examined the protective effects of VK-28, a brain-permeable iron chelator, against hemoglobin toxicity in an ex vivo organotypic hippocampal slice culture (OHSC) model and in middle-aged mice subjected to an in vivo, collagenase-induced ICH model. We found that the effects of VK-28 were similar to those of deferoxamine (DFX), a well-studied iron chelator. Both decreased cell death and ROS production in OHSCs and in vivo, decreased iron-deposition and microglial activation around hematoma in vivo, and improved neurologic function. Moreover, compared with DFX, VK-28 polarized microglia to an M2-like phenotype, reduced brain water content, deceased white matter injury, improved neurobehavioral performance, and reduced overall death rate after ICH. The protection of VK-28 was confirmed in a blood-injection ICH model and in aged-male and young female mice. Our findings indicate that VK-28 is protective against iron toxicity after ICH and that, at the dosage tested, it has better efficacy and less toxicity than DFX does.

  3. Novel SNPs of WNK1 and AKR1C3 are associated with preeclampsia.

    Science.gov (United States)

    Sun, Cheng-Juan; Li, Lin; Li, Xueyan; Zhang, Wei-Yuan; Liu, Xiao-Wei

    2018-08-20

    Preeclampsia is a hypertensive disorder of pregnancy and is one of the most common causes of poor perinatal outcomes. Preeclampsia increases the risk of hypertension in the future. Variants of WNK1 (lysine deficient protein kinase 1), ADRB2 (β2 adrenergic receptor), NEDD4L (ubiquitin-protein ligase NEDD4-like), KLK1 (kallikrein 1) contribute to hypertension, and AKR1C3 (aldo-keto reductase family1 member C3), is associated with preeclampsia. The association of single nucleotide polymorphisms (SNPs) in these five candidate preeclampsia susceptibility genes and the related traits in Chinese individuals were investigated. In this study, 13 SNPs of the five genes were genotyped in 276 preeclampsia patients and 229 age- and area-matched normal pregnancies in women of Chinese Northern Han origin. The 95% confidence interval (CI) and odds ratio (OR) were estimated by binary logistic regression. No obvious linkage disequilibrium or haplotypes were observed among these SNPs. Those with GG genotype and allele G of AKR1C3 (rs10508293) had a decreased risk of preeclampsia (adjusted OR = 3.011, 95% CI = 1.758-5.159, and adjusted OR = 1.745, 95% CI = 1.349-2.257, respectively). The AA genotype and allele A of WNK1 (rs1468326) were significantly associated with an increased risk in preeclampsia (adjusted OR = 2.307, 95% CI = 1.206-3.443, and adjusted OR = 1.663, 95% CI = 1.283-2.157, respectively). The findings indicate that the GG genotype of AKR1C3 rs10508293 is associated with decreased risk for preeclampsia and the AA genotype of WNK1 rs1468326 are related with an increased risk for preeclampsia. Copyright © 2018 Elsevier B.V. All rights reserved.

  4. Disruption of AtWNK8 Enhances Tolerance of Arabidopsis to Salt and Osmotic Stresses via Modulating Proline Content and Activities of Catalase and Peroxidase

    Directory of Open Access Journals (Sweden)

    Hong Liao

    2013-03-01

    Full Text Available With no lysine kinases (WNKs play important roles in plant growth and development. However, its role in salt and osmotic stress tolerance is unclear. Here, we report that AtWNK8 is mainly expressed in primary root, hypocotyl, stamen and pistil and is induced by NaCl and sorbitol treatment. Compared to the wild-type, the T-DNA knock-out wnk8 mutant was more tolerant to severe salinity and osmotic stresses, as indicated by 27% and 198% more fresh weight in the NaCl and sorbitol treatment, respectively. The wnk8 mutant also accumulated 1.43-fold more proline than the wild-type in the sorbitol treatment. Under NaCl and sorbitol stresses, catalase (CAT activity in wnk8 mutant was 1.92- and 3.7-times of that in Col-0, respectively. Similarly, under salt and osmotic stress conditions, peroxidase (POD activities in wnk8 mutant were 1.81- and 1.58-times of that in Col-0, respectively. Taken together, we revealed that maintaining higher CAT and POD activities might be one of the reasons that the disruption of AtWNK8 enhances the tolerance to salt stress, and accumulating more proline and higher activities of CAT and POD might result in the higher tolerance of WNK8 to osmotic stress.

  5. WNK1/HSN2 mutation in human peripheral neuropathy deregulates KCC2 expression and posterior lateral line development in zebrafish (Danio rerio.

    Directory of Open Access Journals (Sweden)

    Valérie Bercier

    Full Text Available Hereditary sensory and autonomic neuropathy type 2 (HSNAII is a rare pathology characterized by an early onset of severe sensory loss (all modalities in the distal limbs. It is due to autosomal recessive mutations confined to exon "HSN2" of the WNK1 (with-no-lysine protein kinase 1 serine-threonine kinase. While this kinase is well studied in the kidneys, little is known about its role in the nervous system. We hypothesized that the truncating mutations present in the neural-specific HSN2 exon lead to a loss-of-function of the WNK1 kinase, impairing development of the peripheral sensory system. To investigate the mechanisms by which the loss of WNK1/HSN2 isoform function causes HSANII, we used the embryonic zebrafish model and observed strong expression of WNK1/HSN2 in neuromasts of the peripheral lateral line (PLL system by immunohistochemistry. Knocking down wnk1/hsn2 in embryos using antisense morpholino oligonucleotides led to improper PLL development. We then investigated the reported interaction between the WNK1 kinase and neuronal potassium chloride cotransporter KCC2, as this transporter is a target of WNK1 phosphorylation. In situ hybridization revealed kcc2 expression in mature neuromasts of the PLL and semi-quantitative RT-PCR of wnk1/hsn2 knockdown embryos showed an increased expression of kcc2 mRNA. Furthermore, overexpression of human KCC2 mRNA in embryos replicated the wnk1/hsn2 knockdown phenotype. We validated these results by obtaining double knockdown embryos, both for wnk1/hsn2 and kcc2, which alleviated the PLL defects. Interestingly, overexpression of inactive mutant KCC2-C568A, which does not extrude ions, allowed a phenocopy of the PLL defects. These results suggest a pathway in which WNK1/HSN2 interacts with KCC2, producing a novel regulation of its transcription independent of KCC2's activation, where a loss-of-function mutation in WNK1 induces an overexpression of KCC2 and hinders proper peripheral sensory nerve

  6. A nuclear desalination complex with a VK-300 boiling type reactor facility

    International Nuclear Information System (INIS)

    Kuznetzov, Y.N.; Mishanina, Y.A.; Romenkov, A.A.

    2004-01-01

    RDIPE has developed a detailed design of an enhanced safety nuclear steam supply system (NSSS) with a VK-300 boiling water reactor for combined heat and power generation. The thermal power of the reactor is 750 MW. The maximum electrical power in the condensation mode is 250 MWe. The maximum heat generation capacity of 400 Gcal/h is reached at 150 MWe. This report describes, in brief, the basic technical concepts for the VK-300 NSSS and the power unit, with an emphasis on enhanced safety and good economic performance. With relatively small power, good technical and economic performance of the VK-300 reactor that is a base for the desalination complex is attained through: reduced capital costs of the nuclear plant construction thanks to technical approaches ensuring maximum simplicity of the reactor design and the NSSS layout; a single-circuit power unit configuration (reactor-turbine) excluding expensive equipment with a lot of metal, less pipelines and valves; reduced construction costs of the basic buildings thanks to reduced construction volumes due to rational arrangement concepts; higher reliability of equipment and reduced maintenance and repair costs; longer reactor design service life of up to 60 years; selection of the best reactor and desalination equipment interface pattern. The report considers the potential application of the VK-300 reactor as a source of energy for distillation desalination units. The heat from the reactor is transferred to the desalination unit via an intermediate circuit. Comparison is made between variants of the reactor integration with desalination units of the following types: multi-stage flash (MSF technology); multi-effect distillation horizontal-tube film units of the DOU GTPA type (MED technology). The NDC capacity with the VK-300 reactor, in terms of distillate, will be more than 200,000 m 3 /day, with the simultaneous output of electric power from the turbine generator buses of around 150 MWe. The variants of the

  7. Pathogenesis of spinal cord injury induced edema and neuropathic pain: expression of multiple isoforms of wnk1.

    Science.gov (United States)

    Ahmed, Mostafa M; Lee, HyunKyung; Clark, Zach; Miranpuri, Gurwattan S; Nacht, Carrie; Patel, Kush; Liu, Lisa; Joslin, Jiliian; Kintner, Douglus; Resnick, Daniel K

    2014-07-01

    Neuropathic pain (NP) is a common occurrence following spinal cord injury (SCI). Identification of specific molecular pathways that are involved in pain syndromes has become a major priority in current SCI research. We have investigated the role of a cation-dependent chloride transporter, Cl-regulatory protein Na(+)-K(+)-Cl(-) 1 (NKCC1), phosphorylation profile of NKCC1 and its specific involvement in neuropathic pain following contusion SCI (cSCI) using a rat model. Administration of the NKCC1 inhibitor bumetanide (BU) increases the mean hindpaw withdrawal latency time (WLT), thermal hyperalgesia (TH) following cSCI. These results demonstrate implication of NKCC1 co-transporter and BUin SCI-induced neuropathic pain. The with-no-lysine (K)-1 (WNK1) kinase has been shown to be an important regulator of NKCC1 phosphorylation in many systems, including nocioception. Mutations in a neuronal-specific exon of WNK1 (HSN2) was identified in patients that have hereditary sensory neuropathy type II (HSANII) also implicates WNK1 in nocioception, such that these patients have loss of perception to pain, touch and heat. In our ongoing research we proposed two studies utilizing our contusion SCI (cSCI) NP model of rat. Study 1 aimed at NKCC1 expression and activity is up-regulated following cSCI in the early edema and chronic neuropathic pain phases. Study 2 aimed at identifying the expression profile of alternatively spliced WNK1 isoforms in animals exhibiting thermal hyperalgesia (TH) following cSCI. Adult male Sprague Dawley rats (275-300 g) following laminectomy received cSCI at T9 with the NYU impactor-device II by dropping 10 g weight from the height of 12.5 mm. Control rats obtained laminectomy but no impaction. Following injury, functional recovery was assessed by BBB locomotor scores on day 1, 7, 14, 21, 35, and 42 and development of thermal hyperalgesia on day 21, 28, 35, and 42 day of injury by monitoring hind paw withdraw latency time (WLT) in seconds compared with

  8. Infrared observations of giant elliptical galaxies: (V-K) colors and the infrared Hubble diagram

    International Nuclear Information System (INIS)

    Grasdalen, G.L.

    1980-01-01

    The (V-K) colors of giant elliptical galaxies as a function of redshift are discussed. Present data are consistent with mild color evolution at z approximately 0.45. An infrared Hubble (redshift-magnitude) diagram is given. Cosmological models with q 0 =0 and no luminosity evolution are clearly excluded by the present data. A wide variety of models including those with q 0 =0 are permissible if luminosity evolution is included. Instrumental and programmatic implications of these results are summarized. (Auth.)

  9. Taurine Inhibits K+-Cl− Cotransporter KCC2 to Regulate Embryonic Cl− Homeostasis via With-no-lysine (WNK) Protein Kinase Signaling Pathway*

    Science.gov (United States)

    Inoue, Koichi; Furukawa, Tomonori; Kumada, Tatsuro; Yamada, Junko; Wang, Tianying; Inoue, Rieko; Fukuda, Atsuo

    2012-01-01

    GABA inhibits mature neurons and conversely excites immature neurons due to lower K+-Cl− cotransporter 2 (KCC2) expression. We observed that ectopically expressed KCC2 in embryonic cerebral cortices was not active; however, KCC2 functioned in newborns. In vitro studies revealed that taurine increased KCC2 inactivation in a phosphorylation-dependent manner. When Thr-906 and Thr-1007 residues in KCC2 were substituted with Ala (KCC2T906A/T1007A), KCC2 activity was facilitated, and the inhibitory effect of taurine was not observed. Exogenous taurine activated the with-no-lysine protein kinase 1 (WNK1) and downstream STE20/SPS1-related proline/alanine-rich kinase (SPAK)/oxidative stress response 1 (OSR1), and overexpression of active WNK1 resulted in KCC2 inhibition in the absence of taurine. Phosphorylation of SPAK was consistently higher in embryonic brains compared with that of neonatal brains and down-regulated by a taurine transporter inhibitor in vivo. Furthermore, cerebral radial migration was perturbed by a taurine-insensitive form of KCC2, KCC2T906A/T1007A, which may be regulated by WNK-SPAK/OSR1 signaling. Thus, taurine and WNK-SPAK/OSR1 signaling may contribute to embryonic neuronal Cl− homeostasis, which is required for normal brain development. PMID:22544747

  10. Changes in phase composition and stress state of surface layers of VK20 hard alloy after ion bombardment

    International Nuclear Information System (INIS)

    Platonov, G.L.; Leonov, E.Yu.; Anikin, V.N.; Anikeev, A.I.

    1988-01-01

    Titanium ion bombardment of the surface of the hard VK20 alloy is studied for its effect on variations in the phase and chemical composition of its surface layers. It is stated that ion treatment results in the appearance of the η-phase of Co 6 W 6 C composition in the surface layer of the VK20 alloy, in the increase of distortions and decrease of coherent scattering blocks of the hard alloy carbide phase. Such a bombardment is found to provoke a transition of the plane-stressed state of the hard alloy surface into the volume-stressed state. It is established that ion treatment does not cause an allotropic transition of the cobalt phase α-modification, formed during grinding of the hard alloy, into the β-modification

  11. The Results of Feasibility Study of Co-generation NPP With Innovative VK-300 Simplified Boiling Water Reactor

    International Nuclear Information System (INIS)

    Kuznetsov, Yury N.

    2006-01-01

    The co-generation nuclear power plant (CNPP) producing electricity and district heating heat is planned to be constructed in Archangelsk Region of Russia. Following the 'Letter of Intent' signed by Governor of Archangelsk region and by Minister of the Russian Federation for atomic energy the feasibility study of the Project has been done. The NPP will be based on the four co-generation nuclear power units with the Russian VK-300 SBWR. The innovative passive VK-300 reactor facility has been designed on the basis of well-established nuclear technologies, proven major components, the operating experience of the prototype VK-50 reactor in RIAR, Dimitrovgrad, and the experience in designing such reactors as SBWR (GE) and SWR-1000 (Siemens). The CNPP's total power is planned to be 1000 MW(e) and district-heating heat production capacity 1600 Gcal/h. A detailed description of the results of the feasibility study is presented in the report. The results of the feasibility study have shown that the Archangelsk CGNP is feasible in terms of engineering, economics and production. (authors)

  12. The results of feasibility study of co-generation NPP with innovative VK-300 simplified boiling water reactor

    International Nuclear Information System (INIS)

    Kuznetsov, Yu. N.; Gabaraev, B. A.

    2004-01-01

    The co-generation nuclear power plant (CNPP) producing electricity and district-heating heat is planned to be constructed in Archangelsk Region of Russia. Following the Letter of Intent signed by Governor of Archangelsk region and by Minister of the Russian Federation for atomic energy the feasibility study of the Project has been done. The NPP will be based on the four co-generation nuclear power units with the Russian VK-300 SBWR. The innovative passive VK-300 reactor facility has been designed on the basis of well-established nuclear technologies, proven major components, the operating experience of the prototype VK-50 reactor in RIAR, Dimitrovgrad, and the experience in designing such reactors as SBWR (GE) and SWR-1000 (Siemens). The CNPP's total power is planned to be 1000 MW(e) and district-heating heat production capacity 1600 Gcal /h. A detailed description of the results of the feasibility study is presented in the report. The results of the feasibility study have shown that the Archangelsk CGNP is feasible in terms of engineering, economics and production.(author)

  13. Investigation of two-phase flow structure in model of draught pipe of water boiling reactor VK-300

    International Nuclear Information System (INIS)

    Efanov, A.D.; Kuznetzov, Y.N.; Kaliakin, S.G.; Lisitza, F.D.; Remizov, O.V.; Serdun, N.P.

    2001-01-01

    VK-300 reactor represents a vessel-type boiling reactor with integral arrangement of assemblies and in-vessel steam separation at one-circuit scheme. The circuit consists of core, draught pipes, and separation facilities. The vessel of VK-300 reactor is chosen on the base of the dimensions of that of VVER-1000 reactor. The following thermal-hydraulic parameters of nuclear power plant (NPP) were investigated experimentally: dependence of void fraction upon the steam quality in mixing chamber (on the draught section input); pressure losses at different, specific zones of up-flow and down-flow sections of the circuit with free circulation; degree of steam separation in the separating chamber (at the first step of phase separation) and its dependence upon steam quality; structure of steam-water flow in draught pipes (distribution of phases over the draught pipe cross- section); presence of steam hovering and height of this hovering in inter-pipe space of draught section. (author)

  14. Hydrodynamic study of the adiabatic two-phase flow in the draught region of the VK-50 reactor

    International Nuclear Information System (INIS)

    Solodkij, V.A.; Bartolomej, G.G.; Fedulin, V.N.; Kharitonov, Yu.V.; Shmelev, V.E.; Abasov, A.V.

    1981-01-01

    Aimed at obtaining the spatial distribution of steam content PHI in the draught region (2.7 m high, equivalent diameter of 2 m) of the VK-50 experimental power boiling water reactor the local PHI values have been measured by electroprobing. The experiments were performed in a wide range of operating parameters (1.2-6.5 MPa and 10-180 MW (th)). Characteristic probe signal oscillograms and the axial and radial PHI distributions are presented. The local PHI values have occurred to oscillate in time, that proves structural inhomogeneity of the steemwater flow related to large scale turbulent pulsations. The effect is most prominent at low reactor pressures and powers. The effect of migration of the steam phase generated by peripheral fuel assemblies to the central part of the draught region has been observed up to the height of 0.8 m from the core outlet [ru

  15. VK-phantom male with 583 structures and female with 459 structures, based on the sectioned images of a male and a female, for computational dosimetry.

    Science.gov (United States)

    Park, Jin Seo; Jung, Yong Wook; Choi, Hyung-Do; Lee, Ae-Kyoung

    2018-04-05

    The anatomical structures in most phantoms are classified according to tissue properties rather than according to their detailed structures, because the tissue properties, not the detailed structures, are what is considered important. However, if a phantom does not have detailed structures, the phantom will be unreliable because different tissues can be regarded as the same. Thus, we produced the Visible Korean (VK) -phantoms with detailed structures (male, 583 structures; female, 459 structures) based on segmented images of the whole male body (interval, 1.0 mm; pixel size, 1.0 mm2) and the whole female body (interval, 1.0 mm; pixel size, 1.0 mm2), using house-developed software to analyze the text string and voxel information for each of the structures. The density of each structure in the VK-phantom was calculated based on Virtual Population and a publication of the International Commission on Radiological Protection. In the future, we will standardize the size of each structure in the VK-phantoms. If the VK-phantoms are standardized and the mass density of each structure is precisely known, researchers will be able to measure the exact absorption rate of electromagnetic radiation in specific organs and tissues of the whole body.

  16. Spectrofluorimetric study on the inclusion interaction between vitamin K3 with p-(p-sulfonated benzeneazo)calix[6]arene and determination of VK3.

    Science.gov (United States)

    Zhou, Yunyou; Xu, Hongwei; Wu, Lian; Liu, Chun; Lu, Qin; Wang, Lun

    2008-11-15

    The characteristics of host-guest complexation between p-(p-sulfonated benzeneazo) calix[6]arene (SBC6A) and vitamin K3 (VK3) were investigated by fluorescence spectrometry. A 1:1 stoichiometry for the complexation was established and was verified by Job's plot. An association constant of 4.95 x 10(3)L mol(-1) at 20 degrees C was calculated by applying a deduced equation. The interaction mechanism of the inclusion complex was discussed. It was found that the fluorescence of SBC6A could be remarkably quenched by an appropriate amount of VK3 especially when non-ionic surfactant Triton X-100 existed. According to the obtained results, a novel sensitive spectrofluorimetric method for the determination of VK3 based on supramolecular complex was developed with a linear range of 5.0 x 10(-7) -3.0 x 10(-5)mol L(-1) and a detection limit of 2.0 x 10(-7)mol L(-1). The proposed method was used to determine VK3 in commercial preparations with satisfactory results.

  17. Spectrofluorimetric study on the inclusion interaction between vitamin K 3 with p-( p-sulfonated benzeneazo)calix[6]arene and determination of VK 3

    Science.gov (United States)

    Zhou, Yunyou; Xu, Hongwei; Wu, Lian; Liu, Chun; Lu, Qin; Wang, Lun

    2008-11-01

    The characteristics of host-guest complexation between p-( p-sulfonated benzeneazo) calix[6]arene (SBC6A) and vitamin K 3 (VK 3) were investigated by fluorescence spectrometry. A 1:1 stoichiometry for the complexation was established and was verified by Job's plot. An association constant of 4.95 × 10 3 L mol -1 at 20 °C was calculated by applying a deduced equation. The interaction mechanism of the inclusion complex was discussed. It was found that the fluorescence of SBC6A could be remarkably quenched by an appropriate amount of VK 3 especially when non-ionic surfactant Triton X-100 existed. According to the obtained results, a novel sensitive spectrofluorimetric method for the determination of VK 3 based on supramolecular complex was developed with a linear range of 5.0 × 10 -7-3.0 × 10 -5 mol L -1 and a detection limit of 2.0 × 10 -7 mol L -1. The proposed method was used to determine VK 3 in commercial preparations with satisfactory results.

  18. Experimental study on hydrodynamics of the up-draught part of the VK-50 boiling water reactor

    International Nuclear Information System (INIS)

    Fedulin, V.N.; Shmelev, V.E.; Solodkij, V.A.; Kharitonov, Yu.V.

    1982-01-01

    The investigation results on steam content distribution in the volume of the up-draught part of the VK 50 reactor on the basis of the electrical sounding method are presented. The operating conditions of the up-draught part of a large diameter and limited height is characterized by hydrodynamic non-uniformity of distribution of steam content field over its volume. In the up-draught part of the reactor owing to its limited height hydrodynamic flow stabilization over the section is not attained. The higher void fraction in the central region of the up-draught part (owing to higher energy release in the centre of the core) causes accelerated coolant motion upwatds which results in steam migration from the periphery to the centre and to increase of general non-uniformity of steam distribution. The revealed steam distribution non-uniformity over the height and radius of the up-draught part elucidates the discrepancy of experimental and calculation values of the average volumetric steam content and determines the necessity of the development of new calculation methods

  19. Steam content of the two-phase flow in the Vk-50 boiling water cooled reactor draught section

    International Nuclear Information System (INIS)

    Fedulin, V.N.; Shmelev, V.E.; Solodkij, V.A.; Bartolomej, G.G.

    1983-01-01

    Results are presented of experimental investigation of the two-phase steam-water coolant flow hydrodynamics within the VK-50 reactor draught section. On the basis of the analysis of the obtained data a two-phase coolant flow model in a large diameter channel is proposed. It is shown that the steam-content distribution in the volume of the draught section has a pronounced non-equilibrium character manifested in the steam migration from the periphery to the central region. A minimum value of the steam content at the periphery is attained at the 0.7-1.0 m height; it is followed by a partial steam content levelling over the section. However the total steam content levelling over the cross section of the draught section does not take place. The steam distribution in the water layer over the draught section (overflow zone) is also nonuniform over the reactor section. The non-uniform steam distribution enchances with reduction nn pressure

  20. Corrosion of X18H9T steel after 25 years of operation in steam water environments of the VK-50 reactor

    International Nuclear Information System (INIS)

    Filyakin, G.V.; Shamardin, V.E.; Goncharenko, Yu.D.; Kazakov, V.A.

    2004-01-01

    This paper presents the results from testing a VK-50 reactor measuring channel, removed from the reactor after 25 years of operation without signs of integrity loss. Metallography and electron microscopy as well as Auger spectroscopy of elemental composition were carried out. Intergranular corrosion is revealed in a base metal of the measurement channel tube at the core bottom level. A network of non-through, mainly longitudinal cracks of intergranular nature are located at the level of top and center of the core as well as directly under the reactor cover. The investigation results enable us to draw a conclusion that corrosion damage rate of the channel material depends on axial coolant density in the core. The neutron irradiation impact may be provocative but not chief factor for increasing the base metal sensitivity to intergranular corrosion and corrosion cracking. (authors)

  1. Banana peel: a potential substrate for laccase production by Aspergillus fumigatus VkJ2.4.5 in solid-state fermentation.

    Science.gov (United States)

    Vivekanand, V; Dwivedi, Pallavi; Pareek, Nidhi; Singh, Rajesh P

    2011-09-01

    In solid-state fermentation, among various solid supports evaluated, banana peel was found to be an ideal support and resulted into higher levels of laccase (6281.4 ± 63.60 U l(-1)) along with notable levels of manganese peroxidase production (1339.0 ± 131.23 U l(-1)) by Aspergillus fumigatus VkJ2.4.5. Maximum levels of laccase was achieved under derived conditions consisting of 80% of moisture level, 6 days of incubation period, 6% inoculum level, and an aeration level of 2.5 l min(-1). A column-tray bioreactor was designed to scale up and economize the enzyme production in three successive cycles of fermentation using the same fungal biomass. Thermal and pH stability profiles revealed that enzyme was stable up to 50°C and at varying pH range from 5-9 for up to 2 h. The apparent molecular weight of laccase was found to be 34 ± 1 kDa. MALDI-TOF/TOF analysis of the protein showed significant homology with maximum identity of 67% to other laccases reported in database.

  2. Phylloquinone and Menaquinone-4 Tissue Distribution at Different Life Stages in Male and Female Sprague–Dawley Rats Fed Different VK Levels Since Weaning or Subjected to a 40% Calorie Restriction since Adulthood

    Directory of Open Access Journals (Sweden)

    Guylaine Ferland

    2016-03-01

    Full Text Available Whether through the vitamin K-dependent proteins or the individual K vitamers, vitamin K (VK is associated with a number of age-related conditions (e.g., osteoporosis, atherosclerosis, insulin resistance, cognitive decline. In light of this, we investigated the influence of lifetime dietary VK exposure on the tissue distribution of phylloquinone (K1 and menaquinone-4 (MK-4 vitamers in 3-, 12- and 22-month-old male and female rats fed different K1 diets since weaning or subjected to a 40% calorie restricted diet (CR since adulthood. Dietary K1 intakes around the minimal amount required for normal blood coagulation had no significant influence on body weights of both male and female rats at different life stages. Tissue contents of the K vitamers differed according to organs, were generally higher in females than in males, and increased with K1 intake. The MK-4/total VK ratios tended to be increased in old age possibly reflecting an increased physiological demand for MK-4 during aging. Our study also confirmed the greater susceptibility of male rats to low VK containing diet, notably at a younger age. Despite lifelong higher K1 intakes per unit body weight, tissue K1 and MK-4 contents at 20 months were generally lower in CR rats compared to their ad libitum (AL counterparts. Whether the lower tissue MK-4 content is the result of lower synthesis from K1 or greater tissue utilization remains to be determined. However, the more youthful coagulation profile observed in old CR rats (vs. AL rats tends to support the notion that CR is associated with greater utilization of the K vitamers to sustain physiological functions.

  3. Measurements at the RA Reactor related to the VISA-2 project - Part 3, calculation of VISA-2 samples influence on the reactor reactivity, on the depression of thermal neutron flux in VK-5 channel and VISA-2 samples; Fizicka merenja na reaktoru RA u vezi projekta VISA-2 - III deo, Proracun uticaja uzoraka VISA-2 na reaktivnost reaktora, na depresiju fluksa termalnih neuntrona u kanalu VK-5 i u uzorcima VISA-2

    Energy Technology Data Exchange (ETDEWEB)

    Markovic, H; Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1962-07-01

    The objective of this task was to determine the thermal neutron flux in the RA reactor cell with VISA-2 samples, the influence of VISA-2 samples on the thermal neutron flux distribution in the vicinity of VK-5 channel and the antireactivity of VISA-2 samples placed in the RA reactor core. This distribution is needed for calculating the mean value of absorption and thermal efficiency factor in the reactor cell with the sample. Thermal neutron flux distribution without the sample was calculated by diffusion theory. Fast neutron flux space distribution was assumed to be constant, i.e. that it is dependent only on the nuclear properties of the materials. Macroscopic thermal neutron flux distribution was determined by two-group diffusion theory using the four factor formula applied for two regions: active RA region, and reactor region with calls containing VISA-2 samples. This calculation enables estimation of the VISA-2 samples influence on the thermal neutron flux distribution in the VK-5 channel. Antireactivity of VISA-2 samples was calculated by neutron diffusion theory applying the perturbation method. [Serbo-Croat] Cilj ovog zadatka je da se odredi raspodela fluksa termalnih neutrona u celiji reaktora RA sa uzorcima VISA-2, uticaj uzoraka VISA-2 na makroskopsku raspodelu termalnih neutrona u blizini uzoraka, tj. u kanalu VK-5, kao i antiraktivnost uzoraka VISA-2 ubacenih u jezgro RA. Poznavanje ove raspodele potrebno je za izracunavanje srednje apsorpcije i faktora termalnog iskoriscenja u celiji reaktora sa uzorkom. Raspodela fluksa termalnih neutrona u celiji RA bez uzorka izracunata je na bazi difuzione teorije. Fluks brzih neutrona uzet je kao konstanta s obzirom na prostorne koordinate, tj. da zavisi samo od nuklearnih karakteristika materijala. Makroskopska raspodela fluksa termalnih neutrona u okolini VISA-2 odredjena je na bazi dvogrupne difuzione teorije preko formule cetiri faktora, primenjene na dve zone: prva aktivna zona RA, i druga reaktorka sredina

  4. Quasiclassical trajectory studies of the O(3P) + CX4(vk = 0, 1) → OXv + CX3(n1n2n3n4) [X = H and D] reactions on an ab initio potential energy surface.

    Science.gov (United States)

    Czakó, Gábor; Liu, Rui; Yang, Minghui; Bowman, Joel M; Guo, Hua

    2013-08-01

    We report quasiclassical trajectory calculations of the integral and differential cross sections and the mode-specific product state distributions for the "central-barrier" O((3)P) + CH4/CD4(vk = 0, 1) [k = 1, 2, 3, 4] reactions using a full-dimensional ab initio potential energy surface. The mode-specific vibrational distributions for the polyatomic methyl products are obtained by doing a normal-mode analysis in the Eckart frame, followed by standard histogram binning (HB) and energy-based Gaussian binning (1GB). The reactant bending excitations slightly enhance the reactivity, whereas stretching excitations activate the reaction more efficiently. None of the reactant vibrational excitations is as efficient as an equivalent amount of translational energy to promote the reactions. The excitation functions without product zero-point energy (ZPE) constraint are in good agreement with previous 8-dimensional quantum mechanical (QM) results for the ground-state and stretching-excited O + CH4 reactions, whereas for the bending-excited reactions the soft ZPE constraint, which is applied to the sum of the product vibrational energies, provides better agreement with the QM cross sections. All angular distributions show the dominance of backward scattering indicating a direct rebound mechanism, in agreement with experiment. The title reactions produce mainly OH/OD(v = 0) products for all the initial states. HB significantly overestimates the populations of OH/OD(v = 1), especially in the energetic threshold regions, whereas 1GB provides physically correct results. The CH3/CD3 vibrational distributions show dominant populations for ground (v = 0), umbrella-excited (v2 = 1, 2), in-plane-bending-excited (v4 = 1), and v2 + v4 methyl product states. Neither translational energy nor reactant vibrational excitation transfers significantly into product vibrations.

  5. Microstructural anomalies in a W-Ni alloy liquid phase sintered under microgravity conditions

    International Nuclear Information System (INIS)

    Liu, Y.; Iacocca, R.G.; Johnson, J.L.; German, R.M.; Kohara, Shiro

    1995-01-01

    The gravitational role in liquid phase sintering (LPS) is a problem of great interest in both materials science and engineering practice. Gravity-induced microstructural gradients in grain size, grain shape, and solid volume fraction have been well documented in liquid phase sintered tungsten heavy alloys and have been analyzed by a number of theoretical models. However, gravity may have many unknown effects on LPS, which can only be revealed by experiments conducted under microgravity conditions

  6. Direct observation of densification and grain growth in a W--Ni alloy

    International Nuclear Information System (INIS)

    Riegger, H.; Pask, J.A.; Exner, H.E.

    1979-04-01

    Densification and grain growth in a tungsten--nickel alloy containing 32 vol % of liquid at 1550 0 C were studied by conventional methods aided by hot stage scanning electron microscopy and cinematography. This technique yields important additional qualitative information on the mechanisms. Two stages can be discerned. In stage 1, essentially complete pore elimination, rapid grain growth and adjustment of microstructural geometry take place. In the second stage, microstructure coarsening occurs which is characterized by geometric similarity. Columnar grain growth at the surface is observed due to squeezing out of Ni--W liquid, flooding of surface grains and fast evaporation of the Ni. The driving forces for these processes are discussed showing that a high ratio of grain boundary energy to liquid surface energy is essential. A W--Cu alloy with 32 vol % liquid at 1100 0 C did not show any grain growth due to essentially no solubility of W in Cu at this temperature

  7. Aldosterons effekt på nyrernes kaliumbalance

    DEFF Research Database (Denmark)

    Winther, Signe Abitz; Egfjord, Martin

    2011-01-01

    Recent studies have shown expression of the following regulatory WNK kinases in the kidney: the full-length WNK1 (L-WNK1), the shorter kidney specific WNK1 transcript (KS-WNK1), formed by alternative splicing, and WNK4. Aldosterone activates expression of KS-WNK1 and inhibits WNK4 via SGK1 - both...

  8. Agarwal VK see Balaji C 331 Ahmad Ishfaq Mir see Kessarkar ...

    Indian Academy of Sciences (India)

    tures during winter over a tropical inland station –. Kharagpur (22. ... dient between Indian landmass and neighbouring oceans and .... potential water harvesting sites in the Kali Water- shed, Mahi ... Quasi-periodic VLF emissions observed during daytime at a ... late organic carbon (POC) in the Northeastern Gulf of Mexico. 1.

  9. VK-æraens departementschefer - troldmændene fra Oz

    DEFF Research Database (Denmark)

    Nielsen, Peter Heyn

    2014-01-01

    37 personer nåede at være departementschefer i perioden fra 2001 til 2011 under henholdsvis statsminister Anders Fogh Rasmussen og statsminister Lars Løkke Rasmussen. Nogle var i perioden departementschefer i flere forskellige ministerier, således at man fandt 48 forskellige departements-chefs¬sti...

  10. Nuclear power plant with boiling water reactor VK-300 for district heating and electricity supply

    International Nuclear Information System (INIS)

    Kuznetsov, Y.N.; Lisitza, F.D.; Romenkov, A.A.; Tokarev, Y.I.

    1998-01-01

    The paper considers specific design features of a pressure vessel boiling water reactor with coolant natural circulation and three-step in-vessel steam separation (at draught tube outlet of the upcomer, within zone of overflow from the upcomer to downcomer and in cyclon-type separators). Design description and analytical study results are presented for the passive core cooling system in the case of loss of preferred power and rupture in primary circuit pipeline. Specific features of a primary containment (safeguard vessel) are given for an underground NPP sited in a rock ground. (author)

  11. see Gupta VK 433 Andreev V see Porcellato AM 963 Antony J see ...

    Indian Academy of Sciences (India)

    Cryogenic, superconducting and rf results of the SRFQ2 of PIAVE. 963. Prakash P N. Superconducting linear accelerator system for. NSC. 849 see Ghosh S. 881. Prakash S see Sharma Hitesh. 497. Prasad J see Chopra S. 753. Prasad Moonooku see Pande S A. 859. Prasad R L. CO2 laser photoacoustic spectra and vibra-.

  12. Hlávkův most: betonový produkt generační obměny

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2017-01-01

    Roč. 65, č. 1 (2017), s. 37-52 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : modern architecture * cubism * concrete * Pavel Janák Subject RIV: AL - Art, Architecture , Cultural Heritage OBOR OECD: Arts, Art history

  13. "India's Rasputin"?: V.K. Krishna Menon and Anglo–American misperceptions of Indian foreign policymaking, 1947–1964

    OpenAIRE

    McGarr, Paul M.

    2011-01-01

    From 1947 until his political demise in late 1962, Vengalil Krishanan Krishna Menon stood at the forefront of India's international relations. One of Indian Premier Jawaharlal Nehru's closest political confidantes, Menon served variously as India's High Commissioner to the United Kingdom, leader of its delegation to the United Nations, self-styled mediator in the Korea, Indo–China, and Suez crises of the 1950s and, from 1957, his country's Defence Minister. Vilified in the West as “India's Ra...

  14. Genetics Home Reference: pseudohypoaldosteronism type 2

    Science.gov (United States)

    ... Belsha CW, Hunley TE, Nelson RD, Trachtman H, Cole TR, Pinsk M, Bockenhauer D, Shenoy M, Vaidyanathan ... hypertension syndrome interacts with and ubiquitylates WNK isoforms: disease-causing mutations in KLHL3 and WNK4 disrupt interaction. ...

  15. Nuclear Power Plant with VK-300 Reactor. Simplicity and Passivity as a Way to Provide Enhanced Safety and Economic Competitive Ability

    International Nuclear Information System (INIS)

    Kuznetsov, Y. N.; Lisitsa, F. D.; Tokarev, Y. I.; Glazkov, O. M.

    1998-01-01

    NPP with simplified boiling reactors with coolant natural circulation is developed by RDIPE. removal of residual heat releases under any emergency conditions is supposed to be put into effect with maximum application of passive systems and devices. (author)

  16. Calculation of the hyperfine constants of Vk center in CaF2, SrF2 and BaF2

    International Nuclear Information System (INIS)

    Bufaical, R.F.

    1975-03-01

    The magnetic hyperfine constants of the V sub(K) center in CaF 2 , SrF 2 and BaF 2 have been calculated, assuming a phenomenological model, based on the F 2 central molecule, to describe the wave function of the defect. The introduction of covalence, with the ions neighboring the central molecule, have shown that this is a better description for the defect than a simple central molecule model. It was also shown that the results for the hyperfine constants are strongly dependent on the relaxations of these neighboring ions, which have been determined by fitting the experimental data. The present results are compared with other previous calculations where similar and different methods have been used. A better description for the wave function of the defect is suggested

  17. Aplikace logistických technologií v dodávkách pro automobilový průmysl

    OpenAIRE

    TESAŘ, Petr

    2008-01-01

    The point of this bachelor thesis was to find a way, how are aplicated the logistic technologies in chosen organisation ISOBAST s.r.o., which produces and works on products from expanded plastics and plastics, mostly for automotive industry. Today company uses the emancipatory strategy JIT. In the light of how big the company is and how produces, we can suggest of using another logistic technology - Kanban or EQM. Each of this technologies has its advantages and disadvantages. As advantage we...

  18. EpiCollect+: linking smartphones to web applications for complex data collection projects [v1; ref status: indexed, http://f1000r.es/3vk

    Directory of Open Access Journals (Sweden)

    David M. Aanensen

    2014-08-01

    Full Text Available Previously, we have described the development of the generic mobile phone data gathering tool, EpiCollect, and an associated web application, providing two-way communication between multiple data gatherers and a project database. This software only allows data collection on the phone using a single questionnaire form that is tailored to the needs of the user (including a single GPS point and photo per entry, whereas many applications require a more complex structure, allowing users to link a series of forms in a linear or branching hierarchy, along with the addition of any number of media types accessible from smartphones and/or tablet devices (e.g., GPS, photos, videos, sound clips and barcode scanning. A much enhanced version of EpiCollect has been developed (EpiCollect+. The individual data collection forms in EpiCollect+ provide more design complexity than the single form used in EpiCollect, and the software allows the generation of complex data collection projects through the ability to link many forms together in a linear (or branching hierarchy. Furthermore, EpiCollect+ allows the collection of multiple media types as well as standard text fields, increased data validation and form logic. The entire process of setting up a complex mobile phone data collection project to the specification of a user (project and form definitions can be undertaken at the EpiCollect+ website using a simple ‘drag and drop’ procedure, with visualisation of the data gathered using Google Maps and charts at the project website. EpiCollect+ is suitable for situations where multiple users transmit complex data by mobile phone (or other Android devices to a single project web database and is already being used for a range of field projects, particularly public health projects in sub-Saharan Africa. However, many uses can be envisaged from education, ecology and epidemiology to citizen science.

  19. Studies on screening, isolation and purification of a fibrinolytic protease from an isolate (VK12) of Ganoderma lucidum and evaluation of its antithrombotic activity.

    Science.gov (United States)

    Kumaran, Sekar; Palani, Perumal; Nishanthi, Ramasami; Kaviyarasan, Venkatesan

    2011-01-01

    Antithrombotic activity of a protease purified from a medicinal mushroom, Ganoderma lucidum, has been evaluated platelet aggregation in vitro and pulmonary thrombosis in vivo. The purified protease exhibited concentration dependent inhibitory effects on platelet aggregation induced by ADP (adenosine diphosphate), with an IC(50) value of 2.4 mg/mL. The purified protease protected mice against thrombotic death or paralysis induced by collagen and epinephrine in a dose dependent manner when administered orally. It produced a significant inhibition of thrombotic death or paralysis at 60 µg/kg body weight, while aspirin produced a significant inhibition of thrombosis at 10-20 mg/kg body weight. The purified protease also has showed fibrinolytic activity and alters coagulation parameters such as activated partial thromboplastin time (APTT), and thrombin time (TT) in rat platelet. These results suggested that the antithrombotic activity of Ganoderma lucidum protease might be due to antiplatelet activity rather than anticoagulation activity.

  20. Characterization and properties of an advanced composite substrate for YBCO-coated conductors

    DEFF Research Database (Denmark)

    Gao, M.; Suo, H.; Zhao, Y.

    2010-01-01

    Thin, biaxially textured Ni5W/Ni12W/Ni5W composite substrates for coated conductor applications have been fabricated. The particularity of this three-layer composite configuration resides in the elemental diffusion between the outer layer and the core layer. Due to the migration of elemental W...

  1. Woman – mother and citzen. Cecylia Plater-Zyberkówna’s considerations in the light of her writing work and educational activity [Kobieta – matka i obywatelka. Rozważania Cecylii Plater-Zyberkówny w świetle jej dorobku pisarskiego i działalności oświatowej

    Directory of Open Access Journals (Sweden)

    Stefania WALASEK

    2016-06-01

    Full Text Available The woman - a mother and citizen. Cecilia Plater-Zyberkówna’s View in the light of her literary work and educational activities Cecylia Plater-Zyberkówna’s (1853– 1920 writing activity and socio-cultural activities focused on education and the education of girls. At this level she showed, in practice as well as in her writing work, the preparation of the girls to perform the responsible roles of: mother, wife and citizen. Political and social events of the second half of the XIXth century, which Cecilia PlaterZyberkówna witnessed, solidified her belief in the need of involvement in solving the so-called women issue. She developed her commitment to broad social activities by working among girls and in the environment of young women. These were organisational initiatives through which she implemented her educational concepts. She included her pedagogical views in numerous theoretical works and in her journalism. In her theoretical considerations she emphasized the role of family and above all mothers who should be the guardians of hearth and home. The most important matter for PlaterZyberkówna was the answer to question: how to educate and prepare the girl to perform responsible roles in adult life? She answered that question in the work „Woman – the hearth and home in the family.”

  2. Effects of vitamin K3 and K5 on proliferation, cytokine production, and regulatory T cell-frequency in human peripheral-blood mononuclear cells.

    Science.gov (United States)

    Hatanaka, Hiroshige; Ishizawa, Hitomi; Nakamura, Yurie; Tadokoro, Hiroko; Tanaka, Sachiko; Onda, Kenji; Sugiyama, Kentaro; Hirano, Toshihiko

    2014-03-18

    The effects of vitamin K (VK) derivatives VK3 and VK5 on human immune cells have not been extensively investigated. We examined the effects of VK3 and VK5 on proliferation, apoptosis, cytokine production, and CD4+CD25+Foxp3+ regulatory T (Treg) cell-frequency in human peripheral blood mononuclear cells (PBMCs) activated by T cell mitogen in vitro. Anti-proliferative effects of VK3 and VK5 on T-cell mitogen activated PBMCs were assessed by WST assay procedures. Apoptotic cells were determined as Annexin V positive/propidium iodide (PI) negative cells. Cytokine concentrations in the supernatant of the culture medium were measured with bead-array procedures followed by analysis with flow cytometry. The CD4+CD25+Foxp3+Treg cells in mitogen-activated PBMCs were stained with fluorescence-labeled specific antibodies followed by flow cytometry. VK3 and VK5 suppressed the mitogen-activated proliferation of PBMCs significantly at 10-100μM (p<0.05). The data also suggest that VK3 and VK5 promote apoptosis in the mitogen-activated T cells. VK3 and VK5 significantly inhibited the production of tumor necrosis factor (TNF) α, interleukin (IL)-4, -6, and -10 from the activated PBMCs at 10-100μM (p<0.05). In contrast, VK3 and VK5 significantly increased Treg cell-frequency in the activated PBMCs at concentrations more than 10μM (p<0.001). Our data suggest that VK3 and VK5 attenuate T cell mediated immunity by inhibiting the proliferative response and inducing apoptosis in activated T cells. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Riskikapital aitab Videoplanetil laieneda / Tiit Efert

    Index Scriptorium Estoniae

    Efert, Tiit, 1976-

    2003-01-01

    Autor selgitab, miks filmilaenutusketti Videoplanet haldava V&K Holding senised omanikud otsustasid Lätti ja Leetu laienemiseks kaasata omanikeringi riskikapitaliinvestori Baltcap. Tabelid: Kasumiaruanne; Rahavoogude aruanne; V&K Holdingu bilanss

  4. Vitamin K3 increased BMD at 1 and 2 months post-surgery and the maximum stress of the middle femur in the rat.

    Science.gov (United States)

    Hong, You-jia; Liu, Sheng; Jiang, Ning-yi; Jiang, Sen; Liang, Jiu-gen

    2015-02-01

    The therapeutic effects of vitamin K3 (VK3) on osteoporosis are still unknown. In this study, we hypothesized that VK3 possesses therapeutic effects on osteoporosis; to verify this hypothesis, the ovariectomized rat was used as an osteoporosis model. Fifty-six Sprague-Dawley female rats aged 8 to 9 months were randomly assigned to 4 groups: sham surgery, ovariectomy with saline, ovariectomy with low-dose VK3, and ovariectomy with high-dose VK3. Intramuscular injection of VK3 was performed every other day beginning 1 month postoperatively. The therapeutic effects of VK3 on osteoporosis were evaluated by measurement of bone mineral density (BMD), bone biochemical markers, biomechanical properties, and bone morphometric parameters. The overall average BMD in VK3-treated groups increased to a level between those of the ovariectomy group and the sham surgery group. The procollagen I N-terminal peptide level peaked at 2 months after surgery in all groups except in the group that had undergone ovariectomy with low-dose VK3. The tartrate-resistant acid phosphatase 5b level increased more slowly at 4 months after surgery than at 2 months after surgery in the VK3-treated groups. The ovariectomy with high-dose VK3 group had the highest maximum stress of the middle femur of all groups. With VK3 treatment, the trabecular bone area percentage increased. All morphometric indicators for the middle tibia in the VK3-treated groups reached the levels found in the sham surgery group. In summary, VK3 therapy increased BMD at 1 and 2 months postsurgery and the maximum stress of the middle femur. In addition, VK3 therapy slowed the increase in bone turnover in ovariectomized rats. Furthermore, VK3 can improve morphometric indicators for the middle tibia. Our preliminary study indicates that VK3 has a potential therapeutic effect on osteoporosis and is worthy of further investigation. Copyright © 2015 Elsevier Inc. All rights reserved.

  5. In silico and in vitro characterization of anti-amyloidogenic activity of vitamin K3 analogues for Alzheimer's disease.

    Science.gov (United States)

    Huy, Pham Dinh Quoc; Yu, Yao-Chung; Ngo, Son Tung; Thao, Tran Van; Chen, Chin-Piao; Li, Mai Suan; Chen, Yi-Cheng

    2013-04-01

    Aggregation of amyloid-beta (Aβ) has been proposed as the main cause of Alzheimer's disease (AD). Vitamin K deficiency has been linked to the pathogenesis of AD. Therefore, 15 synthesized vitamin K3 (VK3) analogues were studied for their anti-amyloidogenic activity. Biological and spectroscopic assays were used to characterize the effect of VK3 analogues on amyloidogenic properties of Aβ, such as aggregation, free radical formation, and cell viability. Molecular dynamics simulation was used to calculate the binding affinity and mode of VK3 analogue binding to Aβ. Both numerical and experimental results showed that several VK3 analogues, including VK3-6, VK3-8, VK3-9, VK3-10, and VK3-224 could effectively inhibit Aβ aggregation and conformational conversion. The calculated inhibition constants were in the μM range for VK3-10, VK3-6, and VK3-9 which was similar to the IC50 of curcumin. Cell viability assays indicated that VK3-9 could effectively reduce free radicals and had a protective effect on cytotoxicity induced by Aβ. The results clearly demonstrated that VK3 analogues could effectively inhibit Aβ aggregation and protect cells against Aβ induced toxicity. Modified VK3 analogues can possibly be developed as effective anti-amyloidogenic drugs for the treatment of AD. VK3 analogues effectively inhibit Aβ aggregation and are highly potent as anti-amyloidogenic drugs for therapeutic treatment of AD. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Evaluation of the antitumor effects of vitamin K2 (menaquinone-7) nanoemulsions modified with sialic acid-cholesterol conjugate.

    Science.gov (United States)

    Shi, Jia; Zhou, Songlei; Kang, Le; Ling, Hu; Chen, Jiepeng; Duan, Lili; Song, Yanzhi; Deng, Yihui

    2018-02-01

    Numerous studies have recently shown that vitamin K 2 (VK 2 ) has antitumor effects in a variety of tumor cells, but there are few reports demonstrating antitumor effects of VK 2 in vivo. The antitumor effects of VK 2 in nanoemulsions are currently not known. Therefore, we sought to characterize the antitumor potential of VK 2 nanoemulsions in S180 tumor cells in the present study. Furthermore, a ligand conjugate sialic acid-cholesterol, with enhanced affinity towards the membrane receptors overexpressed in tumors, was anchored on the surface of the nanoemulsions to increase VK 2 distribution to the tumor tissue. VK 2 was encapsulated in oil-in-water nanoemulsions, and the physical and chemical stability of the nanoemulsions were characterized during storage at 25 °C. At 25 °C, all nanoemulsions remained physically and chemically stable with little change in particle size. An in vivo study using syngeneic mice with subcutaneously established S180 tumors demonstrated that intravenous or intragastric administration of VK 2 nanoemulsions significantly suppressed the tumor growth. The VK 2 nanoemulsions modified with sialic acid-cholesterol conjugate showed higher tumor growth suppression than the VK 2 nanoemulsions, while neither of them exhibited signs of drug toxicity. In summary, VK 2 exerted effective antitumor effects in vivo, and VK 2 nanoemulsions modified with sialic acid-cholesterol conjugate enhanced the antitumor activity, suggesting that these VK 2 may be promising agents for the prevention or treatment of tumor in patients.

  7. OSR1 regulates a subset of inward rectifier potassium channels via a binding motif variant.

    Science.gov (United States)

    Taylor, Clinton A; An, Sung-Wan; Kankanamalage, Sachith Gallolu; Stippec, Steve; Earnest, Svetlana; Trivedi, Ashesh T; Yang, Jonathan Zijiang; Mirzaei, Hamid; Huang, Chou-Long; Cobb, Melanie H

    2018-04-10

    The with-no-lysine (K) (WNK) signaling pathway to STE20/SPS1-related proline- and alanine-rich kinase (SPAK) and oxidative stress-responsive 1 (OSR1) kinase is an important mediator of cell volume and ion transport. SPAK and OSR1 associate with upstream kinases WNK 1-4, substrates, and other proteins through their C-terminal domains which interact with linear R-F-x-V/I sequence motifs. In this study we find that SPAK and OSR1 also interact with similar affinity with a motif variant, R-x-F-x-V/I. Eight of 16 human inward rectifier K + channels have an R-x-F-x-V motif. We demonstrate that two of these channels, Kir2.1 and Kir2.3, are activated by OSR1, while Kir4.1, which does not contain the motif, is not sensitive to changes in OSR1 or WNK activity. Mutation of the motif prevents activation of Kir2.3 by OSR1. Both siRNA knockdown of OSR1 and chemical inhibition of WNK activity disrupt NaCl-induced plasma membrane localization of Kir2.3. Our results suggest a mechanism by which WNK-OSR1 enhance Kir2.1 and Kir2.3 channel activity by increasing their plasma membrane localization. Regulation of members of the inward rectifier K + channel family adds functional and mechanistic insight into the physiological impact of the WNK pathway.

  8. The in vitro antitumor activity of vitamins C and K3 against ovarian carcinoma.

    Science.gov (United States)

    von Gruenigen, Vivian E; Jamison, James M; Gilloteaux, Jacques; Lorimer, Heather E; Summers, Marcia; Pollard, Robert R; Gwin, Carley A; Summers, Jack L

    2003-01-01

    The objective was to evaluate the cytotoxic effect and mechanism of action of vitamins C (VC) and K3 (VK3) on ovarian carcinoma. Cytotoxicity assays were performed on ovarian cancer cell lines with VC, VK3 or a VC/VK3 combination. FIC index was employed to evaluate synergism. Flow cytometry was accomplished at 90% cytotoxic doses. Light, transmission electron microscopy and DNA isolation were performed. Antitumor activity was exhibited by both VC, VK3 and VC/VK3. VC/VK3 demonstrated synergistic activity. VC/VK3 may induce a G1 block in the cell cycle. Combined vitamin treatment resulted in cells that maintain apparently intact nuclei while extruding pieces of organelle-free cytoplasm. Degradation of chromosomal DNA was observed. Cell death (autoschizis) displayed characteristics of both apoptosis and necrosis. The cytotoxic effects observed may enable vitamins C and K3 to play an adjuvant role in the treatment of ovarian cancer.

  9. The Role of the Component Metals in the Toxicity of Military-Grade Tungsten Alloy

    Directory of Open Access Journals (Sweden)

    Christy A. Emond

    2015-12-01

    Full Text Available Tungsten-based composites have been recommended as a suitable replacement for depleted uranium. Unfortunately, one of these mixtures composed of tungsten (W, nickel (Ni and cobalt (Co induced rhabdomyosarcomas when implanted into the leg muscle of laboratory rats and mice to simulate a shrapnel wound. The question arose as to whether the neoplastic effect of the mixture could be solely attributed to one or more of the metal components. To investigate this possibility, pellets with one or two of the component metals replaced with an identical amount of the biologically-inert metal tantalum (Ta were manufactured and implanted into the quadriceps of B6C3F1 mice. The mice were followed for two years to assess potential adverse health effects. Implantation with WTa, CoTa or WNiTa resulted in decreased survival, but not to the level reported for WNiCo. Sarcomas in the implanted muscle were found in 20% of the CoTa-implanted mice and 5% of the WTa- and WCoTa-implanted rats and mice, far below the 80% reported for WNiCo-implanted mice. The data obtained from this study suggested that no single metal is solely responsible for the neoplastic effects of WNiCo and that a synergistic effect of the three metals in tumor development was likely.

  10. African Journal of Biotechnology - Vol 10, No 32 (2011)

    African Journals Online (AJOL)

    Seed germination and in vitro regeneration of the African medicinal and pesticidal plant, Bobgunnia madagascariensis · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... An alkaliphilic cyclodextrin glycosyltransferase from a new Bacillus agaradhaerens WN-I strain isolated from an Egyptian soda lake: Purification and ...

  11. Flow Cytometry Study of Lymphocyte Subsets in Malnourished and Well-Nourished Children with Bacterial Infections

    Science.gov (United States)

    Nájera, Oralia; González, Cristina; Toledo, Guadalupe; López, Laura; Ortiz, Rocío

    2004-01-01

    Protein-energy malnutrition is the primary cause of immune deficiency in children across the world. It has been related to changes in peripheral T-lymphocyte subsets. The aim of the present study was to evaluate the effects of infection and malnutrition on the proportion of peripheral-lymphocyte subsets in well-nourished non-bacterium-infected (WN), well-nourished bacterium-infected (WNI), and malnourished bacterium-infected (MNI) children by flow cytometry. A prospectively monitored cohort of 15 MNI, 12 WNI, and 17 WN children was studied. All the children were 3 years old or younger and had only bacterial infections. Results showed a significant decrease in the proportion of T CD3+ (P < 0.05 for relative and P < 0.03 for absolute values), CD4+ (P < 0.01 for relative and absolute values), and CD8+ (P < 0.05 for relative values) lymphocyte subsets in WNI children compared to the results seen with WN children. Additionally, B lymphocytes in MNI children showed significant lower values (CD20+ P < 0.02 for relative and P < 0.05 for absolute values) in relation to the results seen with WNI children. These results suggest that the decreased proportions of T-lymphocyte subsets observed in WNI children were associated with infection diseases and that the incapacity to increase the proportion of B lymphocyte was associated with malnutrition. This low proportion of B lymphocytes may be associated with the mechanisms involved in the immunodeficiency of malnourished children. PMID:15138185

  12. Signal transduction of vitamin K3 for pancreas cancer therapy

    Directory of Open Access Journals (Sweden)

    Toshiyuki Tanahashi

    2011-10-01

    Full Text Available We characterized molecular mechanisms of vitamin K3 (VK3-induced inhibition of proliferation to evaluate VK3 effectiveness in treating advanced pancreatic cancer. A novel endoscopic drug delivery system, ultrasound injection technique, was used to study local effects of VK3. VK3 inhibited pancreas cancer cell growth by rapid phosphorylation of growth factor receptor and cellular signal factors such as extracellular signal-regulated kinase. VK3 also activated apoptosis, and apoptosis inhibitor antagonized the apoptosis pathway without inhibiting cell growth. Thiol antioxidant treatment completely abrogated VK3-induced ERK but not JNK phosphorylation or inhibition of proliferation. Non-thiol antioxidant did not affect ERK phosphorylation or growth inhibitory actions. Arylation was considered the main mechanism of VK3-induced growth inhibition through ERK activation. VK3 may lead to favorable outcomes in the treatment of pancreatic tumors. Detection of ERK phosphorylation in tissue is important to predict VK3 effect. Endoscopic ultrasound-guided fine-needle injection may be beneficial for treating pancreatic cancer with VK3.

  13. Sledování kvalitativního a kvantitativního zastoupení vitaminů v masozeleninových přesnídávkách určených pro dětskou vyživu

    OpenAIRE

    Solčány, Veronika

    2016-01-01

    This thesis deals with the qualitative and quantitative representation of vitamins in the meat-vegetables based infant food. The work is divided into the theoretical and the experimental part. The theoretical part describes a child nutrition and the vitamins. In the chapters, dealing with vitamins, is a description of particular vitamins, their biological functions in the body, the recommended daily dose and their stability during food processing. These chapters concern fat-soluble vitamins (...

  14. Reply to the comment on 'Monsoon related changes in sea surface productivity and water column denitrification in the Eastern Arabian Sea during the last glacial cycle' by V.K. Banakar, T. Oba, A.R. Chodankar, T. Kuramoto, M. Yamamoto, M. Minagawa

    Digital Repository Service at National Institute of Oceanography (India)

    Banakar, V.K.; Oba, T.; Chodankar, A.R.; Kuramoto, T.; Yamamoto, M.; Minagawa, M.

    proxies utilized in our study have not been greatly affected by preservation problems. 3 RT proposes diagenesis as an alternative explanation for C/N ratio variation recorded by our study. Although diagenesis cannot be ruled out, we think it is very...

  15. DNA polymerase gamma inhibition by vitamin K3 induces mitochondria-mediated cytotoxicity in human cancer cells.

    Science.gov (United States)

    Sasaki, Ryohei; Suzuki, Yoko; Yonezawa, Yuko; Ota, Yosuke; Okamoto, Yoshiaki; Demizu, Yusuke; Huang, Peng; Yoshida, Hiromi; Sugimura, Kazuro; Mizushina, Yoshiyuki

    2008-05-01

    Among the vitamin K (VK) compounds, VK3 exhibits distinct cytotoxic activity in cancer cells and is thought to affect redox cycling; however, the underlying mechanisms remain unclear. Here we demonstrate that VK3 selectively inhibits DNA polymerase (pol) gamma, the key enzyme responsible for mitochondrial DNA replication and repair. VK3 at 30 microM inhibited pol gamma by more than 80%, caused impairment of mitochondrial DNA replication and repair, and induced a significant increase in reactive oxygen species (ROS), leading to apoptosis. At a lower concentration (3 microM), VK3 did not cause a significant increase in ROS, but was able to effectively inhibit cell proliferation, which could be reversed by supplementing glycolytic substrates. The cytotoxic action of VK3 was independent of p53 tumor suppressor gene status. Interestingly, VK3 only inhibited pol gamma but did not affect other pol including human pol alpha, pol beta, pol delta, and pol epsilon. VK1 and VK2 exhibited no inhibitory effect on any of the pol tested. These data together suggest that the inhibition of pol gamma by VK3 is relatively specific, and that this compound seems to exert its anticancer activity by two possible mechanisms in a concentration-dependent manner: (1) induction of ROS-mediated cell death at high concentrations; and (2) inhibition of cell proliferation at lower concentrations likely through the suppression of mitochondrial respiratory function. These findings may explain various cytotoxic actions induced by VK3, and may pave the way for the further use of VK3.

  16. Chemical dosimetry at the RA reactor; Hemijska dozimetrija reaktora RA

    Energy Technology Data Exchange (ETDEWEB)

    Gal, O [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    This report presents the results of measurements of absorbed doses axial and radial distribution in the vertical experimental channels of the RA reactor. Measurements were done in channels VK-5, VK-7, VK-9 and GF-36. Results were compared to the results of calorimetry measurements and measured neutron flux values performed by other laboratories. Fricke and oxalate dosemeters were used in addition to the cobalt indicators.

  17. Vitamin K3 triggers human leukemia cell death through hydrogen peroxide generation and histone hyperacetylation.

    Science.gov (United States)

    Lin, Changjun; Kang, Jiuhong; Zheng, Rongliang

    2005-10-01

    Vitamin K3 (VK3) is a well-known anticancer agent, but its mechanism remains elusive. In the present study, VK3 was found to simultaneously induce cell death, reactive oxygen species (ROS) generation, including superoxide anion (O2*-) and hydrogen peroxide (H2O2) generation, and histone hyperacetylation in human leukemia HL-60 cells in a concentration- and time-dependent manner. Catalase (CAT), an antioxidant enzyme that specifically scavenges H2O2, could significantly diminish both histone acetylation increase and cell death caused by VK3, whereas superoxide dismutase (SOD), an enzyme that specifically eliminates O2*-, showed no effect on both of these, leading to the conclusion that H2O2 generation, but not O2*- generation, contributes to VK3-induced histone hyperacetylation and cell death. This conclusion was confirmed by the finding that enhancement of VK3-induced H2O2 generation by vitamin C (VC) could significantly promote both the histone hyperacetylation and cell death. Further studies suggested that histone hyperacetylation played an important role in VK3-induced cell death, since sodium butyrate, a histone deacetylase (HDAC) inhibitor, showed no effect on ROS generation, but obviously potentiated VK3-induced histone hyperacetylation and cell death. Collectively, these results demonstrate a novel mechanism for the anticancer activity of VK3, i.e., VK3 induced tumor cell death through H2O2 generation, which then further induced histone hyperacetylation.

  18. Abyssal sediment erosion from the Central Indian Basin: Evidence from radiochemical and radiolarian studies

    Digital Repository Service at National Institute of Oceanography (India)

    Banakar, V.K.; Gupta, S.M.; Padmavati, V.K.

    ) 167-173 167 Elsevier Science Publishers B.V., Amsterdam Letter Section Abyssal sediment erosion in the Central Indian Basin: Evidence from radiochemical and radiolarian studies V.K. Banakar, S.M. Gupta and V.K. Padmavathi National Institute... of Oceanography, Dona-Paula, Goa-403 004, India (Revision accepted September 17, 1990) ABSTRACT Banakar, V.K., Gupta, S.M. and Padmavathi, V.K., 1991. Abyssal sediment erosion from the Central Indian Basin: Evi- dence from radiochemical and radiolarian studies...

  19. Alternative therapeutic approach to renal-cell carcinoma: induction of apoptosis with combination of vitamin K3 and D-fraction.

    Science.gov (United States)

    Degen, Michael; Alexander, Bobby; Choudhury, Muhammad; Eshghi, Majid; Konno, Sensuke

    2013-12-01

    Because of a dismal prognosis for advanced renal-cell carcinoma (RCC), an alternative therapeutic approach, using vitamin K3 (VK3) and D-fraction (DF) was investigated. VK3 is a synthetic VK derivative and DF is a bioactive mushroom extract, and they have been shown to have antitumor activity. We examined if the combination of VK3 and DF would exhibit the improved anticancer effect on RCC in vitro. Human RCC, ACHN cell line, were treated with varying concentrations of VK3, DF, or a combination of the two. Cell viability was assessed at 72 hours by MTT assay. To explore the possible anticancer mechanism, studies on cell cycle, chromatin modifications, and apoptosis were conducted. VK3 alone led to a ~20% reduction in cell viability at 4 μM, while DF alone induced a 20% to 45% viability reduction at ≥ 500 μg/mL. A combination of VK3 (4 μM) and DF (300 μg/mL) led to a drastic >90% viability reduction, however. Cell cycle analysis indicated that VK3/DF treatment induced a G1 cell cycle arrest, accompanied by the up-regulation of p21(WAF1) and p27(Kip1). Histone deacetylase (HDAC) was also significantly (~60%) inactivated, indicating chromatin modifications. In addition, Western blot analysis revealed that the up-regulation of Bax and activation of poly-(ADP-ribose)-polymerase (PARP) were seen in VK3/DF-treated cells, indicating induction of apoptosis. The combination of VK3 and DF can lead to a profound reduction in ACHN cell viability, through a p21(WAF1)-mediated G1 cell cycle arrest, and ultimately induces apoptosis. Therefore, the combination of VK3/DF may have clinical implications as an alternative, improved therapeutic modality for advanced RCC.

  20. Prevalence of the Novel Torque Teno Sus Virus Species k2b from Pigs in the United States and Lack of Association with Post-Weaning Multisystemic Wasting Syndrome or Mulberry Heart Disease.

    Science.gov (United States)

    Rogers, A J; Huang, Y-W; Heffron, C L; Opriessnig, T; Patterson, A R; Meng, X-J

    2017-12-01

    The family Anelloviridae includes a number of viruses infecting humans (Torque teno viruses, TTV) and other animals including swine (Torque teno sus viruses, TTSuV). Two genetically distinct TTSuV species have been identified from swine thus far (TTSuV1 and TTSuVk2), although their definitive association with disease remains debatable. In 2012, a novel TTSuV species was identified from commercial swine serum and classified in the genus Kappatorquevirus as TTSuVk2b. The other Kappatorquevirus species, TTSuVk2a, has been associated with post-weaning multisystemic wasting syndrome (PMWS) when coinfected with porcine circovirus type 2 (PCV2). Therefore, in this study, we initially amplified a portion of TTSuVk2b ORF1 and, subsequently, assessed the molecular prevalence of the virus in pigs in the United States. A total of 127 serum and 115 tissue samples were obtained from pigs with PMWS or mulberry heart disease (MHD) in six states and tested by PCR for the presence of TTSuVk2b DNA. Approximately 27.6% of the serum and 21.7% of tissue samples tested positive for TTSuVk2b DNA, and the positive products were confirmed by sequencing. However, we did not detect a correlation between TTSuVk2b infection and PMWS or MHD. The near full-length genomic sequence of US TTSuVk2b was determined, and sequence analysis revealed that the US TTSuVk2b isolates were 95% identical to the TTSuVk2b isolate from Spain, with most of the variations clustering in ORF1. We conclude that the novel TTSuVk2b species is present in pigs in the United States and its potential association with a disease warrants further investigation. © 2016 Blackwell Verlag GmbH.

  1. The Western New York regional electronic health record initiative: Healthcare informatics use from the registered nurse perspective.

    Science.gov (United States)

    Sackett, Kay M; Erdley, W Scott; Jones, Janice

    2006-01-01

    This paper describes a select population of Western New York (WNY) Registered Nurses' (RN) perspectives on the use of healthcare informatics and the adoption of a regional electronic health record (EHR). A three part class assignment on healthcare informatics used a Strengths, Weaknesses, Opportunities, Threats (SWOT) Analysis, and a Healthcare Informatics Schemata: A paradigm shift over time(c) timeline to determine RN perspectives about healthcare informatics use at their place of employment. Qualitative analysis of 41 RNs who completed the SWOT analysis provided positive and negative themes related to perceptions about healthcare informatics and EHR use at their place of employment. 29 healthcare organizations were aggregated by year on the timeline from 1950 through 2000. Information suggests that, RNs have the capacity to positively drive the adoption of EHRs and healthcare informatics in WNY.

  2. A novel approach using powder metallurgy for strengthened RABiTS composite substrates for coated superconductors

    International Nuclear Information System (INIS)

    Suo Hongli; Zhao Yue; Liu Min; Ye Shuai; Zhu YongHua; He Dong; Ma Lingji; Ji Yuan; Zhou Meiling

    2008-01-01

    We report on the development of mechanically strengthened, highly textured Ni-5 at.%W/Ni-12 at.%W composite materials prepared by a powder metallurgical approach as promising weakly magnetic substrates for coated superconductors. The key configuration of this composite substrate consists of a thin, sharp cubic textured Ni-5 at.%W layer on a Ni-12 at.%W alloy core, thus providing a mechanical reinforcement while decreasing the saturation magnetization of the whole substrate. The composite substrates have a sharp cubic texture at the top Ni-5 at.%W outer layer and their yield strength reaches 272 MPa, exceeding that of the commercially used Ni5W substrates by a factor of 1.6. The saturation magnetization of the composite substrate Ni5W/Ni12W/Ni5W is substantially reduced when compared to that of pure Ni and Ni-5 at.%W substrates, respectively

  3. Pulmonary toxicity after exposure to military-relevant heavy metal tungsten alloy particles

    International Nuclear Information System (INIS)

    Roedel, Erik Q.; Cafasso, Danielle E.; Lee, Karen W.M.; Pierce, Lisa M.

    2012-01-01

    Significant controversy over the environmental and public health impact of depleted uranium use in the Gulf War and the war in the Balkans has prompted the investigation and use of other materials including heavy metal tungsten alloys (HMTAs) as nontoxic alternatives. Interest in the health effects of HMTAs has peaked since the recent discovery that rats intramuscularly implanted with pellets containing 91.1% tungsten/6% nickel/2.9% cobalt rapidly developed aggressive metastatic tumors at the implantation site. Very little is known, however, regarding the cellular and molecular mechanisms associated with the effects of inhalation exposure to HMTAs despite the recognized risk of this route of exposure to military personnel. In the current study military-relevant metal powder mixtures consisting of 92% tungsten/5% nickel/3% cobalt (WNiCo) and 92% tungsten/5% nickel/3% iron (WNiFe), pure metals, or vehicle (saline) were instilled intratracheally in rats. Pulmonary toxicity was assessed by cytologic analysis, lactate dehydrogenase activity, albumin content, and inflammatory cytokine levels in bronchoalveolar lavage fluid 24 h after instillation. The expression of 84 stress and toxicity-related genes was profiled in lung tissue and bronchoalveolar lavage cells using real-time quantitative PCR arrays, and in vitro assays were performed to measure the oxidative burst response and phagocytosis by lung macrophages. Results from this study determined that exposure to WNiCo and WNiFe induces pulmonary inflammation and altered expression of genes associated with oxidative and metabolic stress and toxicity. Inhalation exposure to both HMTAs likely causes lung injury by inducing macrophage activation, neutrophilia, and the generation of toxic oxygen radicals. -- Highlights: ► Intratracheal instillation of W–Ni–Co and W–Ni–Fe induces lung inflammation in rats. ► W–Ni–Co and W–Ni–Fe alter expression of oxidative stress and toxicity genes. ► W

  4. Vitamin K3 analogs induce selective tumor cytotoxicity in neuroblastoma.

    Science.gov (United States)

    Kitano, Toru; Yoda, Hiroyuki; Tabata, Keiichi; Miura, Motofumi; Toriyama, Masaharu; Motohashi, Shigeyasu; Suzuki, Takashi

    2012-01-01

    We investigated the cytotoxicity of eight vitamin K3 (VK3) analogs against neuroblastoma cell lines (IMR-32, LA-N-1, NB-39, and SK-N-SH) and normal cell lines (human umbilical vein endothelial cells (HUVEC) and human dermal fibroblasts (HDF)) using a 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide (MTT) assay. 2-[(2-Methoxy)ethylthio]-3-methyl-1,4-naphthoquinone (VK3-OCH(3)) showed especially potent cytotoxic activities against neuroblastoma cells compared with normal cells. In a Hoechst 33342 staining experiment, apoptotic morphologies characterized by cell shrinkage, nuclear condensation, and nuclear fragmentation were observed in IMR-32 and LA-N-1 cells after 48 h of treatment with 10(-5) M of VK3-OCH(3). To clarify the molecular mechanisms of apoptosis induced by VK3-OCH(3), we examined the expression of apoptosis related proteins using a Proteome Profiler Array and western blotting. Heme oxygenase (HO)-1 was remarkably increased by VK3-OCH(3) compared with the control (173% in IMR-32 and 170% in LA-N-1 at 24 h). Moreover, caveolin-1 was induced by VK3-OCH(3) at 48 h. In addition, VK3-OCH(3) arrested the cell cycle at the G2/M phase in IMR-32 cells. These results suggest that VK3-OCH(3) exhibited a selective antitumor activity via HO-1-related mechanisms.

  5. Calixarene capped ZnS quantum dots as an optical nanoprobe for detection and determination of menadione.

    Science.gov (United States)

    Joshi, Kuldeep V; Joshi, Bhoomika K; Pandya, Alok; Sutariya, Pinkesh G; Menon, Shobhana K

    2012-10-21

    In this communication we report a p-sulfonatocalix[4]arene coated ZnS quantum dots "cup type" highly stable optical probe for the detection and determination of menadione (VK(3)) with high sensitivity and selectivity. The detection of VK(3) depends on supramolecular host-guest chemistry.

  6. Vitamin K2, a menaquinone present in dairy products targets castration-resistant prostate cancer cell-line by activating apoptosis signaling.

    Science.gov (United States)

    Dasari, Subramanyam; Samy, Angela Lincy Prem Antony; Kajdacsy-Balla, Andre; Bosland, Maarten C; Munirathinam, Gnanasekar

    2018-05-01

    The aim of this study was to evaluate the therapeutic effects of vitamin K2 (VK2) on castration-resistant prostate cancer (CRPC) and its anti-cancer mechanisms in a pre-clinical study using a VCaP cell line (ATCC ® CRL-2876™) which was established from a vertebral bone metastasis from a patient with hormone refractory prostate cancer. Our data showed that VK2 significantly inhibited CRPC VCaP cell proliferation in a dose-dependent manner at 48 h treatment in vitro. In addition, VK2 reduced the migration potential of VCaP cells and inhibited anchorage-independent growth of these cells. Our results also showed that VK2 induces apoptosis in VCaP cells. Furthermore, VK2 enforced growth arrest in VCaP cells by activating cellular senescence. Notably, VK2 treatment elevated the levels of reactive oxygen species in VCaP cells. Western blot analysis revealed that VK2 downregulated the expression of androgen receptor, BiP, survivin, while activating caspase-3 and -7, PARP-1 cleavage, p21 and DNA damage response marker, phospho-H2AX in VCaP cells. In conclusion, our study suggests that VK2 might be a potential anti-cancer agent for CRPC by specifically targeting key anti-apoptotic, cell cycle progression and metastasis-promoting signaling molecules. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. A race-specific interaction between vitamin K status and statin use during warfarin therapy initiation

    Science.gov (United States)

    Vitamin K (VK) is required for the post-translational modification of several clotting factors. Warfarin is a vitamin K antagonist and anticoagulant. The most common dietary and circulating form of VK is phylloquinone (PK). PK is lipid soluble, carried by triglyceride-rich lipoproteins, and shares a...

  8. Epithermal neutron flux in the experimental channels of the RA reactor; Fluks epitermalnih neutrona u eksperimentalnim kanalima reaktora RA

    Energy Technology Data Exchange (ETDEWEB)

    Raisic, N; Dobrosavljevic, N [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    Epithermal neutron flux was determined by measuring the cadmium ratio from activation analysis of gold and indium foils. Irradiation was done in experimental channels VK-5, VK-2, VK-7, VK-0, VK-HS next to the core, and next to the fuels elements. Activation of bare foils and foils covered by 0.8 and 1.0 mm thick cadmium foils was done simultaneously. Activity was measured by GM counter. Corrections were done for resonant neutrons self-absorption since the foils used were too thick concerning most important resonances of gold and indium. Final results were presented as spectrum factor r for their direct use in determining the effective neutron cross sections.

  9. Acquired absolute vitamin K deficiency in a patient undergoing warfarin therapy.

    Science.gov (United States)

    Takada, Hiroaki; Toru, Hifumi; Bunya, Naofumi; Kiriu, Nobuaki; Kato, Hiroshi; Koido, Yuichi; Yasuhiro, Kuroda

    2014-06-01

    We report a case of absolute vitamin K deficiency (VKD) diagnosed by measuring serum VK levels in an elderly woman undergoing warfarin therapy. A 78-year-old woman was admitted to our hospital because of dyspnea and sore throat diagnosed as pharyngitis 1 week before admission. On admission, the sore throat had exacerbated and dyspnea developed. She had history of atrial fibrillation, for which warfarin 1.5 mg/d was started approximately 10 years prior and her international normalized ratio (INR) had been maintained at an acceptable therapeutic level. Blood results revealed unmeasurable INR and abnormally prolonged activated partial thromboplastin time (APTT). She was diagnosed with adenoiditis and warfarin-related coagulopathy and administered intravenous VK (20 mg) and fresh frozen plasma (FFP; 4 U), which improved INR and APTT. Since the coagulopathy responded to intravenous VK administration, the patient was clinically diagnosed with warfarin-related relative VKD. Approximately 1 month later, she returned with complaints of sore throat. Blood results indicated abnormal INR (7.22) and APTT (N80.0 s). She was diagnosed with recurrent adenoiditis and VK deficient coagulopathy. The patient’s serum VK levels were low (VK1 level, 0.13 ng/mL; VK2 levels, 0.85 ng/mL). Initial treatment of VK (20 mg) and FFP followed by intravenous VK (20 mg/d) for 6 days, her symptoms dissipated. Warfarin was suspected to have caused absolute VKD. Severe coagulopathy in patients undergoing warfarin therapy is primarily caused by, relative VKD. However, the possibility of warfarin-related absolute VKD should be suspected when INRis not sufficiently improved by intravenous VK administration.

  10. Vitamin K2 improves developmental competency and cryo-tolerance of in vitro derived ovine blastocyst.

    Science.gov (United States)

    Sefid, Fatemeh; Ostadhosseini, S; Hosseini, S M; Ghazvini Zadegan, F; Pezhman, M; Nasr Esfahani, Mohammad Hossein

    2017-08-01

    Vitamin K2 (VK2), acts as an electron carrier in mitochondria and thereby effects reactive oxygen species (ROS) and ATP production. This study evaluates role of VK2 on in vitro developmental competency and cryo-survival of pre-implantation ovine embryos. Initially the optimal and beneficial concentration of VK2 on compaction and blastocyst formation rates was defined (0.1 μM). Subsequently, it was shown that 0.1 μM VK2, at blastocyst stage, reduces H2O2 production, increase the expression of mitochondrial related gene and improved embryos quality. We further assessed presence VK2 supplementation before and/or after vitrification of in vitro derived blastocysts. Our results reveal that presence of VK2 before and after vitrification improves rates of blastocysts re-expansion (88.19± 3.37% vs 73.68± 1.86%, P < 0.05) and hatching (49.55± 4.37% vs 32.7± 3.32%) compared to control group. These observation were consistent with reduction in H2O2 production and improved in expression of mitochondrial related genes. However, VK2 before or after vitrification, not only had no positive effect on these two parameters, but also significantly reduced these parameters. Therefore, in concordance with pervious report in bovine, we show that VK2 supplementation post genomic activation (Day 3-7) improved developmental competency of ovine in vitro derived embryos. We also showed that presence of VK2 after vitrification improves the cryo-survival of ovine embryos. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Prevalence and Predictors of Functional Vitamin K Insufficiency in Mothers and Newborns in Uganda

    Directory of Open Access Journals (Sweden)

    Data Santorino

    2015-10-01

    Full Text Available Vitamin K deficiency bleeding (VKDB in infancy is a serious but preventable cause of mortality or permanent disability. Lack of epidemiologic data for VKDB in sub-Saharan Africa hinders development and implementation of effective prevention strategies. We used convenience sampling to consecutively enroll mothers delivering in a southwestern Uganda Hospital. We collected socio-demographic and dietary information, and paired samples of maternal venous and neonatal cord blood for the immunoassay of undercarboxylated prothrombin (PIVKA-II, a sensitive marker of functional vitamin K (VK insufficiency. We used univariable and multivariable logistic regression models to identify predictors of VK insufficiency. We detected PIVKA-II of ≥0.2 AU (Arbitrary Units per mL/mL (indicative of VK insufficiency in 33.3% (47/141 of mothers and 66% (93/141 of newborns. Importantly, 22% of babies had PIVKA-II concentrations ≥5.0 AU/mL, likely to be associated with abnormal coagulation indices. We found no significant predictors of newborn VK insufficiency, including infant weight (AOR (adjusted odds ratio 1.85, 95% CI (confidence interval 0.15–22.49, gender (AOR 0.54, 95% CI 0.26–1.11, term birth (AOR 0.72, 95% CI 0.20–2.62, maternal VK-rich diet (AOR 1.13, 95% CI 0.55–2.35 or maternal VK insufficiency (AOR 0.99, 95% CI 0.47–2.10. VK insufficiency is common among mothers and newborn babies in southwestern Uganda, which in one fifth of babies nears overt deficiency. Lack of identifiable predictors of newborn VK insufficiency support strategies for universal VK prophylaxis to newborns to prevent VKDB.

  12. The epithermal neutron-flux distribution in the reactor RA - Vinca

    International Nuclear Information System (INIS)

    Marinkov, V.; Bikit, I.; Martinc, R.; Veskovic, M.; Slivka, J.; Vaderna, S.

    1987-01-01

    The distribution of the epithermal neutron flux in the reactor RA - Vinca has been measured by means of Zr - activation detectors. In the channel VK-8 non-homogeneous flux distribution was observed (author) [sr

  13. THE EMISSION, LIFETIMES, AND FORMATION THRESHOLD OF THE VEGARD–KAPLAN TRANSITION OF SOLID NITROGEN EXPOSED TO FAR-ULTRAVIOLET RADIATION

    International Nuclear Information System (INIS)

    Lu, Hsiao-Chi; Lo, Jen-Iu; Peng, Yu-Chain; Chou, Sheng-Lung; Lin, Meng-Yeh; Cheng, Bing-Ming

    2016-01-01

    Irradiation of solid nitrogen at 4 K with far-ultraviolet light from a synchrotron caused excitation to the upper state of the Vegard–Kaplan (VK) system; the emission in that system was simultaneously recorded in wavelength region 200–440 nm. The lifetimes of emission lines for VK (0, 1) to (0, 12) transitions were measured in the range of 2.12 ∼ 2.65 s. The threshold wavelength to observe the VK emission was 175.0 ± 3.5 nm, corresponding to energy 7.08 ± 0.14 eV. This investigation of the generation of icy VK nitrogen enhances our understanding of its photochemistry in space.

  14. Veterans Crisis Line: Videos About Reaching out for Help

    Medline Plus

    Full Text Available ... v/K5u3sb-Dbkc Watch additional videos about getting help. Behind the Scenes see more videos from Veterans Health Administration Be There: Help Save a Life see more videos from Veterans ...

  15. Study on vitamin K 3-cyclodextrin inclusion complex and analytical application

    Science.gov (United States)

    Zhenming, Dong; Xiuping, Liu; Guomei, Zhang; Shaomin, Shuang; Jinghao, Pan

    2003-07-01

    The inclusion interaction of the complexes between Vitamin K3 (VK3) and β-cyclodextrin (β-CD), hydroxypropyl-β-cyclodextrin (HP-β-CD) and sulfobutylether-β-cyclodextrin (SBE-β-CD) were studied by using steady-state fluorescence measurements. The various factors affecting the inclusion process were examined in detail. The formation constants and inclusion stoichiometry for VK3-CDs were determined. The results showed that the inclusion ability of β-CD and its derivatives was the order: SBE-β-CD>HP-β-CD>β-CD. The related inclusion mechanism is proposed to explain the inclusion process. A method of determining VK3 was established with the linear range was 2.5×10-6-5.0×10-4 M, and was used to determine the VK3 tablets. The recoveries were in the range of 97.52-103.5%. The results were satisfactory.

  16. The potential of vitamin K3 as an anticancer agent against breast cancer that acts via the mitochondria-related apoptotic pathway.

    Science.gov (United States)

    Akiyoshi, Takeshi; Matzno, Sumio; Sakai, Mika; Okamura, Noboru; Matsuyama, Kenji

    2009-12-01

    We tried to clarify the cytotoxic mechanism of VK(3) using the breast cancer cell line MCF-7. Cytotoxicity was measured via intracellular esterase activity. DNA fragmentation was assessed by agarose gel electrophoresis. JC-1 staining was applied to measure mitochondrial dysfunction. Caspase activation and reactive oxidative species (ROS) generation were also measured. VK(3) exhibited cytotoxicity that caused DNA fragmentation in MCF-7 cells with an IC(50) of 14.2 microM. JC-1 staining revealed that VK(3) caused mitochondrial dysfunction including a disappearance of mitochondrial membrane potential. Additional investigation showed that the mitochondrial damage was induced by the generation of ROS and the subsequent activation of caspase-7 and -9. Our findings demonstrate that VK(3)-induced apoptosis is selectively initiated by the mitochondria-related pathway and might be useful in breast cancer chemotherapy.

  17. Joonisfilmid / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2005-01-01

    Eesti Joonisfilm ja Nukufilm üllitasid firma V&K Holding kaudu kaks videokassetti "Armastuskolmnurgad" ja "Rebasenaine läheb taevasse" eesti noorte animaatorite Kaspar Jancise, Ülo Pikkovi ja Priit Tenderi loominguga

  18. African Journal of Biotechnology - Vol 12, No 18 (2013)

    African Journals Online (AJOL)

    RNA interference: A novel tool for plant disease management · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VK Sharma, Gulzar S Sanghera, Prem L Kashyap, Brij Bihari Sharma, Chandresh Chandel ...

  19. Effect of oxygen intercalation on properties of sputtered CuYO 2 for ...

    Indian Academy of Sciences (India)

    Keywords. Transparent conducting oxide; RF sputtering; -type TCO. ... The positive sign of Seebeck coefficient (+274 VK-1) confirms the -type conductivity of the films. The optical bandgap of CuYO2 ... Bulletin of Materials Science | News.

  20. Klassika kauplemine / Ede Schank

    Index Scriptorium Estoniae

    Schank, Ede

    2003-01-01

    Kultuuriministeerium toetab väärtfilmiklassika jõudmist Eesti videolevisse, tehes peamiselt koostööd firmaga V&K Holding. Ka OÜ Sonatiin püüab tegutseda samas suunas. Firmadevahelistest vastuoludest

  1. THE EMISSION, LIFETIMES, AND FORMATION THRESHOLD OF THE VEGARD–KAPLAN TRANSITION OF SOLID NITROGEN EXPOSED TO FAR-ULTRAVIOLET RADIATION

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Hsiao-Chi; Lo, Jen-Iu; Peng, Yu-Chain; Chou, Sheng-Lung; Lin, Meng-Yeh; Cheng, Bing-Ming, E-mail: bmcheng@nsrrc.org.tw [National Synchrotron Radiation Research Center, No. 101, Hsin-Ann Road, Hsinchu Science Park, Hsinchu 30076, Taiwan (China)

    2016-11-20

    Irradiation of solid nitrogen at 4 K with far-ultraviolet light from a synchrotron caused excitation to the upper state of the Vegard–Kaplan (VK) system; the emission in that system was simultaneously recorded in wavelength region 200–440 nm. The lifetimes of emission lines for VK (0, 1) to (0, 12) transitions were measured in the range of 2.12 ∼ 2.65 s. The threshold wavelength to observe the VK emission was 175.0 ± 3.5 nm, corresponding to energy 7.08 ± 0.14 eV. This investigation of the generation of icy VK nitrogen enhances our understanding of its photochemistry in space.

  2. The Emission, Lifetimes, and Formation Threshold of the Vegard-Kaplan Transition of Solid Nitrogen Exposed to Far-ultraviolet Radiation

    Science.gov (United States)

    Lu, Hsiao-Chi; Lo, Jen-Iu; Peng, Yu-Chain; Chou, Sheng-Lung; Lin, Meng-Yeh; Cheng, Bing-Ming

    2016-11-01

    Irradiation of solid nitrogen at 4 K with far-ultraviolet light from a synchrotron caused excitation to the upper state of the Vegard-Kaplan (VK) system; the emission in that system was simultaneously recorded in wavelength region 200-440 nm. The lifetimes of emission lines for VK (0, 1) to (0, 12) transitions were measured in the range of 2.12 ˜ 2.65 s. The threshold wavelength to observe the VK emission was 175.0 ± 3.5 nm, corresponding to energy 7.08 ± 0.14 eV. This investigation of the generation of icy VK nitrogen enhances our understanding of its photochemistry in space.

  3. DVD-plaatide hind langeb / Ivar Sild

    Index Scriptorium Estoniae

    Sild, Ivar

    2003-01-01

    DVD (Digital Versatile Disk = digitaalne mitmekülgne plaat) kui ka juba Eestis videolindiga edukalt konkureeriv audiovisuaalse info kandja. Ivar Vendelin firmast V&K Holding loodab jõuda DVDga massidesse

  4. High prevalence of co-infection with multiple Torque teno sus virus species in Italian pig herds.

    Directory of Open Access Journals (Sweden)

    Sylvain Blois

    Full Text Available Torque teno viruses (TTVs are a large group of vertebrate-infecting small viruses with circular single-stranded DNA, classified in the Anelloviridae family. In swine, two genetically distinct species, Torque teno sus virus 1a (TTSuV1a and 1b (TTSuV1b are currently grouped into the genus Iotatorquevirus. More recently, a novel Torque teno sus virus species, named Torque teno sus virus k2b (TTSuVk2b, has been included with Torque teno sus virus k2a (TTSuVk2a into the genus Kappatorquevirus. In the present study, TTSuV1 (TTSuV1a and TTSuV1b, TTSuVk2a and TTSuVk2b prevalence was evaluated in 721 serum samples of healthy pigs from Sardinian farms, insular Italy. This is the largest study to date on the presence of TTSuV in healthy pigs in Italy. The global prevalence of infection was 83.2% (600/721, being 62.3% (449/721, 60.6% (437/721, and 11.5% (83/721 the prevalence of TTSuV1, TTSuVk2a and TTSuVk2b, respectively. The rate of co-infection with two and/or three species was also calculated, and data show that co-infections were significantly more frequent than infections with single species, and that TTSuV1+TTSuVk2a double infection was the prevalent combination (35.4%. Quantitative results obtained using species-specific real time-qPCR evidenced the highest mean levels of viremia in the TTSuV1 subgroup, and the lowest in the TTSuVk2b subgroup. Interestingly, multiple infections with distinct TTSuV species seemed to significantly affect the DNA load and specifically, data highlighted that double infection with TTSuVk2a increased the viral titers of TTSuV1, likewise the co-infection with TTSuVk2b increased the titers of TTSuVk2a.

  5. High prevalence of co-infection with multiple Torque teno sus virus species in Italian pig herds.

    Science.gov (United States)

    Blois, Sylvain; Mallus, Francesca; Liciardi, Manuele; Pilo, Cristian; Camboni, Tania; Macera, Lisa; Maggi, Fabrizio; Manzin, Aldo

    2014-01-01

    Torque teno viruses (TTVs) are a large group of vertebrate-infecting small viruses with circular single-stranded DNA, classified in the Anelloviridae family. In swine, two genetically distinct species, Torque teno sus virus 1a (TTSuV1a) and 1b (TTSuV1b) are currently grouped into the genus Iotatorquevirus. More recently, a novel Torque teno sus virus species, named Torque teno sus virus k2b (TTSuVk2b), has been included with Torque teno sus virus k2a (TTSuVk2a) into the genus Kappatorquevirus. In the present study, TTSuV1 (TTSuV1a and TTSuV1b), TTSuVk2a and TTSuVk2b prevalence was evaluated in 721 serum samples of healthy pigs from Sardinian farms, insular Italy. This is the largest study to date on the presence of TTSuV in healthy pigs in Italy. The global prevalence of infection was 83.2% (600/721), being 62.3% (449/721), 60.6% (437/721), and 11.5% (83/721) the prevalence of TTSuV1, TTSuVk2a and TTSuVk2b, respectively. The rate of co-infection with two and/or three species was also calculated, and data show that co-infections were significantly more frequent than infections with single species, and that TTSuV1+TTSuVk2a double infection was the prevalent combination (35.4%). Quantitative results obtained using species-specific real time-qPCR evidenced the highest mean levels of viremia in the TTSuV1 subgroup, and the lowest in the TTSuVk2b subgroup. Interestingly, multiple infections with distinct TTSuV species seemed to significantly affect the DNA load and specifically, data highlighted that double infection with TTSuVk2a increased the viral titers of TTSuV1, likewise the co-infection with TTSuVk2b increased the titers of TTSuVk2a.

  6. K-Cl cotransporters, cell volume homeostasis, and neurological disease.

    Science.gov (United States)

    Kahle, Kristopher T; Khanna, Arjun R; Alper, Seth L; Adragna, Norma C; Lauf, Peter K; Sun, Dandan; Delpire, Eric

    2015-08-01

    K(+)-Cl(-) cotransporters (KCCs) were originally characterized as regulators of red blood cell (RBC) volume. Since then, four distinct KCCs have been cloned, and their importance for volume regulation has been demonstrated in other cell types. Genetic models of certain KCCs, such as KCC3, and their inhibitory WNK-STE20/SPS1-related proline/alanine-rich kinase (SPAK) serine-threonine kinases, have demonstrated the evolutionary necessity of these molecules for nervous system cell volume regulation, structure, and function, and their involvement in neurological disease. The recent characterization of a swelling-activated dephosphorylation mechanism that potently stimulates the KCCs has pinpointed a potentially druggable switch of KCC activity. An improved understanding of WNK/SPAK-mediated KCC cell volume regulation in the nervous system might reveal novel avenues for the treatment of multiple neurological diseases. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Effects of Intermediates between Vitamins K2 and K3 on Mammalian DNA Polymerase Inhibition and Anti-Inflammatory Activity

    Directory of Open Access Journals (Sweden)

    Takeshi Azuma

    2011-02-01

    Full Text Available Previously, we reported that vitamin K3 (VK3, but not VK1 or VK2 (=MK-4, inhibits the activity of human DNA polymerase γ (pol γ. In this study, we chemically synthesized three intermediate compounds between VK2 and VK3, namely MK-3, MK-2 and MK-1, and investigated the inhibitory effects of all five compounds on the activity of mammalian pols. Among these compounds, MK-2 was the strongest inhibitor of mammalian pols α, κ and λ, which belong to the B, Y and X families of pols, respectively; whereas VK3 was the strongest inhibitor of human pol γ, an A-family pol. MK-2 potently inhibited the activity of all animal species of pol tested, and its inhibitory effect on pol λ activity was the strongest with an IC50 value of 24.6 μM. However, MK-2 did not affect the activity of plant or prokaryotic pols, or that of other DNA metabolic enzymes such as primase of pol α, RNA polymerase, polynucleotide kinase or deoxyribonuclease I. Because we previously found a positive relationship between pol λ inhibition and anti-inflammatory action, we examined whether these compounds could inhibit inflammatory responses. Among the five compounds tested, MK-2 caused the greatest reduction in 12-O-tetradecanoylphorbol-13-acetate (TPA-induced acute inflammation in mouse ear. In addition, in a cell culture system using mouse macrophages, MK-2 displayed the strongest suppression of the production of tumor necrosis factor (TNF-α induced by lipopolysaccharide (LPS. Moreover, MK-2 was found to inhibit the action of nuclear factor (NF-κB. In an in vivo mouse model of LPS-evoked acute inflammation, intraperitoneal injection of MK-2 in mice led to suppression of TNF-α production in serum. In conclusion, this study has identified VK2 and VK3 intermediates, such as MK-2, that are promising anti-inflammatory candidates.

  8. Komodo dragon-inspired synthetic peptide DRGN-1 promotes wound-healing of a mixed-biofilm infected wound

    OpenAIRE

    M.C. Chung, Ezra; Dean, Scott N.; Propst, Crystal N.; Bishop, Barney M.; van Hoek, Monique L.

    2017-01-01

    Cationic antimicrobial peptides are multifunctional molecules that have a high potential as therapeutic agents. We have identified a histone H1-derived peptide from the Komodo dragon (Varanus komodoensis), called VK25. Using this peptide as inspiration, we designed a synthetic peptide called DRGN-1. We evaluated the antimicrobial and anti-biofilm activity of both peptides against Pseudomonas aeruginosa and Staphylococcus aureus. DRGN-1, more than VK25, exhibited potent antimicrobial and anti-...

  9. Immune Responses and Protection of Aotus Monkeys Immunized with Irradiated Plasmodium vivax Sporozoites

    Science.gov (United States)

    2011-01-01

    The experimental protocol was approved by the Animal Ethical Committee of the Universidad del Valle (Cali). Parasite and irradiation. Plasmodium...three repeats ofpll (GDRADGPA) and (ANGAGNQPG) sequences, derived from VK210 and VK247 CS variants, respectively. A non-malaria related peptide Ptt30...Universidad del Valle and Centro Internacional de Vacunas, Cali, Colombia, E-mails: alejovi@hotmail.com, anbonelo@yahoo.com, alejcaste@yahoo.com

  10. Creating a Connected Community: Lessons Learned from the Western New York Beacon Community

    Science.gov (United States)

    Maloney, Nancy; Heider, Arvela R.; Rockwood, Amy; Singh, Ranjit

    2014-01-01

    Introduction: Secure exchange of clinical data among providers has the potential to improve quality, safety, efficiency, and reduce duplication. Many communities are experiencing challenges in building effective health information exchanges (HIEs). Previous studies have focused on financial and technical issues regarding HIE development. This paper describes the Western New York (WNY) HIE growth and lessons learned about accelerating progress to become a highly connected community. Methods: HEALTHeLINK, with funding from the Office of the National Coordinator for Health Information Technology (ONC) under the Beacon Community Program, expanded HIE usage in eight counties. The communitywide transformation process used three main drivers: (1) a communitywide Electronic Health Record (EHR) adoption program; (2) clinical transformation partners; and (3) HIE outreach and infrastructure development. Results: ONC Beacon Community funding allowed WNY to achieve a new level in the use of interoperable HIE. Electronic delivery of results into the EHR expanded from 23 practices in 2010 to 222 practices in 2013, a tenfold increase. There were more than 12.5 million results delivered electronically (HL7 messages) to 222 practices’ EHRs via the HIE in 2013. Use of a secure portal and Virtual Health Record (VHR) to access reports (those not delivered directly to the EHR) also increased significantly, from 13,344 report views in 2010 to over 600,000 in 2013. Discussion and Conclusion: The WNY Beacon successfully expanded the sharing of clinical information among different sources of data and providers, creating a highly connected community to improve the quality and continuity of care. Technical, organizational, and community lessons described in this paper should prove beneficial to others as they pursue efforts to create connected communities. PMID:25848618

  11. Mechanisms of CFTR Functional Variants That Impair Regulated Bicarbonate Permeation and Increase Risk for Pancreatitis but Not for Cystic Fibrosis

    OpenAIRE

    LaRusch, Jessica; Jung, Jinsei; General, Ignacio J.; Lewis, Michele D.; Park, Hyun Woo; Brand, Randall E.; Gelrud, Andres; Anderson, Michelle A.; Banks, Peter A.; Conwell, Darwin; Lawrence, Christopher; Romagnuolo, Joseph; Baillie, John; Alkaade, Samer; Cote, Gregory

    2014-01-01

    CFTR is a dynamically regulated anion channel. Intracellular WNK1-SPAK activation causes CFTR to change permeability and conductance characteristics from a chloride-preferring to bicarbonate-preferring channel through unknown mechanisms. Two severe CFTR mutations (CFTRsev ) cause complete loss of CFTR function and result in cystic fibrosis (CF), a severe genetic disorder affecting sweat glands, nasal sinuses, lungs, pancreas, liver, intestines, and male reproductive system. We hypothesize tha...

  12. Optimization of Extended Relational Database Systems

    Science.gov (United States)

    1986-07-23

    control functions are integrated into a single system in a homogeneoua way. As a first exam - ple, consider previous work in supporting various semantic...sizes are reduced and, wnk? quently, the number of materializations that will be needed is aba lower. For exam - pie, in the above query tuple...retrieve (EMP.name) where EMP hobbies instrument = ’ violin ’ When the various entries in the hobbies field are materialized, only those queries that

  13. Generation and analysis of knock-in mice carrying pseudohypoaldosteronism type II-causing mutations in the cullin 3 gene.

    Science.gov (United States)

    Araki, Yuya; Rai, Tatemitsu; Sohara, Eisei; Mori, Takayasu; Inoue, Yuichi; Isobe, Kiyoshi; Kikuchi, Eriko; Ohta, Akihito; Sasaki, Sei; Uchida, Shinichi

    2015-10-21

    Pseudohypoaldosteronism type II (PHAII) is a hereditary hypertensive disease caused by mutations in four different genes: with-no-lysine kinases (WNK) 1 and 4, Kelch-like family member 3 (KLHL3), and cullin 3 (Cul3). Cul3 and KLHL3 form an E3 ligase complex that ubiquitinates and reduces the expression level of WNK4. PHAII-causing mutations in WNK4 and KLHL3 impair WNK4 ubiquitination. However, the molecular pathogenesis of PHAII caused by Cul3 mutations is unclear. In cultured cells and human leukocytes, PHAII-causing Cul3 mutations result in the skipping of exon 9, producing mutant Cul3 protein lacking 57 amino acids. However, whether this phenomenon occurs in the kidneys and is responsible for the pathogenesis of PHAII in vivo is unknown. We generated knock-in mice carrying a mutation in the C-terminus of intron 8 of Cul3, c.1207-1G>A, which corresponds to a PHAII-causing mutation in the human Cul3 gene. Heterozygous Cul3(G(-1)A/+) knock-in mice did not exhibit PHAII phenotypes, and the skipping of exon 9 was not evident in their kidneys. However, the level of Cul3 mRNA expression in the kidneys of heterozygous knock-in mice was approximately half that of wild-type mice. Furthermore, homozygous knock-in mice were nonviable. It suggested that the mutant allele behaved like a knockout allele and did not produce Cul3 mRNA lacking exon 9. A reduction in Cul3 expression alone was not sufficient to develop PHAII in the knock-in mice. Our findings highlighted the pathogenic role of mutant Cul3 protein and provided insight to explain why PHAII-causing mutations in Cul3 cause kidney-predominant PHAII phenotypes. © 2015. Published by The Company of Biologists Ltd.

  14. Microscopic Aspects of Autoschizic Cell Death in Human Ovarian Carcinoma (2774) Cells Following Vitamin C, Vitamin K3 or Vitamin C:K3 Treatment

    Science.gov (United States)

    Gilloteaux, Jacques; Jamison, James M.; Arnold, David; Taper, Henryk S.; von Gruenigen, Vivian E.; Summers, Jack L.

    2003-08-01

    Human ovarian carcinoma cells (MDAH 2774) were treated with sodium ascorbate (VC), menadione (VK3), or with a VC:VK3 combination for 1 h and then studied using light microscopy (LM) and scanning (SEM) and transmission electron (TEM) microscopy. Plasma membrane damage (blisters and blebs, hairy aspect) results from vitamin C (VC) treatment, while cytoskeletal damage and self-morsellation are caused by vitamin K3 (VK3) treatment. VC:VK3-treated cells exhibit exacerbated injuries characteristic of both VC and VK3 treatment as well as a significant decrease in cell diameters from 20 35 [mu]m for control cells to 7 12 [mu]m for VC:VK3 treatment. Moreover, after a 1-h exposure to the vitamin combination, autoschizis (43%), apoptosis (3%), and oncosis (1.9%) are observed at the percentages indicated. All cellular changes associated with autoschizis observed with SEM were confirmed by LM and TEM observations and are consistent with cell death by autoschizis: decrease in cell size, cytoplasmic self-excisions, degradation of the nucleus and nucleolus without formation of apoptotic bodies and, ultimately, karyorrhexis and karyolysis. These results also suggest that the vitamin combination may find clinical use in the treatment of ovarian cancer.

  15. alpha-Tocopheryl succinate promotes selective cell death induced by vitamin K3 in combination with ascorbate.

    Science.gov (United States)

    Tomasetti, M; Strafella, E; Staffolani, S; Santarelli, L; Neuzil, J; Guerrieri, R

    2010-04-13

    A strategy to reduce the secondary effects of anti-cancer agents is to potentiate the therapeutic effect by their combination. A combination of vitamin K3 (VK3) and ascorbic acid (AA) exhibited an anti-cancer synergistic effect, associated with extracellular production of H(2)O(2) that promoted cell death. The redox-silent vitamin E analogue alpha-tocopheryl succinate (alpha-TOS) was used in combination with VK3 and AA to evaluate their effect on prostate cancer cells. Prostate cancer cells were sensitive to alpha-TOS and VK3 treatment, but resistant to AA upto 3.2 mM. When combined, a synergistic effect was found for VK3-AA, whereas alpha-TOS-VK3 and alpha-TOS-AA combination showed an antagonist and additive effect, respectively. However, sub-lethal doses of AA-VK3 combination combined with a sub-toxic dose of alpha-TOS showed to induce efficient cell death that resembles autoschizis. Associated with this cell demise, lipid peroxidation, DNA damage, cytoskeleton alteration, lysosomal-mitochondrial perturbation, and release of cytochrome c without caspase activation were observed. Inhibition of lysosomal proteases did not attenuate cell death induced by the combined agents. Furthermore, cell deaths by apoptosis and autoschizis were detected. These finding support the emerging idea that synergistic combinations of some agents can overcome toxicity and other side-effects associated with high doses of single drugs creating the opportunity for therapeutically relevant selectivity.

  16. ज्वार-भाटा: एक समुद्री प्रक्रिया

    Digital Repository Service at National Institute of Oceanography (India)

    Singh, J.; VijayKumar, K.

    Ecj 2013 t; flag ,oa fot; dqekj dukSft;k Foh dk yxHkx 71 izfr'kr Hkkx ikuh ls vkSj egk}hi vofLFkr gSaA i`Foh dk cM+k Hkkx tks ikuh ls vkSj bl leqnz dks dbZ lkxjksa vk... ,oa eè; Hkkx½ mu yksxksa ds fy, leqnz ls lacafèkr Kku fdlh dkSrwgy ls de ugha gSA èkjrh ds leku leqnz esa Hkh cgqr lh izfØ;k,a gksrh jgrh gSa ftuesa ,d izfØ;k Tokj&HkkVk gSA Tokj&HkkVk ,d izkd`frd izfØ;k gS tks panzek] lw;Z vkSj i`Foh ds la;qDr xq...

  17. A novel liquid chromatography-tandem mass spectrometry method for determination of menadione in human plasma after derivatization with 3-mercaptopropionic acid.

    Science.gov (United States)

    Liu, Ruijuan; Wang, Mengmeng; Ding, Li

    2014-10-01

    Menadione (VK3), an essential fat-soluble naphthoquinone, takes very important physiological and pathological roles, but its detection and quantification is challenging. Herein, a new method was developed for quantification of VK3 in human plasma by liquid chromatography-tandem mass spectrometry (LC-MS/MS) after derivatization with 3-mercaptopropionic acid via Michael addition reaction. The derivative had been identified by the mass spectra and the derivatization conditions were optimized by considering different parameters. The method was demonstrated with high sensitivity and a low limit of quantification of 0.03 ng mL(-1) for VK3, which is about 33-fold better than that for the direct analysis of the underivatized compound. The method also had good precision and reproducibility. It was applied in the determination of basal VK3 in human plasma and a clinical pharmacokinetic study of menadiol sodium diphosphate. Furthermore, the method for the quantification of VK3 using LC-MS/MS was reported in this paper for the first time, and it will provide an important strategy for the further research on VK3 and menadione analogs. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Simultaneous estimation of vitamin K1 and heparin with low limit of detection using cascaded channels fiber optic surface plasmon resonance.

    Science.gov (United States)

    Tabassum, Rana; Gupta, Banshi D

    2016-12-15

    We report an approach for the simultaneous estimation of vitamin K1 (VK1) and heparin via cascaded channel multianalyte sensing probe employing fiber optic surface plasmon resonance technique. Cladding from two well separated portions of the fiber is removed and are respectively coated with thin films of silver (channel-1) and copper (channel-2). The nanohybrid of multiwalled carbon nanotube in chitosan is fabricated over silver layer for the sensing of VK1 whereas core shell nanostructure of polybrene@ZnO is coated over copper layer for the sensing of heparin. Spectral interrogation method is used for the characterization of the sensor. Analyte selectivity of both the channels is performed by carrying out experiments using independent solutions of VK1 and heparin. Experiments performed on the solution of the mixture of VK1 and heparin show red shifts in both the channels on changing the concentration of both the analytes in the mixture. The operating range of both VK1 and heparin is from 0 to 10(-3)g/l. The limit of detection of the sensor is 2.66×10(-4)µg/l and 2.88×10(-4)µg/l for VK1 and heparin respectively which are lower than the reported ones. The additional advantages of the present sensor are low cost, possibility of online monitoring and remote sensing. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. IEEE Conference Record of 1978 Thirteenth Pulse Power Modulator Symposium, Buffalo, New York, 20-22 June 1978.

    Science.gov (United States)

    1978-01-01

    tubes must be made to fire simultane- ously. As the rising edge of the output pulse becomes faster, jitter and drift in_____ turn become more important...S. In separate tests this oil In combination with mylar - The jetting action from the perforations in the tube copper windings had a breakdown strength...173 SESSIO VuI - SWITCHES Wni AN I~RMW CAPAB~LY’ A 100-kY W0A Long-Pukse Switch Tube , £6.L MeNera, EIMAC Division of Varian

  20. The utility of vitamin K3 (menadione) against pancreatic cancer.

    Science.gov (United States)

    Osada, Shinji; Tomita, Hiroyuki; Tanaka, Yoshihiro; Tokuyama, Yasuharu; Tanaka, Hidenori; Sakashita, Fumio; Takahashi, Takao

    2008-01-01

    To evaluate the efficacy of vitamin K3 (VK3) against pancreatic cancer, the molecular mechanism of VK3 or gemcitabine (GEM)-induced inhibition of proliferation was characterized. The cell viability was determined using the 3-[4,5-dimethylthiazol]-2,5-diphenyl tetrazolium bromide (MTT) test method. The expressions of cellular proteins were evaluated by Western blot analysis. For morphological studies of the in vivo transplanted cancer cells, the tissues were stained with hematoxylin and eosin. The IC50 of VK3 for pancreatic cancer cells was calculated for 42.1 +/- 3.5 microM. Western blot analysis showed that VK3 induced rapid phosphorylation of extracellular signal-regulated kinase (ERK) and c-Jun NH2-terminal kinase (JNK) 30 minutes after application. ERK but not JNK phosphorylation was maintained for at least 12 hours. Activation of apoptosis by VK3, as shown by molecular weight shifts of the pro-activated 32-kDa form of caspase-3 and poly(ADP-ribose)polymerase (PARP) cleavage of the 112-kDa form, was found. Treatment with the thiol antioxidant, L-cysteine (>0.2 mM), completely abrogated the VK3-induced phosphorylation of ERK, but not the JNK, and inhibition of proliferation. A caspase-3 inhibitor antagonized caspase-3 activation, but had no inhibitory effect on the proliferative activity of VK3. GEM at concentrations >0.1 microg/ml was found to inhibit cell proliferation after 24 hours. GEM also induced phosphorylation of JNK, activation of caspase-3 and accumulation of cyclin B1. Local application of VK3 was found to induce extensive tumor tissue necrosis, but slight hematemesis without necrosis was observed 48 hours after GEM injection. In Western blot, ERK but not JNK phosphorylation, was clearly detected in response to VK3 injection into the tumor tissue. The action of VK3 may lead to a favorable outcome against pancreatic cancer, and the detection of ERK phosphorylation in the tissue is important for predicting this effect.

  1. 2-Bromo-1,4-naphthoquinone: a potentially improved substitute of menadione in Apatone™ therapy

    Directory of Open Access Journals (Sweden)

    F.S. Graciani

    2012-08-01

    Full Text Available Apatone™, a combination of menadione (2-methyl-1,4-naphthoquinone, VK3 and ascorbic acid (vitamin C, VC is a new strategy for cancer treatment. Part of its effect on tumor cells is related to the cellular pro-oxidative imbalance provoked by the generation of hydrogen peroxide (H2O2 through naphthoquinone redox cycling. In this study, we attempted to find new naphthoquinone derivatives that would increase the efficiency of H2O2 production, thereby potentially increasing its efficacy for cancer treatment. The presence of an electron-withdrawing group in the naphthoquinone moiety had a direct effect on the efficiency of H2O2 production. The compound 2-bromo-1,4-naphthoquinone (BrQ, in which the bromine atom substituted the methyl group in VK3, was approximately 10- and 19-fold more efficient than VK3 in terms of oxygen consumption and H2O2 production, respectively. The ratio [H2O2]produced / [naphthoquinone]consumed was 68 ± 11 and 5.8 ± 0.2 (µM/µM for BrQ and VK3, respectively, indicating a higher efficacy of BrQ as a catalyst for the autoxidation of ascorbic acid. Both VK3 and BrQ reacted with glutathione (GSH, but BrQ was the more effective substrate. Part of GSH was incorporated into the naphthoquinone, producing a nucleophilic substitution product (Q-SG. The depletion of BrQ by GSH did not prevent its redox capacity since Q-SG was also able to catalyze the production of reactive oxygen species. VK3/VC has already been submitted to clinical trials for the treatment of prostate cancer and has demonstrated promising results. However, replacement of VK3 with BrQ will open new lines of investigation regarding this approach to cancer treatment.

  2. 2-Bromo-1,4-naphthoquinone: a potentially improved substitute of menadione in Apatone™ therapy

    International Nuclear Information System (INIS)

    Graciani, F.S.; Ximenes, V.F.

    2012-01-01

    Apatone™, a combination of menadione (2-methyl-1,4-naphthoquinone, VK 3 ) and ascorbic acid (vitamin C, VC) is a new strategy for cancer treatment. Part of its effect on tumor cells is related to the cellular pro-oxidative imbalance provoked by the generation of hydrogen peroxide (H 2 O 2 ) through naphthoquinone redox cycling. In this study, we attempted to find new naphthoquinone derivatives that would increase the efficiency of H 2 O 2 production, thereby potentially increasing its efficacy for cancer treatment. The presence of an electron-withdrawing group in the naphthoquinone moiety had a direct effect on the efficiency of H 2 O 2 production. The compound 2-bromo-1,4-naphthoquinone (BrQ), in which the bromine atom substituted the methyl group in VK 3 , was approximately 10- and 19-fold more efficient than VK 3 in terms of oxygen consumption and H 2 O 2 production, respectively. The ratio [H 2 O 2 ] produced / [naphthoquinone] consumed was 68 ± 11 and 5.8 ± 0.2 (µM/µM) for BrQ and VK 3 , respectively, indicating a higher efficacy of BrQ as a catalyst for the autoxidation of ascorbic acid. Both VK 3 and BrQ reacted with glutathione (GSH), but BrQ was the more effective substrate. Part of GSH was incorporated into the naphthoquinone, producing a nucleophilic substitution product (Q-SG). The depletion of BrQ by GSH did not prevent its redox capacity since Q-SG was also able to catalyze the production of reactive oxygen species. VK 3 /VC has already been submitted to clinical trials for the treatment of prostate cancer and has demonstrated promising results. However, replacement of VK 3 with BrQ will open new lines of investigation regarding this approach to cancer treatment

  3. Draft environmental statement related to the Western Nuclear, Inc. Split Rock Mill (Fremont County, Wyoming)

    International Nuclear Information System (INIS)

    1978-11-01

    The proposed action is the renewal of Source Material License SUA-56 (with amendments) issued to Western Nuclear, Inc. (WNI), for the operation of the Split Rock uranium mill near Jeffrey City and the Green Mountain ion-exchange facility, both in Fremont County, Wyoming. The license also permits possession of material from past operations at four ancillary facilities in the Gas Hills mining area--the Bullrush, Day-Loma, Frazier-Lamac, and Rox sites (Docket No. 40-1162). The Split Rock mill is an acid-leach, ion-exchange and solvent-extraction uranium-ore processing mill with a design capacity of 1540 MT (1700 tons) of ore per day. WNI has proposed by license amendment request to increase the storage capacity of the tailings ponds in order to permit the continuation of present production rates of U 3 O 8 through 1996 using lower-grade ores. Conditions for the protection of the environment include reclamation, tailings, stabilization, archeological survey, monitoring, etc

  4. Final environmental statement related to the Western Nuclear, Inc., Split Rock Uranium Mill (Fremont County, Wyoming)

    International Nuclear Information System (INIS)

    1980-02-01

    The proposed action is the renewal of Source Material License SUA-56 (with amendments) issued to Western Nuclear, Inc. (WNI), for the operation of the Split Rock Uranium Mill near Jeffrey City and the Green Mountain Ion-Exchange Facility, both in Fremont County, Wyoming. The license also permits possession of material from past operations at four ancillary facilities in the Gas Hills mining area - the Bullrush, Day-Loma, Frazier-Lamac, and Rox sites (Docket No. 40-1162). However, although heap leaching operations were previously authorized at Frazier-Lamac, there has never been any processing of material at this site. The Split Rock mill is an acid-leach, ion-exchange and solvent-extraction uranium-ore processing mill with a design capacity of 1540 MT (1700 tons) of ore per day. WNI has proposed by license amendment request to increase the storage capacity of the tailings ponds in order to permit the continuation of present production rates of U 3 O 8 through 1996 using lower-grade ores

  5. Precipitation formation in recrystallized nickel-plated non-sag tungsten wire

    International Nuclear Information System (INIS)

    Lai, Z.H.

    1994-01-01

    It is well established that some metals, such as palladium and nickel, can easily penetrate into tungsten by fast diffusion via crystal defects such as grain boundaries and dislocations. As a result of the fast penetration of these so called activators the recrystallization temperature of heavily drawn non-sag tungsten wire can be lower from about 2,000 C to about 1,000 C, thus the application of the tungsten wire, serving as reinforcement material in metal matrix composites used at high temperatures, is limited. An interesting question is in which form these activators exist in the recrystallized tungsten wire. It is generally believed that W-Ni intermediate compounds could form in the recrystallized material, presumably at grain boundaries. The free energy difference between the pure tungsten fibbers and the precipitating W(Ni) solid solution was suggested as the chemical driving force which governed the recrystallization process. The presence of nickel in small particles had also been observed in recrystallized grains of nickel plated tungsten wires using scanning electron microscopy (SEM) and secondary ion mass spectroscopy. These particles were considered to be nickel rich precipitates. However, a detailed investigation of the precipitation process has not been reported. In the present work an investigation of the structure, composition and distribution of nickel rich particles precipitated in recrystallized grains of nickel plated heavily drawn non-sage tungsten wires was carried out using analytical electron microscopy (AEM)

  6. Amperometric pyruvate sensor based on a pyruvate dehydrogenase-immobilized carbon paste electrode containing vitamin K3 as a mediator

    Energy Technology Data Exchange (ETDEWEB)

    Miki, K. [Nara National College of Technology, Nara (Japan); Kinoshita, H. [Kawassui Women`s College, Nagasaki (Japan); Yamamoto, Y. [Kyoto Municipal Junior College of Nursing, Kyoto (Japan); Taniguchi, N. [Kyoto Research Center for Hygiene, Kyoto (Japan); Ikeda, T. [Kyoto University, Kyoto (Japan). Faculty of Agriculture

    1995-12-05

    Pyruvate dehydrogenase (PDH) was immobilized on the surface of a carbon paste electrode containing vitamin K3 (2-Methyl-1,4-naphthoquinone, VK), and the electrode surface was covered with a dialysis membrane. The enzyme electrode produced an anodic current starting from -0.2 V to reach a limiting current at +0.1 V vs. Ag/AgCl due to the enzyme-catalyzed oxidation of pyruvate in a phosphate buffer solution of pH 7.0. The current response to pyruvate depended on the amounts of both the immobilized-PDH and VK mixed in the carbon paste electrode at low amount of the enzyme and VK, and became independent at above 0.15 mg PDH and 0.65% (w/w) VK. The electrode with 0.15mg PDH and 0.65% (w/w) VK could be used as a pyruvate sensor to measure in the range of 2 ,{mu}M to 3mM. The response time was about 60 sec, and the current was independent of pH in the range of 5.7 - 7.2. The presence of L-ascorbic acid didn`t interfere with this measurement. Phosphate ion could also be determined with this electrode in a citrate buffer solution. 14 refs., 6 figs., 1 tab.

  7. Vitamin K3 attenuates cerulein-induced acute pancreatitis through inhibition of the autophagic pathway.

    Science.gov (United States)

    Chinzei, Ryo; Masuda, Atsuhiro; Nishiumi, Shin; Nishida, Masayuki; Onoyama, Mitsuko; Sanuki, Tsuyoshi; Fujita, Tsuyoshi; Moritoh, Satoshi; Itoh, Tomoo; Kutsumi, Hiromu; Mizuno, Shigeto; Azuma, Takeshi; Yoshida, Masaru

    2011-01-01

    The discovery of novel and effective treatment methods would be of great help to patients with acute pancreatitis. The aims of this study were to determine the inhibitory effects of vitamin K3 (VK3) against cerulein-induced acute pancreatitis in mice and to examine the mechanisms behind these effects. Acute pancreatitis in mice was induced by intraperitoneal injection of cerulein 6 times at hourly intervals. Vitamin K3 was administered once before the first injection of cerulein or twice before and after the first injection of cerulein. The degrees of inflammation and autophagy in the pancreatic tissue were estimated by histological examination, measurement of enzyme activity, confocal microscopy, and Western blotting. The inhibitory effects of VK3 against rapamycin-induced autophagy were also examined using HeLa cells stably expressing green fluorescent protein LC3. Cerulein-induced acute pancreatitis was markedly attenuated by the administration of VK3. In addition, VK3 led to the inhibition of cerulein-evoked autophagic changes and colocalization of autophagosomes and lysosomes in the pancreatic tissue. Vitamin K3 also reduced rapamycin-induced autophagy in HeLa/green fluorescent protein LC3 cells. Our data suggest that the administration of VK3 reduces pancreatic inflammation in acute pancreatitis through inhibition of the autophagic pathway. Vitamin K3 may be an effective therapeutic strategy against acute pancreatitis.

  8. Study on transparency of adhesive joints of scintillation strips on the polyester basis

    International Nuclear Information System (INIS)

    Bondarenko, V.G.; Grigor'ev, V.A.; Kaplin, V.A.; Gushchin, V.V.; Prikhodchenko, N.N.; Silina, T.S.; Finashina, T.L.

    1979-01-01

    Optical transparency of adhesive joints of polyester-base scintillators is studied. To realize the optical contact between two scintillation strips of the 400x80x20 mm and 300x80x20 mm dimensions the following substances are used: KV-3 vaseline, 21-03V elastosyl adhesive and VK-14 adhesive. Using an installation for measuring adhesive joint transparency the dependence of the photomultiplier signal amplitude on the β-source coordinates is obtained. It is experimentally found that light losses on the adhesive joints were 8% for the VK-14 and elastosyl adhesives, and 10% for the VK-3 vase-line. The measurement error is +-1%. On the basis of the results obtained the conclusion is made that for adhesion of the scintillation detectors on the polyester basis the 21-03V elastosyl for detachable joints and the VK-14 adhesive - for permanent joints adhesive can be used. It is noted that while using the VK-14 adhesive it is necessary to pay attention to thorough preparation of the adhesive surfaces and provision of the necessary pressure during adhesion (not less than 2-3 kg/cm 2 ) [ru

  9. Research progress on the anticancer effects of vitamin K2.

    Science.gov (United States)

    Xv, Fan; Chen, Jiepeng; Duan, Lili; Li, Shuzhuang

    2018-06-01

    Despite the availability of multiple therapeutic methods for patients with cancer, the long-term prognosis is not satisfactory in a number of different cancer types. Vitamin K2 (VK2), which exerts anticancer effects on a number of cancer cell lines, is considered to be a prospective novel agent for the treatment of cancer. The present review aims to summarize the results of studies in which VK2 was administered either to patients with cancer or animals inoculated with cancerous cells, particularly investigating the inhibitory effects of VK2 on cancerous cells, primarily involving cell-cycle arrest, cell differentiation, apoptosis, autophagy and invasion. The present review summarizes evidence stating that treatment with VK2 could positively inhibit the growth of cancer cells, making it a potentially useful approach for the prevention and clinical treatment of cancer. Additionally, the combination treatment of VK2 and established chemotherapeutics may achieve better results, with fewer side effects. Therefore, more attention should be paid to the effects of micronutrients on tumors.

  10. Study on the inclusion interaction of p-sulfonated calix[n]arenes with Vitamin K3 using methylene blue as a spectral probe.

    Science.gov (United States)

    Lu, Qin; Gu, Jiashan; Yu, Huapeng; Liu, Chun; Wang, Lun; Zhou, Yunyou

    2007-09-01

    The characteristics of host-guest complexation between p-sulfonated calix[n]arene (SCnA, n = 4, 6) and Vitamin K(3) (VK(3)) were investigated by fluorescence spectrometry and absorption spectrometry using methylene blue (MB) as a probe. Interaction with MB and SCnA led to an obvious decrease in fluorescence intensity of MB, accompanying with shifts of emission peaks. Absorption peaks also showed interesting changes; however, when VK(3) was added, fluorescence intensity and absorbance recovered and a slight and slow red shift was observed. The obtained results showed that the inclusion ability of p-sulphonated calix[n]arenes towards VK(3) was the order: p-sulphonated calix[6]arene (SC6A) >p-sulphonated calix[4]arene (SC4A). Relative mechanism was proposed to explain the inclusion process.

  11. Development of an energy selector system for laser-driven proton beam applications

    Czech Academy of Sciences Publication Activity Database

    Scuderi, Valentina; Bijan Jia, S.; Carpinelli, M.; Cirrone, G.A.P.; Cuttone, G.; Korn, Georg; Licciardello, T.; Maggiore, Mario; Margarone, Daniele; Pisciotta, P.; Romano, F.; Schillaci, Francesco; Stancampiano, C.; Tramontana, A.

    2014-01-01

    Roč. 740, Mar (2014), 87-93 ISSN 0168-9002 R&D Projects: GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087; GA MŠk EE2.3.30.0057 Grant - others:LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : accelerated proton * therapy * plasma * pulses Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.216, year: 2014

  12. Kaon quark distribution functions in the chiral constituent quark model

    Science.gov (United States)

    Watanabe, Akira; Sawada, Takahiro; Kao, Chung Wen

    2018-04-01

    We investigate the valence u and s ¯ quark distribution functions of the K+ meson, vK (u )(x ,Q2) and vK (s ¯)(x ,Q2), in the framework of the chiral constituent quark model. We judiciously choose the bare distributions at the initial scale to generate the dressed distributions at the higher scale, considering the meson cloud effects and the QCD evolution, which agree with the phenomenologically satisfactory valence quark distribution of the pion and the experimental data of the ratio vK (u )(x ,Q2)/vπ (u )(x ,Q2) . We show how the meson cloud effects affect the bare distribution functions in detail. We find that a smaller S U (3 ) flavor symmetry breaking effect is observed, compared with results of the preceding studies based on other approaches.

  13. Fast neutron flux in the RA reactor experimental channels; Fluks brzih neutrona u eksperimentalnim kanalima reaktora RA

    Energy Technology Data Exchange (ETDEWEB)

    Raisic, N; Dobrosavljevic, N [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    Fast neutron flux in the RA reactor experimental channels was determined by using threshold reaction detectors. The (n,p) type reactions S{sub 32} (n,p)P{sub 32}, and Al{sub 24} (n,p)Na{sub 24}. Prepared sulphur and phosphorous foils were placed in cadmium boxes and irradiated in experimental channels VK-5, VK-7 and VK-9. Gold foils were irradiated simultaneously for controlling the reactor power. Reactor power was 100 kW during irradiation of half an hour. Activity of P{sub 32} and S{sub 31} after reactor shutdown was measured by 4{pi} counter and three calibrated GM counters. Absolute neutron flux was determined by using thus obtained data.

  14. Molecular Mapping of PMR1, a Novel Locus Conferring Resistance to Powdery Mildew in Pepper (Capsicum annuum

    Directory of Open Access Journals (Sweden)

    Jinkwan Jo

    2017-12-01

    Full Text Available Powdery mildew, caused by Leveillula taurica, is a major fungal disease affecting greenhouse-grown pepper (Capsicum annuum. Powdery mildew resistance has a complex mode of inheritance. In the present study, we investigated a novel powdery mildew resistance locus, PMR1, using two mapping populations: 102 ‘VK515' F2:3 families (derived from a cross between resistant parental line ‘VK515R' and susceptible parental line ‘VK515S' and 80 ‘PM Singang' F2 plants (derived from the F1 ‘PM Singang' commercial hybrid. Genetic analysis of the F2:3 ‘VK515' and F2 ‘PM Singang' populations revealed a single dominant locus for inheritance of the powdery mildew resistance trait. Genetic mapping showed that the PMR1 locus is located on syntenic regions of pepper chromosome 4 in a 4-Mb region between markers CZ2_11628 and HRM4.1.6 in ‘VK515R'. Six molecular markers including one SCAR marker and five SNP markers were localized to a region 0 cM from the PMR1 locus. Two putative nucleotide-binding site leucine-rich repeat (NBS-LRR-type disease resistance genes were identified in this PMR1 region. Genotyping-by-sequencing (GBS and genetic mapping analysis revealed suppressed recombination in the PMR1 region, perhaps due to alien introgression. In addition, a comparison of species-specific InDel markers as well as GBS-derived SNP markers indicated that C. baccatum represents a possible source of such alien introgression of powdery mildew resistance into ‘VK515R'. The molecular markers developed in this study will be especially helpful for marker-assisted selection in pepper breeding programs for powdery mildew resistance.

  15. Biophysical and computational comparison on the binding affinity of three important nutrients to β-lactoglobulin: folic acid, ascorbic acid and vitamin K3.

    Science.gov (United States)

    Shahraki, Somaye; Heydari, Ali; Saeidifar, Maryam; Gomroki, Masoumeh

    2017-11-06

    Small globular protein, β-lactoglobulin (βLG), which has significant affinity toward many drugs, is the most abundant whey protein in milk. In this study, the interaction of βLG with three important nutrients, ascorbic acid (ASC), folic acid (FOL), and vitamin K3 (VK3) was investigated by spectroscopic methods (UV-visible and fluorescence) along with molecular docking technique. The results of fluorescence measurements showed that studied nutrients strongly quenched βLG fluorescence in static (FOL and ACS) or static-dynamic combined quenching (VK3) mode. The values of binding constants (K βLG-ASC  ~ 4.34 × 10 4  M -1 , K βLG-FOL ~ 1.67 × 10 4  M -1 and K βLG-VK3 ~ 13.49 × 10 4  M -1 at 310 K) suggested that VK3 and FOL had stronger binding affinity toward βLG than ASC. Thermodynamic analysis indicated that hydrophobic interactions are the major forces in the stability of FOL-βLG complex with enthalpy- and entropy-driving mode while, hydrogen bonds and van der Waals interactions play a major role for βLG-ASC and βLG-VK3 associations. The results of 3D fluorescence FT-IR and UV-Visible measurements indicated that the binding of above nutrients to βLG may induce conformational and micro-environmental changes of protein. Also, there is a reciprocal complement between spectroscopic techniques and molecular docking modeling. The docking results indicate that the ASC, FOL, and VK3 bind to residues located in the subdomain B of βLG. Finally, this report suggests that βLG could be used as an effective carrier of above nutrients in functional foods.

  16. Kinetic isotope effect studies on milk xanthine oxidase and on chicken liver xanthine dehydrogenase

    International Nuclear Information System (INIS)

    D'Ardenne, S.C.; Edmondson, D.E.

    1990-01-01

    The effect of isotopic substitution of the 8-H of xanthine (with 2 H and 3 H) on the rate of oxidation by bovine xanthine oxidase and by chicken xanthine dehydrogenase has been measured. V/K isotope effects were determined from competition experiments. No difference in H/T (V/K) values was observed between xanthine oxidase and xanthine dehydrogenase. Xanthine dehydrogenase exhibited a larger T/D (V/K) value than that observed for xanthine oxidase. Observed H/T (V/K) values for either enzyme are less than those H/T (V/K) values calculated with D/T (V/K) data. These discrepancies are suggested to arise from the presence of a rate-limiting step(s) prior to the irreversible C-H bond cleavage step in the mechanistic pathways of both enzymes. These kinetic complexities preclude examination of whether tunneling contributes to the reaction coordinate for the H-transfer step in each enzyme. No observable exchange of tritium with solvent is observed during the anaerobic incubation of [8- 3 H]xanthine with either enzyme, which suggests the reverse commitment to catalysis (C r ) is essentially zero. With the assumption of adherence to reduced mass relationships, the intrinsic deuterium isotope effect ( D k) for xanthine oxidation is calculated. By the use of these values and steady-state kinetic data, the minimal rate for the hydrogen-transfer step is calculated to be ∼75-fold faster than k cat for xanthine oxidase and ∼10-fold faster than k cat for xanthine dehydrogenase. Values calculated for each enzyme were found to be identical within experimental uncertainty

  17. Polymorphisms in Plasmodium vivax Circumsporozoite Protein (CSP) Influence Parasite Burden and Cytokine Balance in a Pre-Amazon Endemic Area from Brazil

    Science.gov (United States)

    Ribeiro, Bruno de Paulo; Cassiano, Gustavo Capatti; de Souza, Rodrigo Medeiros; Cysne, Dalila Nunes; Grisotto, Marcos Augusto Grigolin; de Azevedo dos Santos, Ana Paula Silva; Marinho, Cláudio Romero Farias; Machado, Ricardo Luiz Dantas; Nascimento, Flávia Raquel Fernandes

    2016-01-01

    Mechanisms involved in severe P. vivax malaria remain unclear. Parasite polymorphisms, parasite load and host cytokine profile may influence the course of infection. In this study, we investigated the influence of circumsporozoite protein (CSP) polymorphisms on parasite load and cytokine profile in patients with vivax malaria. A cross-sectional study was carried out in three cities: São Luís, Cedral and Buriticupu, Maranhão state, Brazil, areas of high prevalence of P. vivax. Interleukin (IL)-2, IL-4, IL-10, IL-6, IL-17, tumor necrosis factor alpha (TNF-α, interferon gamma (IFN-γ and transforming growth factor beta (TGF-β were quantified in blood plasma of patients and in supernatants from peripheral blood mononuclear cell (PBMC) cultures. Furthermore, the levels of cytokines and parasite load were correlated with VK210, VK247 and P. vivax-like CSP variants. Patients infected with P. vivax showed increased IL-10 and IL-6 levels, which correlated with the parasite load, however, in multiple comparisons, only IL-10 kept this association. A regulatory cytokine profile prevailed in plasma, while an inflammatory profile prevailed in PBMC culture supernatants and these patterns were related to CSP polymorphisms. VK247 infected patients showed higher parasitaemia and IL-6 concentrations, which were not associated to IL-10 anti-inflammatory effect. By contrast, in VK210 patients, these two cytokines showed a strong positive correlation and the parasite load was lower. Patients with the VK210 variant showed a regulatory cytokine profile in plasma, while those infected with the VK247 variant have a predominantly inflammatory cytokine profile and higher parasite loads, which altogether may result in more complications in infection. In conclusion, we propose that CSP polymorphisms is associated to the increase of non-regulated inflammatory immune responses, which in turn may be associated with the outcome of infection. PMID:26943639

  18. Molecular Mapping of PMR1, a Novel Locus Conferring Resistance to Powdery Mildew in Pepper (Capsicum annuum).

    Science.gov (United States)

    Jo, Jinkwan; Venkatesh, Jelli; Han, Koeun; Lee, Hea-Young; Choi, Gyung Ja; Lee, Hee Jae; Choi, Doil; Kang, Byoung-Cheorl

    2017-01-01

    Powdery mildew, caused by Leveillula taurica , is a major fungal disease affecting greenhouse-grown pepper ( Capsicum annuum ). Powdery mildew resistance has a complex mode of inheritance. In the present study, we investigated a novel powdery mildew resistance locus, PMR1 , using two mapping populations: 102 'VK515' F 2:3 families (derived from a cross between resistant parental line 'VK515R' and susceptible parental line 'VK515S') and 80 'PM Singang' F 2 plants (derived from the F 1 'PM Singang' commercial hybrid). Genetic analysis of the F 2:3 'VK515' and F 2 'PM Singang' populations revealed a single dominant locus for inheritance of the powdery mildew resistance trait. Genetic mapping showed that the PMR1 locus is located on syntenic regions of pepper chromosome 4 in a 4-Mb region between markers CZ2_11628 and HRM4.1.6 in 'VK515R'. Six molecular markers including one SCAR marker and five SNP markers were localized to a region 0 cM from the PMR1 locus. Two putative nucleotide-binding site leucine-rich repeat (NBS-LRR)-type disease resistance genes were identified in this PMR1 region. Genotyping-by-sequencing (GBS) and genetic mapping analysis revealed suppressed recombination in the PMR1 region, perhaps due to alien introgression. In addition, a comparison of species-specific InDel markers as well as GBS-derived SNP markers indicated that C. baccatum represents a possible source of such alien introgression of powdery mildew resistance into 'VK515R'. The molecular markers developed in this study will be especially helpful for marker-assisted selection in pepper breeding programs for powdery mildew resistance.

  19. KIF1A, an axonal transporter of synaptic vesicles, is mutated in hereditary sensory and autonomic neuropathy type 2.

    Science.gov (United States)

    Rivière, Jean-Baptiste; Ramalingam, Siriram; Lavastre, Valérie; Shekarabi, Masoud; Holbert, Sébastien; Lafontaine, Julie; Srour, Myriam; Merner, Nancy; Rochefort, Daniel; Hince, Pascale; Gaudet, Rébecca; Mes-Masson, Anne-Marie; Baets, Jonathan; Houlden, Henry; Brais, Bernard; Nicholson, Garth A; Van Esch, Hilde; Nafissi, Shahriar; De Jonghe, Peter; Reilly, Mary M; Timmerman, Vincent; Dion, Patrick A; Rouleau, Guy A

    2011-08-12

    Hereditary sensory and autonomic neuropathy type II (HSANII) is a rare autosomal-recessive disorder characterized by peripheral nerve degeneration resulting in a severe distal sensory loss. Although mutations in FAM134B and the HSN2 exon of WNK1 were associated with HSANII, the etiology of a substantial number of cases remains unexplained. In addition, the functions of WNK1/HSN2 and FAM134B and their role in the peripheral nervous system remain poorly understood. Using a yeast two-hybrid screen, we found that KIF1A, an axonal transporter of synaptic vesicles, interacts with the domain encoded by the HSN2 exon. In parallel to this screen, we performed genome-wide homozygosity mapping in a consanguineous Afghan family affected by HSANII and identified a unique region of homozygosity located on chromosome 2q37.3 and spanning the KIF1A gene locus. Sequencing of KIF1A in this family revealed a truncating mutation segregating with the disease phenotype. Subsequent sequencing of KIF1A in a series of 112 unrelated patients with features belonging to the clinical spectrum of ulcero-mutilating sensory neuropathies revealed truncating mutations in three additional families, thus indicating that mutations in KIF1A are a rare cause of HSANII. Similarly to WNK1 mutations, pathogenic mutations in KIF1A were almost exclusively restricted to an alternatively spliced exon. This study provides additional insights into the molecular pathogenesis of HSANII and highlights the potential biological relevance of alternative splicing in the peripheral sensory nervous system. Copyright © 2011 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  20. Genes for hereditary sensory and autonomic neuropathies: a genotype–phenotype correlation

    Science.gov (United States)

    Rotthier, Annelies; Baets, Jonathan; Vriendt, Els De; Jacobs, An; Auer-Grumbach, Michaela; Lévy, Nicolas; Bonello-Palot, Nathalie; Kilic, Sara Sebnem; Weis, Joachim; Nascimento, Andrés; Swinkels, Marielle; Kruyt, Moyo C.; Jordanova, Albena; De Jonghe, Peter

    2009-01-01

    Hereditary sensory and autonomic neuropathies (HSAN) are clinically and genetically heterogeneous disorders characterized by axonal atrophy and degeneration, exclusively or predominantly affecting the sensory and autonomic neurons. So far, disease-associated mutations have been identified in seven genes: two genes for autosomal dominant (SPTLC1 and RAB7) and five genes for autosomal recessive forms of HSAN (WNK1/HSN2, NTRK1, NGFB, CCT5 and IKBKAP). We performed a systematic mutation screening of the coding sequences of six of these genes on a cohort of 100 familial and isolated patients diagnosed with HSAN. In addition, we screened the functional candidate gene NGFR (p75/NTR) encoding the nerve growth factor receptor. We identified disease-causing mutations in SPTLC1, RAB7, WNK1/HSN2 and NTRK1 in 19 patients, of which three mutations have not previously been reported. The phenotypes associated with mutations in NTRK1 and WNK1/HSN2 typically consisted of congenital insensitivity to pain and anhidrosis, and early-onset ulcero-mutilating sensory neuropathy, respectively. RAB7 mutations were only found in patients with a Charcot-Marie-Tooth type 2B (CMT2B) phenotype, an axonal sensory-motor neuropathy with pronounced ulcero-mutilations. In SPTLC1, we detected a novel mutation (S331F) corresponding to a previously unknown severe and early-onset HSAN phenotype. No mutations were found in NGFB, CCT5 and NGFR. Overall disease-associated mutations were found in 19% of the studied patient group, suggesting that additional genes are associated with HSAN. Our genotype–phenotype correlation study broadens the spectrum of HSAN and provides additional insights for molecular and clinical diagnosis. PMID:19651702

  1. Relaxation dynamics of femtosecond-laser-induced temperature modulation on the surfaces of metals and semiconductors

    Czech Academy of Sciences Publication Activity Database

    Levy, Yoann; Derrien, Thibault; Bulgakova, Nadezhda M.; Gurevich, E.L.; Mocek, Tomáš

    2016-01-01

    Roč. 374, Jun (2016), s. 157-164 ISSN 0169-4332 R&D Projects: GA MŠk ED2.1.00/01.0027 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : LIPSS * modulated temperature relaxation * two-temperature model * nano-melting Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.387, year: 2016

  2. Effect of phosphorus additions on hot pressing temperature and some properties of WC-Co hard alloys

    International Nuclear Information System (INIS)

    Dotsenko, V.M.; Simkina, Eh.S.; Tsypin, N.V.

    1977-01-01

    Results of studies on the effect of phosphorus additions on hot pressing temperature and some properties of VK6 and VK15 hard alloys are given. It is shown that alloying of hard alloys with 3-6 wt % phosphorus gives opportunity to lower substantially (for 200-300 deg) their hot pressing temperature. Hardness and density of alloys with phosphorus do not practically change. Some decrease of strength and wear-resistance characteristics is observed which is obviously connected with irregular distribution of phosphorus in the alloy

  3. Eco information 9. Influence of operation of the plants Jadrova vyradovacia spolocnost, a.s., on the environment, locality of Bohunice, within September 2014

    International Nuclear Information System (INIS)

    2014-10-01

    In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The radioactive effluents into atmosphere within January - September 2014 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 1.483 MBq (0.002 of AL) for V1, 0.087 MBq (0.029% of AL) for MSVP, 0.084 MBq (0.060% of AL) for BSC, 0.400 MBq (0.061% of AL) for HVB and 0.028 MBq (0.020% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a September 2014 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.258 MBq (V1), 0.007 MBq (VK MSVP), 0.018 MBq (VK 808 BSC), 0.005 MBq (VK 46A) and 0.002 MBq (VK 46B) of aero-soles into atmosphere; 1.169 MBq (V1 and MSVP) and 0.522 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.002 GBq (V1 and MSVP) and 16.740 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - September 2014 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 12.402 MBq (0.095% of AL for V1 and MSVP) and 5.010 MBq (0.042% of AL for TSU RAO and MSVP); and for tritium it is 8.382 GBq (0.419% of AL) for V1 and MSVP, and 98.415 GBq (0.984% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.

  4. XAS study of V2O5/Al2O3 catalysts doped with rare earth oxides

    International Nuclear Information System (INIS)

    Centeno, M.A.; Malet, P.; Capitan, M.J.; Benitez, J.J.; Carrizosa, I.; Odriozola, J.A.

    1995-01-01

    This paper reports on XAS studies of well dispersed V 2 O 5 /Al 2 O 3 and V 2 O 5 /Sm 2 O 3 /Al 2 O 3 samples. XAS spectra at V-K and Sm-L III edges show that the rare earth oxide favours the formation of regular tetrahedral units, [VO 4 ], over the surface of the support. Positions of the preedge peak at the V-K edge, and intensities of the white line at the Sm-L III edge also suggest modifications in the electronic density around V and Sm atoms when they are simultaneously supported over Al 2 O 3 . ((orig.))

  5. Eco information 1. Influence of operation of the plants Jadrova vyradovacia spolocnost, a.s., on the environment, locality of Bohunice, within January 2016

    International Nuclear Information System (INIS)

    2016-02-01

    In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The alpha radioactive effluents into atmosphere within January 2016 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 0.051 MBq (0.0001 of AL) for V1, 0.006 MBq (0.002% of AL) for MSVP, 0.007 MBq (0.005% of AL) for BSC, 0.027 MBq (0.004% of AL) for HVB and 0.003 MBq (0.002% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a January 2016 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.051 MBq (V1), 0.006 MBq (VK MSVP), 0.007 MBq (VK 808 BSC), 0.027 MBq (VK 46A) and 0.003 MBq (VK 46B) of aero-soles into atmosphere; 0.192 MBq (V1 and MSVP) and 0.346 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.001 GBq (V1 and MSVP) and 10.991 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - January 2016 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 0.192 MBq (0.0015% of AL for V1 and MSVP) and 0.346 MBq (0.003% of AL for TSU RAO and MSVP); and for tritium it is 0.001 GBq (0.00003% of AL) for V1 and MSVP, and 10.991 GBq (0.110% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.

  6. Eco information 4 Influence of operation of the plants Jadrova vyradovacia spolocnost, a.s., on the environment, locality of Bohunice, within April 2016

    International Nuclear Information System (INIS)

    2016-05-01

    In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The alpha radioactive effluents into atmosphere within January - April 2016 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 0.141 MBq (0.0002 of AL) for V1, 0.027 MBq (0.006% of AL) for MSVP, 0.029 MBq (0.016% of AL) for BSC, 0.127 MBq (0.015% of AL) for HVB and 0.009 MBq (0.006% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a April 2016 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.017 MBq (V1), 0.008 MBq (VK MSVP), 0.006 MBq (VK 808 BSC), 0.029 MBq (VK 46A) and 0.003 MBq (VK 46B) of aero-soles into atmosphere; 0.880 MBq (V1 and MSVP) and 0.397 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.315 GBq (V1 and MSVP) and 7.163 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - April 2016 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 2.658 MBq (0.0204% of AL for V1 and MSVP) and 1.744 MBq (0.015% of AL for TSU RAO and MSVP); and for tritium it is 0.736 GBq (0.03679% of AL) for V1 and MSVP, and 31.833 GBq (0.318% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.

  7. Eco information 2. Influence of operation of the plants Jadrova vyradovacia spolocnost, a.s., on the environment, locality of Bohunice, within February 2016

    International Nuclear Information System (INIS)

    2016-03-01

    In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The alpha radioactive effluents into atmosphere within January - February 2016 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 0.100 MBq (0.001 of AL) for V1, 0.013 MBq (0.004% of AL) for MSVP, 0.017 MBq (0.012% of AL) for BSC, 0.048 MBq (0.007% of AL) for HVB and 0.005 MBq (0.003% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a February 2016 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.049 MBq (V1), 0.007 MBq (VK MSVP), 0.011 MBq (VK 808 BSC), 0.020 MBq (VK 46A) and 0.002 MBq (VK 46B) of aero-soles into atmosphere; 0.706 MBq (V1 and MSVP) and 0.738 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.419 GBq (V1 and MSVP) and 7.479 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - February 2016 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 0.898 MBq (0.0069% of AL for V1 and MSVP) and 1.084 MBq (0.009% of AL for TSU RAO and MSVP); and for tritium it is 0.420 GBq (0.02098% of AL) for V1 and MSVP, and 18.470 GBq (0.185% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.

  8. Microstructural, phase evolution and corrosion properties of silicon carbide reinforced pulse electrodeposited nickel–tungsten composite coatings

    International Nuclear Information System (INIS)

    Singh, Swarnima; Sribalaji, M.; Wasekar, Nitin P.; Joshi, Srikant; Sundararajan, G.; Singh, Raghuvir; Keshri, Anup Kumar

    2016-01-01

    Graphical abstract: - Highlights: • Pulse electrodeposited Ni–W–SiC coating has been synthesized successfully. • Dome to turtle like structure has been observed on addition of SiC in Ni–W coating. • Formation of W(Ni) solid solution was observed on adding 5 g/l SiC in Ni–W coating. • Corrosion resistance improved for Ni–W–5 g/l SiC coating. • Texture formation and continuous barrier layer enhanced the corrosion resistance. - Abstract: Silicon carbide (SiC) reinforced nickel–tungsten (Ni–W) coatings were successfully fabricated on steel substrate by pulse electrodeposition method (PED) and the amount of SiC was varied as 0 g/l, 2 g/l, and 5 g/l in Ni–W coating. Effect of subsequent addition of SiC on microstructures, phases and on corrosion property of the coating was investigated. Field emission scanning electron microscopy (FE-SEM) image of the surface morphology of the coating showed the transformation from the dome like structure to turtle shell like structure. X-ray diffraction (XRD) of Ni–W–5 g/l SiC showed the disappearance of (220) plane of Ni(W), peak splitting in major peak of Ni(W) and formation of distinct peak of W(Ni) solid solution. Absence of (220) plane, peak splitting and presence of W(Ni) solid solution was explained by the high resolution transmission electron microscopy (HR-TEM) images. Tafel polarization plot was used to study the corrosion property of the coatings in 0.5 M NaCl solution. Ni–W–5 g/l SiC coating was showed higher corrosion resistance (i.e. ∼21% increase in corrosion potential, E_c_o_r_r) compared to Ni–W coating. Two simultaneous phenomena have been identified for the enhanced corrosion resistance of Ni–W–5 g/l SiC coating. (a) Presence of crystallographic texture (b) formation of continuous double barrier layer of NiWO_4 and SiO_2.

  9. Microstructural, phase evolution and corrosion properties of silicon carbide reinforced pulse electrodeposited nickel–tungsten composite coatings

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Swarnima; Sribalaji, M. [Materials Science and Engineering, Indian Institute of Technology Patna, Navin Government Polytechnic Campus, Patliputra Colony, Patna, Bihar 800013 (India); Wasekar, Nitin P.; Joshi, Srikant; Sundararajan, G. [International Advanced Research Centre for Powder Metallurgy & New Materials (ARCI) Hyderabad, Balapur P.O., Hyderabad, Andhra Pradesh 500005 (India); Singh, Raghuvir [CSIR-National Metallurgical Laboratory, Jamshedpur, Jharkhand 831007 (India); Keshri, Anup Kumar, E-mail: anup@iitp.ac.in [Materials Science and Engineering, Indian Institute of Technology Patna, Navin Government Polytechnic Campus, Patliputra Colony, Patna, Bihar 800013 (India)

    2016-02-28

    Graphical abstract: - Highlights: • Pulse electrodeposited Ni–W–SiC coating has been synthesized successfully. • Dome to turtle like structure has been observed on addition of SiC in Ni–W coating. • Formation of W(Ni) solid solution was observed on adding 5 g/l SiC in Ni–W coating. • Corrosion resistance improved for Ni–W–5 g/l SiC coating. • Texture formation and continuous barrier layer enhanced the corrosion resistance. - Abstract: Silicon carbide (SiC) reinforced nickel–tungsten (Ni–W) coatings were successfully fabricated on steel substrate by pulse electrodeposition method (PED) and the amount of SiC was varied as 0 g/l, 2 g/l, and 5 g/l in Ni–W coating. Effect of subsequent addition of SiC on microstructures, phases and on corrosion property of the coating was investigated. Field emission scanning electron microscopy (FE-SEM) image of the surface morphology of the coating showed the transformation from the dome like structure to turtle shell like structure. X-ray diffraction (XRD) of Ni–W–5 g/l SiC showed the disappearance of (220) plane of Ni(W), peak splitting in major peak of Ni(W) and formation of distinct peak of W(Ni) solid solution. Absence of (220) plane, peak splitting and presence of W(Ni) solid solution was explained by the high resolution transmission electron microscopy (HR-TEM) images. Tafel polarization plot was used to study the corrosion property of the coatings in 0.5 M NaCl solution. Ni–W–5 g/l SiC coating was showed higher corrosion resistance (i.e. ∼21% increase in corrosion potential, E{sub corr}) compared to Ni–W coating. Two simultaneous phenomena have been identified for the enhanced corrosion resistance of Ni–W–5 g/l SiC coating. (a) Presence of crystallographic texture (b) formation of continuous double barrier layer of NiWO{sub 4} and SiO{sub 2}.

  10. Mechanisms of CFTR functional variants that impair regulated bicarbonate permeation and increase risk for pancreatitis but not for cystic fibrosis.

    Science.gov (United States)

    LaRusch, Jessica; Jung, Jinsei; General, Ignacio J; Lewis, Michele D; Park, Hyun Woo; Brand, Randall E; Gelrud, Andres; Anderson, Michelle A; Banks, Peter A; Conwell, Darwin; Lawrence, Christopher; Romagnuolo, Joseph; Baillie, John; Alkaade, Samer; Cote, Gregory; Gardner, Timothy B; Amann, Stephen T; Slivka, Adam; Sandhu, Bimaljit; Aloe, Amy; Kienholz, Michelle L; Yadav, Dhiraj; Barmada, M Michael; Bahar, Ivet; Lee, Min Goo; Whitcomb, David C

    2014-07-01

    CFTR is a dynamically regulated anion channel. Intracellular WNK1-SPAK activation causes CFTR to change permeability and conductance characteristics from a chloride-preferring to bicarbonate-preferring channel through unknown mechanisms. Two severe CFTR mutations (CFTRsev) cause complete loss of CFTR function and result in cystic fibrosis (CF), a severe genetic disorder affecting sweat glands, nasal sinuses, lungs, pancreas, liver, intestines, and male reproductive system. We hypothesize that those CFTR mutations that disrupt the WNK1-SPAK activation mechanisms cause a selective, bicarbonate defect in channel function (CFTRBD) affecting organs that utilize CFTR for bicarbonate secretion (e.g. the pancreas, nasal sinus, vas deferens) but do not cause typical CF. To understand the structural and functional requirements of the CFTR bicarbonate-preferring channel, we (a) screened 984 well-phenotyped pancreatitis cases for candidate CFTRBD mutations from among 81 previously described CFTR variants; (b) conducted electrophysiology studies on clones of variants found in pancreatitis but not CF; (c) computationally constructed a new, complete structural model of CFTR for molecular dynamics simulation of wild-type and mutant variants; and (d) tested the newly defined CFTRBD variants for disease in non-pancreas organs utilizing CFTR for bicarbonate secretion. Nine variants (CFTR R74Q, R75Q, R117H, R170H, L967S, L997F, D1152H, S1235R, and D1270N) not associated with typical CF were associated with pancreatitis (OR 1.5, p = 0.002). Clones expressed in HEK 293T cells had normal chloride but not bicarbonate permeability and conductance with WNK1-SPAK activation. Molecular dynamics simulations suggest physical restriction of the CFTR channel and altered dynamic channel regulation. Comparing pancreatitis patients and controls, CFTRBD increased risk for rhinosinusitis (OR 2.3, p<0.005) and male infertility (OR 395, p<0.0001). WNK1-SPAK pathway-activated increases in CFTR

  11. Mechanisms of CFTR functional variants that impair regulated bicarbonate permeation and increase risk for pancreatitis but not for cystic fibrosis.

    Directory of Open Access Journals (Sweden)

    Jessica LaRusch

    2014-07-01

    Full Text Available CFTR is a dynamically regulated anion channel. Intracellular WNK1-SPAK activation causes CFTR to change permeability and conductance characteristics from a chloride-preferring to bicarbonate-preferring channel through unknown mechanisms. Two severe CFTR mutations (CFTRsev cause complete loss of CFTR function and result in cystic fibrosis (CF, a severe genetic disorder affecting sweat glands, nasal sinuses, lungs, pancreas, liver, intestines, and male reproductive system. We hypothesize that those CFTR mutations that disrupt the WNK1-SPAK activation mechanisms cause a selective, bicarbonate defect in channel function (CFTRBD affecting organs that utilize CFTR for bicarbonate secretion (e.g. the pancreas, nasal sinus, vas deferens but do not cause typical CF. To understand the structural and functional requirements of the CFTR bicarbonate-preferring channel, we (a screened 984 well-phenotyped pancreatitis cases for candidate CFTRBD mutations from among 81 previously described CFTR variants; (b conducted electrophysiology studies on clones of variants found in pancreatitis but not CF; (c computationally constructed a new, complete structural model of CFTR for molecular dynamics simulation of wild-type and mutant variants; and (d tested the newly defined CFTRBD variants for disease in non-pancreas organs utilizing CFTR for bicarbonate secretion. Nine variants (CFTR R74Q, R75Q, R117H, R170H, L967S, L997F, D1152H, S1235R, and D1270N not associated with typical CF were associated with pancreatitis (OR 1.5, p = 0.002. Clones expressed in HEK 293T cells had normal chloride but not bicarbonate permeability and conductance with WNK1-SPAK activation. Molecular dynamics simulations suggest physical restriction of the CFTR channel and altered dynamic channel regulation. Comparing pancreatitis patients and controls, CFTRBD increased risk for rhinosinusitis (OR 2.3, p<0.005 and male infertility (OR 395, p<<0.0001. WNK1-SPAK pathway-activated increases in

  12. Enhanced phosphoserine insertion during Escherichia coli protein synthesis via partial UAG codon reassignment and release factor 1 deletion

    Science.gov (United States)

    Heinemann, Ilka U.; Rovner, Alexis J.; Aerni, Hans R.; Rogulina, Svetlana; Cheng, Laura; Olds, William; Fischer, Jonathan T.; Söll, Dieter; Isaacs, Farren J.; Rinehart, Jesse

    2012-01-01

    Genetically encoded phosphoserine incorporation programmed by the UAG codon was achieved by addition of engineered elongation factor and an archaeal aminoacyl-tRNA synthetase to the normal Escherichia coli translation machinery (Park (2011) Science 333, 1151). However, protein yield suffers from expression of the orthogonal phosphoserine translation system and competition with release factor 1 (RF-1). In a strain lacking RF-1, phosphoserine phosphatase, and where 7 UAG codons residing in essential genes were converted to UAA, phosphoserine incorporation into GFP and WNK4 was significantly elevated, but with an accompanying loss in cellular fitness and viability. PMID:22982858

  13. Mechanical characteristics of heterogeneous structures obtained by high-temperature brazing of corrosion-resistant steels with rapidly quenched non-boron nickel-based alloys

    Science.gov (United States)

    Kalin, B.; Penyaz, M.; Ivannikov, A.; Sevryukov, O.; Bachurina, D.; Fedotov, I.; Voennov, A.; Abramov, E.

    2018-01-01

    Recently, the use rapidly quenched boron-containing nickel filler metals for high temperature brazing corrosion resistance steels different classes is perspective. The use of these alloys leads to the formation of a complex heterogeneous structure in the diffusion zone that contains separations of intermediate phases such as silicides and borides. This structure negatively affects the strength characteristics of the joint, especially under dynamic loads and in corrosive environment. The use of non-boron filler metals based on the Ni-Si-Be system is proposed to eliminate this structure in the brazed seam. Widely used austenitic 12Cr18Ni10Ti and ferrite-martensitic 16Cr12MoSiWNiVNb reactor steels were selected for research and brazing was carried out. The mechanical characteristics of brazed joints were determined using uniaxial tensile and impact toughness tests, and fractography was investigated by electron microscopy.

  14. Multiscale Modeling of Grain Boundary Segregation and Embrittlement in Tungsten for Mechanistic Design of Alloys for Coal Fired Plants

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Jian; Tomar, Vikas; Zhou, Naixie; Lee, Hongsuk

    2013-06-30

    Based on a recent discovery of premelting-like grain boundary segregation in refractory metals occurring at high temperatures and/or high alloying levels, this project investigated grain boundary segregation and embrittlement in tungsten (W) based alloys. Specifically, new interfacial thermodynamic models have been developed and quantified to predict high-temperature grain boundary segregation in the W-Ni binary alloy and W-Ni-Fe, W-Ni-Ti, W-Ni-Co, W-Ni-Cr, W-Ni-Zr and W-Ni-Nb ternary alloys. The thermodynamic modeling results have been experimentally validated for selected systems. Furthermore, multiscale modeling has been conducted at continuum, atomistic and quantum-mechanical levels to link grain boundary segregation with embrittlement. In summary, this 3-year project has successfully developed a theoretical framework in combination with a multiscale modeling strategy for predicting grain boundary segregation and embrittlement in W based alloys.

  15. Understanding hydrodenitrogenation on novel unsupported sulfide Mo-W-Ni catalysis

    Energy Technology Data Exchange (ETDEWEB)

    Hein, J.; Hrabar, A.; Gutierrez, O.Y.; Lercher, J.A. [Technische Univ. Muenchen (Germany). Catalysis Research Center

    2011-07-01

    WNi, NiMo and Mo-W-Ni unsupported catalysts were synthesized, characterized and tested with respect to their hydrodenitrogenation properties using o-propylaniline as test reactant. The bimetallic oxide precursors are crystalline metallates, whereas the trimetallic materials are amorphous. In the sulfide form, the catalysts are mixtures of agglomerated Mo(W)S{sub 2} and Ni sulfides. The performance of all catalysts is similar, suggesting the same nature of active sites regardless the composition. Due to the lack of correlation between activity and density of coordinatively unsaturated sites of the catalysts, two kinds of active sites are proposed, i.e. coordinatively unsaturated sites and electron rich sites at the edges of the sulfides. (orig.)

  16. Effect of Ni interlayer on diffusion bonding of a W alloy and a Ta alloy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jian; Liu, Ruxia; Wei, Qinqin; Luo, Guoqiang; Shen, Qiang; Zhang, Lianmeng [Wuhan Univ. of Technology (China). The State Key Lab. of Advanced Technology for Materials Synthesis and Processing

    2017-11-01

    The combination of W and Ta is expected to be highly beneficial for many applications from aerospace, weapons, military and nuclear industry. In this paper, W and Ta alloys were successfully diffusion bonded with Ni interlayer. The process of the formation of W/Ni/Ta diffusion bonded joints was investigated by means of scanning electron microscopy, X-ray diffraction system, electron probe micro-analyzer, energy dispersive spectrometry and shear strength measurement. The results show that the shear strength increases when the bonding temperature increases and exhibits a maximum value of 244 MPa at 930 C. The bonding of W/Ni can be attributed to the bonding of Ni to tungsten grains and the bonding of Ni to a Ni-Fe-binder mainly by elemental diffusion. The fracture takes place in the Ni/Ta interface and Ni{sub 3}Ta and Ni{sub 2}Ta intermetallic compounds are formed on the fracture surfaces.

  17. High-energy, high-rate consolidation of tungsten and tungsten-based composite powders

    Energy Technology Data Exchange (ETDEWEB)

    Raghunathan, S.K.; Persad, C.; Bourell, D.L.; Marcus, H.L. (Center for Materials Science and Engineering, Univ. of Texas, Austin (USA))

    1991-01-20

    Tungsten and tungsten-based heavy alloys are well known for their superior mechanical properties at elevated temperatures. However, unalloyed tungsten is difficult to consolidate owing to its very high melting temperature (3683 K). The additions of small amounts of low-melting elements such as iron, nickel, cobalt and copper, facilitate the powder processing of dense heavy alloys at moderate temperatures. Energetic high-current pulses have been used recently for powder consolidation. In this paper, the use of a homopolar generator as a power source to consolidate selected tungsten and tungsten-based alloys is examined. Various materials were consolidated including unalloyed tungsten, W-Nb, W-Ni, and tungsten heavy alloy with boron carbide. The effect of process parameters such as pressure and specific energy input on the consolidation of different alloy systems is described in terms of microstructure and property relationships. (orig.).

  18. Development of the urban space surrounding selected railway stations in Poland

    Directory of Open Access Journals (Sweden)

    Dragan Weronika

    2017-12-01

    Full Text Available At present, many railway stations, in spite of being architecturally valuable, are subject to de-capitalization and degradation, which increasingly leads to demolition including elements or even entire railway stations of historical importance. Therefore, there arises a need to transform these facilities – as well as their nearby surroundings – into service areas not only for railway passengers but also for the consumer or tourist. This article presents an overview of the types of development of functional and spatial areas around a railway station, as well as the building itself, on selected examples in cities of Poland. In past historical periods, the surroundings of railway stations often became the new core of the studied centres, creating new urban structures. Train station forecourts, as well as access roads leading to railway stations, became specific links of railway infrastructure, the main points of which were railway stations, with the original urban layout. Unfortunately, the decline in the importance of rail transport has contributed to the recession and degradation of these spaces, and often to changes in their functions. This article refers to the concept of redevelopment of the railway station area, which emphasizes the creation of hubs integrating various modes of transport on the one hand, and transforming the area around the stations into an area of development of new business activities, on the other. Some of the discussed train stations have undergone a thorough renovation (e.g. Kraków Główny, Katowice and Poznań Główny, frequently in an attempt to allude to global trends in the commercialization of space and transport integration within station squares. However, this poses a problem and a challenge for decision-makers attempting to redevelop such facilities and the spaces associated with them.

  19. Laser-induced change of electrical resistivity of metals and its applications

    Science.gov (United States)

    Pawlak, Ryszard; Kostrubiec, Franciszek; Tomczyk, Mariusz; Walczak, Maria

    2005-01-01

    Applying of laser alloying for modification of electrical resistivity of metals with significant importance in electrical and electronic engineering and utilization of this method for producing passive elements of electric circuit have been presented. The alloyed metals were obtained by means of laser beams with different wave length and various mode of working (cw or pulse), by different methods for the supplying of alloying elements. It was possible to form alloyed layers of metals forming different types of metallurgical systems: with full (Cu-Au, Cu-Ni) or partial solubility (Mo-Ni, W-Ni, Cu-Al, Ag-Sn), insoluble (Mo-Au and Cu-Cr) and immiscible (Ag-Ni and Ni-Au) metals, with metallic as well as non-metallic additions (oxide). It has been shown as well that it is possible to achieve resistive elements modified in whole cross section, in a single technological process. The results of systematic investigations into the resistivity of alloyed metals in the temperature range of 77-450 K have been presented. The alloyed layers, obtained, were characterised by a range of resistivity from 2.8 x 10-8 Ωm (Cu-Cr) to 128 x 10-8 Ωm (W-Ni). The microstructure and composition of alloyed layers were examined by means of SEM-microscopy and EDX analyser. In selected cases it was shown how results of investigations could be utilized for modification of surface layer of contact materials or to optimize the resistance of laser welded joints. In addition the results of investigations of new developed microtechnology -- producing micro-areas with extremely high resistivity -- have been presented.

  20. Microstructural, phase evolution and corrosion properties of silicon carbide reinforced pulse electrodeposited nickel-tungsten composite coatings

    Science.gov (United States)

    Singh, Swarnima; Sribalaji, M.; Wasekar, Nitin P.; Joshi, Srikant; Sundararajan, G.; Singh, Raghuvir; Keshri, Anup Kumar

    2016-02-01

    Silicon carbide (SiC) reinforced nickel-tungsten (Ni-W) coatings were successfully fabricated on steel substrate by pulse electrodeposition method (PED) and the amount of SiC was varied as 0 g/l, 2 g/l, and 5 g/l in Ni-W coating. Effect of subsequent addition of SiC on microstructures, phases and on corrosion property of the coating was investigated. Field emission scanning electron microscopy (FE-SEM) image of the surface morphology of the coating showed the transformation from the dome like structure to turtle shell like structure. X-ray diffraction (XRD) of Ni-W-5 g/l SiC showed the disappearance of (220) plane of Ni(W), peak splitting in major peak of Ni(W) and formation of distinct peak of W(Ni) solid solution. Absence of (220) plane, peak splitting and presence of W(Ni) solid solution was explained by the high resolution transmission electron microscopy (HR-TEM) images. Tafel polarization plot was used to study the corrosion property of the coatings in 0.5 M NaCl solution. Ni-W-5 g/l SiC coating was showed higher corrosion resistance (i.e. ∼21% increase in corrosion potential, Ecorr) compared to Ni-W coating. Two simultaneous phenomena have been identified for the enhanced corrosion resistance of Ni-W-5 g/l SiC coating. (a) Presence of crystallographic texture (b) formation of continuous double barrier layer of NiWO4 and SiO2.

  1. Disease: H01514 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01514 Landau-Kleffner syndrome; Acquired epileptic aphasia Landau-Kleffner syndro...y, however, only 70% have clinical seizures. The main symptoms are acute or subacute aphasia...S ... Bhardwaj P, Sharma VK, Sharma R, Gautam P ... TITLE ... Acquired epileptic aphasia

  2. Dependence of Radar Backscatter on the Energetics of the Air-Sea Interface

    Science.gov (United States)

    1990-07-01

    et al., 1977; Moore and Fung, 1979; Schroeder, et al., 1982). However, Daley, et al., (1984) identify the deficiencies in this simple type of...between wind input and dissipation then yields the high wavenumber spectrum: T.)= [-40. 194 p,,{ k)- -..]. 4vk) (100) where a=fl(Tk 2/pwg) and n=f2( Tk2

  3. Dietary Supplementation with Vitamin K Affects Transcriptome and Proteome of Senegalese Sole, Improving Larval Performance and Quality

    DEFF Research Database (Denmark)

    Richard, Nadege; Fernandez, Ignacio; Wulff, Tune

    2014-01-01

    Nutritional factors strongly influence fish larval development and skeletogenesis, and may induce skeletal deformities. Vitamin K (VK) has been largely disregarded in aquaculture nutrition, despite its important roles in bone metabolism, in gamma-carboxylation of Gla proteins, and in regulating...

  4. An attempt to evaluate the effect of vitamin K3 using as an enhancer of anticancer agents.

    Science.gov (United States)

    Matzno, Sumio; Yamaguchi, Yuka; Akiyoshi, Takeshi; Nakabayashi, Toshikatsu; Matsuyama, Kenji

    2008-06-01

    The possibility of vitamin K3 (VK3) as an anticancer agent was assessed. VK3 dose-dependently diminished the cell viability (measured as esterase activity) with IC50 of 13.7 microM and Hill coefficient of 3.1 in Hep G2 cells. It also decreased the population of S phase and arrested cell cycle in the G2/M phase in a dose-dependent manner. G2/M arrest was regulated by the increment of cyclin A/cdk1 and cyclin A/cdk2 complex, and contrasting cyclin B/cdk1 complex decrease. Finally, combined application demonstrated that VK3 significantly enhanced the cytotoxicity of etoposide, a G2 phase-dependent anticancer agent, whereas it reduced the cytotoxic activity of irinotecan, a S phase-dependent agent. These findings suggest that VK3 induces G2/M arrest by inhibition of cyclin B/cdk1 complex formation, and is thus useful as an enhancer of G2 phase-dependent drugs in hepatic cancer chemotherapy.

  5. ABCC6 does not transport vitamin K3-glutathione conjugate from the liver: relevance to pathomechanisms of pseudoxanthoma elasticum.

    Science.gov (United States)

    Fülöp, Krisztina; Jiang, Qiujie; Wetering, Koen V D; Pomozi, Viola; Szabó, Pál T; Arányi, Tamás; Sarkadi, Balázs; Borst, Piet; Uitto, Jouni; Váradi, András

    2011-11-25

    Vitamin K is a cofactor required for gamma-glutamyl carboxylation of several proteins regulating blood clotting, bone formation and soft tissue mineralization. Vitamin K3 is an important intermediate during conversion of the dietary vitamin K1 to the most abundant vitamin K2 form. It has been suggested that ABCC6 may have a role in transporting vitamin K or its derivatives from the liver to the periphery. This activity is missing in pseudoxanthoma elasticum, a genetic disorder caused by mutations in ABCC6 characterized by abnormal soft tissue mineralization. Here we examined the efflux of the glutathione conjugate of vitamin K3 (VK3GS) from the liver in wild type and Abcc6(-/-) mice, and in transport assays in vitro. We found in liver perfusion experiments that VK3GS is secreted into the inferior vena cava, but we observed no significant difference between wild type and Abcc6(-/-) animals. We overexpressed the human ABCC6 transporter in Sf9 insect and MDCKII cells and assayed its vitamin K3-conjugate transport activity in vitro. We found no measurable transport of VK3GS by ABCC6, whereas ABCC1 transported this compound at high rate in these assays. These results show that VK3GS is not the essential metabolite transported by ABCC6 from the liver and preventing the symptoms of pseudoxanthoma elasticum. Copyright © 2011 Elsevier Inc. All rights reserved.

  6. Adaptive Multi-Sensor Interrogation of Targets Embedded in Complex Environments

    Science.gov (United States)

    2010-06-09

    to efficient refinement of data from distributed networked sensor systems for interpretation by both machines and humans in a low latency and...of a DP draw: Tk^HIltiU-^). Vk*& Beta{l,a), d’k ~ d" H. (19) where 5g - is a point measure concentrated at 9*k (each 9*k is termed an atom

  7. Health Status and Performance of United States Air Force Airmen Following Mild Traumatic Brain Injury

    Science.gov (United States)

    2010-09-01

    adrenal insufficiency, hypopituitarism, hypothyroidism , growth- hormone deficiency and posterior pituitary dysfunction [53, 54, 56-60]. Growth...central hypothyroidism which can result in fatigue, apathy, decreased strength and cognitive dysfunction, symptoms commonly observed in PTSD [54...injury: Detecting high risk patients. In: Leon-Carrion J vK ZG, editor. Brain Injury Treatment , Theories, and Practices. London and New York: Taylor

  8. A Computational Study of the Respiratory Airflow Characteristics in Normal and Obstructed Human Airways

    Science.gov (United States)

    2014-01-01

    46] Y.S. Tzeng, K. Lutchen, M. Albert , The difference in ventilation heterogeneity between asthmatic and healthy subjects quantified using...endurance and diaphragmatic activation in patients with chronic airflow limitation, Thorax 44 (1989) 903–912. [52] V.K. Sidhaye, K.S. Schweitzer , M.J

  9. Factors influencing birth weights in Cameroon | Ngassa | Clinics in ...

    African Journals Online (AJOL)

    PC Ngassa, L Feuzeu, MT Wamba, L Kouam, N Fomulu, MT Obama, E Nkwabong, W Takang, VK Mve, MR Ekono, EJ Kongnuy, J Itoua-Isséna ... We recommend that the effects of other risk factors like cigarette smoking and nutritional status be studied in future because of the increasing impact of emerging changes in life ...

  10. Lactobacillus crispatus Modulates Vaginal Epithelial Cell Innate Response to Candida albicans

    Directory of Open Access Journals (Sweden)

    Xiao-Xi Niu

    2017-01-01

    Conclusions: L. crispatus can attenuate the virulence of C. albicans, modulate the secretion of cytokines and chemokines, and enhance the immune response of VK2/E6E7 cells in vitro. The vaginal mucosa has a potential function in the local immune responses against pathogens that can be promoted by L. crispatus.

  11. Theoretical study of the mechanism of proton transfer in tautomeric ...

    Indian Academy of Sciences (India)

    Unknown

    transferred is forced to come close to the positively charged carbon atom at ..... geometry of the transition state, and the charge densities on the atoms involved in the ..... One of the authors (VK) thanks the Council of Scientific and Industrial ...

  12. Synergistic antitumor cytotoxic actions of ascorbate and menadione on human prostate (DU145) cancer cells in vitro: nucleus and other injuries preceding cell death by autoschizis.

    Science.gov (United States)

    Gilloteaux, Jacques; Jamison, James M; Neal, Deborah; Summers, Jack L

    2014-04-01

    Scanning (SEM) and transmission electron microscopy (TEM) were used to characterize the cytotoxic effects of ascorbate (VC), menadione (VK3), or a VC:VK3 combination on a human prostate carcinoma cell line (DU145) following a 1-h vitamin treatment and a subsequent 24-h incubation in culture medium. Cell alterations examined by light and electron microscopy were treatment-dependent with VC + VK3 >VK3 > VC > Sham. Oxidative stress-induced damage was found in most organelles. This report describes injuries in the tumor cell nucleus (chromatin and nucleolus), mitochondria, endomembranes, lysosomal bodies (autophagocytoses) and inclusions. Morphologic alterations suggest that cytoskeleton damage is likely responsible for the superficial cytoplasmic changes, including major changes in cell shape and size and the self-excising phenomena. Unlike apoptotic bodies, the excised pieces contain ribonucleoproteins, but not organelles. These deleterious events cause a progressive, significant reduction in the tumor cell size. During nuclear alterations, the nuclei maintain their envelope during chromatolysis and karyolysis until cell death, while nucleoli undergo a characteristic segregation of their components. In addition, changes in fat and glycogen storage are consistent the cytotoxic and metabolic alterations caused by the respective treatments. All cellular ultrastructural changes are consistent with cell death by autoschizis and not apoptosis or other kinds of cell death.

  13. African Journal of Health Sciences - Vol 14, No 3 (2007)

    African Journals Online (AJOL)

    ... study of Multiple versus Single infection doses of Schistosoma haematobium in Golden hamsters (Mesocricetus auratus) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VK Njoroge, F Nyundo, M Limo, DS Yole, 187-194. http://dx.doi.org/10.4314/ajhs.v14i3.30864 ...

  14. DVD. Piret Tamm soovitab : "Mootorrattapäevikud" / Piret Tamm

    Index Scriptorium Estoniae

    Tamm, Piret, 1966-

    2006-01-01

    Mängufilm Che Guevarast "Mootorratta päevikud" ("Diarios de motocicleta") : režissöör Walter Salles : Ameerika Ühendriigid - Saksamaa - Suurbritannia - Argentiina - Tšiili - Peruu 2004. Kriitikat ka firma V&K Holding DVD kvaliteedi kohta

  15. Revk - a Tool for the Fulfilment of Requirements from National Rules for Tracking and Documentation of Radioactive Residual Material and Radioactive Waste

    International Nuclear Information System (INIS)

    Hartmann, B.; Haeger, M.; Gruendler, D.

    2006-01-01

    According to the German Radiation Protection Ordinance treatment, storage, whereabouts of radioactive material etc. have to be documented. Due to legal requirements an electronic documentation system for radioactive waste has to be installed. Within the framework of the currently largest decommissioning project of nuclear facilities by Energiewerke Nord GmbH, a material flow-waste tracking and control system (ReVK) has been developed, tailored to the special needs of the decommissioning of nuclear facilities. With this system it is possible to record radioactive materials which can be released after treatment or decay storage for restricted and unrestricted utilization. Radioactive waste meant for final storage can be registered and documented as well. Based on ORACLE, ReVK is a client/server data base system with the following modules: 1. data registration, 2. transport management, 3. waste tracking, 4. storage management, 5. container management, 6. reporting, 7. activity calculation, 8. examination of technical acceptance criteria for storages and final repositories. Furthermore ReVK provides a multitude of add-ons to meet special user needs, which enlarge the spectrum of application enormously. ReVK is validated and qualified, accepted by experts and authorities and fulfils the requirements for a radioactive waste documentation system. (authors)

  16. Developing Novel Therapeutics Targeting Undifferentiated and Castration-Resistant Prostate Cancer Stem Cells

    Science.gov (United States)

    2016-10-01

    2009;106:268-73. 41. Carver BS, Chapinski C, Wongvipat J, Hieronymus H, Chen Y, Chandarlapaty S, Arora VK, Le C, Koutcher J, Scher H, Scardino PT... Rosen N, Sawyers CL. Reciprocal feedback regulation of PI3K and androgen receptor signaling in PTEN- deficient prostate cancer. Cancer Cell. 2011;19

  17. An Assessment for the Presence of Powassan Virus in Ixodes scapularis Nymphs from Locations in Virginia, Maryland, New Jersey, Pennsylvania, New York, and Connecticut

    Science.gov (United States)

    2013-03-21

    1214-7 46. Kislenko GS, Chunikhin SP, Rasnitsyn SP, Kurenkov VB, Izotov VK. 1982. [Reproduction of Powassan and West Nile viruses in Aedes aegypti ...Ixodes scapularis (Say 1821), an aggressive tick that readily bites humans. This study collected I. scapularis from sites along the U.S. East Coast...68 Appendix 3: Sampling times and collection rates (Ticks

  18. Short-term environmental variability in cold-water coral habitat at Viosca Knoll, Gulf of Mexico

    NARCIS (Netherlands)

    Davies, Andrew J.; Duineveld, Gerard C.A.; van Weering, T.C.E.; Mienis, Furu; Quattrini, Andrea M.; Seim, Harvey E.; Bane, John M.; Ross, Steve W.

    2010-01-01

    The Lophelia pertusa community at Viosca Knoll (VK826) is the most extensive found to date in the Gulf of Mexico. As part of a multi-disciplinary study, the physical setting of this area was described using benthic landers, CTD transects and remotely operated vehicle observations. The site was

  19. comparison of accuracies in techniques for evaluating wind power ...

    African Journals Online (AJOL)

    Dk.kainkwa

    Johnson functions (Conradsen et al. 1984). Several non normal distributions have been suggested as ... Vf exp. 1. (4). The mean wind speed of the Weibull distribution is expressed as (Johnson 2006):. dV c. V c. V c. Vk. V .... Electricity Supply Company (TANESCO). The meteorological parameters namely wind speed and ...

  20. Binary compact object inspiral: Detection expectations

    Indian Academy of Sciences (India)

    ... events/yr. These predictions, for the first time, bring the expectations for DNS detections by initial LIGO .... our galactic event rate out to the local group. ..... VK thanks her collaborators in the work reviewed here: C Kim, P Grandclément,. C Ihm ...

  1. SA Journal of Radiology - Vol 9, No 2 (2005)

    African Journals Online (AJOL)

    Bronchiolitis obliterans organising pneumonia (BOOP) or cryptogenic organising pneumonia (COP) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VK Bhagwandas, R Morar, HD Bhula, 19-21. http://dx.doi.org/10.4102/sajr.v9i2.86 ...

  2. Seasonal Variation of Atmospheric Composition of Water-Soluble ...

    African Journals Online (AJOL)

    `123456789jkl''''#

    and 2006 wet season campaigns using a “Gent” PM10 stacked filter unit sampler with sequential Nuclepore polycarbonate filters. ... the effectiveness of abatement strategies for relevant ..... Giri, D., V.K. Murthy, P.R. Adhikary, and. S.N. Khanal ...

  3. The bile sequestrant cholestyramine increases survival in a rabbit model of brodifacoum poisoning.

    Science.gov (United States)

    Lindeblad, Matthew; Lyubimov, Alexander; van Breemen, Richard; Gierszal, Kamil; Weinberg, Guy; Rubinstein, Israel; Feinstein, Douglas L

    2018-06-12

    Patients exposed to long acting anticoagulant rodenticides (LAARs) are typically administered large amounts of oral vitamin K1 (VK1) to counteract life-threatening anti-coagulant effects. While VK1 treatment effectively prevents mortality, additional methods are needed to reduce the long duration of VK1 treatment which can last for months at high expense. We developed a model of brodifacoum (BDF) poisoning, one of the most potent LAARs, in adult male New Zealand White (NZW) rabbits. The LD50 for oral BDF was determined to be 192 μg/kg, similar to that calculated for adult rats. However, in contrast to rats, NZW rabbits exhibited severe internal hemorrhage including in the brain, symptoms which mimic what occurs in cases of human poisoning. Similar to warfarin, BDF and other LAARs undergo enterohepatic recirculation which contributes to their long half-lives. We therefore tested effects of cholestyramine (CSA), an FDA-approved bile sequestrant, on BDF-induced mortality. When given daily (0.67 gm/kg, oral) starting the day of BDF administration, CSA reduced mortality from 67% to 11%. At the same CSA prevented the increase in clotting time, and reduced the decrease in core body temperature due to BDF. Given its excellent safety record and that it is approved for children older than 6 years, these findings suggest CSA could be considered as an adjunct to VK1 for treatment of LAAR poisoning.

  4. Microscopic analysis of nanostructured plasma coatings

    Science.gov (United States)

    Ageev, E. V.; Altukhov, A. Yu; Ageeva, E. V.; Khardikov, S. V.

    2018-03-01

    In the course of the study, it was found that plasma nanocomposite coating obtained from a mixture of powders of BRS, VK8 and nichrome with a portable plasma device “ALPES-02M” has high performance properties, which significantly expands the scope of its application.

  5. African Journal of Clinical and Experimental Microbiology - Vol 17 ...

    African Journals Online (AJOL)

    Prevalence and distribution of intestinal parasite infections in HIV seropositive individuals on antiretroviral therapy in Vom, Plateau State Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PM Lar, VK Pam, Julius Ayegba, Hosea Zumbes, 18-24 ...

  6. 31 strategiske forskningstemaer

    DEFF Research Database (Denmark)

    Pedersen, Bente Klarlund; christensen, claus hviid; Højberg Christensen, Jesper

    Bedre grundlag for at prioritere den strategiske forskningInitiativet FORSK2015 Strategiske satsninger skal bidrage til at skabe bedre grundlag for at identificere og prioritere indsatsområderne for den strategiske forskning. FORSK2015 er et af de initiativer, VK-regeringen sammen med Dansk Folke...

  7. AcEST: DK948548 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sicum... 431 e-120 sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 430 e-120 sp|P32290|CATA_PHA...VK Sbjct: 181 ESLHMFTFLFDDIGIPQDYRHMDGSGVHTFTLINRAGKSTYVK 223 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella a

  8. Genetics Home Reference: Guillain-Barré syndrome

    Science.gov (United States)

    ... Nyati KK, Verma A, Rizwan A, Paliwal VK. Tumor necrosis factor-alpha polymorphisms and expression in Guillain-Barré syndrome. Hum Immunol. 2010 Sep;71(9):905-10. doi: 10.1016/j.humimm.2010.06.013. Epub 2010 Jun 19. ... L. Association of tumor necrosis factor polymorphisms with Guillain-Barré syndrome. Eur ...

  9. 2018-03-18T16:42:18Z https://www.ajol.info/index.php/index/oai oai ...

    African Journals Online (AJOL)

    article/55645 2018-03-18T16:42:18Z ajrh:ART Gender dynamics and sexual norms among youth in Mali in the context of HIV/AIDS prevention Boileau, C Vissandjee, B Nguyen, V-K Rashed, S Sylla, M Zunzunegui, MV Gender roles, sexual ...

  10. Toxicities of RDX or TNT Freshly Amended or Weathered-and-Aged in Five Natural Soils to the Collembolan Folsomia candida

    Science.gov (United States)

    2013-05-01

    Explosive 2,4,6-Trinitrotoluene. Ecotoxicol. Environ. Saf. 2002, 51, 133–144. 65 Gorontzy, T.; Drzyga, O.; Kahl, M.W.; Bruns- Nigel , D.; Breitung, J... Taylor and Francis Group: Boca Raton, FL, 2009; pp 5–33. Monteil-Rivera, F.; Paquet, L.; Deschamps, S.; Balakrishnan, V.K.; Beaulieu, C.; Hawari, J

  11. What does it mean to say that a hegemonic project is neo-liberal?

    DEFF Research Database (Denmark)

    Hansen, Allan Dreyer

    Udgangspunktet for dette papir er VK-O regeringerne under Anders Fogh Rasmussen i nullerne i Danmark for at rejse spørgsmålet om hvilke teoretiske resurser Laclau og Mouffes hegemoni teori tilbyder, men også hvor yderlig udvikling og nye teoretiske artikulationer er nødvendig. Papiret giver ikke ...

  12. Lenin nuclear reactor research institute in the tenth five-year plan

    International Nuclear Information System (INIS)

    Tsykanov, V.A.; Kulov, E.V.

    1980-01-01

    Main tasks and research results of Lenin Nuclear Reactor Reseach Institute in the 10-th Five-Year Plan are considered. Main research achievements are noted in nuclear power, radiation material testing, accumulation of transuranium elements and investigation of their physicochemical properties at VK-50, BOR-60, SM-2, RBT-6 and MIR reactor plants and in material testing laboratories

  13. Canola and hydrogenated soybean oils accelerate ectopic bone formation induced by implantation of bone morphogenetic protein in mice

    Directory of Open Access Journals (Sweden)

    Yoko Hashimoto

    2014-01-01

    Full Text Available Canola oil (Can and hydrogenated soybean oil (H2-Soy are commonly used edible oils. However, in contrast to soybean oil (Soy, they shorten the survival of stroke-prone spontaneously hypertensive (SHRSP rats. It has been proposed that the adverse effects of these oils on the kidney and testis are caused at least in part by dihydro-vitamin K (VK 1 in H2-Soy and unidentified component(s in Can. Increased intake of dihydro-VK1 is associated with decreased tissue VK2 levels and bone mineral density in rats and humans, respectively. The aim of the present study was to determine the effects of these oils on bone morphogenetic protein (BMP-induced ectopic bone formation, which is promoted by VK2 deficiency, in relation to the role of VK in the γ-carboxylation of osteocalcin and matrix Gla protein. A crude extract of BMPs was implanted into a gap in the fascia of the femoral muscle in 5-week-old mice maintained on a Soy, Can, or H2-Soy diet. Newly formed bone volume, assessed by three-dimensional X-ray micro-computed tomography and three-dimensional reconstruction imaging for bone, was 4-fold greater in the Can and H2-Soy groups than in the Soy group. The plasma carboxylated osteocalcin (Gla-OC and total OC (Gla-OC plus undercarboxylated osteocalcin [Glu-OC] levels were significantly lower in the Can group than in the Soy group (p < 0.05. However, these levels did not significantly differ between the H2-Soy and Soy groups. The plasma Gla-OC/Glu-OC ratio in the Can and H2-Soy groups was significantly lower (in Can; p = 0.044 or was almost significantly lower (in H2-Soy; p = 0.053 than that in the Soy group. In conclusion, Can and H2-Soy accelerated BMP-induced bone formation in mice to a greater extent than Soy. Further research is required to evaluate whether the difference in accelerated ectopic bone formation is associated with altered levels of VK2 and VK-dependent protein(s among the three dietary groups.

  14. 2-Bromo-1,4-naphthoquinone: a potentially improved substitute of menadione in Apatone™ therapy

    Energy Technology Data Exchange (ETDEWEB)

    Graciani, F.S.; Ximenes, V.F. [Departamento de Química, Faculdade de Ciências, Universidade Estadual Paulista, Bauru SP (Brazil); Departamento de Análises Clínicas, Faculdade de Ciências Farmacêuticas, Universidade Estadual Paulista, Araraquara SP (Brazil)

    2012-05-18

    Apatone™, a combination of menadione (2-methyl-1,4-naphthoquinone, VK{sub 3}) and ascorbic acid (vitamin C, VC) is a new strategy for cancer treatment. Part of its effect on tumor cells is related to the cellular pro-oxidative imbalance provoked by the generation of hydrogen peroxide (H{sub 2}O{sub 2}) through naphthoquinone redox cycling. In this study, we attempted to find new naphthoquinone derivatives that would increase the efficiency of H{sub 2}O{sub 2} production, thereby potentially increasing its efficacy for cancer treatment. The presence of an electron-withdrawing group in the naphthoquinone moiety had a direct effect on the efficiency of H{sub 2}O{sub 2} production. The compound 2-bromo-1,4-naphthoquinone (BrQ), in which the bromine atom substituted the methyl group in VK{sub 3}, was approximately 10- and 19-fold more efficient than VK{sub 3} in terms of oxygen consumption and H{sub 2}O{sub 2} production, respectively. The ratio [H{sub 2}O{sub 2}]{sub produced} / [naphthoquinone]{sub consumed} was 68 ± 11 and 5.8 ± 0.2 (µM/µM) for BrQ and VK{sub 3}, respectively, indicating a higher efficacy of BrQ as a catalyst for the autoxidation of ascorbic acid. Both VK{sub 3} and BrQ reacted with glutathione (GSH), but BrQ was the more effective substrate. Part of GSH was incorporated into the naphthoquinone, producing a nucleophilic substitution product (Q-SG). The depletion of BrQ by GSH did not prevent its redox capacity since Q-SG was also able to catalyze the production of reactive oxygen species. VK{sub 3}/VC has already been submitted to clinical trials for the treatment of prostate cancer and has demonstrated promising results. However, replacement of VK{sub 3} with BrQ will open new lines of investigation regarding this approach to cancer treatment.

  15. Vitamin K2 inhibits rat vascular smooth muscle cell calcification by restoring the Gas6/Axl/Akt anti-apoptotic pathway.

    Science.gov (United States)

    Qiu, Cuiting; Zheng, Haijun; Tao, Huiren; Yu, Wenjun; Jiang, Xiaoyu; Li, Aiqin; Jin, Hui; Lv, Anlin; Li, Huan

    2017-09-01

    Vascular calcification is associated with cardiovascular disease as a complication of hypertension, hyperlipidemia, diabetes mellitus, and chronic kidney disease. Vitamin K2 (VK2) delays vascular calcification by an unclear mechanism. Moreover, apoptosis modulates vascular smooth muscle cell (VSMC) calcification. This paper aimed to study VK2-modified VSMC calcification and survival cell signaling mediated by growth arrest-specific gene 6 (Gas6) and its tyrosine kinase receptor Axl. Primary-cultured VSMCs were dose-dependently treated with VK2 in the presence of calcification medium for 8 days, or pre-treated for 1 h with/without the Axl inhibitor R428 (2 μmol/L) or the caspase inhibitor Z-VAD-fmk (20 μmol/L) followed by treatment with VK2 (10 μmol/L) or rmGas6 (200 nmol/L) in calcification medium for 8 days. Calcium deposition was determined by the o-cresolphthalein complexone assay and Alizarin Red S staining. Apoptosis was determined by TUNEL and flow cytometry using Annexin V-FITC and propidium iodide staining. Western blotting detected the expressions of Axl, Gas6, p-Akt, Akt, and Bcl2. VK2 significantly inhibited CaCl 2 - and β-sodium glycerophosphate (β-GP)-induced VSMC calcification and apoptosis, which was dependent on restored Gas6 expression and activated downstream signaling by Axl, p-Akt, and Bcl2. Z-VAD-fmk significantly inhibited CaCl 2 - and β-GP-induced VSMC calcification and apoptosis. Augmented recombinant mouse Gas6 protein (rmGas6) expression significantly reduced VSMC calcification and apoptosis. Furthermore, the Gas6/Axl interaction was inhibited by R428, which abolished the preventive effect of VK2 on CaCl 2 - and β-GP-induced apoptosis and calcification. These results suggest that Gas6 is critical in VK2-mediated functions that attenuate CaCl 2 - and β-GP-induced VSMC calcification by blocking apoptosis.

  16. Frequency of mutations in the genes associated with hereditary sensory and autonomic neuropathy in a UK cohort.

    Science.gov (United States)

    Davidson, G L; Murphy, S M; Polke, J M; Laura, M; Salih, M A M; Muntoni, F; Blake, J; Brandner, S; Davies, N; Horvath, R; Price, S; Donaghy, M; Roberts, M; Foulds, N; Ramdharry, G; Soler, D; Lunn, M P; Manji, H; Davis, M B; Houlden, H; Reilly, M M

    2012-08-01

    The hereditary sensory and autonomic neuropathies (HSAN, also known as the hereditary sensory neuropathies) are a clinically and genetically heterogeneous group of disorders, characterised by a progressive sensory neuropathy often complicated by ulcers and amputations, with variable motor and autonomic involvement. To date, mutations in twelve genes have been identified as causing HSAN. To study the frequency of mutations in these genes and the associated phenotypes, we screened 140 index patients in our inherited neuropathy cohort with a clinical diagnosis of HSAN for mutations in the coding regions of SPTLC1, RAB7, WNK1/HSN2, FAM134B, NTRK1 (TRKA) and NGFB. We identified 25 index patients with mutations in six genes associated with HSAN (SPTLC1, RAB7, WNK1/HSN2, FAM134B, NTRK1 and NGFB); 20 of which appear to be pathogenic giving an overall mutation frequency of 14.3%. Mutations in the known genes for HSAN are rare suggesting that further HSAN genes are yet to be identified. The p.Cys133Trp mutation in SPTLC1 is the most common cause of HSAN in the UK population and should be screened first in all patients with sporadic or autosomal dominant HSAN.

  17. Frequency of mutations in the genes associated with hereditary sensory and autonomic neuropathy in a UK cohort.

    LENUS (Irish Health Repository)

    Davidson, G L

    2012-08-01

    The hereditary sensory and autonomic neuropathies (HSAN, also known as the hereditary sensory neuropathies) are a clinically and genetically heterogeneous group of disorders, characterised by a progressive sensory neuropathy often complicated by ulcers and amputations, with variable motor and autonomic involvement. To date, mutations in twelve genes have been identified as causing HSAN. To study the frequency of mutations in these genes and the associated phenotypes, we screened 140 index patients in our inherited neuropathy cohort with a clinical diagnosis of HSAN for mutations in the coding regions of SPTLC1, RAB7, WNK1\\/HSN2, FAM134B, NTRK1 (TRKA) and NGFB. We identified 25 index patients with mutations in six genes associated with HSAN (SPTLC1, RAB7, WNK1\\/HSN2, FAM134B, NTRK1 and NGFB); 20 of which appear to be pathogenic giving an overall mutation frequency of 14.3%. Mutations in the known genes for HSAN are rare suggesting that further HSAN genes are yet to be identified. The p.Cys133Trp mutation in SPTLC1 is the most common cause of HSAN in the UK population and should be screened first in all patients with sporadic or autosomal dominant HSAN.

  18. Alpha-tocopheryl succinate inhibits autophagic survival of prostate cancer cells induced by vitamin K3 and ascorbate to trigger cell death.

    Science.gov (United States)

    Tomasetti, Marco; Nocchi, Linda; Neuzil, Jiri; Goodwin, Jacob; Nguyen, Maria; Dong, Lanfeng; Manzella, Nicola; Staffolani, Sara; Milanese, Claudio; Garrone, Beatrice; Alleva, Renata; Borghi, Battista; Santarelli, Lory; Guerrieri, Roberto

    2012-01-01

    The redox-silent vitamin E analog α-tocopheryl succinate (α-TOS) was found to synergistically cooperate with vitamin K3 (VK3) plus ascorbic acid (AA) in the induction of cancer cell-selective apoptosis via a caspase-independent pathway. Here we investigated the molecular mechanism(s) underlying cell death induced in prostate cancer cells by α-TOS, VK3 and AA, and the potential use of targeted drug combination in the treatment of prostate cancer. The generation of ROS, cellular response to oxidative stress, and autophagy were investigated in PC3 prostate cancer cells by using drugs at sub-toxic doses. We evaluated whether PARP1-mediated apoptosis-inducing factor (AIF) release plays a role in apoptosis induced by the combination of the agents. Next, the effect of the combination of α-TOS, VK3 and AA on tumor growth was examined in nude mice. VK3 plus AA induced early ROS formation associated with induction of autophagy in response to oxidative stress, which was reduced by α-TOS, preventing the formation of autophagosomes. α-TOS induced mitochondrial destabilization leading to the release of AIF. Translocation of AIF from mitochondria to the nucleus, a result of the combinatorial treatment, was mediated by PARP1 activation. The inhibition of AIF as well as of PARP1 efficiently attenuated apoptosis triggered by the drug combination. Using a mouse model of prostate cancer, the combination of α-TOS, VK3 and AA was more efficient in tumor suppression than when the drugs were given separately, without deleterious side effects. α-TOS, a mitochondria-targeting apoptotic agent, switches at sub-apoptotic doses from autophagy-dependent survival of cancer cells to their demise by promoting the induction of apoptosis. Given the grim prognosis for cancer patients, this finding is of potential clinical relevance.

  19. Alpha-tocopheryl succinate inhibits autophagic survival of prostate cancer cells induced by vitamin K3 and ascorbate to trigger cell death.

    Directory of Open Access Journals (Sweden)

    Marco Tomasetti

    Full Text Available BACKGROUND: The redox-silent vitamin E analog α-tocopheryl succinate (α-TOS was found to synergistically cooperate with vitamin K3 (VK3 plus ascorbic acid (AA in the induction of cancer cell-selective apoptosis via a caspase-independent pathway. Here we investigated the molecular mechanism(s underlying cell death induced in prostate cancer cells by α-TOS, VK3 and AA, and the potential use of targeted drug combination in the treatment of prostate cancer. METHODOLOGY/PRINCIPAL FINDINGS: The generation of ROS, cellular response to oxidative stress, and autophagy were investigated in PC3 prostate cancer cells by using drugs at sub-toxic doses. We evaluated whether PARP1-mediated apoptosis-inducing factor (AIF release plays a role in apoptosis induced by the combination of the agents. Next, the effect of the combination of α-TOS, VK3 and AA on tumor growth was examined in nude mice. VK3 plus AA induced early ROS formation associated with induction of autophagy in response to oxidative stress, which was reduced by α-TOS, preventing the formation of autophagosomes. α-TOS induced mitochondrial destabilization leading to the release of AIF. Translocation of AIF from mitochondria to the nucleus, a result of the combinatorial treatment, was mediated by PARP1 activation. The inhibition of AIF as well as of PARP1 efficiently attenuated apoptosis triggered by the drug combination. Using a mouse model of prostate cancer, the combination of α-TOS, VK3 and AA was more efficient in tumor suppression than when the drugs were given separately, without deleterious side effects. CONCLUSIONS/SIGNIFICANCE: α-TOS, a mitochondria-targeting apoptotic agent, switches at sub-apoptotic doses from autophagy-dependent survival of cancer cells to their demise by promoting the induction of apoptosis. Given the grim prognosis for cancer patients, this finding is of potential clinical relevance.

  20. Novel Vitamin K analogues suppress seizures in zebrafish and mouse models of epilepsy

    Science.gov (United States)

    Rahn, Jennifer J.; Bestman, Jennifer E.; Josey, Benjamin J.; Inks, Elizabeth S.; Stackley, Krista D.; Rogers, Carolyn E.; Chou, C. James; Chan, Sherine S. L.

    2014-01-01

    Epilepsy is a debilitating disease affecting 1-2% of the world’s population. Despite this high prevalence, 30% of patients suffering from epilepsy are not successfully managed by current medication suggesting a critical need for new anti-epileptic drugs (AEDs). In an effort to discover new therapeutics for the management of epilepsy, we began our study by screening drugs that, like some currently used AEDs, inhibit HDACs using a well-established larval zebrafish model. In this model, 7-day post fertilization (dpf) larvae are treated with the widely used seizure-inducing compound pentylenetetrazol (PTZ) which stimulates a rapid increase in swimming behavior previously determined to be a measurable manifestation of seizures. In our first screen, we tested a number of different HDAC inhibitors and found that one, NQN1, significantly decreased swim activity to levels equal to that of VPA. We continued to screen structurally related compounds including Vitamin K3 (VK3) and a number of novel Vitamin K (VK) analogues. We found that VK3 was a robust inhibitor of the PTZ-induced swim activity, as were several of our novel compounds. Three of these compounds were subsequently tested on mouse seizure models at the National Institute of Neurological Disorders and Stroke (NINDS) Anticonvulsant Screening Program. Compound 2h reduced seizures particularly well in the minimal clonic seizure (6 Hz) and corneal kindled mouse models of epilepsy, with no observable toxicity. As VK3 affects mitochondrial function, we tested the effects of our compounds on mitochondrial respiration and ATP production in a mouse hippocampal cell line. We demonstrate that these compounds affect ATP metabolism and increase total cellular ATP. Our data indicate the potential utility of these and other VK analogues for prevention of seizures and suggest the potential mechanism for this protection may lie in the ability of these compounds to affect energy production. PMID:24291671

  1. Design and optimization of an adaptive optics system for a high-average-power multi-slab laser (HiLASE)

    Czech Academy of Sciences Publication Activity Database

    Pilař, Jan; Slezák, Jiří; Sikocinski, Pawel; Divoký, Martin; Sawicka, Magdalena; Bonora, Stefano; Lucianetti, Antonio; Mocek, Tomáš; Jelínková, H.

    2014-01-01

    Roč. 53, č. 15 (2014), 3255-3261 ISSN 1559-128X R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : adaptive optics * multislab * amplifier * wavefront Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.784, year: 2014

  2. Formation of TiO2 domains in Poly (9-vinylcarbazole) thin film by hydrolysis-condensation of a metal alkoxide

    International Nuclear Information System (INIS)

    Barlier, V.; Bounor-Legare, V.; Alcouffe, P.; Boiteux, G.; Davenas, J.

    2007-01-01

    New organic-inorganic hybrid thin films based on Poly (9-vinylcarbazole) (P9VK) and Dioxide titanium (TiO 2 ) bulk-heterojunction were obtained by a hydrolysis-condensation (H-C) process of titanium (IV) isopropoxide in thin film. The TiO 2 distribution in the film was investigated by scanning electron microscopy. The results indicated that homogeneous TiO 2 particles around 100 nm were formed on the surface of the polymer thin film. Photoluminescence spectroscopy has been used to study the charge transfer efficiency in the photoactive layer and results were compared with a simplest elaboration route, the dispersion of TiO 2 anatase in a P9VK solution before spin coating. Results showed that TiO 2 elaborated by H-C exhibits a competitive quenching effect with TiO 2 anatase

  3. Cryogenically-cooled Yb:YGAG ceramic mode-locked laser

    Czech Academy of Sciences Publication Activity Database

    Mužík, Jiří; Jelínek, M.; Jambunathan, Venkatesan; Miura, Taisuke; Smrž, Martin; Endo, Akira; Mocek, Tomáš; Kubeček, V.

    2015-01-01

    Roč. 24, č. 2 (2015), s. 1402-1408 ISSN 1094-4087 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk LO1602; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : solid-states laser * lasing characteristics Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 3.148, year: 2015

  4. Investigation into springback characteristics of two HSS sheets during cold v-bending

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Gang; Gao, Wei-Ran [Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China)

    2013-12-16

    Considering the safety and the light-weight structure, there is an increasing requirement of high strength steel (HSS) sheets in the automotive industry. The high-precise prediction of the springback depends on constitutive equations and their corresponding material parameters. In order to investigate the springback of HSS sheets, DP590 and B280VK, their constitutive behaviors were analyzed based on the sheet tension tests. With respect to the constitutive equation, the Voce model is more proper to two hot-rolled steels, DP590 and B280VK, than the Swift model. Two steels are all saturated hardening, and the degree of hardening decreases with the strain. The cold v-banding tests of two HSS sheets were carried out for evaluation of springback characteristics. Results of v-bending experiments showed that the springback angle increases with the bending along 45°, 90° and 0° to the rolling direction of steel in turn.

  5. Transport and dosimetric solutions for the ELIMED laser-driven beam line

    Czech Academy of Sciences Publication Activity Database

    Cirrone, G.A.P.; Romano, F.; Scuderi, Valentina; Amato, A.; Candiano, G.; Cuttone, G.; Giove, D.; Korn, Georg; Krása, Josef; Leanza, R.; Manna, R.; Maggiore, M.; Marchese, V.; Margarone, Daniele; Milluzzo, G.; Petringa, G.; Sabini, M.G.; Schillaci, F.; Tramontana, A.; Valastro, L.; Velyhan, Andriy

    2015-01-01

    Roč. 796, Oct (2015), s. 99-103 ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE2.3.30.0057 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : laser-driven ion * beam-transport * Faraday cup dosimetry * absolute dosimetry Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.200, year: 2015

  6. Joule-class 940-nm diode laser bars for millisecond pulse applications

    Czech Academy of Sciences Publication Activity Database

    Crump, P.; Frevert, C.; Ginolas, A.; Knigge, S.; Maassdorf, A.; Lotz, J.; Fassbender, W.; Neukum, J.; Körner, J.; Töpfer, T.; Pranovich, Alina; Divoký, Martin; Lucianetti, Antonio; Mocek, Tomáš; Ertel, K.; De Vido, M.; Erbert, G.; Traenkle, G.

    2015-01-01

    Roč. 27, č. 15 (2015), s. 1663-1666 ISSN 1041-1135 R&D Projects: GA MŠk EE2.3.20.0143; GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.30.0057 Grant - others:OP VK 6(XE) CZ.1.07/2.3.00/20.0143; HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : semiconductor laser arrays * power conversion * pulse power systems * pumps * YAG lasers * cryogenics Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.945, year: 2015

  7. Thermally induced depolarization in terbium gallium garnet ceramics rod with natural convection cooling

    Czech Academy of Sciences Publication Activity Database

    Slezák, Ondřej; Yasuhara, R.; Lucianetti, Antonio; Vojna, David; Mocek, Tomáš

    2015-01-01

    Roč. 17, č. 6 (2015), s. 1-8, č. článku 065610. ISSN 2040-8978 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : stress-induced birefringence * thermal depolarization * high-power lasers Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.847, year: 2015

  8. Generation of radially polarized high energy mid-infrared optical vortex by use of a passive axially symmetric ZnSe waveplate

    Czech Academy of Sciences Publication Activity Database

    Wakayama, T.; Oikawa, H.; Sasanuma, A.; Arai, G.; Fujii, Y.; Dinh, T.H.; Higashiguchi, T.; Sakaue, K.; Washio, M.; Miura, Taisuke; Takahashi, A.; Nakamura, D.; Okada, T.; Yonemura, M.; Otani, Y.

    2015-01-01

    Roč. 107, č. 8 (2015), "081112-1"-"081112-5" ISSN 0003-6951 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : laser * phase * beams Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.142, year: 2015

  9. High-contrast, high-intensity petawatt-class laser and applications

    Czech Academy of Sciences Publication Activity Database

    Kiriyama, H.; Mori, M.; Pirozhkov, A.S.; Ogura, K.; Sagisaka, A.; Kon, A.; Esirkepov, T.Z.; Hayashi, Y.; Kotaki, H.; Kanasaki, M.; Sakaki, H.; Fukuda, Y.; Koga, J.; Nishiuchi, M.; Kando, M.; Bulanov, S.; Kondo, K.; Bolton, P.R.; Slezák, Ondřej; Vojna, David; Sawicka-Chyla, Magdalena; Jambunathan, Venkatesan; Lucianetti, Antonio; Mocek, Tomáš

    2015-01-01

    Roč. 21, č. 1 (2015), s. 1601118 ISSN 0018-9197 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : petawatt laser * applications * Ti:saphire * ASE Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.843, year: 2015

  10. The Energy Selection System for the laser-accelerated proton beams at ELI-Beamlines

    Czech Academy of Sciences Publication Activity Database

    Tramontana, A.; Candiano, G.; Carpinelli, M.; Cirrone, G.A.P.; Cuttone, G.; Bijan Jia, S.; Korn, Georg; Licciardello, T.; Maggiore, Mario; Manti, L.; Margarone, Daniele; Pisciotta, P.; Romano, F.; Stancampiano, C.; Schillaci, Francesco; Scuderi, Valentina

    2014-01-01

    Roč. 9, May (2014), s. 1-11 ISSN 1748-0221 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : instrumentation for hadron therapy * wake-field acceleration (laser-driven, electron-driven) * plasma diagnostics * charged-particle spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.399, year: 2014

  11. Design of high-energy-class cryogenically cooled Yb.sup.3+./sup.:YAG multislab laser system with low wavefront distortion

    Czech Academy of Sciences Publication Activity Database

    Divoký, Martin; Sikocinski, Pawel; Pilař, Jan; Lucianetti, Antonio; Sawicka, Magdalena; Slezák, Jiří; Mocek, Tomáš

    2013-01-01

    Roč. 52, č. 6 (2013), "064201-1"-"064201-6" ISSN 0091-3286 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : DPSSL * Yb 3+ :YAG * cryogenically cooled amplifier * pulsed high average power laser Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.958, year: 2013

  12. Sintering of cermets on the base of corundum and molybdenum

    International Nuclear Information System (INIS)

    Fedotov, A.V.

    1987-01-01

    Liquid-phase sintering of cermets has been studied to develop rational technology allowing to produce a dense material at lower temperatures. Molybdenum of the MPCh mark with the specific surface ranged from 1900 to 4000 cm 2 /g and the corundum powder of the VK-94-1 mark with the specific surface of 6000 cm 2 /g containing upto 10% of the glass-phase have been used as initial materials. It is shown that application of the VK-94-1 ceramics powder for molybdenum content cermets allows to decrease the temperature of dense material production (∼ upto 100 deg C). To produce dense materials, it is necessary to restrict the initial porosity of compaction and to correspond it to the sintering conditions. The increase of molybdenum dispersion allows to produce material with the more homogeneous structure, higher density and strength. Molybdenum presence decreases recrystallization of corundum crystals and causes structure production resistant to high-temperature heating

  13. Overview of the HiLASE project: high average power pulsed DPSSL systems for research and industry

    Czech Academy of Sciences Publication Activity Database

    Divoký, Martin; Smrž, Martin; Chyla, Michal; Sikocinski, Pawel; Severová, Patricie; Novák, Ondřej; Huynh, Jaroslav; Nagisetty, Siva S.; Miura, Taisuke; Pilař, Jan; Slezák, Jiří; Sawicka, Magdalena; Jambunathan, Venkatesan; Vanda, Jan; Endo, Akira; Lucianetti, Antonio; Rostohar, Danijela; Mason, P.D.; Phillips, P.J.; Ertel, K.; Banerjee, S.; Hernandez-Gomez, C.; Collier, J.L.; Mocek, Tomáš

    2014-01-01

    Roč. 2, SI (2014), s. 1-10 ISSN 2095-4719 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : DPSSL * Yb3C:YAG * thin-disk * multi-slab * pulsed high average power laser Subject RIV: BH - Optics, Masers, Lasers

  14. Learning-based Nonlinear Model Predictive Control to Improve Vision-based Mobile Robot Path Tracking

    Science.gov (United States)

    2015-07-01

    corresponding cost function to be J(u) = ( xd − x)TQx ( xd − x) + uTRu, (20) where Qx ∈ RKnx×Knx is positive semi-definite, R and u are as in (3), xd is a...sequence of desired states, xd = ( xd ,k+1, . . . , xd ,k+K), x is a sequence of predicted states, x = (xk+1, . . . ,xk+K), and K is the given prediction...vact,k−1+b, ωact,k−1+b), based ωk θk vk xd ,i−1 xd ,i xd ,i+1 xk yk Figure 5: Definition of the robot velocities, vk and ωk, and three pose variables

  15. Influence of laser pulse duration on extreme ultraviolet and ion emission features from tin plasmas

    Czech Academy of Sciences Publication Activity Database

    Roy, Amitava; Harilal, S.S.; Polek, M.P.; Hassan, S.M.; Endo, Akira; Hassanein, A.

    2014-01-01

    Roč. 21, č. 3 (2014), "033109-1"-"033109-7" ISSN 1070-664X R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : width * efficiency * clusters * targets Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.142, year: 2014

  16. Extreme ultraviolet emission and confinement of tin plasmas in the resenceof a magnetic field

    Czech Academy of Sciences Publication Activity Database

    Roy, Amitava; Hassan, S.M.; Harilal, S.S.; Endo, Akira; Mocek, Tomáš; Hassanein, A.

    2014-01-01

    Roč. 21, č. 5 (2014), "053106-1"-"053106-11" ISSN 1070-664X R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : laser-produced plasma * debris mitigation * dynamics * targets Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.142, year: 2014

  17. Collimation of laser-produced plasmas using axial magnetic field

    Czech Academy of Sciences Publication Activity Database

    Roy, Amitava; Harilal, S.S.; Hassan, S.M.; Endo, Akira; Mocek, Tomáš; Hassanein, A.

    2015-01-01

    Roč. 33, č. 2 (2015), s. 175-182 ISSN 0263-0346 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : laser-produced plasma * optical emission spectroscopy * plasma-B field interaction * plasma temperature and density * tin plasma Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.649, year: 2015

  18. Fabrication of advanced targets for laser driven nuclear fusion reactions through standard microelectronics technology approaches.

    Czech Academy of Sciences Publication Activity Database

    Picciotto, A.; Crivellari, M.; Bellutti, P.; Barozzi, M.; Kucharik, M.; Krása, Josef; Swidlovsky, A.; Malinowska, A.; Velyhan, Andriy; Ullschmied, Jiří; Margarone, Daniele

    2017-01-01

    Roč. 12, October (2017), č. článku P10001. ISSN 1748-0221 Grant - others:OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : Nuclear instruments and methods for hot plasma diagnostics * Plasma generation (laserproduced, RF, x ray-produced) * Plasma diagnostics - charged-particle spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics; BL - Plasma and Gas Discharge Physics (FZU-D) OBOR OECD: 2.11 Other engineering and technologies; 2.11 Other engineering and technologies (FZU-D) Impact factor: 1.220, year: 2016 http://iopscience.iop.org/article/10.1088/1748-0221/12/10/P10001/meta

  19. Investigation into springback characteristics of two HSS sheets during cold v-bending

    International Nuclear Information System (INIS)

    Fang, Gang; Gao, Wei-Ran

    2013-01-01

    Considering the safety and the light-weight structure, there is an increasing requirement of high strength steel (HSS) sheets in the automotive industry. The high-precise prediction of the springback depends on constitutive equations and their corresponding material parameters. In order to investigate the springback of HSS sheets, DP590 and B280VK, their constitutive behaviors were analyzed based on the sheet tension tests. With respect to the constitutive equation, the Voce model is more proper to two hot-rolled steels, DP590 and B280VK, than the Swift model. Two steels are all saturated hardening, and the degree of hardening decreases with the strain. The cold v-banding tests of two HSS sheets were carried out for evaluation of springback characteristics. Results of v-bending experiments showed that the springback angle increases with the bending along 45°, 90° and 0° to the rolling direction of steel in turn

  20. Thermoelectric power of YBa2Cu3Osub(7-δ) under pressure upto 9GPa

    International Nuclear Information System (INIS)

    Ramasesha, S.K.; Singh, A.K.

    1991-01-01

    Thermoelectric power (TEP) of two YBa 2 Cu 3 Osub(7-δ) compounds (with δ=0.17 and 0.21) was measured as a function of quasi-hydrostatic pressure up to 9GPa at 300 K on samples with low porosity. In both cases TEP decreases with increasing pressure, at a rate ∼0.8μVK -1 /GPa. The data obtained under hydrostatic pressure up to 3 GPa are in good agreement with those under quasi-hydrostatic pressure. The TEP of both compositions is found to decrease linearly at a rate 0.8 μVK -1 /GPa above 1.5 GPA. (author). 17 refs

  1. Joint and collaborative representation with local Volterra kernels convolution feature for face recognition

    Science.gov (United States)

    Feng, Guang; Li, Hengjian; Dong, Jiwen; Chen, Xi; Yang, Huiru

    2018-04-01

    In this paper, we proposed a joint and collaborative representation with Volterra kernel convolution feature (JCRVK) for face recognition. Firstly, the candidate face images are divided into sub-blocks in the equal size. The blocks are extracted feature using the two-dimensional Voltera kernels discriminant analysis, which can better capture the discrimination information from the different faces. Next, the proposed joint and collaborative representation is employed to optimize and classify the local Volterra kernels features (JCR-VK) individually. JCR-VK is very efficiently for its implementation only depending on matrix multiplication. Finally, recognition is completed by using the majority voting principle. Extensive experiments on the Extended Yale B and AR face databases are conducted, and the results show that the proposed approach can outperform other recently presented similar dictionary algorithms on recognition accuracy.

  2. Three monoclonal antibodies to the VHS virus glycoprotein: comparison of reactivity in relation to differences in immunoglobulin variable domain gene sequences

    DEFF Research Database (Denmark)

    Lorenzen, Niels; Cupit, P.M.; Secombes, C.J.

    2000-01-01

    and their neutralising activity was evident. Binding kinetic analyses by plasmon resonance identified differences in the dissociation rate constant (kd) as a possible explanation for the different reactivity levels of the MAbs. The Ig variable heavy (VH) and light (V kappa) domain gene sequences of the three hybridomas...... were compared. The inferred amino acid sequence of the two neutralising antibody VH domains differed by three amino acid residues (97% identity) and only one residue difference was evident in the Vk. domains. In contrast, IP1H3 shared only 38 and 39% identity with the 3F1A2 and 3F1H10 VH domains...... respectively and 49 and 50% identity with the 3F1A2 and 3F1H10 VK domains respectively. The neutralising antibodies were produced by hybridomas originating from the same fusion and the high nucleotide sequence homology of the variable Ig gene regions indicated that the plasma cell partners of the hybridomas...

  3. [Hereditary sensory and autonomic neuropathy type II A: early neurological and skeletal findings].

    Science.gov (United States)

    Esmer, C; Díaz Zambrano, S; Santos Díaz, M A; González Huerta, L M; Cuevas Covarrubias, S A; Bravo Oro, A

    2014-04-01

    The hereditary sensory and autonomic neuropathies are genetic disorders characterized by the loss of sensation including pain, tactile and temperature. Its clinical and molecular features vary widely; the symptoms may begin from birth or be noticed in the first or second decade, with different types of complications of trauma to the extremities such as ulcers, mutilations and acral amputations. They are classified into six groups from I to VI, determined by the abnormality in eleven genes leading to phenotypic variations in the age of onset and the presence or absence of dysautonomia signs. With the exception of type I, all are autosomal recessive. The type II of these neuropathies is characterized by insensitivity to pain, heat and proprioception. We describe three members of a Mexican family with WNK1 gene mutation that caused hereditary neuropathy IIA. Copyright © 2013 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.

  4. Genetic polymorphism of adult reindeer coat colour in a herding cooperative in Finnish Lapland

    Directory of Open Access Journals (Sweden)

    Jean J. Lauvergne

    2011-04-01

    Full Text Available In a random sample of 188 adult reindeer belonging to a reindeer herding cooperative in Finnish Lapland, the following coat colour mutants were identified: Abf at the locus Agouti (A, kalppinokka (WNk at the locus White Nose (WN and white at the locus W (White. Coefficients of coat colour phenotypic polymorphism K were estimated, in order to quantify this genetic polymorphism. Estimations of K were 12.8% for the locus A (Agouti, 5.1% for the locus WN (White Nose, and 7.5% for the locus W (White. This polymorphism results probably from a change in fitness coefficient of genotypes carrying colour mutants following domestication in a random mating context which has not yet been proved.

  5. A Study of Members’ Attitudes toward the Process Action Team Experience at a Naval Hospital

    Science.gov (United States)

    1992-01-01

    the existence of positive-findings bias. Personnel Psychology , JD (3), 579-593. Berwick, D.M., Godfrey, A.B. & Roessner, J. (1990). Curing Health... atAr ~wVL czatxoc t~ L"*-M vkA1JLkiFn Length of time this PAT h 14 5-8 More than 1. Rate your oveall sat Months Months 8 Months Overall Very Satisfied

  6. Forecasting Nutrition Research in 2020

    Science.gov (United States)

    2014-01-01

    Wyatt HR: The myth of healthy obesity. Ann Intern Med 159:789–790, 2013. 14. Hand GA, Shook RP, Paluch AE, Baruth M, Crowley EP, Jaggers JR, Prasad VK...glucoraphanin found in broccoli and other cruciferous veg- etables. Regardless of whether this mutation is present, eat - ing more than 3 servings per week of...Research in 2020 observed 50% reduction in polyps. The null mutation is associ- ated with increased blood levels of isothiocyanate after eating cruciferous

  7. Synthetic Beta-Lactam Antibiotics as a Selective Breast Cancer Cell Apoptosis Inducer: Significance in Breast Cancer Prevention and Treatment

    Science.gov (United States)

    2007-03-01

    References 1. Labbe S, Thiele DJ: Pipes and wiring: the regulation of copper uptake and distribution in yeast . Trends Microbiol 1999, 7:500-505. 2. Aggett...inhibitors. New agents in cancer therapy. Drugs Aging 2000, 17:249-255. 8. Brewer GJ: Copper control as an antiangiogenic anticancer therapy: lessons... Brewer GJ, Dick RD, Grover DK, LeClaire V, Tseng M, Wicha M, Pienta K, Redman BG, Jahan T, Sondak VK, et al.: Treatment of metastatic cancer with

  8. On the advisability of nuclear power plant construction and some solutions on their safety increase

    International Nuclear Information System (INIS)

    Sokolov, I.N.

    1989-01-01

    Neccesity in a further development of nuclear power in the USSR is proved. Specific features of layouts of nuclear heat supplying plants with increased safety including WWER-440, WWER-1000 and VK-50 reactors are considered. It is stressed that even under the most incredible accidents referring to the class of hypothetic ones, radioactive effect on the population, according to evaluations by experts, whould be much lower than maximum admissible one according to the existing standards

  9. Electronic Theory of 2-6 and Related Semiconducting Materials and Structures

    Science.gov (United States)

    1985-10-01

    band damping 3(m,’ ( ! -x(A,&e,) 2VkT should be more pronounced. follows from Eq. (29) by assuming nondegenerate statis- V. IMPLICATIONS FOR tics and...have shown that an ideal parabolic Educacion y Ciencia. This work was supported b) the well absorbs light at the bare harmonic-oscillator frequen...acknowl- different perturbations induce on the ir optical-absorption edge support from Spain’s Ministerio de Educacion y spectrum of wide parabolic

  10. Depth profiles of 230Th excess, transition metals and mineralogy of ferromanganese crusts of the Central Indian Ocean basin and implications for palaeoceanographic influence on crust genesis

    Digital Repository Service at National Institute of Oceanography (India)

    Banakar, V.K.; Borole, D.V.

    any pdstdeposi- tional redistribution over the dating interval (Krishnaswami and Cochran, 1978). The re- lationship used for growth rates estimation is: d In C/dz= -I/S where C= concentration of radionuclide; A=decay constant of the nuclide; s.... Ferromanganese de- posits from the central Pacific Ocean, I. Encrustations from the Line Island archipelago. Geochim. Cosmo- chim. Acta, 49: 427-436. Banakar, V.K., 1988. Chemical, radioisotopic and geo- chronological studies of polymetallic nodules...

  11. The redox chemistry of neptunium in gamma-irradiated aqueous nitric acid in the presence of an organic phase

    Czech Academy of Sciences Publication Activity Database

    Mincher, B.J.; Přeček, Martin; Paulenova, A.

    2016-01-01

    Roč. 308, č. 3 (2016), s. 1005-1009 ISSN 0236-5731 R&D Projects: GA MŠk EE2.3.30.0057 Grant - others:OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : neptunium * redox chemistry * radiation chemistry * solvent extraction Subject RIV: CH - Nuclear ; Quantum Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 1.282, year: 2016

  12. New possibilities for efficient laser surface treatment by diode-pumped kW-class lasers

    Czech Academy of Sciences Publication Activity Database

    Brajer, Jan; Švábek, Roman; Rostohar, Danijela; Divoký, Martin; Lucianetti, Antonio; Mocek, Tomáš; Madl, J.; Pitrmuc, Z.

    2015-01-01

    Roč. 2015, Aug (2015), s. 1-3 ISSN 1823-3430 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : amplifier Subject RIV: BH - Optics, Masers, Lasers

  13. Ultraviolet spectra in the diffuse auroral region

    International Nuclear Information System (INIS)

    Ishimoto, M.; Meng, C.I.; Romick, G.J.; Huffman, R.E.

    1988-01-01

    Nadir-viewing UV spectral/photometric measurements taken aboard the S3-4 satellite at 270 km were used to study the energetics of incident electrons in the nighttime aurora. The results suggest that the average energy of incident electrons was 3 + or - 1 kev. It is also found that the intensity ratio of the LBH (3-10) to VK (0-5) emissions is a good indicator of the average energy flux of the incident electrons. 31 references

  14. Dvoufázová aplikace vlnkové transformace pro filtraci šumu a fázovou analýzu ESPI korelogramů s využitím intenzitního prahování I

    Czech Academy of Sciences Publication Activity Database

    Stanke, Ladislav; Šmíd, Petr; Horváth, P.

    2014-01-01

    Roč. 59, č. 4 (2014), s. 122-123 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LG13007; GA MŠk EE.2.3.20.0087 Grant - others:OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : phase retrieval * wavelets * speckle interferometry * digital image processing * speckle imaging * instrumentation * measurement * metrology Subject RIV: BH - Optics, Masers, Lasers

  15. Dvoufázová aplikace vlnkové transformace pro filtraci šumu a fázovou analýzu ESPI korelogramů s využitím intenzitního prahování II

    Czech Academy of Sciences Publication Activity Database

    Stanke, Ladislav; Šmíd, Petr; Horváth, P.

    2014-01-01

    Roč. 59, č. 5 (2014), s. 133-137 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LG13007; GA MŠk EE.2.3.20.0087 Grant - others:OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : phase retrieval * wavelets * speckle interferometry * digital image processing * speckle imaging * instrumentation * measurement * metrology Subject RIV: BH - Optics, Masers, Lasers

  16. The Shock and Vibration Digest. Volume 14, Number 11

    Science.gov (United States)

    1982-11-01

    Fonrulation to Study the Frequency De- peandat Properties of Absorbing Materialls Key Words: Active vibration contro, Oscilltors V.K. Varadan and V.V...Key Words: Bearings, Rolling contact bearings, Simulation, manipulative labor significantly, when compared to the Computr programs application of the...refs Shock in a Hyperelastic Medium S. Pluchino Key Words: Cavities, Fluid-filled containers, Seismic excita- Seminario Matematico , Universita di

  17. Effective temperatures of late-type stars: The field giants from K0 to M6

    International Nuclear Information System (INIS)

    Ridgway, S.T.; Joyce, R.R.; White, N.M.; Wing, R.F.

    1980-01-01

    Angular diameters from lunar occultation are combined with infrared photometry to determine effective temperatures, T/sub eff/, for K0--M6 giants. The relation between T/sub eff/ and color temperature, MK spectral type, V--K color, and I (104) --L color are derived. The principal result is a general increase in T/sub eff/ for the cooler spectral types compared to previous calibrations. Throughout the temperature range studied, we obtain excellent agreement with recent model atmosphere computations

  18. Proton emission from resonant laser absorption and self-focusing effects from hydrogenated structures

    Czech Academy of Sciences Publication Activity Database

    Cutroneo, M.; Torrisi, L.; Margarone, Daniele; Picciotto, A.

    2013-01-01

    Roč. 272, May (2013), s. 50-54 ISSN 0169-4332 R&D Projects: GA MŠk EE.2.3.20.0087 Grant - others:OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : resonant absorption * self-focusing * Thomson parabola * spectrometer Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013

  19. C7L family of poxvirus host range genes inhibits antiviral activities induced by type I interferons and interferon regulatory factor 1.

    Science.gov (United States)

    Meng, Xiangzhi; Schoggins, John; Rose, Lloyd; Cao, Jingxin; Ploss, Alexander; Rice, Charles M; Xiang, Yan

    2012-04-01

    Vaccinia virus (VACV) K1L and C7L function equivalently in many mammalian cells to support VACV replication and antagonize antiviral activities induced by type I interferons (IFNs). While K1L is limited to orthopoxviruses, genes that are homologous to C7L are found in diverse mammalian poxviruses. In this study, we showed that the C7L homologues from sheeppox virus and swinepox virus could rescue the replication defect of a VACV mutant deleted of both K1L and C7L (vK1L(-)C7L(-)). Interestingly, the sheeppox virus C7L homologue could rescue the replication of vK1L(-)C7L(-) in human HeLa cells but not in murine 3T3 and LA-4 cells, in contrast to all other C7L homologues. Replacing amino acids 134 and 135 of the sheeppox virus C7L homologue, however, made it functional in the two murine cell lines, suggesting that these two residues are critical for antagonizing a putative host restriction factor which has some subtle sequence variation in human and murine cells. Furthermore, the C7L family of host range genes from diverse mammalian poxviruses were all capable of antagonizing type I IFN-induced antiviral activities against VACV. Screening of a library of more than 350 IFN-stimulated genes (ISGs) identified interferon-regulated factor 1 (IRF1) as an inhibitor of vK1L(-)C7L(-) but not wild-type VACV. Expression of either K1L or C7L, however, rendered vK1L(-)C7L(-) resistant to IRF1-induced antiviral activities. Altogether, our data show that K1L and C7L antagonize IRF1-induced antiviral activities and that the host modulation function of C7L is evolutionally conserved in all poxviruses that can readily replicate in tissue-cultured mammalian cells.

  20. Culture-independent characterization of bacterial communities associated with the cold-water coral Lophelia pertusa in the northeastern Gulf of Mexico

    Science.gov (United States)

    Kellogg, C.A.; Lisle, J.T.; Galkiewicz, J.P.

    2009-01-01

    Bacteria are recognized as an important part of the total biology of shallow-water corals. Studies of shallow-water corals suggest that associated bacteria may benefit the corals by cycling carbon, fixing nitrogen, chelating iron, and producing antibiotics that protect the coral from other microbes. Cold-water or deep-sea corals have a fundamentally different ecology due to their adaptation to cold, dark, high-pressure environments and as such have novel microbiota. The goal of this study was to characterize the microbial associates of Lophelia pertusa in the northeastern Gulf of Mexico. This is the first study to collect the coral samples in individual insulated containers and to preserve coral samples at depth in an effort to minimize thermal shock and evaluate the effects of environmental gradients on the microbial diversity of samples. Molecular analysis of bacterial diversity showed a marked difference between the two study sites, Viosca Knoll 906/862 (VK906/862) and Viosca Knoll 826 (VK826). The bacterial communities from VK826 were dominated by a variety of unknown mycoplasmal members of the Tenericutes and Bacteroidetes, whereas the libraries from VK906/862 were dominated by members of the Proteobacteria. In addition to novel sequences, the 16S rRNA gene clone libraries revealed many bacterial sequences in common between Gulf of Mexico Lophelia corals and Norwegian fjord Lophelia corals, as well as shallow-water corals. Two Lophelia-specific bacterial groups were identified: a cluster of gammaproteobacteria related to sulfide-oxidizing gill symbionts of seep clams and a group of Mycoplasma spp. The presence of these groups in both Gulf and Norwegian Lophelia corals indicates that in spite of the geographic heterogeneity observed in Lophelia-associated bacterial communities, there are Lophelia-specific microbes. Copyright ?? 2009, American Society for Microbiology. All Rights Reserved.

  1. Attempting to realize n-type BiCuSeO

    Science.gov (United States)

    Zhang, Xiaoxuan; Feng, Dan; He, Jiaqing; Zhao, Li-Dong

    2018-02-01

    As an intrinsic p-type semiconductor, BiCuSeO has been widely researched in the thermoelectric community, however, n-type BiCuSeO has not been reported so far. In this work, we successfully realized n-type BiCuSeO through carrying out several successive efforts. Seebeck coefficient of BiCuSeO was increased through introducing extra Bi/Cu to fill the Bi/Cu vacancies that may produce holes, and the maximum Seebeck coefficient was increase from +447 μVK-1 for undoped BiCuSeO to +638 μVK-1 for Bi1.04Cu1.05SeO. The Seebeck coefficient of Bi1.04Cu1.05SeO was changed from p-type to n-type through electron doping through introducing Br/I in Se sites, the maximum negative Seebeck coefficient can reach ∼ -465 μVK-1 and -543 μVK-1 for Bi1.04Cu1.05Se1-xIxO and Bi1.04Cu1.05Se1-xBrxO, respectively. Then, after compositing Bi1.04Cu1.05Se0.99Br0.01O with Ag, n-type BiCuSeO can be absolutely obtained in the whole temperature range of 300-873 K, the maximum ZT 0.05 was achieved at 475 K in the Bi1.04Cu1.05Se0.99Br0.01O+15% Ag. Our report indicates that it is possible to realize n-type conducting behaviors in BiCuSeO system.

  2. Kolektivní paměť a orální historie ve výzkumu soudobých dějin

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Jiří

    2012-01-01

    Roč. 2, č. 2 (2012), s. 6-16 ISSN 1804-753X R&D Projects: GA ČR(CZ) GAP410/11/1352 Institutional support: RVO:68378114 Keywords : oral history * collective memory Subject RIV: AB - History https://docs. google .com/file/d/0Bxcn8cZ-v0QrVzVkR2RfV0JJQTg/edit?usp=sharing&pli=1

  3. Spříznění (s) orální historií aneb Malá biografická skica Donalda a Anne Ritchie

    Czech Academy of Sciences Publication Activity Database

    Mücke, Pavel

    2012-01-01

    Roč. 2, č. 2 (2012), s. 17-27 ISSN 1804-753X R&D Projects: GA ČR(CZ) GAP410/11/1352 Institutional support: RVO:68378114 Keywords : oral history * Donald Ritchie * Anne Ritchie Subject RIV: AB - History https://docs. google .com/file/d/0Bxcn8cZ-v0QrVzVkR2RfV0JJQTg/edit?usp=sharing&pli=1

  4. Development of antibacterial quaternary ammonium silane coatings on polyurethane catheters

    Czech Academy of Sciences Publication Activity Database

    Zanini, S.; Polissi, A.; Maccagni, E.A.; Dell'Orto, E.C.; Liberatore, Chiara; Riccardi, C.

    2015-01-01

    Roč. 451, Aug (2015), 78-84 ISSN 0021-9797 R&D Projects: GA MŠk EE2.3.20.0143 Grant - others:OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : plasma-induced graft-polymerization * acrylic acid * ATR/FTIR * AFM * quaternary ammonium silane * Escherichia coli Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.782, year: 2015

  5. Pitfalls in Designing Zero-Effort Deauthentication: Opportunistic Human Observation Attacks

    OpenAIRE

    Huhta, O.; Shrestha, P.; Udar, S.; Juuti, M.; Saxena, N.; Asokan, N.

    2015-01-01

    VK: Asokan, N. Deauthentication is an important component of any authentication system. The widespread use of computing devices in daily life has underscored the need for zero-effort deauthentication schemes. However, the quest for eliminating user effort may lead to hidden security flaws in the authentication schemes. As a case in point, we investigate a prominent zero-effort deauthentication scheme, called ZEBRA, which provides an interesting and a useful solution to a difficult problem ...

  6. Isotope effect studies of chicken liver NADP malic enzyme: role of the metal ion and viscosity dependence

    International Nuclear Information System (INIS)

    Grissom, C.B.; Cleland, W.W.

    1988-01-01

    The role of the metal ion in the oxidative decarboxylation of malate by chicken liver NADP malic enzyme and details of the reaction mechanism have been investigated by 13 C isotope effects. With saturating NADP and the indicated metal ion at a total concentration 10-fold higher than its K/sub m/, the following primary 13 C kinetic isotope effects at C 4 of malate [ 13 (VK/sub mal/)] were observed at pH 8.0: Mg 2+ , 1.0336; Mn 2+ , 1.0365; Cd 2+ , 1.0366; Zn 2+ , 1.0337; Co 2+ , 1.0283; Ni 2+ , 1.025. Knowing the partitioning of the intermediate oxalacetate between decarboxylation to pyuvate and reduction to malate allows calculation of the intrinsic carbon isotope effect for decarboxylation to pyuvate and reduction to malate allows calculation of the intrinsic carbon isotope effect for decarboxylation. For Mg 2+ as activator, this was 1.049 with NADP and 1.046 with 3-acetylpyridine adenine dinucleotide phosphate, although the intrinsic primary deuterium isotope effects on dehydrogenation were 5.6 and 4.2, and the partition ratios of the oxalacetate intermediate for decarboxylation as opposed to hydride transfer were 0.11 and 3.96. It was not possible to calculate reasonable intrinsic carbon isotope effects with the other metal ions by use of the partitioning ratio of oxalacetate because of decarboxylation by another mechanism. The variation of 13 (VK/sub mal/) with pH was used to dissect the total forward and external components. When the authors attempted to use the variation of 13 (VK/sub mal/) with solution viscosity to determine the internal and external commitments, incorrect values were obtained because of a specific effect of the viscosogen in decreasing the K/sub m/ for malate, so that VK/sub mal/ actually increased with viscosity instead of decreasing, as theory predicts

  7. Disease: H00250 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00250 Congenital nongoitrous hypothyroidism (CHNG) Congenital nongoitrous hypothyroidism...ing can avoid the poor prognosis of hypothyroidism. Endocrine disease (CHNG1) TSH... on the management of congenital hypothyroidism. ... JOURNAL ... Horm Res 68 Suppl 5:107-11 (2007) DOI:10.1159/0...00110591 ... PMID:15863666 ... AUTHORS ... Park SM, Chatterjee VK ... TITLE ... Genetics of congenital hypothyroidi...sm. ... JOURNAL ... J Med Genet 42:379-89 (2005) DOI:10.1136/jmg.2004.024158 ... PMID:2567

  8. Disease: H00251 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available thesis that result in congenital hypothyroidism due to genetic defects in the synthesis of thyroid hormones....is, dysgenesis, and dyshormonogenesis in congenital hypothyroidism. ... JOURNAL ... P...hyroidism. ... JOURNAL ... J Med Genet 42:379-89 (2005) DOI:10.1136/jmg.2004.024158 ... ...530/EJE-07-0037 ... PMID:15863666 ... AUTHORS ... Park SM, Chatterjee VK ... TITLE ... Genetics of congenital hypot

  9. Study of the Utilization BWR Type Nuclear Power Reactor for Desalination Process

    International Nuclear Information System (INIS)

    Itjeu Karliana; Sumijanto; Dhandhang Purwadi, M.

    2008-01-01

    The needs of fresh water increased by rapid population growth and industrials expansion, but these demands can not be prepared naturally. Following this case, seawater desalination becomes the primer option which can fulfill the need through the nuclear desalination technology. The coupled nuclear power reactor enables to supply thermal energy for auxiliary equipment and pumps operation. The utilization study of power reactor type BWR coupled with desalination process has been performed. The goal of study is to obtain characteristic data of desalted water specification which desalination system coupling with nuclear power plant produced energy for desalination process. The study is carried out by browsing data and information, and comprehensive review of thermal energy correlation between NPP with desalination process installation. According to reviewing are found that the thermal energy and electric power utilization from the nuclear power reactor are enable to remove the seawater to produce desalted water and also to operate auxiliary equipments. The assessment results is VK-300 reactor prototype, BWR type 250 MW(e) power are cogeneration unit can supplied hot steam temperature 285 °C to the extraction turbine to empower 150 MW electric power, and a part of hot steam 130 °C is use to operate desalination process and remind heat is distribute to the municipal and offices at that region. The coupled of VK-300 reactor power type BWR with desalination installation of MED type enable to produce desalted water with high quality distillate. Based on the economic calculation that the VK-300 reactor power of BWR type produced water distillate capacity is 300.000 m 3 /hour with cost US$ 0.58/m 3 . The coupling VK-300 reactor power type BWR with MED desalination plant is competitive economically. (author)

  10. Determining the void fraction in draught sections of a boiling water cooled reactor

    International Nuclear Information System (INIS)

    Fedulin, V.N.; Barolomej, G.G.; Solodkij, V.A.; Shmelev, V.E.

    1987-01-01

    Consideration is being given to the problem of improving methods for calculation of the void fraction in large channels of cooling system of the boiling water cooled reactor during two-phase unsteady flow. Investigation of the structure of two-phase flow was conducted in draught section of the VK-50 reactor (diameter D=2 m, height H=3). The method for calculation of the void fraction in channels with H/D ratio close to 1 is suggested

  11. Towards Standardization in Terminal Ballistics Testing: Velocity Representation

    Science.gov (United States)

    1976-01-01

    the above probabilities to equal one-half for e a 0, in whinh case vk would be equivalent to what has elsewhere been termed "v5 0s, the concept of which...of concepts needs to be formalized and an appropriate experiment designed. At issue, briefly, is the prescription of standard procedures for...Penetration d’un Projectile dans un Materiau Plastique ). Translation from the Army Foreign Service and Tech- nology Center, Charlottesville, Virginia

  12. Regulation of brain tumor dispersal by NKCC1 through a novel role in focal adhesion regulation.

    Directory of Open Access Journals (Sweden)

    Tomas Garzon-Muvdi

    Full Text Available Glioblastoma (GB is a highly invasive and lethal brain tumor due to its universal recurrence. Although it has been suggested that the electroneutral Na(+-K(+-Cl(- cotransporter 1 (NKCC1 can play a role in glioma cell migration, the precise mechanism by which this ion transporter contributes to GB aggressiveness remains poorly understood. Here, we focused on the role of NKCC1 in the invasion of human primary glioma cells in vitro and in vivo. NKCC1 expression levels were significantly higher in GB and anaplastic astrocytoma tissues than in grade II glioma and normal cortex. Pharmacological inhibition and shRNA-mediated knockdown of NKCC1 expression led to decreased cell migration and invasion in vitro and in vivo. Surprisingly, knockdown of NKCC1 in glioma cells resulted in the formation of significantly larger focal adhesions and cell traction forces that were approximately 40% lower than control cells. Epidermal growth factor (EGF, which promotes migration of glioma cells, increased the phosphorylation of NKCC1 through a PI3K-dependant mechanism. This finding is potentially related to WNK kinases. Taken together, our findings suggest that NKCC1 modulates migration of glioma cells by two distinct mechanisms: (1 through the regulation of focal adhesion dynamics and cell contractility and (2 through regulation of cell volume through ion transport. Due to the ubiquitous expression of NKCC1 in mammalian tissues, its regulation by WNK kinases may serve as new therapeutic targets for GB aggressiveness and can be exploited by other highly invasive neoplasms.

  13. SPAK Dependent Regulation of Peptide Transporters PEPT1 and PEPT2

    Directory of Open Access Journals (Sweden)

    Jamshed Warsi

    2014-10-01

    Full Text Available Background/Aims: SPAK (STE20-related proline/alanine-rich kinase is a powerful regulator of renal tubular ion transport and blood pressure. Moreover, SPAK contributes to the regulation of cell volume. Little is known, however, about a role of SPAK in the regulation or organic solutes. The present study thus addressed the influence of SPAK on the peptide transporters PEPT1 and PEPT2. Methods: To this end, cRNA encoding PEPT1 or PEPT2 were injected into Xenopus laevis oocytes without or with additional injection of cRNA encoding wild-type, SPAK, WNK1 insensitive inactive T233ASPAK, constitutively active T233ESPAK, and catalytically inactive D212ASPAK. Electrogenic peptide (glycine-glycine transport was determined by dual electrode voltage clamp and PEPT2 protein abundance in the cell membrane by chemiluminescence. Intestinal electrogenic peptide transport was estimated from peptide induced current in Ussing chamber experiments of jejunal segments isolated from gene targeted mice expressing SPAK resistant to WNK-dependent activation (spaktg/tg and respective wild-type mice (spak+/+. Results: In PEPT1 and in PEPT2 expressing oocytes, but not in oocytes injected with water, the dipeptide gly-gly (2 mM generated an inward current, which was significantly decreased following coexpression of SPAK. The effect of SPAK on PEPT1 was mimicked by T233ESPAK, but not by D212ASPAK or T233ASPAK. SPAK decreased maximal peptide induced current of PEPT1. Moreover, SPAK decreased carrier protein abundance in the cell membrane of PEPT2 expressing oocytes. In intestinal segments gly-gly generated a current, which was significantly higher in spaktg/tg than in spak+/+ mice. Conclusion: SPAK is a powerful regulator of peptide transporters PEPT1 and PEPT2.

  14. Vitamin K3 and vitamin C alone or in combination induced apoptosis in leukemia cells by a similar oxidative stress signalling mechanism.

    Science.gov (United States)

    Bonilla-Porras, Angelica R; Jimenez-Del-Rio, Marlene; Velez-Pardo, Carlos

    2011-06-10

    Secondary therapy-related acute lymphoblastic leukemia might emerge following chemotherapy and/or radiotherapy for primary malignancies. Therefore, other alternatives should be pursued to treat leukemia. It is shown that vitamin K3- or vitamin C- induced apoptosis in leukemia cells by oxidative stress mechanism involving superoxide anion radical and hydrogen peroxide generation, activation of NF-κB, p53, c-Jun, protease caspase-3 activation and mitochondria depolarization leading to nuclei fragmentation. Cell death was more prominent when Jurkat and K562 cells are exposed to VC and VK3 in a ratio 1000:1 (10 mM: 10 μM) or 100:1 (300 μM: 3 μM), respectively. We provide for the first time in vitro evidence supporting a causative role for oxidative stress in VK3- and VC-induced apoptosis in Jurkat and K562 cells in a domino-like mechanism. Altogether these data suggest that VK3 and VC should be useful in the treatment of leukemia.

  15. Vitamin K3 and vitamin C alone or in combination induced apoptosis in leukemia cells by a similar oxidative stress signalling mechanism

    Directory of Open Access Journals (Sweden)

    Velez-Pardo Carlos

    2011-06-01

    Full Text Available Abstract Background Secondary therapy-related acute lymphoblastic leukemia might emerge following chemotherapy and/or radiotherapy for primary malignancies. Therefore, other alternatives should be pursued to treat leukemia. Results It is shown that vitamin K3- or vitamin C- induced apoptosis in leukemia cells by oxidative stress mechanism involving superoxide anion radical and hydrogen peroxide generation, activation of NF-κB, p53, c-Jun, protease caspase-3 activation and mitochondria depolarization leading to nuclei fragmentation. Cell death was more prominent when Jurkat and K562 cells are exposed to VC and VK3 in a ratio 1000:1 (10 mM: 10 μM or 100:1 (300 μM: 3 μM, respectively. Conclusion We provide for the first time in vitro evidence supporting a causative role for oxidative stress in VK3- and VC-induced apoptosis in Jurkat and K562 cells in a domino-like mechanism. Altogether these data suggest that VK3 and VC should be useful in the treatment of leukemia.

  16. IGF-1R tyrosine kinase inhibitors and Vitamin K1 enhance the antitumor effects of Regorafenib in HCC cell lines.

    Science.gov (United States)

    Refolo, Maria Grazia; D'Alessandro, Rosalba; Lippolis, Catia; Carella, Nicola; Cavallini, Aldo; Messa, Caterina; Carr, Brian Irving

    2017-11-28

    The recent RESORCE trial showed that treatment with Regorafenib after Sorafenib failure provided a significant improvement in overall survival in HCC patients. Preclinical and clinical trial data showed that Regorafenib is a more potent drug than Sorafenib. In this study we aimed at improving Regorafenib actions and at reducing its toxicity, by targeting parallel pathways or by combination with Vitamins K (VKs). We investigated the effects of Regorafenib administrated at low concentrations and in combination with either VK1 and/or with GSK1838705A or OSI-906, two IGF1-R inhibitors, on HCC cell growth and motility. Our results showed that both IGF1-R inhibitors potentiated the antiproliferative and pro-apoptotic effects of Regorafenib and/or VK1 in HCC cell lines. Moreover we provide evidence that the combined treatment with IG1-R antagonists and Regorafenib (and/or VK1) also caused a significant reduction and depolymerization of actin resulting in synergistic inhibition exerted on cell migration. Thus, simultaneous blocking of MAPK and PI3K/Akt cascades with IGF1-R inhibitors plus Regorafenib could represent a more potent approach for HCC treatment.

  17. Benzoylformate analogues exhibit differential rate-determining steps in the benzoylformate decarboxylase reaction

    International Nuclear Information System (INIS)

    Garcia, G.A.; Weiss, P.M.; Cook, P.F.; Kenyon, G.L.; Cleland, W.W.

    1987-01-01

    Benzoylformate decarboxylase from Pseudomonas putida is a thiamine pyrophosphate (TPP)-dependent enzyme which converts benzoylformate to benzaldehyde and CO 2 . The rate-determining step(s) in the benzoylformate decarboxylase reaction for a series of substituted benzoylformates (p-CH 3 O, p-CH 3 , p-Cl, and m-F) were studied using solvent deuterium and 13 C kinetic isotope effects. The normal substrate was found to have two partially rate-determining steps; initial tetrahedral adduct formation (D 2 O-sensitive) and decarboxylation ( 13 C-sensitive). D 2 O and 13 C isotope effects indicate that electron-withdrawing substituents (p-Cl and m-F) remove the rate dependence upon decarboxylation such that only a D 2 O effect on (V/K) is observed. Conversely, electron-donating substituents increase the rate-dependence upon decarboxylation such that a larger 13 (V/K) is seen while the D 2 O effects on (V) and (V/K) are not dramatically different from those for benzoylformate. All of the data are consistent with substituent stabilization or destabilization of the carbanionic intermediate formed upon decarboxylation

  18. Renormalization of Fermi Velocity in a Composite Two Dimensional Electron Gas

    Science.gov (United States)

    Weger, M.; Burlachkov, L.

    We calculate the self-energy Σ(k, ω) of an electron gas with a Coulomb interaction in a composite 2D system, consisting of metallic layers of thickness d ≳ a0, where a0 = ħ2ɛ1/me2 is the Bohr radius, separated by layers with a dielectric constant ɛ2 and a lattice constant c perpendicular to the planes. The behavior of the electron gas is determined by the dimensionless parameters kFa0 and kFc ɛ2/ɛ1. We find that when ɛ2/ɛ1 is large (≈5 or more), the velocity v(k) becomes strongly k-dependent near kF, and v(kF) is enhanced by a factor of 5-10. This behavior is similar to the one found by Lindhard in 1954 for an unscreened electron gas; however here we take screening into account. The peak in v(k) is very sharp (δk/kF is a few percent) and becomes sharper as ɛ2/ɛ1 increases. This velocity renormalization has dramatic effects on the transport properties; the conductivity at low T increases like the square of the velocity renormalization and the resistivity due to elastic scattering becomes temperature dependent, increasing approximately linearly with T. For scattering by phonons, ρ ∝ T2. Preliminary measurements suggest an increase in vk in YBCO very close to kF.

  19. Room temperature synthesis of Ni-based alloy nanoparticles by radiolysis.

    Energy Technology Data Exchange (ETDEWEB)

    Nenoff, Tina Maria; Berry, Donald T.; Lu, Ping; Leung, Kevin; Provencio, Paula Polyak; Stumpf, Roland Rudolph; Huang, Jian Yu; Zhang, Zhenyuan

    2009-09-01

    Room temperature radiolysis, density functional theory, and various nanoscale characterization methods were used to synthesize and fully describe Ni-based alloy nanoparticles (NPs) that were synthesized at room temperature. These complementary methods provide a strong basis in understanding and describing metastable phase regimes of alloy NPs whose reaction formation is determined by kinetic rather than thermodynamic reaction processes. Four series of NPs, (Ag-Ni, Pd-Ni, Co-Ni, and W-Ni) were analyzed and characterized by a variety of methods, including UV-vis, TEM/HRTEM, HAADF-STEM and EFTEM mapping. In the first focus of research, AgNi and PdNi were studied. Different ratios of Ag{sub x}- Ni{sub 1-x} alloy NPs and Pd{sub 0.5}- Ni{sub 0.5} alloy NP were prepared using a high dose rate from gamma irradiation. Images from high-angle annular dark-field (HAADF) show that the Ag-Ni NPs are not core-shell structure but are homogeneous alloys in composition. Energy filtered transmission electron microscopy (EFTEM) maps show the homogeneity of the metals in each alloy NP. Of particular interest are the normally immiscible Ag-Ni NPs. All evidence confirmed that homogeneous Ag-Ni and Pd-Ni alloy NPs presented here were successfully synthesized by high dose rate radiolytic methodology. A mechanism is provided to explain the homogeneous formation of the alloy NPs. Furthermore, studies of Pd-Ni NPs by in situ TEM (with heated stage) shows the ability to sinter these NPs at temperatures below 800 C. In the second set of work, CoNi and WNi superalloy NPs were attempted at 50/50 concentration ratios using high dose rates from gamma irradiation. Preliminary results on synthesis and characterization have been completed and are presented. As with the earlier alloy NPs, no evidence of core-shell NP formation occurs. Microscopy results seem to indicate alloying occurred with the CoNi alloys. However, there appears to be incomplete reduction of the Na{sub 2}WO{sub 4} to form the W

  20. Pharmacodynamic analysis and clinical trial of amoxicillin sprinkle administered once daily for 7 days compared to penicillin V potassium administered four times daily for 10 days in the treatment of tonsillopharyngitis due to Streptococcus pyogenes in children.

    Science.gov (United States)

    Pichichero, M E; Casey, J R; Block, S L; Guttendorf, R; Flanner, H; Markowitz, D; Clausen, S

    2008-07-01

    An a priori pharmacokinetic/pharmacodynamic (PK/PD) target of 40% daily time above the MIC (T >MIC; based on the MIC(90) of 0.06 microg/ml for Streptococcus pyogenes reported in the literature) was shown to be achievable in a phase 1 study of 23 children with a once-daily (QD) modified-release, multiparticulate formulation of amoxicillin (amoxicillin sprinkle). The daily T >MIC achieved with the QD amoxicillin sprinkle formulation was comparable to that achieved with a four-times-daily (QID) penicillin VK suspension. An investigator-blinded, randomized, parallel-group, multicenter study involving 579 children 6 months to 12 years old with acute streptococcal tonsillopharyngitis was then undertaken. Children were randomly assigned 1:1 to receive either the amoxicillin sprinkle (475 mg for ages 6 months to 4 years, 775 mg for ages 5 to 12 years) QD for 7 days or 10 mg/kg of body weight of penicillin VK QID for 10 days (up to the maximum dose of 250 mg QID). Unexpectedly, the rates of bacteriological eradication at the test of cure were 65.3% (132/202) for the amoxicillin sprinkle and 68.0% (132/194) for penicillin VK (95% confidence interval, -12.0% to 6.6%). Thus, neither antibiotic regimen met the minimum criterion of > or =85% eradication ordinarily required by the U.S. FDA for first-line treatment of tonsillopharyngitis due to S. pyogenes. The results of subgroup analyses across demographic characteristics and current infection characteristics and by age/weight categories were consistent with the primary-efficacy result. The clinical cure rates for amoxicillin sprinkle and penicillin VK were 86.1% (216/251) and 91.9% (204/222), respectively (95% confidence interval, -11.6% to -0.4%). The results of a post hoc PD analysis suggested that a requirement for 60% daily T >MIC(90) more accurately predicted the observed high failure rates for bacteriologic eradication with the amoxicillin sprinkle and penicillin VK suspension studied. Based on the association between

  1. Pharmacodynamic Analysis and Clinical Trial of Amoxicillin Sprinkle Administered Once Daily for 7 Days Compared to Penicillin V Potassium Administered Four Times Daily for 10 Days in the Treatment of Tonsillopharyngitis Due to Streptococcus pyogenes in Children▿

    Science.gov (United States)

    Pichichero, M. E.; Casey, J. R.; Block, S. L.; Guttendorf, R.; Flanner, H.; Markowitz, D.; Clausen, S.

    2008-01-01

    An a priori pharmacokinetic/pharmacodynamic (PK/PD) target of 40% daily time above the MIC (T >MIC; based on the MIC90 of 0.06 μg/ml for Streptococcus pyogenes reported in the literature) was shown to be achievable in a phase 1 study of 23 children with a once-daily (QD) modified-release, multiparticulate formulation of amoxicillin (amoxicillin sprinkle). The daily T >MIC achieved with the QD amoxicillin sprinkle formulation was comparable to that achieved with a four-times-daily (QID) penicillin VK suspension. An investigator-blinded, randomized, parallel-group, multicenter study involving 579 children 6 months to 12 years old with acute streptococcal tonsillopharyngitis was then undertaken. Children were randomly assigned 1:1 to receive either the amoxicillin sprinkle (475 mg for ages 6 months to 4 years, 775 mg for ages 5 to 12 years) QD for 7 days or 10 mg/kg of body weight of penicillin VK QID for 10 days (up to the maximum dose of 250 mg QID). Unexpectedly, the rates of bacteriological eradication at the test of cure were 65.3% (132/202) for the amoxicillin sprinkle and 68.0% (132/194) for penicillin VK (95% confidence interval, −12.0% to 6.6%). Thus, neither antibiotic regimen met the minimum criterion of ≥85% eradication ordinarily required by the U.S. FDA for first-line treatment of tonsillopharyngitis due to S. pyogenes. The results of subgroup analyses across demographic characteristics and current infection characteristics and by age/weight categories were consistent with the primary-efficacy result. The clinical cure rates for amoxicillin sprinkle and penicillin VK were 86.1% (216/251) and 91.9% (204/222), respectively (95% confidence interval, −11.6% to −0.4%). The results of a post hoc PD analysis suggested that a requirement for 60% daily T >MIC90 more accurately predicted the observed high failure rates for bacteriologic eradication with the amoxicillin sprinkle and penicillin VK suspension studied. Based on the association between longer

  2. Thermal oxidation of tungsten-based sputtered coatings

    International Nuclear Information System (INIS)

    Louro, C.; Cavaleiro, A.

    1997-01-01

    The effect of the addition of nickel, titanium, and nitrogen on the air oxidation behavior of W-based sputtered coatings in the temperature range 600 to 800 C was studied. In some cases these additions significantly improved the oxidation resistance of the tungsten coatings. As reported for bulk tungsten, all the coatings studied were oxidized by layers following a parabolic law. Besides WO 3 and WO x phases detected in all the oxidized coatings, TiO 2 and NiWO 4 were also detected for W-Ti and W-Ni films, respectively. WO x was present as an inner protective compact layer covered by the porous WO 3 oxide. The best oxidation resistance was found for W-Ti and W-N-Ni coatings which also presented the highest activation energies (E a = 234 and 218 kJ/mol, respectively, as opposed to E a ∼ 188 kJ/mol for the other coatings). These lower oxidation weight gains were attributed to the greater difficulty of the inward diffusion of oxygen ions for W-Ti films, owing to the formation of fine particles of TiO 2 , and the formation of the external, more protective layer of NiWO 4 for W-N-Ni coatings

  3. THE STATUS OF MATRIMONIAL PROPERTY OWNERSHIP IN MIXED MARRIAGES

    Directory of Open Access Journals (Sweden)

    Sonny Dewi Judiasih

    2015-02-01

    Full Text Available Many Indonesians have committed themselves into a mixed marriage, both in Indonesia and outside the country. Mixed marriage would mean that there are differing nationalities who abide under two different state laws and as consequence of this, issues of private international law in joint property would emerge. On the status of ownership on immovable assets such as land, the nationality principle must be paid attention to, because according to Indonesian law, only Indonesian citizens may have access to Land Ownership Rights. Thus, in mixed marriages, foreign spouses (husband or wife may not have land ownership rights.   Masyarakat Indonesia banyak yang melakukan perkawinan campuran, baik yang dilakukan di Indonesia maupun di luar negeri. Pelaksanaan perkawinan campuran menyebabkan adanya perbedaan kewarganegaraan dimana mereka tunduk pada sistem hukum yang berlainan sehingga melahirkan masalah hukum perdata internasional dalam pengaturan harta bersama. Mengenai status kepemilikan atas benda tidak bergerak seperti tanah, terdapat asas nasionalitas yang harus diperhatikan, yaitu hanya WNI saja yang boleh mempunyai Hak Milik Atas Tanah. Oleh karena itu, dalam perkawinan campuran, suami atau istri yang berkewarganegaraan asing tidak boleh mempunyai hak milik atas tanah.

  4. The influence of Fe content on spreading ability of tungsten heavy alloys matrix on tungsten surface

    Directory of Open Access Journals (Sweden)

    A. Krzyńska

    2011-07-01

    Full Text Available The results of experimental study of tungsten spreading ability with W-Ni-Co-Fe matrix are presented. The aim of these investigations was to see how Fe concentration in W – Ni – Co matrix influences the wettability of tungsten grains during liquid phase sintering. Four green compact specimens containing 50%W, 10%Co and Ni + Fe = 40% but with different Ni to Fe ratio were prepared. The cylindrical specimen 5mm diameter and 5mm height were put on clean pure tungsten substrate and then 20 minutes heated at 1520oC in hydrogen atmosphere. After heating the specimens were carefully measured and then the specimens for structure observations were prepared. It was concluded, that increase of Fe content decrease the melting temperature of W – Ni – Co alloy. The melting point decrease caused by Fe content increase substantially the spreading ability of tungsten substrate with W – Ni – Co alloy. Metallography investigations showed some microstructure changes in “reaction zone” identified in tungsten substrate – (WNi40-xCo10Fex interface. The results of the study confirmed our earlier observations that even relative small Fe addition promotes Weight Heavy Alloys (WHA liquid phase sintering.

  5. AGRICULTURAL TAX SYSTEM IN POLAND AND DIRECTIONS OF THE CHANGES

    Directory of Open Access Journals (Sweden)

    Marzena Malewska

    2014-03-01

    Full Text Available A research problem taken in the article is a question, whether legal solutions applied in the Polish system of the taxation of agriculture have an appropriate shape and whether this system is optimal? If not, what are possible options of changes and whether the in-come tax is good for agricultural activities. A method of analysis of secondary sources was used in order to solve the research problem. Required data was taken from the base of the Główny Urząd Statystyczny and scientific publications of the publishing universi-ty. In the article were formulated the following hypotheses: 1.\tThe system of the taxation of agriculture is different than other existing Polish law and it is regarded as unfair in relation to other social groups. 2.\tChanging the tax system in agriculture is necessary and would lead to positive chang-es in the structure of agriculture. 3.\tThe reform of the taxation system of agricultural production is in many aspects neces-sary and beneficial, but it should nevertheless take into account the specificities of the agricultural activity. 4.\tThe introduction of the income tax has its bad side and carries the disadvantages for both farmers and municipalities.

  6. The Electronic Historical Latvian Dictionary Based on the Corpus of Early Written Latvian Texts

    Directory of Open Access Journals (Sweden)

    Everita Andronova

    2016-12-01

    Główny nacisk położono na opis haseł słownikowych, zawierający istotne uwagi praktyczne i teoretyczne. Omówiono poszczególne części hasła słownikowego, po czym umieszczono komentarz odnoszący się do różnych kwestii związanych z daną częścią (np. wybór hasła wyrazowego i przedstawienia wersji pisowni i do przyję­tych rozwiązań. Szczególną uwagę poświęcono główce hasła, objaśnieniu znaczenia wynikającego z przykładów występujacych w korpusie, różnym rodzajom kolokacji i ich przedstawieniu w słowniku, jak też informacjom etymologicznym. Na końcu zamieszczono zwięzły przegląd oprogramowania słownikowego TLex 2013, oparty na doświadczeniu autorów, zdobytym podczas pracy z tym narzędziem.

  7. Tobacco sales in pharmacies: a survey of attitudes, knowledge and beliefs of pharmacists employed in student experiential and other worksites in Western New York

    Directory of Open Access Journals (Sweden)

    Smith Danielle M

    2012-08-01

    Full Text Available Abstract Background Pharmacies are venues in which patients seek out products and professional advice in order to improve overall health. However, many pharmacies in the United States continue to sell tobacco products, which are widely known to cause detrimental health effects. This conflict presents a challenge to pharmacists, who are becoming increasingly more involved in patient health promotion activities. This study sought to assess Western New York (WNY area pharmacists’ opinions about the sale of tobacco products in pharmacies, and pharmacists’ opinions on their role in patient smoking cessation. Methods Participants responded to two parallel surveys; a web-based survey was completed by 148 university-affiliated pharmacist preceptors via a list based sample, and a mail-based survey was completed by the supervising pharmacist in 120 area pharmacies via a list-based sample. The combined response rate for both surveys was 31%. Univariate and bivariate analyses were performed to determine any significant differences between the preceptor and supervising pharmacist survey groups. Results Over 75% of respondents support legislation banning the sale of tobacco products in pharmacies. Over 86% of respondents would prefer to work in a pharmacy that does not sell tobacco products. Differences between preceptor and supervising pharmacist groups were observed. Action regarding counseling patients was uncommon among both groups. Conclusions Pharmacists support initiatives that increase their role in cessation counseling and initiatives that restrict the sale of tobacco products in pharmacies. These data could have important implications for communities and pharmacy practice.

  8. Wprowadzenie do teorii kapitalizmu kognitywnego: kapitalizm kognitywny jako reżim akumulacji

    Directory of Open Access Journals (Sweden)

    Mikołaj Ratajczak

    2015-12-01

    Full Text Available Artykuł stanowi zarazem historyczne, jak i systematyczne oraz problemowe wprowadzenie do teorii kapitalizmu kognitywnego. Rekonstruuje najważniejsze stanowiska i debaty w danym polu, od pierwszych publikacji na temat prac niematerialnych oraz postfordyzmu przez analizy kryzysu finansowego 2001 roku po najnowsze publikacje teoretyków i teoretyczek kapitalizmu kognitywnego. Systematyzuje rozproszone w debacie nad kapitalizmem kognitywnym analizy, od wzrastającej roli efektów zewnętrznych i renty we współczesnym kapitalizmie, przez przekształcenia intelektu powszechnego po wykształcenie się nowych form wartości i nowych mechanizmów jej akumulacji. To właśnie to ostatnie zagadnienie, nowe mechanizmy akumulacji wartości, stanowi główny problem, na którym skupia się artykuł. Ukazując funkcje kapitału finansowego w ukształtowaniu się kapitalizmu kognitywnego jako pewnego reżimu akumulacji, artykuł nie tylko analizuje kapitalizm kognitywny jako niestabilny reżim akumulacji, ale stara się w systematyczny sposób przedstawić sprzeczności tegoż reżimu akumulacji.

  9. Effect of holding time on the microstructure and strength of tungsten/ferritic steel joints diffusion bonded with a nickel interlayer

    International Nuclear Information System (INIS)

    Zhong Zhihong; Hinoki, Tatsuya; Kohyama, Akira

    2009-01-01

    The microstructural development and mechanical properties of a tungsten/ferritic steel diffusion joint with a Ni interlayer, bonded at 900 deg. C under vacuum for 0.5-2 h, were investigated. Cross-sectional images of the W/Ni diffusion zone indicate the presence of a Ni-rich solid solution, Ni(W), for holding times up to 1.5 h. However, an intermetallic compound Ni 4 W grew as a distinguishable layer between the W and Ni(W) when the holding time was increased to 2 h. The growth behavior of diffusion layers and their growth mechanism is discussed. On the other hand, smooth changes in concentration of various elements across the Ni/steel interface were observed for the joints annealed at the holding time studied. An average bond strength of 215 MPa was obtained for the joint bonded for 1 h; this bond strength decreased as holding time increased. Variations in the strength of the joints was significantly related to the microstructural development of the diffusion zone. The formation of Ni 4 W and a solid solution phase enhanced hardness at the interfaces but reduced strength of the joints.

  10. Mechanistic deductions from multiple kinetic and solvent deuterium isotope effects and pH studies of pyridoxal phosphate dependent carbon-carbon lyases: escherichia coli tryptophan indole-lyase

    International Nuclear Information System (INIS)

    Kiick, D.M.; Phillips, R.S.

    1988-01-01

    Analysis of the pH dependence of the kinetic parameters and competitive inhibitor Ki values for tryptophan indole-lyase suggests two enzymic groups must be unprotonated in order to facilitate binding and catalysis of tryptophan. The V/K for tryptophan and the pKi for oxindolyl-L-alanine, a putative transition state analogue and competitive inhibitor, decrease below two pK values of 7.6 and 6.0, while the Ki for L-alanine, also a competitive inhibitor, is 3300-fold larger (20 mM) than that for oxindolyl-L-alanine and increases below a single pK of 7.6. A single pK of 7.6 is also observed in the V/K profile for the alternate substrate, S-methyl-L-cysteine. Therefore, the enzymic group with a pK of 7.6 is responsible for proton abstraction at the 2-position of tryptophan, while the enzymic group with a pK of 6.0 interacts with the indole portion of tryptophan and probably catalyzes formation of the indolenine tautomer of tryptophan (in concert with proton transfer to C-3 of indole from the group with pK 7.6) to facilitate carbon-carbon bond cleavage and elimination of indole. The pH variation of the primary deuterium isotope effects for proton abstraction at the 2-position of tryptophan (DV = 2.5 and D(V/Ktrp) = 2.8) are pH independent, while the Vmax for tryptophan or S-methyl-L-cysteine is the same and also pH independent. Thus, substrates bind only to the correctly protonated form of the enzyme. Further, tryptophan is not sticky, and the pK values observed in both V/K profiles are the correct ones

  11. A facile method to prepare superparamagnetic iron oxide and hydrophobic drug-encapsulated biodegradable polyurethane nanoparticles

    Directory of Open Access Journals (Sweden)

    Cheng K

    2017-03-01

    Full Text Available Kuo-Wei Cheng, Shan-hui Hsu Institute of Polymer Science and Engineering, College of Engineering, National Taiwan University, Taipei, Taiwan, Republic of China Abstract: Superparamagnetic iron oxide nanoparticles (SPIO NPs have a wide range of biomedical applications such as in magnetic resonance imaging, targeting, and hyperthermia therapy. Aggregation of SPIO NPs can occur because of the hydrophobic surface and high surface energy of SPIO NPs. Here, we developed a facile method to encapsulate SPIO NPs in amphiphilic biodegradable polymer. Anionic biodegradable polyurethane nanoparticles (PU NPs with ~35 nm size and different chemistry were prepared by waterborne processes. SPIO NPs were synthesized by chemical co-precipitation. SPIO NPs were then added to the aqueous dispersion of PU NPs, followed by application of high-frequency (~20 kHz ultrasonic vibration for 3 min. This method rendered SPIO-PU hybrid NPs (size ~110 nm suspended in water. SPIO-PU hybrid NPs contained ~50–60 wt% SPIO and retained the superparamagnetic property (evaluated by a magnetometer as well as high contrast in magnetic resonance imaging. SPIO-PU NPs also showed the ability to provide cell hyperthermic treatment. Using the same ultrasonic method, hydrophobic drug (Vitamin K3 [VK3] or (9-(methylaminomethylanthracene [MAMA] could also be encapsulated in PU NPs. The VK3-PU or MAMA-PU hybrid NPs had ~35 nm size and different release profiles for PUs with different chemistry. The encapsulation efficiency for VK3 and MAMA was high (~95% without burst release. The encapsulation mechanism may be attributed to the low glass transition temperature (Tg and good mechanical compliance of PU NPs. The new encapsulation method involving waterborne biodegradable PU NPs is simple, rapid, and effective to produce multimodular NP carriers. Keywords: superparamagnetic iron oxide, polyurethane, drug release, hybrid nanoparticles

  12. Melanin fate in the human epidermis: a reassessment of how best to detect and analyse histologically.

    Science.gov (United States)

    Joly-Tonetti, Nicolas; Wibawa, Judata I D; Bell, Mike; Tobin, Desmond

    2016-07-01

    Melanin is the predominant pigment responsible for skin colour and is synthesized by the melanocyte in the basal layer of the epidermis and then transferred to surrounding keratinocytes. Despite its optical properties, melanin is barely detectable in unstained sections of human epidermis. However, identification and localization of melanin is of importance for the study of skin pigmentation in health and disease. Current methods for the histologic quantification of melanin are suboptimal and are associated with significant risk of misinterpretation. The aim of this study was to reassess the existing literature and to develop a more effective histological method of melanin quantification in human skin. Moreover, we confirm that Warthin-Starry (WS) stain provides a much more sensitive and more specific melanin detection method than the commonplace Fontana-Masson (FM) stain. For example, WS staining sensitivity allowed the visualization of melanin even in very pale Caucasian skin that was missed by FM or Von Kossa (VK) stains. From our reassessment of the histology-related literature, we conclude that so-called melanin dust is most likely an artifact of discoloration due to non-specific silver deposition in the stratum corneum. Unlike FM and VK, WS was not associated with this non-specific stratum corneum darkening, misinterpreted previously as 'degraded' melanin. Finally, WS melanin particle counts were largely similar to previously reported manual counts by transmission electron microscopy, in contrast to both FM and VK. Together these findings allow us to propose a new histology/Image J-informed method for the accurate and precise quantification of epidermal melanin in skin. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  13. A facile method to prepare superparamagnetic iron oxide and hydrophobic drug-encapsulated biodegradable polyurethane nanoparticles.

    Science.gov (United States)

    Cheng, Kuo-Wei; Hsu, Shan-Hui

    2017-01-01

    Superparamagnetic iron oxide nanoparticles (SPIO NPs) have a wide range of biomedical applications such as in magnetic resonance imaging, targeting, and hyperthermia therapy. Aggregation of SPIO NPs can occur because of the hydrophobic surface and high surface energy of SPIO NPs. Here, we developed a facile method to encapsulate SPIO NPs in amphiphilic biodegradable polymer. Anionic biodegradable polyurethane nanoparticles (PU NPs) with ~35 nm size and different chemistry were prepared by waterborne processes. SPIO NPs were synthesized by chemical co-precipitation. SPIO NPs were then added to the aqueous dispersion of PU NPs, followed by application of high-frequency (~20 kHz) ultrasonic vibration for 3 min. This method rendered SPIO-PU hybrid NPs (size ~110 nm) suspended in water. SPIO-PU hybrid NPs contained ~50-60 wt% SPIO and retained the superparamagnetic property (evaluated by a magnetometer) as well as high contrast in magnetic resonance imaging. SPIO-PU NPs also showed the ability to provide cell hyperthermic treatment. Using the same ultrasonic method, hydrophobic drug (Vitamin K3 [VK3]) or (9-(methylaminomethyl) anthracene [MAMA]) could also be encapsulated in PU NPs. The VK3-PU or MAMA-PU hybrid NPs had ~35 nm size and different release profiles for PUs with different chemistry. The encapsulation efficiency for VK3 and MAMA was high (~95%) without burst release. The encapsulation mechanism may be attributed to the low glass transition temperature (Tg) and good mechanical compliance of PU NPs. The new encapsulation method involving waterborne biodegradable PU NPs is simple, rapid, and effective to produce multimodular NP carriers.

  14. Effects of Female Sex Hormones on Susceptibility to HSV-2 in Vaginal Cells Grown in Air-Liquid Interface.

    Science.gov (United States)

    Lee, Yung; Dizzell, Sara E; Leung, Vivian; Nazli, Aisha; Zahoor, Muhammad A; Fichorova, Raina N; Kaushic, Charu

    2016-08-30

    The lower female reproductive tract (FRT) is comprised of the cervix and vagina, surfaces that are continuously exposed to a variety of commensal and pathogenic organisms. Sexually transmitted viruses, such as herpes simplex virus type 2 (HSV-2), have to traverse the mucosal epithelial lining of the FRT to establish infection. The majority of current culture systems that model the host-pathogen interactions in the mucosal epithelium have limitations in simulating physiological conditions as they employ a liquid-liquid interface (LLI), in which both apical and basolateral surfaces are submerged in growth medium. We designed the current study to simulate in vivo conditions by growing an immortalized vaginal epithelial cell line (Vk2/E6E7) in culture with an air-liquid interface (ALI) and examined the effects of female sex hormones on their growth, differentiation, and susceptibility to HSV-2 under these conditions, in comparison to LLI cultures. ALI conditions induced Vk2/E6E7 cells to grow into multi-layered cultures compared to the monolayers present in LLI conditions. Vk2 cells in ALI showed higher production of cytokeratin in the presence of estradiol (E2), compared to cells grown in progesterone (P4). Cells grown under ALI conditions were exposed to HSV-2-green fluorescent protein (GFP) and the highest infection and replication was observed in the presence of P4. Altogether, this study suggests that ALI cultures more closely simulate the in vivo conditions of the FRT compared to the conventional LLI cultures. Furthermore, under these conditions P4 was found to confer higher susceptibility to HSV-2 infection in vaginal cells. The vaginal ALI culture system offers a better alternative to study host-pathogen interactions.

  15. A comparative evaluation of effect of modern-curing lights and curing modes on conventional and novel-resin monomers

    Science.gov (United States)

    Roy, Konda Karthik; Kumar, Kanumuru Pavan; John, Gijo; Sooraparaju, Sujatha Gopal; Nujella, Surya Kumari; Sowmya, Kyatham

    2018-01-01

    Aim: The aim of this study is to compare and to evaluate effect of curing light and curing modes on the nanohybrid composite resins with conventional Bis-GMA and novel tricyclodecane (TCD) monomers. Methodology: Two nanohybrid composites, IPS empress direct and charisma diamond were used in this study. Light-emitting diode (LED)-curing unit and quartz-tungsten-halogen (QTH)-curing unit which were operated into two different modes: continuous and soft start. Based on the composite resin, curing lights, and mode of curing used, the samples were divided into 8 groups. After polymerization, the samples were stored for 48 h in complete darkness at 37°C and 100% humidity. The Vickers hardness (VK) of the surface was determined with Vickers indenter by the application of 200 g for 15 s. Three VK readings were recorded for each sample surface both on top and bottom surfaces. For all the specimens, the three hardness values for each surface were averaged and reported as a single value. The mean VK and hardness ratio were calculated. The depth of cure was assessed based on the hardness ratio. Results: Comparison of mean hardness values and hardness ratios was done using ANOVA with post hoc Tukey's test. Conclusion: Both QTH- and LED-curing units had shown the adequate depth of cure. Soft-start-curing mode in both QTH- and LED-curing lights had effectively increased microhardness than the continuous mode of curing. TCD monomer had shown higher hardness values compared with conventional Bis-GMA-containing resin. PMID:29628651

  16. Kinetic isotope effect studies of the S-adenosylmethionine synthetase reaction

    International Nuclear Information System (INIS)

    Markham, G.D.; Parkin, D.W.; Schramm, V.L.

    1986-01-01

    S-adenosylmethionine (AdoMet) synthetase catalyzes a unique substitution reaction at the 5' carbon of MgATP. Kinetic isotope effect (V/K) measurements have been used to investigate the mechanism of AdoMet synthetase from E. coli. Changes in 3 H/ 14 C ratios when AdoMet is formed from a mixture of either ([5'- 14 C]ATP and [5'- 12 C,1'- 3 H]ATP) or ([5'- 3 H]ATP and [5'- 1 H,1'- 14 C]ATP) were examined. The effects of varying the concentrations of the co-substrate methionine and the monovalent cation activator K + were investigated. Substitution of 14 C for 12 C at the 5' position of ATP yields a primary V/K kinetic isotope effect ( 12 C/ 14 C) of 1.128 +/- 0.004 at low K + and methionine concentrations. The observed isotope effect diminishes slightly to 1.107 +/- 0.003 when both K + and methionine are present at saturating concentrations, suggesting that MgATP has only a low commitment to catalysis from at conditions near Vmax. No secondary V/K 3 H isotope effect from [5'- 3 H]ATP was detected ( 1 H/ 3 H) = 0.997 +/- 0.003. The magnitude of the primary 14 C isotope effect and the small secondary 3 H effect demonstrate that AdoMet synthesis occurs with a S/sub N/ 2 transition state which is symmetric with respect to the sulfur nucleophile and the departing tripolyphosphate group

  17. Duffy Negative Antigen Is No Longer a Barrier to Plasmodium vivax – Molecular Evidences from the African West Coast (Angola and Equatorial Guinea)

    Science.gov (United States)

    Mendes, Cristina; Dias, Fernanda; Figueiredo, Joana; Mora, Vicenta Gonzalez; Cano, Jorge; de Sousa, Bruno; do Rosário, Virgílio E.; Benito, Agustin; Berzosa, Pedro; Arez, Ana Paula

    2011-01-01

    Background Plasmodium vivax shows a small prevalence in West and Central Africa due to the high prevalence of Duffy negative people. However, Duffy negative individuals infected with P. vivax have been reported in areas of high prevalence of Duffy positive people who may serve as supply of P. vivax strains able to invade Duffy negative erythrocytes. We investigated the presence of P. vivax in two West African countries, using blood samples and mosquitoes collected during two on-going studies. Methodology/Findings Blood samples from a total of 995 individuals were collected in seven villages in Angola and Equatorial Guinea, and 820 Anopheles mosquitoes were collected in Equatorial Guinea. Identification of the Plasmodium species was achieved by nested PCR amplification of the small-subunit rRNA genes; P. vivax was further characterized by csp gene analysis. Positive P. vivax-human isolates were genotyped for the Duffy blood group through the analysis of the DARC gene. Fifteen Duffy-negative individuals, 8 from Equatorial Guinea (out of 97) and 7 from Angola (out of 898), were infected with two different strains of P. vivax (VK210 and VK247). Conclusions In this study we demonstrated that P. vivax infections were found both in humans and mosquitoes, which means that active transmission is occurring. Given the high prevalence of infection in mosquitoes, we may speculate that this hypnozoite-forming species at liver may not be detected by the peripheral blood samples analysis. Also, this is the first report of Duffy negative individuals infected with two different strains of P. vivax (VK247 and classic strains) in Angola and Equatorial Guinea. This finding reinforces the idea that this parasite is able to use receptors other than Duffy to invade erythrocytes, which may have an enormous impact in P. vivax current distribution. PMID:21713024

  18. Vaccine Containing the Three Allelic Variants of the Plasmodium vivax Circumsporozoite Antigen Induces Protection in Mice after Challenge with a Transgenic Rodent Malaria Parasite

    Directory of Open Access Journals (Sweden)

    Alba Marina Gimenez

    2017-10-01

    Full Text Available Plasmodium vivax is the most common species that cause malaria outside of the African continent. The development of an efficacious vaccine would contribute greatly to control malaria. Recently, using bacterial and adenoviral recombinant proteins based on the P. vivax circumsporozoite protein (CSP, we demonstrated the possibility of eliciting strong antibody-mediated immune responses to each of the three allelic forms of P. vivax CSP (PvCSP. In the present study, recombinant proteins representing the PvCSP alleles (VK210, VK247, and P. vivax-like, as well as a hybrid polypeptide, named PvCSP-All epitopes, were generated. This hybrid containing the conserved C-terminal of the PvCSP and the three variant repeat domains in tandem were successfully produced in the yeast Pichia pastoris. After purification and biochemical characterization, they were used for the experimental immunization of C57BL/6 mice in a vaccine formulation containing the adjuvant Poly(I:C. Immunization with a recombinant protein expressing all three different allelic forms in fusion elicited high IgG antibody titers reacting with all three different allelic variants of PvCSP. The antibodies targeted both the C-terminal and repeat domains of PvCSP and recognized the native protein on the surface of P. vivax sporozoites. More importantly, mice that received the vaccine formulation were protected after challenge with chimeric Plasmodium berghei sporozoites expressing CSP repeats of P. vivax sporozoites (Pb/PvVK210. Our results suggest that it is possible to elicit protective immunity against one of the most common PvCSP alleles using soluble recombinant proteins expressed by P. pastoris. These recombinant proteins are promising candidates for clinical trials aiming to develop a multiallele vaccine against P. vivax malaria.

  19. 33{sup rd} international Vienna motor symposium. Vol. 2. Second day; 33. internationales Wiener Motorensymposium. Bd. 2. Zweiter Tag

    Energy Technology Data Exchange (ETDEWEB)

    Lenz, Hans Peter (comp.)

    2012-11-01

    This two-volume report makes the presentations of the 33{sup rd} International Vienna Motor Symposium (April 26-27, 2012) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H.P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).

  20. 33{sup rd} international Vienna motor symposium. Vol. 1. First day; 33. internationales Wiener Motorensymposium. Bd. 1. Erster Tag

    Energy Technology Data Exchange (ETDEWEB)

    Lenz, Hans Peter (comp.)

    2012-11-01

    This two-volume report makes the presentations of the 33{sup rd} International Vienna Motor Symposium (April 26-27, 2012) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H.P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).

  1. 34{sup th} international Vienna motor symposium. Vol. 2. Second day; 34. Internationales Wiener Motorensymposium. Bd. 2. Zweiter Tag

    Energy Technology Data Exchange (ETDEWEB)

    Lenz, Hans Peter (comp.)

    2013-08-01

    This two-volume report makes the presentations of the 34th International Vienna Motor Symposium (April 25-26, 2013) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H. P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).

  2. 34{sup th} international Vienna motor symposium. Vol. 1. First day; 34. Internationales Wiener Motorensymposium. Bd. 1. Erster Tag

    Energy Technology Data Exchange (ETDEWEB)

    Lenz, Hans Peter (comp.)

    2013-08-01

    This two-volume report makes the presentations of the 34th International Vienna Motor Symposium (April 25-26, 2013) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H. P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).

  3. High performance SiC detectors for MeV ion beamsgenerated by intense pulsed laser plasmas

    Czech Academy of Sciences Publication Activity Database

    Cutroneo, M.; Musumeci, P.; Zimbone, M.; Torrisi, L.; La Via, F.; Margarone, Daniele; Velyhan, Andriy; Ullschmied, Jiří; Calcagno, L.

    2013-01-01

    Roč. 28, č. 1 (2013), s. 87-93 ISSN 0884-2914 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 ; RVO:61389021 Keywords : silicon carbide * ion detectors * high power laser Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.815, year: 2013

  4. A hollow-duct radiation delivery system in a power-scaled arrangement

    Czech Academy of Sciences Publication Activity Database

    Fibrich, Martin; Rus, Bedřich; Kramer, Daniel

    2013-01-01

    Roč. 10, č. 8 (2013), "085001-1"-"085001-5" ISSN 1612-2011 R&D Projects: GA MŠk EE.2.3.20.0091; GA MŠk ED1.1.00/02.0061 Grant - others:OP VK 1 LaserSys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : wave-guide * laser * optimization Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.964, year: 2013

  5. Disease: H01792 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01792 1p36 deletion syndrome 1p36 deletion syndrome is is a recently delineated d...isorder, considered to be the most common subtelomeric microdeletion syndrome. 1p36 deletion syndrome is cha...g affected individuals. This variation is due, at least in part, to the genetic heterogeneity seen in 1p36 deletion...s which include terminal and interstitial deletions of varying lengths. Ch... ... AUTHORS ... Jordan VK, Zaveri HP, Scott DA ... TITLE ... 1p36 deletion syndrome: an update. ... JOURNAL ... Appl C

  6. Localities With Elevated Radiation Background in the High Karst Zone of Montenegro

    International Nuclear Information System (INIS)

    Vukotic, P.; Svrkota, R.; Andjelic, T.; Zekic, R.; Antovic, N.

    2011-01-01

    Research aimed to find localities in Montenegro with an elevated terrestrial gamma background was conducted during the period 2008-2009. For this purpose, 138 localities which have geological formations known to contain minerals with potentially high concentrations of U, Th and K, were selected throughout the country for a dosimetric survey. There are four distinctive geotectonic units in Montenegro: the Adriatic-Ionian Zone (JZ), the Budva-Cukali Zone (BZ), the High Karst Zone (VK), and the Durmitor Tectonic Unit (DTJ). The central and southern parts of Montenegro belong to the VK zone, whose geological structure is predominated by Mesozoic carbonate sediments, with occurrences of red and white bauxite formations, Triassic volcanic rocks, Paleogene flysch sediments and Quaternary sediments. In total, 38 localities belonging to the VK zone were selected for field investigations of terrestrial radiation. Knowing from earlier investigations that in Montenegro the average absorbed dose-rate in the air, 1 m above the ground, is 55 nGy/h, it was arbitrarily adopted that only localities with absorbed doses at least 50 % above this average value would be considered as having a relatively elevated radiation background. Field measurements have shown that 12 of the surveyed localities in the VK zone have such elevated dose values, five of them being with the highest dose rates in Montenegro. Among these five sites, the highest dose rate (192 nGy/h) was found at a locality which lies on andesite volcanic rock, while the other four localities (131 - 149 nGy/h) lie on bauxite deposits. Compared to the other areas in the world known to have a high natural radiation background, all of these localities in Montenegro have a moderately elevated radiation level. From the 12 localities with a relatively elevated radiation background, soil samples have been collected and analyzed by gamma spectrometry to determine activity concentrations of 40K, 232Th, 235U, 238U, 226Ra and 137Cs

  7. Simulation of Organic Magnetic Resonance Force Microscopy Experiments

    Science.gov (United States)

    2006-12-01

    Citation of manufacturer’s or trade names does not constitute an official endorsement or approval of the use thereof. Destroy this report when...doubled. In both the 2-D and 3-D cases, we do not sum over a finite spin system but integrate over a spin density. In 3-D the intergral is ∂Fx ∂x = − V...k To determine ∆fc given by equation 3, the intergral in equation 2 must be performed. The integral over all sensitive slices is determined with an

  8. Charge Movement in a Fast Twitch Skeletal Muscle from Rat

    OpenAIRE

    Simon, B. J.; Beam, K. G.

    1983-01-01

    Voltage-dependent charge movement in the rat omohyoid muscle was investigated using the three microelectrode voltage clamp technique. The charge that moved during a depolarization from the holding potential (-90 mV) to the test potential, V, increased with increasing V, saturating around 0 mV. The charge vs. voltage relationship was well fitted by Q = Qmax/{1 + exp[-(V - V)/k]}, with Qmax = 28.5 nC/μF, V = -34.2 mV, and k = 8.7 mV. Repolarization of the fiber from the test potential back to t...

  9. Experimental investigation of hole boring and light sail regimes of RPA by varying laser and target parameters

    Czech Academy of Sciences Publication Activity Database

    Kar, S.; Kakolee, K.F.; Cerchez, M.; Doria, D.; Macchi, A.; McKenna, P.; Neely, D.; Osterholz, J.; Quinn, K.; Ramakrishna, B.; Sarri, G.; Willi, O.; Yuan, X.H.; Zepf, M.; Borghesi, Marco

    2013-01-01

    Roč. 55, č. 12 (2013), "124030-1"-"124030-6" ISSN 0741-3335 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : plasmas * absorption Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.386, year: 2013

  10. Generation of high-energy-density ion bunches by ultraintense laser-cone-target interaction

    Czech Academy of Sciences Publication Activity Database

    Yang, X.H.; Yu, W.; Xu, H.; Zhuo, H.B.; Ma, Y.Y.; Zou, D.B.; Yu, T.P.; Ge, Z.Y.; Yin, Y.; Shao, F.Q.; Borghesi, Marco

    2014-01-01

    Roč. 21, č. 6 (2014), "0631053-1"-"0631053-7" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : temporal contrast * proton-beams * driven * acceleration * enhancement Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.142, year: 2014

  11. Soft x-ray free-electron laser induced damage to inorganic scintillators

    Czech Academy of Sciences Publication Activity Database

    Burian, Tomáš; Hájková, Věra; Chalupský, Jaromír; Vyšín, Luděk; Boháček, Pavel; Přeček, Martin; Wild, J.; Özkan, C.; Coppola, N.; Farahani, S.D.; Schulz, J.; Sinn, H.; Tschentscher, T.; Gaudin, J.; Bajt, S.; Tiedtke, K.; Toleikis, S.; Chapman, H.N.; Loch, R.A.; Jurek, M.; Sobierajski, R.; Krzywinski, J.; Moeller, S.; Harmand, M.; Galasso, G.; Nagasono, M.; Saskl, K.; Sovák, P.; Juha, Libor

    2015-01-01

    Roč. 5, č. 2 (2015), 254-264 ISSN 2159-3930 R&D Projects: GA ČR(CZ) GAP108/11/1312; GA MŠk EE2.3.30.0057 Grant - others:OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : fluorescent and luminescent materials * laser damage * free-electron lasers * soft x-rays * laser materials processing Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.657, year: 2015

  12. Constraints in using Cerium-animaly of bulk sediments as an indicator of paleo bottom water redox environment: A case study from the Central Indian Ocean Basin

    Digital Repository Service at National Institute of Oceanography (India)

    Pattan, J.N.; Pearce, N.J.G.; Mislankar, P.G.

    for paleo-oceanic redox conditions. Geochem. Cosmo- chim. Acta 5, 1361–1371. Lyle, M., Dymond, J., Heath, G.R., 1977. Copper–nickel enriched ferromanganese nodules and associated crusts from the Baur Basin, northwest Nazca plate. Earth Planet. Sci. Lett. 35.... Cosmo- chim. Acta 61, 2375–2388. Nozaki, Y., Horible, Y., Tsubota, H., 1981. The water column distribution of thorium isotopes in the western North Pacific. Earth Planet. Sci. Lett. 66, 73–90. Pattan, J.N., Banakar, V.K., 1997. Diagenetic remobilization...

  13. Characterisation of deuterium spectra from laser driven multi-species sources by employing differentially filtered image plate detectors in Thomson spectrometers

    Czech Academy of Sciences Publication Activity Database

    Alejo, A.; Kar, S.; Ahmed, H.; Krygier, A.G.; Doria, D.; Clarke, R.; Fernandez, J.; Freeman, R.R.; Fuchs, J.; Green, A.; Green, J.S.; Jung, D.; Kleinschmidt, A.; Lewis, C. L. S.; Morrison, J.T.; Najmudin, Z.; Nakamura, H.; Nersisyan, G.; Norreys, P.; Notley, M.; Oliver, M.; Roth, M.; Ruiz, J.A.; Vassura, L.; Zepf, M.; Borghesi, Marco

    2014-01-01

    Roč. 85, č. 3 (2014), , "093303-1"-"093303-7" ISSN 0034-6748 R&D Projects: GA MŠk EE2.3.20.0279; GA MŠk ED1.1.00/02.0061 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : acceleration driven * plasma interactions * ion-acceleration * generation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.614, year: 2014

  14. Characterisation of deuterium spectra from laser driven multi-species sources by employing differentially filtered image plate detectors in Thomson spectrometers

    Czech Academy of Sciences Publication Activity Database

    Alejo, A.; Kar, S.; Ahmed, H.; Krygier, A.G.; Doria, D.; Clarke, R.; Fernandez, J.; Freeman, R.R.; Fuchs, J.; Green, A.; Green, J.S.; Jung, D.; Kleinschmidt, A.; Lewis, C. L. S.; Morrison, J.T.; Najmudin, Z.; Nakamura, H.; Nersisyan, G.; Norreys, P.; Notley, M.; Oliver, M.; Roth, M.; Ruiz, J.A.; Vassura, L.; Zepf, M.; Borghesi, Marco

    2014-01-01

    Roč. 85, č. 9 (2014), , "093303-1"-"093303-7" ISSN 0034-6748 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : acceleration driven * plasma interactions * ion-acceleration * generation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.614, year: 2014

  15. Laser-driven ablation through fast electrons in PALS experiment at the laser radiation intensity of 1–50 PW/cm2

    Czech Academy of Sciences Publication Activity Database

    Gus’kov, S.Yu.; Demchenko, N. N.; Kasperczuk, A.; Pisarczyk, T.; Kalinowska, Z.; Chodukowski, T.; Renner, Oldřich; Šmíd, Michal; Krouský, Eduard; Pfeifer, Miroslav; Skála, Jiří; Ullschmied, Jiří; Pisarczyk, P.

    2014-01-01

    Roč. 32, č. 1 (2014), s. 177-195 ISSN 0263-0346 R&D Projects: GA MŠk LM2010014; GA MŠk EE2.3.20.0279 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:AVČR(CZ) M100101208; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 ; RVO:61389021 Keywords : inertial confinement fusion * shock ignition * laser-produced plasma * three-frame interferometry * X-ray spectroscopy * fast electron generation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.295, year: 2014

  16. Charge steering of laser plasma accelerated fast ions in a liquid spray - creation of MeV negative ion and neutral atom beams

    Czech Academy of Sciences Publication Activity Database

    Schnürer, M.; Abicht, F.; Prasad, R.; Borghesi, Marco; Priebe, G.; Braenzel, J.; Andreev, A.; Nickles, P.V.; Jequier, S.; Tikhonchuk, V.; Ter-Avetisyan, Sargis

    2013-01-01

    Roč. 20, č. 11 (2013), "113105-1"-"113105-6" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : electron-capture * molecular-hydrogen * cross-sections * high-intensity * exchange * implantation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013

  17. Polar DuaLs of Convex Bodies

    Science.gov (United States)

    1990-01-01

    dual mixed volumes are defined in Lutwak [181 by 17) (K,,....,K.) = 1 fp (K.,,u) ... p (K , u) du S.-’ where du signifies the area element on S". Let...the unit ball in R’. We shall use the following results of Lutwak [18]: (19) I’( )< ’ - ’" / and (20) V"(K 1,...,K.) _ VtK,).. V(K.). After obtaining...Rogers 161, Firey [91, Guggenheimer (13,141, Heil [161, Lutwak [18j, and Steinhardt [221 for partial results. In Theorem 3 we use an inequality due to

  18. DVD-filmid tõrjuvad VHSid poodidest välja / Erki Freiberg

    Index Scriptorium Estoniae

    Freiberg, Erki

    2005-01-01

    DVD- ja VHS-filmide müüjad ennustavad VHS-kassettide müügilt kadumist juba kahe aasta jooksul. Eesti ühe suurema filmide müüja AS-i V&K Holding müügijuhi Andrus Aigro sõnul suureneb DVD-de osakaal aastas ligi 30%, samal ajal kui videofilmide osakaal langeb 10%. Diagramm: DVD-filmide laenutajate arv on kasvanud üle kahe korra. Vt. samas: DVD-filmide pealetung on käimas ka Soomes

  19. Cryogenic Yb:YAG laser pumped by VBG-stabilized narrowband laser diode at 969 nm

    Czech Academy of Sciences Publication Activity Database

    Jambunathan, Venkatesan; Horáčková, Lucie; Navrátil, Petr; Lucianetti, Antonio; Mocek, Tomáš

    2016-01-01

    Roč. 128, č. 12 (2016), s. 1328-1331 ISSN 1041-1135 R&D Projects: GA MŠk EE2.3.20.0143; GA ČR GA14-01660S Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : Diode-pumped * cryogenic * volume Bragg grating * Yb doped * solid state lasers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.375, year: 2016

  20. Electronic and Optical Properties of Titanium Nitride Bulk and Surfaces from First Principles Calculations (Postprint)

    Science.gov (United States)

    2015-11-18

    properties of TiN bulk and surface structures were previously per- formed,24–35 analysis of the optical properties at an ab initio level for this...TDDFT dielectric functions has shown that the functional is subject to validation with GW-BSE calcula- tions. Analysis of the GW0-BSE results in...al.55) is given by the Cartesian tensor eð2Þab ðxÞ ¼ 4p 2e2 X limq!0 1 q2 P c;v;k2wkdðwkck vk wÞ huckþeaqjuvkihuckþeabqjuvki, where x is in

  1. Dynamics and Robust Control of Sampled Data Systems for Large Space Structures

    Science.gov (United States)

    1992-11-01

    physical interpretation of J 1 is this: We wish to keep the state near zero without excessive control-energy expenditcure. The weighting matrix, Q...can be given as follows. Defining v(k) -- [RI+ HT75(k÷!) H) -’ HTP (k+l)Gx(k) (249) where P(k) is a modified version of the Ricatti Equation. £(k)-C... Manual ", GTICES Systems Laboratory, Georgia Institute of Technology, Altanta, GA, Rev.J, April 1978. 21) Ericsson, A.J., "Determination of Frequencies

  2. Impacts of ambient and ablation plasmas on short- and ultrashort-pulse laser processing of surfaces

    Czech Academy of Sciences Publication Activity Database

    Bulgakova, Nadezhda M.; Panchenko, A.N.; Zhukov, V.P.; Kudryashov, S.I.; Pereira, A.; Marine, W.; Mocek, Tomáš; Bulgakov, A.V.

    2014-01-01

    Roč. 5, č. 4 (2014), s. 1344-1372 ISSN 2072-666X R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : pulsed laser ablation * laser material processing * laser plasma * ambient gas breakdown * material redeposition * plasma pipe formation * microstructures Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.269, year: 2014

  3. Efficient ASE management in disk laser amplifiers with variable absorbing clads

    Czech Academy of Sciences Publication Activity Database

    Slezák, Ondřej; Lucianetti, Antonio; Mocek, Tomáš

    2014-01-01

    Roč. 50, č. 12 (2014), s. 1052-1060 ISSN 0018-9197 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : amplifiers * laser * absorbing * Yb:YAG * multi slab Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.887, year: 2014

  4. Non-Maxwellian electron distributions in time-dependent simulations of low-Z materials illuminated by a high-intensity X-ray laser

    Czech Academy of Sciences Publication Activity Database

    de la Varga, A.G.; Velarde, P.; de Gaufridy de Dortan, Francois; Portillo, D.; Cotelo, M.; Barbas, A.; González, A.; Zeitoun, Ph.

    2013-01-01

    Roč. 9, č. 3 (2013), s. 542-547 ISSN 1574-1818 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : non-Maxwellian electron distribution * time - dependent atomic kinetics Subject RIV: BE - Theoretical Physics Impact factor: 1.519, year: 2013

  5. Biological, immunological and functional properties of two novel multi-variant chimeric recombinant proteins of CSP antigens for vaccine development against Plasmodium vivax infection.

    Science.gov (United States)

    Shabani, Samaneh H; Zakeri, Sedigheh; Salmanian, Ali H; Amani, Jafar; Mehrizi, Akram A; Snounou, Georges; Nosten, François; Andolina, Chiara; Mourtazavi, Yousef; Djadid, Navid D

    2017-10-01

    The circumsporozoite protein (CSP) of the malaria parasite Plasmodium vivax is a major pre-erythrocyte vaccine candidate. The protein has a central repeat region that belongs to one of repeat families (VK210, VK247, and the P. vivax-like). In the present study, computer modelling was employed to select chimeric proteins, comprising the conserved regions and different arrangements of the repeat elements (VK210 and VK247), whose structure is similar to that of the native counterparts. DNA encoding the selected chimeras (named CS127 and CS712) were synthetically constructed based on E. coli codons, then cloned and expressed. Mouse monoclonal antibodies (mAbs; anti-Pv-210-CDC and -Pv-247-CDC), recognized the chimeric antigens in ELISA, indicating correct conformation and accessibility of the B-cell epitopes. ELISA using IgG from plasma samples collected from 221 Iranian patients with acute P. vivax showed that only 49.32% of the samples reacted to both CS127 and CS712 proteins. The dominant subclass for the two chimeras was IgG1 (48% of the positive responders, OD 492 =0.777±0.420 for CS127; 48.41% of the positive responders, OD 492 =0.862±0.423 for CS712, with no statistically significant difference P>0.05; Wilcoxon signed ranks test). Binding assays showed that both chimeric proteins bound to immobilized heparan sulphate and HepG2 hepatocyte cells in a concentration-dependent manner, saturable at 80μg/mL. Additionally, anti-CS127 and -CS712 antibodies raised in mice recognized the native protein on the surface of P. vivax sporozoite with high intensity, confirming the presence of common epitopes between the recombinant forms and the native proteins. In summary, despite structural differences at the molecular level, the expression levels of both chimeras were satisfactory, and their conformational structure retained biological function, thus supporting their potential for use in the development of vivax-based vaccine. Copyright © 2017 Elsevier Ltd. All rights

  6. Southern Ocean seaweeds: A resource for exploration in food and drugs

    Digital Repository Service at National Institute of Oceanography (India)

    Dhargalkar, V.K.; Verlecar, X.N

    the land drainage in Barton, Pinitos and Penon de Pesca. In Penon de Pesca the nitrate concentra- tion was even higher at 20 and 30 m depth than near the surface. The phosphate concentrations ranged from 1.23 μM to 3.68 μmol l –1 with higher values only... temperatures and low light 235V.K. Dhargalkar, X.N. Verlecar / Aquaculture 287 (2009) 229–242 conditions in the Southern Oceans (Lamb and Zimmermann, 1977; DeLaca and Lipps,1976; Moe and DeLaca,1976; Wiencke and Clayton, 2002; Neushul, 1965; Amsler et al., 1998...

  7. Kinetic speciation of mercury–humate complexes in aqueous solutions by using competing ligand exchange method

    Digital Repository Service at National Institute of Oceanography (India)

    Vudamala, K.; Chakraborty, P.

    with ultrapure water (of resistivity 18.2 MΩ cm-1) acidified to contain 1 % (v/v) ultrapure HNO3 (Merck, Germany). Stock solutions of humic acid (HA) was prepared using HA from Fluka (commercialized by Sigma-Aldrich, cat. No. 53680, Sigma-Aldrich, Inc... river emptying into Cochin backwaters, Indian J. Mar. Sci. 15 (1986) 253–259. http://cat.inist.fr/?aModele=afficheN&cpsidt=8219806 (accessed September 4, 2015). [25] P.K. Krishnakumar, V.K. Pillai, Mercury Near a Caustic Soda plant at karwar,India, Mar...

  8. Absolute measurements of the fast neutron flux in the reactor RA

    Energy Technology Data Exchange (ETDEWEB)

    Berovic, N; Boreli, F; Dragin, R [Institute of Nuclear Sciences Boris Kidric, Department of physics, Vinca, Beograd (Serbia and Montenegro)

    1961-10-15

    The absolute neutron flux in the vertical VK-5 hole of the reactor RA was determined by using the {sup 27}Al (n, alpha) {sup 24}Na reaction, and by counting the {sup 24}Na - 2.5 MeV gamma line photopeak activity. A method for the determination of {sigma}{sub eff} as a mean value between the two large limiting cases of neutron spectra is used. The flux at the power level of 5 MW was found to be (2.5{+-}0.9){center_dot}10{sup 12}n/cm{sup 2}sec (author)

  9. Sampling system for a boiling reactor NPP

    International Nuclear Information System (INIS)

    Zabelin, A.I.; Yakovleva, E.D.; Solov'ev, Yu.A.

    1976-01-01

    Investigations and pilot running of the nuclear power plant with a VK-50 boiling reactor reveal the necessity of normalizing the design system of water sampling and of mandatory replacement of the needle-type throttle device by a helical one. A method for designing a helical throttle device has been worked out. The quantitative characteristics of depositions of corrosion products along the line of reactor water sampling are presented. Recommendations are given on the organizaton of the sampling system of a nuclear power plant with BWR type reactors

  10. Hadronic and electromagnetic fragmentation of ultrarelativistic heavy ions at LHC

    Czech Academy of Sciences Publication Activity Database

    Braun, H.H.; Fasso, Alberto; Ferrari, A.; Jowett, J.M.; Sala, P.R.; Smirnov, G.I.

    2014-01-01

    Roč. 17, č. 2 (2014), "021006-1"-"021006-14" ISSN 1098-4402 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : ions * accelerators * beams Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.661, year: 2014

  11. AcEST: DK956225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 103 4e-21 tr|A7P8S5|A7P8S5_VITVI Chromosome chr3 scaffold_8, whole genome ... 102 8e-21 tr|A1Y2K8|A1Y2K8_9RO...6 VTHVKNQGACG 156 >tr|A1Y2K8|A1Y2K8_9ROSI VXH-C (Fragment) OS=Vasconcellea x heilbornii PE=2 SV=1 Length = 2...YSGEFRYRDVADLP----ESVDWRKKGA 145 Query: 468 VTPVKDQGMCG 500 VT VK+QG CG Sbjct: 14

  12. Quadrupole lens-free multiple-profile diagnostics for emittance measurement of laser wakefield accelerated electron beams

    Czech Academy of Sciences Publication Activity Database

    Krůs, Miroslav; Laštovička, Tomáš; Levato, Tadzio

    2016-01-01

    Roč. 810, Feb (2016), s. 32-36 ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; AVČR(CZ) M100101210 Institutional support: RVO:68378271 Keywords : scattering * plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.362, year: 2016

  13. Residual fluxes of water and nutrient transport through the main inlet of a tropical estuary, Cochin estuary, West Coast, India

    Digital Repository Service at National Institute of Oceanography (India)

    Vinita, J.; Lallu, K.R; Revichandran, C.; Muraleedharan, K.R; Jineesh, V.K.; Shivaprasad, A.

    of Oceanic Engineering, 25(4), 437-445. 13    Sooria, P.M., Jyothibabu, R., Anjusha, A., Vineetha, G., Vinita, J., Lallu, K. R., Paul, M., Jagadeesan, L., et al. (2015). Plankton food web and its seasonal dynamics in a large monsoonal estuary (Cochin... J., Lallu K.R., Muraleedharan K. R., Jineesh V.K., Shivaprasad A. Abstract Determining robust values for estuarine material fluxes has been a complex task and an interdisciplinary research challenge. With the advent of Acoustic Doppler...

  14. Time-resolved measurement of thermally induced aberrations in a cryogenically cooled Yb:YAG slab with a wavefront sensor

    Czech Academy of Sciences Publication Activity Database

    Sikocinski, Pawel; Novák, Ondřej; Smrž, Martin; Pilař, Jan; Jambunathan, Venkatesan; Jelínková, H.; Endo, Akira; Lucianetti, Antonio; Mocek, Tomáš

    2016-01-01

    Roč. 122, č. 4 (2016), 1-10, č. článku 73. ISSN 0946-2171 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk LO1602; GA ČR GA14-01660S Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : solid-state laser * Yb-Yag Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.696, year: 2016

  15. Time-resolved characterization of the formation of a collisionless shock

    Czech Academy of Sciences Publication Activity Database

    Ahmed, H.; Dieckmann, M.E.; Romagnani, L.; Doria, D.; Sarri, G.; Cerchez, M.; Ianni, E.; Kourakis, I.; Giesecke, A.L.; Notley, M.; Prasad, R.; Quinn, K.; Willi, O.; Borghesi, Marco

    2013-01-01

    Roč. 110, č. 20 (2013), "205001-1"-"205001-5" ISSN 0031-9007 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : cosmic-ray acceleration * laser-produced-plasma * supernova remnant * temperature * electrons * waves * ions Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 7.728, year: 2013

  16. Energetic beams of negative and neutral hydrogen from intense laser plasma interaction

    Czech Academy of Sciences Publication Activity Database

    Abicht, F.; Prasad, R.; Borghesi, Marco; Priebe, G.; Braenzel, J.; Andreev, A.; Nickles, P.V.; Schnürer, M.; Jequier, S.; Revet, G.; Tikhonchuk, V.; Ter-Avetisyan, Sargis

    2013-01-01

    Roč. 103, č. 25 (2013), "253501-1"-"253501-5" ISSN 0003-6951 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : charge-exchange * cross-sections * atomic- hydrogen * helium ions * gases * potassium * protons Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.515, year: 2013

  17. Mapping strain fields induced in Zr-based bulk metallic glasses during in-situ nanoindentation by X-ray nanodiffraction

    Czech Academy of Sciences Publication Activity Database

    Gamcová, J.; Mohanty, G.; Michalik, Štefan; Wehrs, J.; Bednarčík, J.; Krywka, C.; Breguet, J.M.; Michler, J.; Franz, H.

    2016-01-01

    Roč. 108, č. 3 (2016), 1-4, č. článku 031907. ISSN 0003-6951 R&D Projects: GA MŠk EE2.3.30.0057 Grant - others:OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057; AVČR(CZ) M100101221 Institutional support: RVO:68378271 Keywords : X-ray diffraction * hardness * elasticity * nanotechnology * amorphous metals Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.411, year: 2016

  18. How to optimize ultrashort pulse laser interaction with glass surfaces in cutting regimes?

    Czech Academy of Sciences Publication Activity Database

    Bulgakova, Nadezhda M.; Zhukov, V.P.; Collins, A.R.; Rostohar, Danijela; Derrien, Thibault; Mocek, Tomáš

    2015-01-01

    Roč. 336, May (2015), s. 364-374 ISSN 0169-4332 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : laser material processing * high power lasers * glass cutting * laser-matter interaction * biwave length irradiation * ambient gas ionization Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.150, year: 2015

  19. Chemical evolution of the Magellanic Clouds

    Science.gov (United States)

    Barbuy, B.; de Freitas Pacheco, J. A.; Idiart, T.

    We have obtained integrated spectra for 14 clusters in the Magellanic Clouds, on which the spectral indices Hβ, Mg2, Fe5270, Fe5335 were measured. Selecting indices whose behaviour depends essentially on age and metallicity (Hβ and ), together with (B-V) and (V-K) colours, we were able to determine age and metallicities for these clusters, using calibrations based on single stellar population models (Borges et al. 1995). A chemical evolution model which follows a star formation history as indicated by the field population is checked with the age and metallicity data for our sample star clusters.

  20. Wear-resistance investigation of electro-screen coatings obtained using electroerosive powders of micro and nanofractions

    Science.gov (United States)

    Ageev, E. V.; Altukhov, A. Yu; Malneva, Yu V.; Novikov, A. N.

    2018-03-01

    The results of the wear resistance investigation of electro sparking coatings, applied using electrode material from electroerosive powders of hard alloy VK-8 (90%) with the addition of powder of high-speed steel of grade R6M5 (10%), are presented. Electro spark coatings were formed on samples of 30KhGSA steel using these electrodes and installation UR-121. The coefficient of friction and the wear rate of the surface of the sample and counterbody were measured on an automated friction machine “Tribometer” (CSM Instruments, Switzerland), controlled by a computer, according to the standard “ball-disk” test scheme.

  1. 23RD International Conference on Phenomena in Ionized Gases, Volume 1

    Science.gov (United States)

    1998-12-01

    PLASMAS 1-76 Ohe K., Kimura T., Nakamura M. IONIZATION COEFFICIENT IN ARGON-ISOBUTANE MIXTURES 1-78 Krajcar-Bronic I., Grosswendt B. ON THE INFLUENCE OF...Tanaka, Xiaodong Zheng, Kazuo Minami, Takao Nagahama and Hisashi Tokurnasu Graduate School of Science and Technology, Niigata Univerity, Niigata 950...S.V. III-54 Krenek P. 11-104 Jelenkovic B.M. 1-98 HII-56 Kriha V. 1-266 Jivotov V.K. IV-222 Kimura T. 1-76 Kroesen G.M.W. 1-152 IV-224 11-22 IV.246

  2. Cyclic hexapeptide-conjugated nanoparticles enhance curcumin delivery to glioma tumor cells and tissue

    Directory of Open Access Journals (Sweden)

    Zhang X

    2017-08-01

    Full Text Available Xuemei Zhang,1–3 Xuejuan Li,1,4 Hongchen Hua,1 Aiping Wang,1 Wanhui Liu,1–3 Youxin Li,1–3 Fenghua Fu,1–3 Yanan Shi,5 Kaoxiang Sun1 1School of Pharmacy, Yantai University, Yantai, Shandong Province, People’s Republic of China; 2State Key Laboratory of Long-acting and Targeting Drug Delivery System, Yantai, Shandong Province, People’s Republic of China; 3Luye Pharmaceutical Co., Ltd., Shandong Province, People’s Republic of China; 4National Engineering and Technology Research Center of Chirality Pharmaceutical, Lunan Pharmaceutical Group Co., Ltd., Shandong Province, People’s Republic of China; 5School of Pharmacy, Binzhou Medical University, Shandong Province, People’s Republic of China Abstract: Glioma has one of the highest mortality rates among primary brain tumors. The clinical treatment for glioma is very difficult due to its infiltration and specific growth locations. To achieve improved drug delivery to a brain tumor, we report the preparation and in vitro and in vivo evaluation of curcumin nanoparticles (Cur-NPs. The cyclic hexapeptide c(RGDf(N-meVK-C (cHP has increased affinity for cells that overexpress integrins and was designed to target Cur-NPs to tumors. Functional polyethyleneglycol-modified poly(D,L-lactide-co-glycolide (PEG-PLGA conjugated to cHP was synthesized, and targeted Cur-NPs were prepared using a self-assembly nanoprecipitation process. The physicochemical properties and the in vitro cytotoxicity, accuracy, and penetration capabilities of Cur-NPs targeting cells with high levels of integrin expression were investigated. The in vivo targeting and penetration capabilities of the NPs were also evaluated against glioma in rats using in vivo imaging equipment. The results showed that the in vitro cytotoxicity of the targeted cHP-modified curcumin nanoparticles (cHP/Cur-NPs was higher than that of either free curcumin or non-targeted Cur-NPs due to the superior ability of the cHP/Cur-NPs to target tumor cells

  3. Inversion of substrate stereoselectivity of horse liver alcohol dehydrogenase by substitutions of Ser-48 and Phe-93.

    Science.gov (United States)

    Kim, Keehyuk; Plapp, Bryce V

    2017-10-01

    The substrate specificities of alcohol dehydrogenases (ADH) are of continuing interest for understanding the physiological functions of these enzymes. Ser-48 and Phe-93 have been identified as important residues in the substrate binding sites of ADHs, but more comprehensive structural and kinetic studies are required. The S48T substitution in horse ADH1E has small effects on kinetic constants and catalytic efficiency (V/K m ) with ethanol, but decreases activity with benzyl alcohol and affinity for 2,2,2-trifluoroethanol (TFE) and 2,3,4,5,6-pentafluorobenzyl alcohol (PFB). Nevertheless, atomic resolution crystal structures of the S48T enzyme complexed with NAD + and TFE or PFB are very similar to the structures for the wild-type enzyme. (The S48A substitution greatly diminishes catalytic activity.) The F93A substitution significantly decreases catalytic efficiency (V/K m ) for ethanol and acetaldehyde while increasing activity for larger secondary alcohols and the enantioselectivity for the R-isomer relative to the S-isomer of 2-alcohols. The doubly substituted S48T/F93A enzyme has kinetic constants for primary and secondary alcohols similar to those for the F93A enzyme, but the effect of the S48T substitution is to decrease V/K m for (S)-2-alcohols without changing V/K m for (R)-2-alcohols. Thus, the S48T/F93A substitutions invert the enantioselectivity for alcohol oxidation, increasing the R/S ratio by 10, 590, and 200-fold for 2-butanol, 2-octanol, and sec-phenethyl alcohol, respectively. Transient kinetic studies and simulations of the ordered bi bi mechanism for the oxidation of the 2-butanols by the S48T/F93A ADH show that the rate of hydride transfer is increased about 7-fold for both isomers (relative to wild-type enzyme) and that the inversion of enantioselectivity is due to more productive binding for (R)-2-butanol than for (S)-2-butanol in the ternary complex. Molecular modeling suggests that both of the sec-phenethyl alcohols could bind to the enzyme

  4. Review of climatic input data for wind load design in accordance with SANS 10160-3

    CSIR Research Space (South Africa)

    Goliger, Adam MW

    2017-12-01

    Full Text Available factor QWE that provides for the wind engineering procedures, such as the wind speed profile and pressure coefficients. The characteristic wind load is then given by Equation 4, where CoV is the coefficient of variation (σV/µV): QW,k = QWE (µV + 2....59 σV)2 = QWE µVk2(1+ 2.59 CoVV)2 (6) Design wind load The design wind load can be obtained by determining the wind speed according to Equation 4 for an exceedance probability (PF) that corresponds with the appropriate target reliability (β...

  5. Testing the reliability of non-LTE spectroscopic models for complexions

    Czech Academy of Sciences Publication Activity Database

    Hansen, s.; Armstrong, G.S.J.; Bastiani-Ceccotti, S.; Bowen, C.; Chung, H.-K.; Colgan, J.P.; de Gaufridy de Dortan, Francois; Fontes, C.J.; Gilleron, F.; Marquès, J.-R.; Piron, R.; Peyrusse, O.; Poirier, M.; Ralchenko, Yu.; Sasaki, A.; Stambulchik, E.; Thais, F.

    2013-01-01

    Roč. 9, č. 3 (2013), 523-527 ISSN 1574-1818 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : X-ray spectroscopy * atomic kinetics * plasma diagnostics Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.519, year: 2013

  6. Plasma-based creation of short light pulses: analysis and simulation of amplification and focusing

    Czech Academy of Sciences Publication Activity Database

    Riconda, C.; Weber, Stefan A.; Lancia, L.; Marqués, J.-R.; Mourou, G.; Fuchs, J.

    2015-01-01

    Roč. 57, č. 1 (2015), s. 014002 ISSN 0741-3335 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : plasma-based amplification * PIC simulations * parametric instabilities Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.404, year: 2015

  7. Bubble shape and electromagnetic field in the nonlinear regime for laser wakefield acceleration

    Czech Academy of Sciences Publication Activity Database

    Li, X.F.; Yu, Q.; Gu, Yanjun; Huang, S.; Kong, Q.; Kawata, S.

    2015-01-01

    Roč. 22, č. 8 (2015), "083112-1"-"083112-6" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : electron-beams * plasma- waves * excitation * driven Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.207, year: 2015

  8. Characteristics of target polarization by laser ablation

    Czech Academy of Sciences Publication Activity Database

    Krása, Josef; Delle Side, D.; Giuffreda, E.; Nassisi, V.

    2015-01-01

    Roč. 33, č. 4 (2015), 601-605 ISSN 0263-0346 R&D Projects: GA ČR GAP205/12/0454; GA MŠk EE2.3.20.0279 Grant - others:LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : Target current in laser-produced plasmas * positive and negative target polarization * space structure of ion front Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.649, year: 2015

  9. Two-dimensional simulations of laser–plasma interaction and hot electron generation in the context of shock-ignition research

    Czech Academy of Sciences Publication Activity Database

    Klimo, O.; Psikal, J.; Tikhonchuk, V.T.; Weber, Stefan A.

    2014-01-01

    Roč. 56, č. 5 (2014), 055010 ISSN 0741-3335 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : laser plasma interaction * stimulated Raman scattering * hot electrons * particle-in-cell simulation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.186, year: 2014

  10. Temperature dependence of parametric instabilities in the context of the shock-ignition approach to inertial confinement fusion

    Czech Academy of Sciences Publication Activity Database

    Weber, Stefan A.; Riconda, C.

    2015-01-01

    Roč. 3, Feb (2015), e6 ISSN 2095-4719 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : inertial confinement fusion * shock ignition * laser- plasma interaction * parametric instabilities Subject RIV: BL - Plasma and Gas Discharge Physics

  11. East Europe Report

    Science.gov (United States)

    1986-01-23

    Mezögazdasäg, erdögazdäl- kodäs, vizgazdälkodäs 2,5% LfKözlekedes, tävközles 0,9% Lakossag 8,1% LEgyeb 9,6% -Ipar78,9% (2)VILLAM0S- ENERGIA ...1970’s centered around renovation of the completely used up infrastructure and the obsolete, dangerous buildings. It turned out, however, that the... renovation . [Question] But reconstruction began in 1976.... [Answer] Right. But this did not prove successful. The reason partly was that it began

  12. Measurement of neutrons in the RA reactor cell; Merenje neutrona u elementarnoj celiji reaktora RA

    Energy Technology Data Exchange (ETDEWEB)

    Raisic, N; Bosevski, T [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    A special experimental device was constructed for measuring the neutron flux distribution in the RA reactor cell. This device simulated the reactor cell in order to avoid disturbance in the reactor core. It was made of an aluminium cylindrical vessel having outer diameter same as the vertical experimental channel and contained three fuel slugs. Hole was made in through the center of the fuel slugs and a copper wire was placed in the hole for measuring the thermal neutron flux distribution. It was placed in the experimental channel VK-5 in the location of highest neutron flux. Handling of samples for irradiation was quite simple.

  13. XUV spectra of laser-produced zirconium plasmas

    Czech Academy of Sciences Publication Activity Database

    Li, B.; Higashiguchi, T.; Otsuka, T.; Jiang, W.; Endo, Akira; Dunne, P.; O'Sullivan, G.

    2012-01-01

    Roč. 45, č. 24 (2012), "245004-1"-"245004-6" ISSN 0953-4075 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6 k HILASE(XE) CZ.1.07/2.3.00/20.0143 Program:EE Institutional support: RVO:68378271 Keywords : x-ray-spectra * dielectronic recombination * transitions * spectroscopy * microscopy * ions Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.031, year: 2012

  14. Effects of buried high-Z layers on fast electron propagation

    Czech Academy of Sciences Publication Activity Database

    Yang, X.; Xu, H.; Zhuo, H.; Ma, Y.; Shao, F.; Yin, Y.; Borghesi, Marco

    2014-01-01

    Roč. 68, č. 2 (2014), s. 1-7 ISSN 1434-6060 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : laser-plasma interactions * short-pulse * hot-electrons * solid targets * transport * field Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.228, year: 2014

  15. Generation of hemispherical fast electron waves in the presence of preplasma in ultraintense laser-matter interaction

    Czech Academy of Sciences Publication Activity Database

    Yang, H.X.; Ma, Y.Y.; Xu, H.; Shao, F.Q.; Yu, M.Y.; Yin, Y.; Zhuo, H.B.; Borghesi, Marco

    2013-01-01

    Roč. 31, č. 3 (2013), s. 379-386 ISSN 0263-0346 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : betatron resonance * electron plasma waves * ponderomotive force * preplasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.701, year: 2013

  16. "Water window" sources: Selection based on the interplay of spectralproperties and multilayer reflection bandwidth

    Czech Academy of Sciences Publication Activity Database

    Li, B.; Higashiguchi, T.; Otsuka, T.; Jiang, W.; Endo, Akira; Dunne, A.; O´Sullivan, G.

    2013-01-01

    Roč. 102, č. 4 (2013), " 041117-1"-" 041117-4" ISSN 0003-6951 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : X-ray microscopy * radiation * extreme * plasma * lithography * emission Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.515, year: 2013 http://scitation.aip.org/content/aip/journal/apl/102/4/10.1063/1.4789982

  17. Short-wavelength ablation of polymers in the high-fluence regime

    Czech Academy of Sciences Publication Activity Database

    Liberatore, Chiara; Mann, K.; Müller, M.; Pina, L.; Juha, Libor; Vyšín, Luděk; Rocca, J.J.; Endo, Akira; Mocek, Tomáš

    T161, MAY (2014), "014066-1"-"014066-4" ISSN 0031-8949 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : extreme ultraviolet * soft x-ray * ablation * polymers Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.126, year: 2014

  18. Calculation of the thermal neutron flux depression in the loop VISA-1; Izracunavanje depresije fluksa termalnih neutrona u 'petlji' VISA-1

    Energy Technology Data Exchange (ETDEWEB)

    Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    Among other applications, the VISA-1 loop is to be used for thermal load testing of materials. For this type of testing one should know the maximum power generated in the loop. This power is determined from the maximum thermal neutron flux in the VK-5 channel and mean flux depression in the fissile component of the loop. Thermal neutron flux depression is caused by neutron absorption in the components of the loop, shape of the components and neutron leaking through gaps as well as properties of the surrounding medium of the core. All these parameters were taken into account for calculating the depression of thermal neutron flux in the VISA-1 loop. Two group diffusion theory was used. Fast neutron from the fission in the loop and slowed down were taken into account. Depression of the thermal neutron flux is expressed by depression factor which represents the ratio of the mean thermal neutron flux in the fissile loop component and the thermal neutron flux in the VK-5 without the loop. Calculation error was estimated and it was recommended to determine the depression factor experimentally as well. [Serbo-Croat] Petlja VISA-1 namenjena je izmedju ostalog ispitivanju materiajala na termicka naprezanja. Za ova ispitivanja potrebno je poznavati maksimalnu snagu koja se razvija u petlji, a ona se odredjuje na osnovu maksimalnog fluksa termalnih neutrona u kanalu VK-5 i srednje depresije fluksa u fisibilnoj komponenti petlje. Depresija fluksa termalnih neutrona uzrokovana je apsorpcijom neutrona u komponentama petlje, geometrijom komponeni i isticanjem neutrona preko supljina u petlji kao i osobinama reaktorske sredine koja okruzuje petlju. Svi ovi faktori uzeti su u obzir pri proracunu depresije fluksa termalnih neutrona u petlji VISA-1. Primenjena je difuziona dvo grupna teorija. Uzeti su u obzir brzi neutroni nastali fisijom u petlji i usporeni u aktivnoj zoni RA. Depresija neutronskog fluksa izrazena je depresionim faktorom, koji predstavlja odnos srednjeg fluksa

  19. Response of dosemeters in the radiation field generated by a TW-class laser system

    Czech Academy of Sciences Publication Activity Database

    Olšovcová, Veronika; Klír, Daniel; Krása, Josef; Krůs, Miroslav; Velyhan, Andriy; Zelenka, Z.; Rus, Bedřich

    2014-01-01

    Roč. 161, 1-4 (2014), 343-346 ISSN 0144-8420 R&D Projects: GA MŠk ED1.1.00/02.0061; GA ČR GAP205/12/0454; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : radiology * nuclear medicine * medical imaging Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.913, year: 2014

  20. Effects of resistive magnetic field on fast electron divergence measured in experiment

    Czech Academy of Sciences Publication Activity Database

    Yang, H.X.; Zhuo, H.B.; Ma, Y.Y.; Xu, H.; Yu, T.P.; Zou, D.B.; Ge, Z.Y.; Xu, B.B.; Zhu, Q.J.; Shao, F.Q.; Borghesi, Marco

    2015-01-01

    Roč. 57, č. 2 (2015), s. 025011 ISSN 0741-3335 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : fast electron * divergence measument * resistive magnetic field * laser-plasma interactions * short-pulse * acceleration Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.404, year: 2015

  1. Change of diamond film structure and morphology with N2 addition in MW PECVD apparatus with linear antenna delivery system

    Czech Academy of Sciences Publication Activity Database

    Jakl Krečmarová, Marie; Petrák, Václav; Taylor, Andrew; Sankaran, K. J.; Lin, I. N.; Jäger, Aleš; Gärtnerová, Viera; Fekete, Ladislav; Drahokoupil, Jan; Laufek, František; Vacík, Jiří; Hubík, Pavel; Mortet, Vincent; Nesladek, M.

    2014-01-01

    Roč. 211, č. 10 (2014), s. 2296-2301 ISSN 1862-6300 R&D Projects: GA ČR GA13-31783S; GA MŠk(CZ) LM2011026; GA MŠk(XE) LM2011019 Grant - others:OP VK(XE) CZ.1.07/2.3.00/20.0306; AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:68378271 ; RVO:61389005 Keywords : linear antenna * nano-diamond * nitrogen doping * TEM * Raman spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.616, year: 2014 http://onlinelibrary.wiley.com/doi/10.1002/pssa.201431255/full

  2. Effect of amplified spontaneous emission and parasitic oscillations on the performance of cryogenically-cooled slab amplifiers

    Czech Academy of Sciences Publication Activity Database

    Sawicka, Magdalena; Divoký, Martin; Lucianetti, Antonio; Mocek, Tomáš

    2013-01-01

    Roč. 31, č. 4 (2013), s. 553-560 ISSN 0263-0346 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : amplified spontaneous emission * cryogenic cooling * parasitic oscillations * slab lasers * Yb:YAG, Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.701, year: 2013

  3. Light Armor in Deep Operational Maneuver: The New Excalibur?

    Science.gov (United States)

    1994-05-04

    organizations. 29 777-P7 777777-7 Operatlon Barration . The Belorussilan Camoaign During The Russo - German War. 194& Operation Bagration took place...McLean, VA: Brassey’s Defence Publisher’s, 1984), p. 141., 35. James 3. Schneider, "V.K. Triandafillov, Military Theorist." The Journal of SoQviet...Doctrine," The_= RIjournaL (March 1976): 38-46. Barbara,~ James C. and Brown, R.F. "Deep Thrust on the Extended Battlefield," Military Review (October 1982

  4. Види соціальної реклами за характером її завдань (на прикладі соціальної мережі «ВКонтакте»)

    OpenAIRE

    Бусел, Лілія Ю.; Busel, L. Y.

    2014-01-01

    У статті здійснено опис зафіксованих зразків зображальної соціальної реклами у тематичних групах «Социальная реклама» (http://vk.com/socialr), «Социальная реклама. D-factor» (http://vk.com/dfactor), «Вирусный маркетинг. Социальная реклама. Бизнес» (http://vk.com/club29205860) та в групі, яка не визначає свою тематику як соціальну, «Задумайся над этим фото» (http://vk.com/think.photo). Здійснено аналіз ефективності розміщення соціальної реклами у соціальній мережі, а також окреслено переваги м...

  5. Thin disk amplifier-based 40 mJ, 1 kHz, picosecond laser at 515 nm

    Czech Academy of Sciences Publication Activity Database

    Novák, Jakub; Green, Jonathan T.; Metzger, T.; Mazanec, Tomáš; Himmel, Bedřich; Horáček, Martin; Hubka, Zbyněk; Boge, Robert; Antipenkov, Roman; Batysta, František; Naylon, Jack A.; Bakule, Pavel; Rus, Bedřich

    2016-01-01

    Roč. 24, č. 6 (2016), s. 5728-5733 ISSN 1094-4087 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 Laser Sys(XE) CZ.1.07/2.3.00/20.0091 Institutional support: RVO:68378271 Keywords : laser amplifiers * laser s * pulsed * laser s * diode -pumped * laser s * frequency doubled * ultrafast laser s Subject RIV: BH - Optics, Masers, Laser s Impact factor: 3.307, year: 2016

  6. Efficient laser performance of a cryogenic Yb:YAG laser pumped by fiber coupled 940 and 969 nm laser diodes

    Czech Academy of Sciences Publication Activity Database

    Jambunathan, Venkatesan; Miura, Taisuke; Těsnohlídková, L.; Lucianetti, Antonio; Mocek, Tomáš

    2015-01-01

    Roč. 12, č. 1 (2015), "015002-1"-"015002-6" ISSN 1612-2011 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA ČR GA14-01660S Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : cryogenic laser s * absorption * bandwidth * emission cross-section * absorption cross-section * diode pumping Subject RIV: BH - Optics, Masers, Laser s Impact factor: 2.391, year: 2015

  7. Report of the Technology Service - Annex B

    International Nuclear Information System (INIS)

    Martinc, R.; Cupac, S.; Vukadin, Z.; Stosic, T.; Sotic, O.

    1986-01-01

    This report describes the organisational structure of the technology service and its activities and tasks: routine control of reactor parameters and cooperation with the reactor users; development of methodology of reactor control and its application; control of heavy water and gas system operation; dosimetry measurements of contamination in the reactor building; technical aspects of radiation protection; decontamination and accident analysis. Separate chapter describes building of the reactor experimental loop for irradiation of fuel elements and construction materials, which will be placed in the central experimental channel VK-5 [sr

  8. Stable long range proton acceleration driven by intense laser pulse with underdense plasmas

    Czech Academy of Sciences Publication Activity Database

    Gu, Yanjun; Zhu, Z.; Li, F.X.; Yu, Q.; Huang, S.; Zhang, F.; Kong, Q.; Kawata, S.

    2014-01-01

    Roč. 21, č. 6 (2014), "063104-1"-"063104-6" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : ion-acceleration * fast ignition * generation * beams * targets Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.142, year: 2014

  9. Spectroscopic and lasing characteristics of Yb:YGAG ceramic at cryogenic temperatures

    Czech Academy of Sciences Publication Activity Database

    Jambunathan, Venkatesan; Horáčková, Lucie; Miura, Taisuke; Šulc, J.; Jelínková, H.; Endo, Akira; Lucianetti, Antonio; Mocek, Tomáš

    2015-01-01

    Roč. 5, č. 6 (2015), s. 1289-1295 ISSN 2159-3930 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA ČR GA14-01660S Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : laser * absorption * spectra Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.657, year: 2015

  10. Picosecond green and deep ultraviolet pulses generated by a high-power 100 kHz thin-disk laser

    Czech Academy of Sciences Publication Activity Database

    Novák, Ondřej; Turčičová, Hana; Smrž, Martin; Miura, Taisuke; Endo, Akira; Mocek, Tomáš

    2016-01-01

    Roč. 41, č. 22 (2016), s. 5210-5213 ISSN 0146-9592 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk LO1602; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : lasers * diode-pumped * ultraviolet Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.416, year: 2016

  11. Spectroscopic ellipsometry characterization of nano-crystalline diamondfilms prepared at various substrate temperatures and pulsed plasma frequencies using microwave plasma enhanced chemical vapor deposition apparatus with linear antenna delivery

    Czech Academy of Sciences Publication Activity Database

    Mistrík, J.; Janíček, P.; Taylor, Andrew; Fendrych, František; Fekete, Ladislav; Jäger, Aleš; Nesládek, M.

    2014-01-01

    Roč. 571, č. 1 (2014), s. 230-237 ISSN 0040-6090 R&D Projects: GA ČR GA13-31783S; GA MŠk(CZ) LM2011026 Grant - others: COST Nano TP(XE) MP0901; OP VK(XE) CZ.1.07/2.3.00/20.0306 Institutional support: RVO:68378271 Keywords : nanocrystalline diamond * thin films * microwave plasma-enhanced chemical vapor deposition * pulsed plasma * low deposition temperature Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.759, year: 2014

  12. Calculation of steam content in a draught section of a tank-type boiling water cooled reactor

    International Nuclear Information System (INIS)

    Panajotov, D.P.; Gorburov, V.I.

    1989-01-01

    Structural and hydrodynamic features of a two-phase flow in a draught section of a tank-type boiling water cooled reactor are considered. A calculated model of the steady flow and methods for determining steam content and phase rate profiles under the maximum steam content at the section axis and at some distance from it are proposed. Steam content distribution by height quantitatively agrees with experimental data for the VK-50 reactor. Calculation technique allows one to obtain steam content and phase rate profiles at the section outlet

  13. Migrering av en webbsida från Joomla! till WordPress.

    OpenAIRE

    Konu, Tommi

    2013-01-01

    Denna rapport bygger på examensarbetet för Högskoleexamen i Medieteknik vid Umeå Universitet.Examensarbetet har utförts med VK Effekt på uppdrag av Västerbottens-Kuriren. Denna rapport kommer att behandla en migrering mellan systemen Joomla! och WordPress.Rapportens syfte är att kortfattat berätta om vilka valmöjligheter som finns vid en migrering, samtdemonstrera och visa en av vägarna som kan tas vid en migrering av en hemsida mellan olika CMS. This report is based on the thesis for the...

  14. Charge equilibrium of a laser-generated carbon-ion beam in warm dense matter

    Czech Academy of Sciences Publication Activity Database

    Gauthier, M.; Chen, S.N.; Lévy, A.; Audebert, P.; Blancard, C.; Ceccotti, T.; Cerchez, M.; Doria, D.; Floquet, V.; Lamour, E.; Peth, C.; Romagnani, L.; Rozet, J.-P.; Scheinder, M.; Shepherd, R.; Toncian, T.; Vernhet, D.; Willi, O.; Borghesi, Marco; Faussurier, G.; Fuchs, J.

    2013-01-01

    Roč. 110, č. 13 (2013), "135003-1"-"135003-5" ISSN 0031-9007 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : fast heavy-ions * stopping powers * energy-loss * states * solids * distributions * surface * plasma * foil Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 7.728, year: 2013

  15. High energy electrons from interaction with a structured gas-jetat FLAME

    Czech Academy of Sciences Publication Activity Database

    Grittani, G.; Anania, M.P.; Gatti, G.; Giulietti, D.; Kando, M.; Krůs, Miroslav; Labate, L.; Levato, Tadzio; Londrillo, P.; Rossi, F.; Gizzi, L.A.

    2014-01-01

    Roč. 740, Mar (2014), s. 257-265 ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : beam-plasma interactions * laser-plasma acceleration * ultra-intenselaser–matter interaction Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.216, year: 2014

  16. Periodic nanostructures self-formed on silicon and silicon carbide by femtosecond laser irradiation

    Czech Academy of Sciences Publication Activity Database

    Gemini, Laura; Hashida, M.; Shimizu, M.; Miyasaka, Y.; Inoue, S.; Tokita, S.; Limpouch, J.; Mocek, Tomáš; Sakabe, S.

    2014-01-01

    Roč. 117, č. 1 (2014), s. 49-54 ISSN 0947-8396 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk(CZ) LG13029 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : coulomb explosion * ablation * surfaces * metals * pulses * semiconductors * fabrication * thresholds * picosecond Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.704, year: 2014

  17. The Cold Gas-Dynamic Spray and Characterization of Microcrystalline Austenitic Stainless Steel

    Science.gov (United States)

    2014-09-01

    the operational availability of the component, both of which are major concerns in the Navy today. P.F. Leyman and V.K. Champagne have...the gas flow was found utilizing the same equation as Champagne [19].   6x x xp g p p p p dT hT T dt c D   (15) where Tpx is the temperature...Deposition Process: Fundamentals and Applications, V. K. Champagne , Ed., Boca Raton, FL, Woodhead, 2007, pp. 43–61. [2] K. Spencer and M. -X. Zhang

  18. Ultra Precision Machining

    Science.gov (United States)

    1990-05-20

    and U can be found by Gauss elimiunation. Using estimated reference states, the control law is uk = - Kzk + (U + KX).,,k (3.51) Linear Quadratic...gain F. An estimator may be used for the reference input states (Eq. 3.48), giving a controller Uk = - Kzk -t- Fk (3.57) Results and conclusions Figure...the following state-space equations: Zk+l = kZk +rkuk+w, (4.12) Zk = HkZk + vk (4.13) where zk is the system state vector, ti, is the propagation matrix

  19. Controllable high-quality electron beam generation by phase slippage effect in layered targets

    Czech Academy of Sciences Publication Activity Database

    Yu, Q.; Gu, Yanjun; Li, X.F.; Huang, S.; Zhang, F.; Kong, O.; Ma, Y.Y.; Kawata, S.

    2014-01-01

    Roč. 21, č. 11 (2014), "113106-1"-"113106-6" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : laser * plasma * electrons Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.142, year: 2014

  20. Carbon storage in eucalyptus and pine plantations in South Africa

    CSIR Research Space (South Africa)

    Christie, SI

    1995-11-01

    Full Text Available of such functions, determined from forestry trial data in South Africa, are shown below. Harrison et al. (1994) give the following result for P. patula in Nelshoogte, South Africa: Vste, . = Vf~,,at(1- exp(-0.141 l(1-0.6782exp(-O.OO13TP))i)) 3"°935 with n = 218... an expected life of more than 20 years. In South Africa most construction timber falls into this category, as well as timber destined to be permanently buried underground as mine supports. The C stored in timber products can be calculated as: Cp = ~aVkPk E...

  1. Microglia Transcriptome Changes in a Model of Depressive Behavior after Immune Challenge.

    Directory of Open Access Journals (Sweden)

    Dianelys Gonzalez-Pena

    Full Text Available Depression symptoms following immune response to a challenge have been reported after the recovery from sickness. A RNA-Seq study of the dysregulation of the microglia transcriptome in a model of inflammation-associated depressive behavior was undertaken. The transcriptome of microglia from mice at day 7 after Bacille Calmette Guérin (BCG challenge was compared to that from unchallenged Control mice and to the transcriptome from peripheral macrophages from the same mice. Among the 562 and 3,851 genes differentially expressed between BCG-challenged and Control mice in microglia and macrophages respectively, 353 genes overlapped between these cells types. Among the most differentially expressed genes in the microglia, serum amyloid A3 (Saa3 and cell adhesion molecule 3 (Cadm3 were over-expressed and coiled-coil domain containing 162 (Ccdc162 and titin-cap (Tcap were under-expressed in BCG-challenged relative to Control. Many of the differentially expressed genes between BCG-challenged and Control mice were associated with neurological disorders encompassing depression symptoms. Across cell types, S100 calcium binding protein A9 (S100A9, interleukin 1 beta (Il1b and kynurenine 3-monooxygenase (Kmo were differentially expressed between challenged and control mice. Immune response, chemotaxis, and chemokine activity were among the functional categories enriched by the differentially expressed genes. Functional categories enriched among the 9,117 genes differentially expressed between cell types included leukocyte regulation and activation, chemokine and cytokine activities, MAP kinase activity, and apoptosis. More than 200 genes exhibited alternative splicing events between cell types including WNK lysine deficient protein kinase 1 (Wnk1 and microtubule-actin crosslinking factor 1(Macf1. Network visualization revealed the capability of microglia to exhibit transcriptome dysregulation in response to immune challenge still after resolution of sickness

  2. Czy jesteśmy „ludzkim zoo”?

    Directory of Open Access Journals (Sweden)

    Katarzyna Wrzesińska

    2016-08-01

    Full Text Available Are we "human zoo"? Review: The Invention of Race. Scientific and Popular Representation, N. Bancel, T. David, D. Thomas (ed., Routlege: New York-Abington, 2014, ss. 320. The book under review is a collection of articles presenting the functioning of the idea of the human race in the scientific, social and cultural backgrounds. The main purpose is to demonstrate how the concept of race have circulated from the late 18th century in scholarship as well as in popular reception. Thus the authors focus their attention on the so-called ethnological expositions (such as Negro or Eskimo Villages organized on the occasion of world‘s fairs, today known as “human zoo.” On the social level, this helped support the conviction of the supremacy of the white race.     Czy jesteśmy  „ludzkim zoo”? Recenzja: The Invention of Race. Scientific and Popular Representation, N. Bancel, T. David, D. Thomas (ed., Routlege: New York-Abington, 2014, ss. 320. Recenzowana praca zawiera zbiór artykułów poświęconych przedstawieniu funkcjonowania koncepcji podziału ludzkości na rasy na szerokim tle: naukowym, społecznym i kulturowym. Główny cel stanowi zobrazowanie procesu cyrkulacji idei rasy – od ujęć naukowych począwszy od końca XVIII w. aż do ukazania problemu na płaszczyźnie odbioru masowego. Tu obiektem zainteresowań badawczych stały się tzw. ekspozycje etnologiczne (np. wioski murzyńskie, eskimoskie organizowane przy okazji wystaw światowych, określane dzisiaj mianem „ludzkich zoo”. Płaszczyzna ta przyczyniła się do utrwalenia w świadomości społecznej poczucia supremacji białej rasy.

  3. Sub-apoptotic dosages of pro-oxidant vitamin cocktails sensitize human melanoma cells to NK cell lysis.

    Science.gov (United States)

    Tremante, Elisa; Santarelli, Lory; Lo Monaco, Elisa; Sampaoli, Camilla; Ingegnere, Tiziano; Guerrieri, Roberto; Tomasetti, Marco; Giacomini, Patrizio

    2015-10-13

    Alpha-tocopheryl succinate (αTOS), vitamin K3 (VK3) and vitamin C (ascorbic acid, AA) were previously shown to synergistically promote different death pathways in carcinoma cells, depending on their concentrations and combinations. Similar effects were observed herein in melanoma cells, although αTOS behaved as an antagonist. Interestingly, suboptimal cell death-inducing concentrations (1.5 μM αTOS/20 μM AA/0.2 μM VK3) effectively up-regulated activating Natural Killer (NK) cell ligands, including MICA (the stress-signaling ligand of the NKG2D receptor), and/or the ligands of at least one of the natural cytotoxicity receptors (NKp30, NKp44 and NKp46) in 5/6 melanoma cell lines. Only an isolated MICA down-regulation was seen. HLA class I, HLA class II, ULBP1, ULBP2, ULBP3, Nectin-2, and PVR displayed little, if any, change in expression. Ligand up-regulation resulted in improved lysis by polyclonal NK cells armed with the corresponding activating receptors. These results provide the first evidence for concerted induction of cell death by cell-autonomous and extrinsic (immune) mechanisms. Alarming the immune system much below the cell damage threshold may have evolved as a sensitive readout of neoplastic transformation and oxidative stress. Cocktails of vitamin analogues at slightly supra-physiological dosages may find application as mild complements of melanoma treatment, and in chemoprevention.

  4. Development of a RIA for clonidine and its comparison with the reference methods

    International Nuclear Information System (INIS)

    Arndts, D.; Staehle, H.; Foerster, H.J.

    1981-01-01

    A radioimmunoassay for clonidine was optimized by introducing, as a tracer ligand, an iodinized clonidine derivative specifically labeled with more than 500 Ci/mMol. The detection limit of clonidine was 10 pg/ml. The high assay specificity was demonstrated by a double isotope technique. The intraassay coefficient of variance (VK) was less than 4% for any concentration, the interassay VK did not exceed 8.3%. The assay reliability was increased when the plasma samples were diluted 1:5, prior to analysis, in normal human blood plasma, which was also used for the preparation of the calibration samples. In a comparative manner, this assay system was subjected to double-blind accuracy control tests, including all other reference methods so far described for clonidine analysis in blood plasma samples. The RIA technique presented here turned out to be the most sensitive and most reliable method, requiring, moreover, the smallest volumes of blood plasma (0.05 ml). This procedure was appropriate for routine tests, since one technician could perform 500 sample analyses a day. The advantages and disadvantages of each method are discussed

  5. Calculation of the thermal neutron flux depression in the loop VISA-1

    International Nuclear Information System (INIS)

    Martinc, R.

    1961-01-01

    Among other applications, the VISA-1 loop is to be used for thermal load testing of materials. For this type of testing one should know the maximum power generated in the loop. This power is determined from the maximum thermal neutron flux in the VK-5 channel and mean flux depression in the fissile component of the loop. Thermal neutron flux depression is caused by neutron absorption in the components of the loop, shape of the components and neutron leaking through gaps as well as properties of the surrounding medium of the core. All these parameters were taken into account for calculating the depression of thermal neutron flux in the VISA-1 loop. Two group diffusion theory was used. Fast neutron from the fission in the loop and slowed down were taken into account. Depression of the thermal neutron flux is expressed by depression factor which represents the ratio of the mean thermal neutron flux in the fissile loop component and the thermal neutron flux in the VK-5 without the loop. Calculation error was estimated and it was recommended to determine the depression factor experimentally as well [sr

  6. Radiation dosimetry of the reactor RA at Vinca, Measurements by isothermal calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    Radak, B; Markovic, V; Draganic, I [Institute of nuclear sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1961-12-15

    1. In this work we have made attempts to: - analyze the problems of reactor radiation dosimetry; - describe the solutions of this problem by the calorimetric method; - present our results of measurements of the reactor RA at Vinca, and to describe the method, apparatus and measuring equipment used. 2. Use was made of the isothermal calorimeter with thermistors which measured the absorbed dose rates within the range 10{sup 4}-10{sup 6} rad/h, with an accuracy of 2-5%. It was shown that the reactor radiation in which the thermal neutron flux is up to the order of magnitude 10{sup 12} n/cm{sup 2}/sec, and the integral thermal neutron flux up to about 10{sup 16} n/cm{sup 2} exerts no significant influence upon the working characteristics out of the thermistors used. 3. Determination was made of the absorbed dose distribution into the gamma-ray and the neutron contribution. For this purpose we used 3 materials: ordinary water, heavy water and graphite. 4. Measurements were carried out in two vertical experimental holes 'VK-5' and 'VK-6' of the reactor RA at several heights. It has been shown that the absorbed dose height distribution agrees well with the thermal flux distribution curve, although the relations of the absorbed doses of the two holes are not in accordance with the corresponding thermal flux relations (author)

  7. Radiation dosimetry of the reactor RA at Vinca, Measurements by isothermal calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    Radak, B; Markovic, V; Draganic, I [Institute of Nuclear Sciences Boris Kidric, Department of radiation chemistry, Vinca, Beograd (Serbia and Montenegro)

    1961-10-15

    In this work we have made attempts to: analyze the problems of reactor radiation dosimetry; describe the solution of this problem by the calorimetric method; present our results of measurements on the reactor RA at Vinca, and to describe the method, apparatus and measuring equipment used. Use was made of the isothermal calorimeter with thermistors which measured the absorbed dose rates within the range 10{sup 4}-10{sup 6} rad/h, with an accuracy of 2-5%. It was shown that the reactor radiation in which the thermal neutron flux is up to the order of magnitude 10{sup 12} n/cm{sup 2}/sec, and the integral thermal neutron flux up to about 10{sup 16} n/cm{sup 2} exerts no significant influence upon the working characteristics of the thermistors used. Determination was made of the absorbed dose distribution into the gamma-ray and the neutron contribution. For this purpose we used 3 materials: ordinary water, heavy water and graphite. Measurements were carried out in two vertical experimental holes 'VK-5' and 'VK-9' of the reactor RA at several heights. It has been shown that the absorbed dose height distribution agrees well with the thermal flux distribution curve, although the relations of the absorbed doses of the two holes are not in accordance with the corresponding thermal flux relations (author)

  8. EVALUATION OF CIRCUMSPOROZOITE PROTEIN OF Plasmodium vivax TO ESTIMATE ITS PREVALENCE IN OIAPOQUE , AMAPÁ STATE, BRAZIL, BORDERING FRENCH GUIANA

    Directory of Open Access Journals (Sweden)

    Margarete do Socorro Mendonça GOMES

    Full Text Available SUMMARY Malaria is a major health problem for people who live on the border between Brazil and French Guiana. Here we discuss Plasmodium vivax distribution pattern in the town of Oiapoque, Amapá State using the circumsporozoite (CS gene as a marker. Ninety-one peripheral blood samples from P. vivax patients have been studied. Of these, 64 individuals were from the municipality of Oiapoque (Amapá State, Brazil and 27 patients from French Guiana (August to December 2011. DNA extraction was performed, and a fragment of the P. vivax CS gene was subsequently analyzed using PCR/RFLP. The VK210 genotype was the most common in both countries (48.36% in Brazil and 14.28% in French Guiana, followed by the P. vivax-like (1.10% in both Brazil and French Guiana and VK247 (1.10% only in Brazil in single infections. We were able to detect all three CS genotypes simultaneously in mixed infections. There were no statistically significant differences either regarding infection site or parasitaemia among individuals with different genotypes. These results suggest that the same genotypes circulating in French Guiana are found in the municipality of Oiapoque in Brazil. These findings suggest that there may be a dispersion of parasitic populations occurring between the two countries. Most likely, this distribution is associated with prolonged and/or more complex transmission patterns of these genotypes in Brazil, bordering French Guiana.

  9. Application of the combined cycle LWR-gas turbine to PWR for NPP life extension, safety upgrade and improving economy

    International Nuclear Information System (INIS)

    Kuznetsov, Yu.N.; Gabaraev, B.A.

    2002-01-01

    Full text: The unconventional technology to extend the lifetime for the NPPs now in operation and make a construction of new NPPs cheaper - erection of steam-gas toppings to the nuclear power units - is considered in the paper. Application of the steam-gas toppings permits through reducing power of ageing reactors to extend lifetime of nuclear power unit, enhance its safety and at the same time to keep full load operation of NPP turbine and other balance-of-plant equipment. Proposed technology is examined for Russian VVER-440 reactor as an example and, also, as a pilot project, for Russian boiling VK-50 reactor now in operation Application of the steam-gas topping permits: extend the service life of ageing VVER-440 reactor by 10...15 years; use the turbine and other NPP balance-of-plant equipment at full power; increase the efficiency of combined cycle up to 48% and more; enhance the safety of NPP operation; utilize NPP balance-of-plant equipment after reactor decommissioning; perform the cost-effective operation in maneuvering modes; increase capacity factor of the plant. The construction of pilot project on the basis of the VK-50 reactor will allow not only to demonstrate new technology but also to attain appreciable economic effect including that obtained due to using the available reserves of the NPP turbine. (author)

  10. Rethinking fundamentals of enzyme action.

    Science.gov (United States)

    Northrop, D B

    1999-01-01

    Despite certain limitations, investigators continue to gainfully employ concepts rooted in steady-state kinetics in efforts to draw mechanistically relevant inferences about enzyme catalysis. By reconsidering steady-state enzyme kinetic behavior, this review develops ideas that allow one to arrive at the following new definitions: (a) V/K, the ratio of the maximal initial velocity divided by the Michaelis-Menten constant, is the apparent rate constant for the capture of substrate into enzyme complexes that are destined to yield product(s) at some later point in time; (b) the maximal velocity V is the apparent rate constant for the release of substrate from captured complexes in the form of free product(s); and (c) the Michaelis-Menten constant K is the ratio of the apparent rate constants for release and capture. The physiologic significance of V/K is also explored to illuminate aspects of antibiotic resistance, the concept of "perfection" in enzyme catalysis, and catalytic proficiency. The conceptual basis of congruent thermodynamic cycles is also considered in an attempt to achieve an unambiguous way for comparing an enzyme-catalyzed reaction with its uncatalyzed reference reaction. Such efforts promise a deeper understanding of the origins of catalytic power, as it relates to stabilization of the reactant ground state, stabilization of the transition state, and reciprocal stabilizations of ground and transition states.

  11. Experimental study of the interaction of two laser-driven radiative shocks at the PALS laser

    Czech Academy of Sciences Publication Activity Database

    Singh, R.L.; Stehlé, C.; Suzuki-Vidal, F.; Kozlová, Michaela; Larour, J.; Chaulagain, Uddhab P.; Clayson, T.; Rodriguez, R.; Gil, J.M.; Nejdl, Jaroslav; Krůs, Miroslav; Dostál, Jan; Dudžák, Roman; Barroso, P.; Acef, O.; Cotelo, M.; Velarde, P.

    2017-01-01

    Roč. 23, June (2017), s. 20-30 ISSN 1574-1818 R&D Projects: GA MŠk EE2.3.30.0057; GA MŠk EE2.3.20.0279; GA MŠk ED1.1.00/02.0061; GA MŠk(CZ) LM2015083 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 ; RVO:61389021 Keywords : radiative shocks * hydrodynamics laser-plasmas * spectroscopy * laboratory astrophysics Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 0.908, year: 2016

  12. Radiation dosimetry of the reactor RA at Vinca, Measurements by isothermal calorimeter

    International Nuclear Information System (INIS)

    Radak, B.; Markovic, V.; Draganic, I.

    1961-01-01

    1. In this work we have made attempts to: - analyze the problems of reactor radiation dosimetry; - describe the solutions of this problem by the calorimetric method; - present our results of measurements of the reactor RA at Vinca, and to describe the method, apparatus and measuring equipment used. 2. Use was made of the isothermal calorimeter with thermistors which measured the absorbed dose rates within the range 10 4 -10 6 rad/h, with an accuracy of 2-5%. It was shown that the reactor radiation in which the thermal neutron flux is up to the order of magnitude 10 12 n/cm 2 /sec, and the integral thermal neutron flux up to about 10 16 n/cm 2 exerts no significant influence upon the working characteristics out of the thermistors used. 3. Determination was made of the absorbed dose distribution into the gamma-ray and the neutron contribution. For this purpose we used 3 materials: ordinary water, heavy water and graphite. 4. Measurements were carried out in two vertical experimental holes 'VK-5' and 'VK-6' of the reactor RA at several heights. It has been shown that the absorbed dose height distribution agrees well with the thermal flux distribution curve, although the relations of the absorbed doses of the two holes are not in accordance with the corresponding thermal flux relations (author)

  13. Radiation dosimetry of the reactor RA at Vinca, Measurements by isothermal calorimeter

    International Nuclear Information System (INIS)

    Radak, B.; Markovic, V.; Draganic, I.

    1961-01-01

    In this work we have made attempts to: analyze the problems of reactor radiation dosimetry; describe the solution of this problem by the calorimetric method; present our results of measurements on the reactor RA at Vinca, and to describe the method, apparatus and measuring equipment used. Use was made of the isothermal calorimeter with thermistors which measured the absorbed dose rates within the range 10 4 -10 6 rad/h, with an accuracy of 2-5%. It was shown that the reactor radiation in which the thermal neutron flux is up to the order of magnitude 10 12 n/cm 2 /sec, and the integral thermal neutron flux up to about 10 16 n/cm 2 exerts no significant influence upon the working characteristics of the thermistors used. Determination was made of the absorbed dose distribution into the gamma-ray and the neutron contribution. For this purpose we used 3 materials: ordinary water, heavy water and graphite. Measurements were carried out in two vertical experimental holes 'VK-5' and 'VK-9' of the reactor RA at several heights. It has been shown that the absorbed dose height distribution agrees well with the thermal flux distribution curve, although the relations of the absorbed doses of the two holes are not in accordance with the corresponding thermal flux relations (author)

  14. Malaria vectors in ecologically heterogeneous localities of the Colombian Pacific region.

    Directory of Open Access Journals (Sweden)

    Nelson Naranjo-Díaz

    Full Text Available The Colombian Pacific region is second nationally in number of malaria cases reported. This zone presents great ecological heterogeneity and Anopheles species diversity. However, little is known about the current spatial and temporal distribution of vector species. This study, conducted in three ecologically different localities of the Pacific region, aimed to evaluate the composition and distribution of Anopheles species and characterize transmission intensity. A total of 4,016 Anopheles mosquitoes were collected representing seven species. The composition and dominant species differed in each locality. Three species were infected with malaria parasites: Anopheles darlingi and An. calderoni were infected with Plasmodium falciparum and An. nuneztovari with Plasmodium vivax VK210 and VK247. Annual EIRs varied from 3.5-7.2 infective bites per year. These results confirm the importance of the primary vector An. nuneztovari in areas disturbed by human interventions, of An. darlingi in deforested margins of humid tropical rainforest and An. albimanus and the suspected vector An. calderoni in areas impacted by urbanization and large-scale palm oil agriculture close to the coast. This constitutes the first report in the Colombia Pacific region of naturally infected An. darlingi, and in Colombia of naturally infected An. calderoni. Further studies should evaluate the epidemiological importance of An. calderoni in the Pacific region.

  15. Measurement of gamma radiation doses at the RA reactor by thermoluminescent dosemeters

    International Nuclear Information System (INIS)

    Prokic, M.

    1974-01-01

    This paper presents the procedures and gamma radiation doses measured at the exit from the horizontal experimental channel HK-5, vertical experimental channel VK-5 and in the thermal column of the RA reactor in Vinca. Measurement of gamma radiation dose in the mixed intense gamma and neutron radiation field was done by two types of thermoluminescent dosemeters, LiF (TLD-700) and CaF 2 (TLD-08). Gamma dose in the VK-5 was measured in the air and on the bottle filled with tissue-equivalent solution. Increase of the dose on the surface of the bottle was 2.3 compared to the gamma dose value in the air. Correction for the influence of neutrons having different energies was done by using the known sensitivity values of both TL dosemeter types for thermal, intermediate and fast neutrons. Results showed that the TLD-700 dosemeter contains 5 time more Li-6 isotopes (0.035%) than the declared value causing increased neutron sensitivity of this dosemeter. This paper includes numerical sensitivity data for neutrons of different energies for both types of TL dosemeters. Neutron sensitivity values for TLD-700 are related to LiF with 0.035% of Li-6 isotope. Result of measurement have also shown that the CaF 2 :Mn (TLD-08) thermoluminescent dosemeter is more suitable for gamma radiation dose measurements in mixed n-gamma fields with intensive neutron fluxes due to lower neutron sensitivity compared to TLD-700 [sr

  16. Cutting Capability Assessment of Highly Porous CBN Wheels by Microrelief of Plane Parts from 06Cr14Ni6Cu2MoWТi-Sh Steel Using Artificial Intelligence System

    Directory of Open Access Journals (Sweden)

    Soler Yakov Iosifovich

    2016-09-01

    Full Text Available The abrasive tools are the weakest element in the grinding process system, to which great attention is being paid by scientific and industrial collectives. Eleven highly porous wheels (HPWs were tested: CBN30 (B76, B107, B126, B151 100 OVK27-КF40; CBN30 B107 100 OVKC10-КF40; CBN30 B126 100(M, L VK27- (КF25, КF40; LKV50 (B107, B126 100 (M, O VK27-КF40. Assessment of the surface topography was carried out by roughness parameters Ra, Rmax, and Sm (GOST 25472-82, which were considered random variables with their position and dispersion measures. Two artificial intelligence systems – fuzzy logic (FL and neural networks (NN – were used to analyze the HPW’s cutting capability (CC. In both cases, the best CC was predicted for grinding with CBN30 (B76 and B151 100 OVK27-КF40 and LKV50 (B107 100 OVK27-KF40. In the absence of a training process in FL modeling, the assessments for the wheels with a low CC were less reliable.

  17. V(D)J recombination process and the Pre-B to immature B-cells transition are altered in Fanca-/- mice.

    Science.gov (United States)

    Nguyen, Thuy Vy; Pawlikowska, Patrycja; Firlej, Virginie; Rosselli, Filippo; Aoufouchi, Saïd

    2016-11-24

    B-lymphocytes in the bone marrow (BM) must generate a functional B-cell receptor and overcome the negative selection induced by reactivity with autoantigens. Two rounds of DNA recombination are required for the production of functional immunoglobulin heavy (Ig-HCs) and light (LCs) chains necessary for the continuation of B-lymphocyte development in the BM. Both rounds depend on the joint action of recombination activating gene-1 (RAG-1) and RAG-2 endonucleases with the DNA non-homologous end-joining pathway. Loss of the FANC gene leads to the chromosome breakage and cancer predisposition syndrome Fanconi anemia. Because the FANC proteins are involved in certain aspects of the recombination process, we sought to determine the impact of the FANC pathway on the Ig diversification process using Fanca -/- mice. In this work we demonstrated that Fanca -/- animals have a mild B-cell differentiation defect characterized by a specific alteration of the IgM - to IgM + transition of the B220 low B-cell population. Pre-B cells from Fanca -/- mice show evidence of impaired kLC rearrangement at the level of the Vk-Jk junction. Furthermore, Fanca -/- mice showed a skewed Vκ gene usage during formation of the LCs Vk-Jk junctions. Therefore, the Fanca protein appears as a yet unidentified factor involved in the primary diversification of Ig.

  18. V(D)J recombination process and the Pre-B to immature B-cells transition are altered in Fanca−/− mice

    Science.gov (United States)

    Nguyen, Thuy Vy; Pawlikowska, Patrycja; Firlej, Virginie; Rosselli, Filippo; Aoufouchi, Saïd

    2016-01-01

    B-lymphocytes in the bone marrow (BM) must generate a functional B-cell receptor and overcome the negative selection induced by reactivity with autoantigens. Two rounds of DNA recombination are required for the production of functional immunoglobulin heavy (Ig-HCs) and light (LCs) chains necessary for the continuation of B-lymphocyte development in the BM. Both rounds depend on the joint action of recombination activating gene-1 (RAG-1) and RAG-2 endonucleases with the DNA non-homologous end-joining pathway. Loss of the FANC gene leads to the chromosome breakage and cancer predisposition syndrome Fanconi anemia. Because the FANC proteins are involved in certain aspects of the recombination process, we sought to determine the impact of the FANC pathway on the Ig diversification process using Fanca−/− mice. In this work we demonstrated that Fanca−/− animals have a mild B-cell differentiation defect characterized by a specific alteration of the IgM− to IgM+ transition of the B220low B-cell population. Pre-B cells from Fanca−/− mice show evidence of impaired kLC rearrangement at the level of the Vk-Jk junction. Furthermore, Fanca−/− mice showed a skewed Vκ gene usage during formation of the LCs Vk-Jk junctions. Therefore, the Fanca protein appears as a yet unidentified factor involved in the primary diversification of Ig. PMID:27883081

  19. Reliability analysis of pipelines and pressure vessels at nuclear power plants

    International Nuclear Information System (INIS)

    Klemin, A.I.; Shiverskij, E.A.

    1979-01-01

    Reliability analysis of pipelines and pressure vessels at NPP is given. The main causes and failure mechanisms of these elements, the ways of reliability improvement and preventing of great damages are considered. The reliability estimation methods both according to the statistical operation data and under the conditions of absence of failure statistics are given. The main characteristics and actual reliability factors of pipelines and pressure vessels of three home NPP: the first in the world NPP, VK-50 and Beloyarsk NPP, are presented. From the start-up there were practically no failures of the pipelines and pressure vessels at the VK-50 pilot installation. The analysis of the operation experience of the first and second blocks of the Beloyarsk NPP, as well as the first in the world NPP, shows that the most part of failures of the pipelines and pressure vessels of these energy blocks with the channel reactors is connected with the coolant leakage at minority pipelines of a small diameter. The most part of failures at individual pipelines of the first and second blocks of the Beloyarsk NPP are connected with the leakages of stuffing boxes of switching off devices. It is noted that serious failures of large pipelines and pressure vessels at all home NPP under operation have not been observed

  20. Optimal operating parameters of the reactor oscillator in the channel of 6.5/10 MW reactor; Odredjivanje optimalnih radnih tacaka za reaktorski oscilator u kanalu na reaktoru 6,5/10 MW

    Energy Technology Data Exchange (ETDEWEB)

    Lolic, B; Zecevic, V [The Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Yugoslavia)

    1961-07-01

    Operating conditions for the reactor oscillator in the central vertical experimental channel (VK5) in the RA reactor were studied during 1960. Channel VK5 was chosen because the sensitivity of the reactor is highest in this case. The central vertical experimental channel is placed in the center of the core and its bottom is placed 200 mm from the bottom of the reactor core. Diameter of the channel is is 110 mm and its length 5706 mm. During operation of the reactor oscillator with total modulation of the reactor power, it is very important to determine the oscillator operating point and the oscillation amplitude in such a way to avoid any change in reactor power level. Positive reactivity changes originating from oscillations of the samples should be compensated by the negative reactivity changes so that the effect should be nil. Operating points of the reactor oscillator are in the middle of the straight part of the figure showing the reactivity change dependent on the position of the absorber.

  1. Methods for measuring nuclear properties of materials, Safety coefficient method and measurement of effective absorption coefficient of graphite by safety coefficient method; Razvijanje metoda merenja nuklearnih karakteristika materijala, Razrada metode koeficijenta opasnosti i merenje efektivnog apsorpcionog preseka grafita metodom koeficijenta opasnosti

    Energy Technology Data Exchange (ETDEWEB)

    Maglic, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1962-11-15

    Reactivity of a reactor depends on production, absorption and leaking of neutrons. Change of absorption causes reactivity change, and this fact is used for determining the neutron absorption cross section for the sample inserted in the reactor core. Method for determining the absorption cross section based on reactivity change is called method of safety coefficient. Measurements of neutron absorption cross section for graphite was done in the RA reactor vertical experimental channel VK-5. taking into account the results obtained for five types of graphite this method is considered to be reliable for use. Comparison of nuclear properties of different types of graphite was done as well. Reaktivnost reaktora zavisi od proizvodnje neutrona, apsorpcije i isticanja neutrona. Promena apsorpcije izaziva promene reaktivnosti reaktora pa se ova osobina koristi za odedjivanje neutronskog apsorpcionog preseka uzorka koji se unosi u reaktor. Metoda merenja apsorpcionog preseka na bazi promene reaktivnosti nazvana je metodom koeficijenta opasnosti. Merenje apsorpcionog preseka grafita uradjeno je na reaktoru RA u vertikalnom eksperimentalnom kanalu VK-5. S obzirom na rezultate koji su dobijeni za pet vrsta grafita moze se smatrati da je opravdano koriscenje ove metode. Izvrseno je i poredjenje nuklearnih osobina pomenutih tipova grafita.

  2. Measurements at the RA Reactor related to the VISA-2 project - Part 2, Measurement of neutron flux in VISA-2 channels; Fizicka merenja na reaktoru RA u vezi projekta VISA-2 - II deo, Merenje fluksa neutrona u kanalima VISA - 2

    Energy Technology Data Exchange (ETDEWEB)

    Markovic, H [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1962-07-15

    This report describes the task concerned with measurements of neutron flux in four experimental channels, called VISA-2 channels. All the channels are made of aluminium tubes, one is sealed to prevent contact of foils with heavy water, and are placed in the regular reactor lattice next to the central experimental channel VK-5. Measuring results, i.e. absolute values of neutron flux and flux distribution are needed for realisation of the VISA-2 project. Measurements of neutron flux are done by activation method. Activation foils are placed in cylindrical aluminium tubes specially prepared for this purpose and placed in VISA-2 channels. Foils are irradiated simultaneously for 5 hours at reactor power of 150 kW. Neutron flux distribution is determined by measuring the relative activity of cobalt foils. [Serbo-Croat] Ovaj izvestaj opisuje merenja neutronskog fluksa u cetiri eksperimentalna kanala VISA-2. Svi VISA-2 kanali nacinjeni su od aluminijuma, jedan je hermeticki zatvoren da folije koje se ozacuju ne dodju ukontakt sa teskom vodom i svi su smesteni neposredno pored centralnog eksperimentalnog kanala VK-5. Rezultati merenja, odnosno apsolutne vrednosti neutronskog fluksa i reposdele fluksa potrebni su za realizaciju projekta VISA-2. Mrerenja neutronskog fluksa izvreseno je aktivacionom tehnikom. Aktivacione folije smestene su u prethodno napravljene aluminijumske cevcice. Folije su ozracivane istovremeno pri snazi od 150 kW pe casova. Raspodela neutronskog fluksa odredjena je merenjem relativne aktivnosti folija od kobalta.

  3. Report of the Technology Service - Annex B; Prilog B - Izvestaj o radu tehnoloske sluzbe

    Energy Technology Data Exchange (ETDEWEB)

    Martinc, R; Cupac, S; Vukadin, Z; Stosic, T; Sotic, O [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1986-12-01

    This report describes the organisational structure of the technology service and its activities and tasks: routine control of reactor parameters and cooperation with the reactor users; development of methodology of reactor control and its application; control of heavy water and gas system operation; dosimetry measurements of contamination in the reactor building; technical aspects of radiation protection; decontamination and accident analysis. Separate chapter describes building of the reactor experimental loop for irradiation of fuel elements and construction materials, which will be placed in the central experimental channel VK-5. [Serbo-Croat] Ovaj izvestaj opisuje organizacionu semu tehnoloske sluzbe i zadatke koje ona obavlja: rutinska kontrola reaktorsko-fizickih parametara reaktora i saradnja sa korisnicima reaktora, razvojni rad na metodologiji kontrole reaktora i njegovog koriscenja, kontrola rezima rada teskovodnog i gasnog sistema, dozimetrija i tehnicka zastita od zracenja u zgradi reaktora, dekontaminacija i akcidentalna analiza. Posebno poglavlje opisuje izgradnju eksperimentale petlje za ozracivanje gorivnih elemenata i konstrukcionih materijala koja ce biti postavljena u centralnom eksperimentalnom kanalu VK-5 reaktora RA, koja je projektovana kao slozena eksperimentalna instalacija.

  4. Pharmacological Cyclophilin Inhibitors Prevent Intoxication of Mammalian Cells with Bordetella pertussis Toxin.

    Science.gov (United States)

    Ernst, Katharina; Eberhardt, Nina; Mittler, Ann-Katrin; Sonnabend, Michael; Anastasia, Anna; Freisinger, Simon; Schiene-Fischer, Cordelia; Malešević, Miroslav; Barth, Holger

    2018-05-01

    The Bordetella pertussis toxin (PT) is one important virulence factor causing the severe childhood disease whooping cough which still accounted for approximately 63,000 deaths worldwide in children in 2013. PT consists of PTS1, the enzymatically active (A) subunit and a non-covalently linked pentameric binding/transport (B) subunit. After endocytosis, PT takes a retrograde route to the endoplasmic reticulum (ER), where PTS1 is released into the cytosol. In the cytosol, PTS1 ADP-ribosylates inhibitory alpha subunits of trimeric GTP-binding proteins (Giα) leading to increased cAMP levels and disturbed signalling. Here, we show that the cyclophilin (Cyp) isoforms CypA and Cyp40 directly interact with PTS1 in vitro and that Cyp inhibitors cyclosporine A (CsA) and its tailored non-immunosuppressive derivative VK112 both inhibit intoxication of CHO-K1 cells with PT, as analysed in a morphology-based assay. Moreover, in cells treated with PT in the presence of CsA, the amount of ADP-ribosylated Giα was significantly reduced and less PTS1 was detected in the cytosol compared to cells treated with PT only. The results suggest that the uptake of PTS1 into the cytosol requires Cyps. Therefore, CsA/VK112 represent promising candidates for novel therapeutic strategies acting on the toxin level to prevent the severe, life-threatening symptoms caused by PT.

  5. In situ focus characterization by ablation technique to enable optics alignment at an XUV FEL source

    Czech Academy of Sciences Publication Activity Database

    Gerasimova, N.; Dziarzhytski, S.; Weigelt, H.; Chalupský, Jaromír; Hájková, Věra; Vyšín, Luděk; Juha, Libor

    2013-01-01

    Roč. 84, č. 6 (2013), "065104-1"-"065104-6" ISSN 0034-6748 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087; GA ČR(CZ) GAP108/11/1312; GA ČR GAP205/11/0571; GA MŠk EE2.3.30.0057; GA MŠk(CZ) LG13029; GA ČR GAP208/10/2302; GA ČR GA13-28721S Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057; AVČR(CZ) M100101221 Institutional support: RVO:68378271 Keywords : free electron lasers * laser ablation * laser beams * optical focusing * ultraviolet sources Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.584, year: 2013

  6. Stabilization of solitons under competing nonlinearities by external potentials

    Energy Technology Data Exchange (ETDEWEB)

    Zegadlo, Krzysztof B., E-mail: zegadlo@if.pw.edu.pl; Karpierz, Miroslaw A. [Faculty of Physics, Warsaw University of Technology, Warsaw, ul. Koszykowa 75, PL-00-662 Warszawa (Poland); Wasak, Tomasz; Trippenbach, Marek [Faculty of Physics, University of Warsaw, ul. Hoza 69, PL-00-681 Warszawa (Poland); Malomed, Boris A. [Department of Physical Electronics, School of Electrical Engineering, Faculty of Engineering, Tel Aviv University, Tel Aviv 69978 (Israel)

    2014-12-15

    We report results of the analysis for families of one-dimensional (1D) trapped solitons, created by competing self-focusing (SF) quintic and self-defocusing (SDF) cubic nonlinear terms. Two trapping potentials are considered, the harmonic-oscillator (HO) and delta-functional ones. The models apply to optical solitons in colloidal waveguides and other photonic media, and to matter-wave solitons in Bose-Einstein condensates loaded into a quasi-1D trap. For the HO potential, the results are obtained in an approximate form, using the variational and Thomas-Fermi approximations, and in a full numerical form, including the ground state and the first antisymmetric excited one. For the delta-functional attractive potential, the results are produced in a fully analytical form, and verified by means of numerical methods. Both exponentially localized solitons and weakly localized trapped modes are found for the delta-functional potential. The most essential conclusions concern the applicability of competing Vakhitov-Kolokolov (VK) and anti-VK criteria to the identification of the stability of solitons created under the action of the competing SF and SDF terms.

  7. The Effect of Solar Radiation on Molecular Nitrogen Emissions Originating in the Sunlit Thermosphere of Earth.

    Science.gov (United States)

    Hatfield, David Brooke

    The vibrational distribution of N_2 triplet states in the sunlit upper thermosphere of Earth is measured and modeled for the first time. A comparison is made between measured and theoretical limb column emission rates for bands originating from each upper vibrational level of C^3Pi_ u(v) and A^3Sigma_sp {u}{+}(v). The measured column emission rates for the Second Positive (2PG) bands are 3.2 (+/-0.2), 3.2 (+/-0.2) and 0.6 (+0.0,-0.4) kRayleighs for bands originating from C^3Pi_ u(0Kaplan (VK) bands originating from A^3Sigma_sp{u}{+ }(0measured 2PG intensities, but comparisons of predicted A^3Sigma_sp{u }{+}(v) column emissions to measured VK intensities are poor. Despite this discrepancy, the predicted sum of all A^3Sigma_sp {u}{+}(v) emission rates over all v compared well to the sum of measured VK intensities. This implies that the excitation rate into the N_2 triplet states is well understood, but that the cascade mechanisms are not as yet understood sufficiently to use dayglow N_2 band emissions as remote sensing probes of the sunlit thermosphere. The dayglow N_2 emissions are modeled by extending the existing auroral model to include resonance scattering of sunlight and replacing the precipitating auroral electrons with photoelectrons. The effects of solar resonance scattering on the X ^1Sigma_sp{g}{+}, A^3Sigma_sp{u }{+} and B^3Pi _ g states are presented as a function of A^3Sigma_sp{u}{+ } quenching rate. These theoretical predictions have important implications for the analysis of dayglow and auroral emissions. The effect of resonance scattering on the A^3Sigma_sp{u} {+} state is small, and will not be measurable under auroral conditions. This implies that the measured auroral vibrational population of the A^3 Sigma_sp{u}{+} state is valid for sunlit aurora. The population of B ^3Pi_ g(v = O) relative to other B^3Pi_ g(v) states is predicted to be enhanced by sunlight. A novel set of computer variables based on tree structures was created to manage the

  8. Biodiversity and community composition of sediment macrofauna associated with deep-sea Lophelia pertusa habitats in the Gulf of Mexico

    Science.gov (United States)

    Demopoulos, Amanda W.J.; Bourque, Jill R.; Frometa, Janessy

    2014-01-01

    Scleractinian corals create three-dimensional reefs that provide sheltered refuges, facilitate sediment accumulation, and enhance colonization of encrusting fauna. While heterogeneous coral habitats can harbor high levels of biodiversity, their effect on the community composition within nearby sediments remains unclear, particularly in the deep sea. Sediment macrofauna from deep-sea coral habitats (Lophelia pertusa) and non-coral, background sediments were examined at three sites in the northern Gulf of Mexico (VK826, VK906, MC751, 350–500 m depth) to determine whether macrofaunal abundance, diversity, and community composition near corals differed from background soft-sediments. Macrofaunal densities ranged from 26 to 125 individuals 32 cm−2 and were significantly greater near coral versus background sediments only at VK826. Of the 86 benthic invertebrate taxa identified, 16 were exclusive to near-coral habitats, while 14 were found only in background sediments. Diversity (Fisher’s α) and evenness were significantly higher within near-coral sediments only at MC751 while taxon richness was similar among all habitats. Community composition was significantly different both between near-coral and background sediments and among the three primary sites. Polychaetes numerically dominated all samples, accounting for up to 70% of the total individuals near coral, whereas peracarid crustaceans were proportionally more abundant in background sediments (18%) than in those near coral (10%). The reef effect differed among sites, with community patterns potentially influenced by the size of reef habitat. Taxon turnover occurred with distance from the reef, suggesting that reef extent may represent an important factor in structuring sediment communities near L. pertusa. Polychaete communities in both habitats differed from other Gulf of Mexico (GOM) soft sediments based on data from previous studies, and we hypothesize that local environmental conditions found near L

  9. Biodiversity and community composition of sediment macrofauna associated with deep-sea Lophelia pertusa habitats in the Gulf of Mexico

    Science.gov (United States)

    Demopoulos, Amanda W. J.; Bourque, Jill R.; Frometa, Janessy

    2014-11-01

    Scleractinian corals create three-dimensional reefs that provide sheltered refuges, facilitate sediment accumulation, and enhance colonization of encrusting fauna. While heterogeneous coral habitats can harbor high levels of biodiversity, their effect on the community composition within nearby sediments remains unclear, particularly in the deep sea. Sediment macrofauna from deep-sea coral habitats (Lophelia pertusa) and non-coral, background sediments were examined at three sites in the northern Gulf of Mexico (VK826, VK906, MC751, 350-500 m depth) to determine whether macrofaunal abundance, diversity, and community composition near corals differed from background soft-sediments. Macrofaunal densities ranged from 26 to 125 individuals 32 cm-2 and were significantly greater near coral versus background sediments only at VK826. Of the 86 benthic invertebrate taxa identified, 16 were exclusive to near-coral habitats, while 14 were found only in background sediments. Diversity (Fisher's α) and evenness were significantly higher within near-coral sediments only at MC751 while taxon richness was similar among all habitats. Community composition was significantly different both between near-coral and background sediments and among the three primary sites. Polychaetes numerically dominated all samples, accounting for up to 70% of the total individuals near coral, whereas peracarid crustaceans were proportionally more abundant in background sediments (18%) than in those near coral (10%). The reef effect differed among sites, with community patterns potentially influenced by the size of reef habitat. Taxon turnover occurred with distance from the reef, suggesting that reef extent may represent an important factor in structuring sediment communities near L. pertusa. Polychaete communities in both habitats differed from other Gulf of Mexico (GOM) soft sediments based on data from previous studies, and we hypothesize that local environmental conditions found near L. pertusa

  10. Do axes of rotation change during fast and slow motions of the dominant and non-dominate arms?

    Directory of Open Access Journals (Sweden)

    Pagano Christopher

    2011-12-01

    Full Text Available The velocity-dependent change in rotational axes observed in the control of unconstrained 3D arm rotations for the dominant limb seems to conform to a minimum inertia resistance (MIR principle [4]. This is an efficient biomechanical solution that allows for the reduction of torques. We tested whether the MIR principle governs rotating movement when subjects were instructed to maintain the shoulder-elbow joint axis close to horizontal for both dominant and non dominant limbs. Subjects (n=12 performed externalinternal rotations of their arms in two angular positions (90° versus 150°, two angular velocities (slow (S versus fast (F, and in two sensory conditions (kinaesthetic (K versus visuo- kinaesthetic (VK. We expected more scattered displacements of the rotation axis employed for rotating the non dominant limb compared to the dominant limb. The results showed that the rotational axis of a multiarticulated limb coincided with SH-EL at S & F velocity for both arms.

  11. Robust Stability and H∞ Control of Uncertain Piecewise Linear Switched Systems with Filippov Solutions

    DEFF Research Database (Denmark)

    Ahmadi, Mohamadreza; Mojallali, Hamed; Wisniewski, Rafal

    2012-01-01

    This paper addresses the robust stability and control problem of uncertain piecewise linear switched systems where, instead of the conventional Carathe ́odory solutions, we allow for Filippov solutions. In other words, in contrast to the previous studies, solutions with infinite switching in fini...... algorithm is proposed to surmount the aforementioned matrix inequality conditions....... time along the facets and on faces of arbitrary dimensions are also taken into account. Firstly, based on earlier results, the stability problem of piecewise linear systems with Filippov solutions is translated into a number of linear matrix inequality feasibility tests. Subsequently, a set of matrix...... inequalities are brought forward, which determines the asymptotic stability of the Filippov solutions of a given uncertain piecewise linear system. Afterwards, bilinear matrix inequality conditions for synthesizing a robust controller with a guaranteed H∞ per- formance are formulated. Finally, a V-K iteration...

  12. Non-electrical Application of Nuclear Energy: Some General Issues and Prospects

    International Nuclear Information System (INIS)

    Kuznetsov, Yu. N.

    2008-01-01

    Co-generation power plants (CPP) are widely used in Russia with its harsh climate and low temperatures. The EU directive encourages further development of co-generation plants as the most efficient and rapid way of energy saving and reduction of CO 2 emissions. Nuclear power facilities can be used efficiently at co-generation power plants. The author discuss requirements for nuclear co-generation power plants (NCPP) from the viewpoint of power level, safety and economics, and look into various approaches towards development of dedicated reactor systems and nuclear units for NCPP so as to meet these requirements. It is shown that the most effective approach is consistent implementation of the principles of design simplicity and passive operation of the main reactors systems and components. The implementation of this approach is illustrated on the example of two Russian developments - VK-300 (Russian SBWR) and RUTA (a pool-type facility). The paper describes in detail the findings of a feasibility study on a project of a co-generation nuclear plant in the Arkhangelsk region of Russia. The CNPP's total power is planned to be 1000 MW(e) and district-heating heat production capacity 1600 Gcal /h. The study has proved the feasibility of NCPP construction in the Arkhangelsk region in terms of engineering solutions, economics and, importantly, from the viewpoint of social benefits. The prospects for NCPP development in Russia are analyzed. Considering the increasing global trend towards the use of desalination and the stable growth of demand for such techniques, Russia has been paying great attention to this technology.The authors look into the prospects of NCPP application for sea water desalination. A Nuclear Desalination Complex (NDC) with VK-300 reactor facility is described as an illustration. The most attractive option is coupling of a VK-300 energy source with distillation desalination units operating based on a multi-stage evaporation principle (MED). This is an

  13. Downhill Domination in Graphs

    Directory of Open Access Journals (Sweden)

    Haynes Teresa W.

    2014-08-01

    Full Text Available A path π = (v1, v2, . . . , vk+1 in a graph G = (V,E is a downhill path if for every i, 1 ≤ i ≤ k, deg(vi ≥ deg(vi+1, where deg(vi denotes the degree of vertex vi ∈ V. The downhill domination number equals the minimum cardinality of a set S ⊆ V having the property that every vertex v ∈ V lies on a downhill path originating from some vertex in S. We investigate downhill domination numbers of graphs and give upper bounds. In particular, we show that the downhill domination number of a graph is at most half its order, and that the downhill domination number of a tree is at most one third its order. We characterize the graphs obtaining each of these bounds

  14. Radiation field characterization and shielding studies for the ELI Beamlines facility

    Czech Academy of Sciences Publication Activity Database

    Ferrari, A.; Amato, E.; Margarone, Daniele; Cowan, T.; Korn, Georg

    2013-01-01

    Roč. 272, May (2013), s. 138-144 ISSN 0169-4332 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087; GA ČR(CZ) GAP205/11/1165 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; AVČR(CZ) M100101210 Institutional support: RVO:68378271 Keywords : particle acceleration from laser-matter interaction * shielding * Monte Carlo * radiation protection Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013

  15. The ELIMED transport and dosimetry beamline for laser-driven ion beams

    Czech Academy of Sciences Publication Activity Database

    Romano, F.; Schillaci, F.; Cirrone, G.A.P.; Cuttone, G.; Scuderi, Valentina; Allegra, L.; Amato, A.; Amico, A.; Candiano, G.; De Luca, G.; Gallo, G.; Giordanengo, S.; Guarachi, L.F.; Korn, Georg; Larosa, G.; Leanza, R.; Manna, R.; Marchese, V.; Marchetto, F.; Margarone, Daniele; Milluzzo, G.; Petringa, G.; Pipek, J.; Pulvirenti, S.; Rizzo, D.; Sacchi, R.; Salamone, S.; Sedita, M.; Vignati, A.

    2016-01-01

    Roč. 829, Sep (2016), s. 153-158 ISSN 0168-9002 R&D Projects: GA MŠk LQ1606; GA MŠk EF15_008/0000162; GA MŠk EE2.3.30.0057; GA ČR(CZ) GA15-02964S; GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : laser-driven beams * beam handling Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.362, year: 2016

  16. Ra reactor operation plan for 1976 - Annex 6

    International Nuclear Information System (INIS)

    Martinc, R.

    1976-01-01

    Contrary to previous years the RA reactor operation plan for 1976 is conditioned by more uncertainties than ever for the following reasons. It is planned for February to repair the components in order to eliminate the consequences of leaking from the vertical experimental channel VK-4 which happened in december 1975. Apart from this, measurements related to transfer of the core to highly enriched fuel under minimum power are foreseen to be performed in February. In April, it would be indispensable to locate the point of He gas leaking and its prevention. Core transfer to highly enriched fuel is planned for April for testing of the fuel elements under operating conditions and step by step increase of the power density up to the nominal power. Complete plan for core transfer would be available by the end of February 1976. It is planned to make-up for the mentioned delays from May-December 1976 [sr

  17. Testing the algorithms for automatic identification of errors on the measured quantities of the nuclear power plant. Verification tests

    International Nuclear Information System (INIS)

    Svatek, J.

    1999-12-01

    During the development and implementation of supporting software for the control room and emergency control centre at the Dukovany nuclear power plant it appeared necessary to validate the input quantities in order to assure operating reliability of the software tools. Therefore, the development of software for validation of the measured quantities of the plant data sources was initiated, and the software had to be debugged and verified. The report contains the proposal for and description of the verification tests for testing the algorithms of automatic identification of errors on the observed quantities of the NPP by means of homemade validation software. In particular, the algorithms treated serve the validation of the hot leg temperature at primary circuit loop no. 2 or 4 at the Dukovany-2 reactor unit using data from the URAN and VK3 information systems, recorded during 3 different days. (author)

  18. Fluorescent Nanodiamonds Embedded in Biocompatible Translucent Shells

    Czech Academy of Sciences Publication Activity Database

    Řehoř, Ivan; Šlegerová, Jitka; Kučka, Jan; Proks, Vladimír; Petráková, Vladimíra; Adam, M.-P.; Treussart, F.; Turner, S.; Bals, S.; Šácha, Pavel; Ledvina, Miroslav; Wen, A. M.; Steinmetz, N. F.; Cígler, Petr

    2014-01-01

    Roč. 10, č. 6 (2014), s. 1106-1115 ISSN 1613-6810 R&D Projects: GA ČR GAP108/12/0640; GA MŠk(CZ) LH11027; GA ČR GBP208/12/G016 Grant - others:Seventh Framework Program(XE) FP7-262348; OPPK(XE) CZ.2.16/3.1.00/24016; OP VK(XE) CZ.1.07/2.3.00/20.0306 Institutional support: RVO:61388963 ; RVO:61389013 ; RVO:68378271 ; RVO:61389005 Keywords : biocompatibilization * fluorescent nanodiamonds * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 8.368, year: 2014

  19. Decentralized scheduling algorithm to improve the rate of production without increasing the stocks of intermediates; Zaiko wo fuyasu kotonaku seisan sokudo wo kojo saseru jiritsu bunsangata sukejuringu arugorizumu

    Energy Technology Data Exchange (ETDEWEB)

    Takeda, Kazuhiro; Shiigi, Daisuke; Tsuge, Yoshifumi; Matsuyama, Hisayoshi [Kyushu University, Fukuoka (Japan). Department of Chemical Engineering

    1999-03-10

    In a factory with a multi-stage production system, push-type scheduling methods can hardly improve the production rate without increasing the stocks of intermediates. For products whose specifications are known before their orders, a pull-type scheduling method named Kanban system has been developed, and has succeeded to improve the production rate without increasing the stocks of intermediates. The Kanban system, however, is not applicable to custom-made products whose specifications are not known before their orders. In this paper, a 'Virtual Kanban (VK) system' is presented as a pull-type scheduling method which is applicable to custom-made products, and its usefulness is demonstrated by simulation of an application specific integrated circuit manufacturing facility. (author)

  20. Thermoelectric Properties in the TiO2/SnO2 System

    Science.gov (United States)

    Dynys, F.; Sayir, A.; Sehirlioglu, A.; Berger, M.

    2009-01-01

    Nanotechnology has provided a new interest in thermoelectric technology. A thermodynamically driven process is one approach in achieving nanostructures in bulk materials. TiO2/SnO2 system exhibits a large spinodal region with exceptional stable phase separated microstructures up to 1400 C. Fabricated TiO2/SnO2 nanocomposites exhibit n-type behavior with Seebeck coefficients greater than -300 .V/K. Composites exhibit good thermal conductance in the range of 7 to 1 W/mK. Dopant additions have not achieved high electrical conductivity (<1000 S/m). Formation of oxygen deficient composites, TixSn1-xO2-y, can change the electrical conductivity by four orders of magnitude. Achieving higher thermoelectric ZT by oxygen deficiency is being explored. Seebeck coeffcient, thermal conductivity, electrical conductance and microstructure will be discussed in relation to composition and doping.

  1. Power Generation by Zinc Antimonide Thin Film under Various Load Resistances at its Critical Operating Temperature

    DEFF Research Database (Denmark)

    Mir Hosseini, Seyed Mojtaba; Rezaniakolaei, Alireza; Rosendahl, Lasse Aistrup

    slightly reduces during unload conditions, although it is expected that by eliminating load in each step, the initial amount of voltage exactly repeats. Similar behavior is observed for Seebeck coefficient distribution versus time of working particularly in lower load resistances. Based on variation...... thin films operating under different load resistances at around its critical operating temperature, 400 ᵒC. The thermoelement is subjected to constant hot side temperature and to room temperature at the cold junction in order to measure the thin film TEG’s sample performance. The nominal loads equal...... to 10, 15, 20, 25, 30, 35, 40, 45… 175, and also 200 Ohms were applied. The results show that the value of the Seebeck coefficient is 0.0002 [V/K] for the specimen, which is in agreement with quantities of other zinc antimonide bulks materials in literature. The results also show that the voltage...

  2. Role of Torque teno sus viruses during co-infection with other swine pathogens

    OpenAIRE

    Aramouni, Mario

    2012-01-01

    Los Torque teno sus virus (TTSuV) son virus ADN que pertenecen a la familia Anelloviridae y que infectan los cerdos. Son virus con genoma circular, de cadena simple, y hasta hoy se han descrito 4 especies diferentes: TTSuV1a y TTSuV1b, miembros del género Iotatorquevirus, y TTSuV2 y TTSuVk2b, miembros del género Kappatorquevirus. En los últimos años se ha sugerido que los TTSuVs podrían ser agentes que actuarían conjuntamente con otros patógenos y participar como posibles desencadenadores de ...

  3. Electronic and Transport Properties of LaNi4Sb12 Skutterudite: Modified Becke-Johnson Approach

    Science.gov (United States)

    Bhat, Tahir Mohiuddin; Singh, Srishti; Gupta, Dinesh C.

    2018-05-01

    We carried out an ab initio study of structural, electronic, thermodynamic, and thermoelectric properties of the lanthanum-filled skutterudite, LaNi4Sb12. Generalized gradient approximation and modified Becke-Johnson potentials were employed for the exchange-correlation potential. The electronic structure calculations display the metallic behavior of the compound. The alloy offers low lattice thermal conductivity along with a high Seebeck coefficient with a value of - 158 (μVK-1) at room temperature. The effect of high pressure and temperature on thermal properties like thermal expansion coefficient, heat capacity, and Grüneisen parameter are also investigated by means of a quasi-harmonic Debye model. The large Seebeck coefficient and high power factor exhibited by LaNi4Sb12 make it an attractive candidate for thermoelectric materials.

  4. Laser-induced damage threshold tests of ultrafast multilayer dielectric coatings in various environmental conditions relevant for operation of ELI beamlines laser systems

    Czech Academy of Sciences Publication Activity Database

    Ďurák, Michal; Velpula, Praveen K.; Kramer, Daniel; Cupal, Josef; Medřík, Tomáš; Hřebíček, Jan; Golasowski, Jiří; Peceli, Davorin; Kozlová, Michaela; Rus, Bedřich

    2017-01-01

    Roč. 56, č. 1 (2017), s. 1-6, č. článku 011024. ISSN 0091-3286 R&D Projects: GA MŠk LQ1606; GA MŠk LM2015065; GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 Laser Sys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : Peta-watt class laser s * ultrafast laser s * behavior at different vacuum levels * cleaning treatment Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.082, year: 2016

  5. Position in Educational Activity and Empathy Ability in Adolescence and Teenage Years

    Directory of Open Access Journals (Sweden)

    Klimenkova E.N.

    2017-11-01

    Full Text Available The article is devoted to the study of the relationship between empathy and learning activity position in adolescence and young. We present the results of empirical research of 78 assisting professions students (psychologists and teachers and 42 Polytechnic College students with the techniques of studying empathic abilities (questionnaire of the Interpersonal Reactivity Index of M. Davis in the adaptation of TD Karyagina, projective technique "Consolation Strategies" Vasiluk and EV Sheryagina, processing in the modification of AB Kholmogorova, and the the subject position (the questionnaire "Subject Position in studying activity" by Yu.V. Zaretsky and V.K. Zaretsky. Students less likely to use emotional support, the objective position is more clearly expressed and less subjective in relation to learning activity. Subjects with a subjective learning activity position have stronger empathy, perspective taking and the ability to provide support. Subjects with a subject position often use emotional support.

  6. Advanced scheme for high-yield laser driven nuclear reactions

    Czech Academy of Sciences Publication Activity Database

    Margarone, Daniele; Picciotto, A.; Velyhan, Andriy; Krása, Josef; Kucharik, M.; Mangione, A.; Szydlowsky, A.; Malinowska, A.; Bertuccio, G.; Shi, Y.; Crivellari, M.; Ullschmied, Jiří; Bellutti, P.; Korn, Georg

    2015-01-01

    Roč. 57, č. 1 (2015), s. 014030 ISSN 0741-3335 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional research plan: CEZ:AV0Z2043910 Institutional support: RVO:68378271 ; RVO:61389021 Keywords : laser plasma * nuclear reaction * laser fusion Subject RIV: BL - Plasma and Gas Discharge Physics; BH - Optics, Masers, Lasers (UFP-V) Impact factor: 2.404, year: 2015

  7. ELIMED, future hadrontherapy applications of laser-accelerated beams

    Czech Academy of Sciences Publication Activity Database

    Cirrone, Giuseppe A.P.; Carpinelli, M.; Cuttone, G.; Gammino, S.; Jia, S.B.; Korn, Georg; Maggiore, Mario; Manti, L.; Margarone, Daniele; Prokůpek, Jan; Renis, M.; Romano, F.; Schillaci, Francesco; Tomasello, B.; Torrisi, L.; Tramontana, A.; Velyhan, Andriy

    2013-01-01

    Roč. 730, Dec (2013), s. 174-177 ISSN 0168-9002. [International Conference on Radiation Effects on Semiconductor Materials, Detectors and Devices /9./(RESMDD). Florence, 09.10.2012-12.10.2012] R&D Projects: GA ČR(CZ) GAP205/11/1165; GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : laser acceleration * cancer treatment * particle selection * Monte Carlo simulation * beam handling Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.316, year: 2013

  8. Application of the combined cycle LWR-gas turbine to PWR for NPP life extension, safety upgrade and improving economy

    International Nuclear Information System (INIS)

    Kuznetsov, Yu. N.; Lisitsa, F. D.; Smirnov, V. G.

    2000-01-01

    The unconventional technology to extend the lifetime for the NPPs now in operation and make a construction of new NPPs cheaper three-quarter erection of steam-gas toppings to the nuclear power units three-quarter is considered in the paper. Application of the steam-gas toppings permits through reducing power of aging reactors to extend lifetime of nuclear power unit, enhance its safety and at the same time to keep full load operation of NPP turbine and other balance-of-plant equipment. Proposed technology is examined for Russian VVER-440 reactor as an example and, also, as a pilot project. for Russian boiling VK-50 reactor now in operation. Heat flow sheets of the power plants, their parameters and economic problems are discussed. (author)

  9. Amorphous to crystalline phase transition in carbon induced by intense femtosecond x-ray free-electron laser pulses

    Czech Academy of Sciences Publication Activity Database

    Gaudin, J.; Peyrusse, O.; Chalupský, Jaromír; Toufarová, Martina; Vyšín, Luděk; Hájková, Věra; Sobierajski, R.; Burian, Tomáš; Dastjani-Farahani, S.; Graf, A.; Amati, M.; Gregoratti, L.; Hau-Riege, S.P.; Hoffmann, G.; Juha, Libor; Krzywinski, J.; London, R.A.; Moeller, S.; Sinn, H.; Schorb, S.; Störmer, M.; Tschentscher, T.; Vorlíček, Vladimír; Vu, H.; Bozek, J.; Bostedt, C.

    2012-01-01

    Roč. 86, č. 2 (2012), "024103-1"-"024103-7" ISSN 1098-0121 R&D Projects: GA ČR(CZ) GAP108/11/1312; GA ČR GAP205/11/0571; GA ČR GAP208/10/2302; GA AV ČR IAAX00100903; GA MŠk EE.2.3.20.0087 Grant - others:OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional research plan: CEZ:AV0Z10100523 Keywords : amorphous carbon * phase transition * graphitization * x-ray laser * free-electron laser Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.767, year: 2012

  10. Fluence scan: an unexplored property of a laser beam

    Czech Academy of Sciences Publication Activity Database

    Chalupský, Jaromír; Burian, Tomáš; Hájková, Věra; Juha, Libor; Polcar, T.; Gaudin, J.; Nagasono, M.; Sobierajski, R.; Yabashi, M.; Krzywinski, J.

    2013-01-01

    Roč. 21, č. 22 (2013), s. 26363-26375 ISSN 1094-4087 R&D Projects: GA ČR(CZ) GAP108/11/1312; GA ČR GA13-28721S; GA MŠk(CZ) LG13029; GA ČR GAP208/10/2302; GA ČR GAP205/11/0571; GA MŠk EE2.3.30.0057 Grant - others:AVČR(CZ) M100101221; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : free-electron lasers (FELs) * UV * EUV * x-ray lasers * laser beam characterization * F-scan Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.525, year: 2013

  11. Power distribution monitoring system in the boiling water cooled reactor core

    International Nuclear Information System (INIS)

    Leshchenko, Yu.I.; Sadulin, V.P.; Semidotskij, I.I.

    1987-01-01

    Consideration is being given to the system of physical power distribution monitoring, used during several years in the VK-50 tank type boiling water cooled reactor. Experiments were conducted to measure the ratios of detector prompt and activation currents, coefficients of detector relative sensitivity with respect to neutrons and effective cross sections of 103 Rh interaction with thermal and epithermal neutrons. Mobile self-powered detectors (SPD) with rhodium emitters are used as the power distribution detectors in the considered system. All detectors move simultaneously with constant rate in channels, located in fuel assembly central tubes, when conducting the measurements. It is concluded on the basis of analyzing the obtained data, that investigated system with calibrated SPD enables to monitor the absolute power distribution in fuel assemblies under conditions of boiling water cooled reactor and is independent of thermal engineering measurements conducted by in core instruments

  12. Analysis of laser-generated plasma ionizing radiation by synthetic single crystal diamond detectors

    Czech Academy of Sciences Publication Activity Database

    Marinelli, M.; Milani, E.; Prestopino, G.; Verona, C.; Verona-Rinati, G.; Cutroneo, M.; Torrisi, L.; Margarone, Daniele; Velyhan, Andriy; Krása, Josef; Krouský, Eduard

    2013-01-01

    Roč. 272, May (2013), s. 104-108 ISSN 0169-4332 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087; GA MŠk(CZ) 7E09092; GA MŠk(CZ) LC528 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OPVK 3 Laser Zdroj(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; 7FP LASERLAB-EUROPE(XE) 228334 Program:EE; FP7 Institutional support: RVO:68378271 Keywords : single crystal diamond * diamond detector * laser-generated plasma * ionizing radiation * time-of-fight spectrometer Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013

  13. A radiation condition in some regions with more pronounced effect of the Chernobyl accident

    International Nuclear Information System (INIS)

    Ivanov, I.V.; Ivanov, I.M.

    1993-01-01

    The radioecological condition of the Devin region situated in the Rodopes mountain (Bulgaria) has been investigated for the period October 1992 - March 1993. It is believed that the Rodopes were more significantly affected by the Chernobyl accident in comparison with other regions of Bulgaria. Some regions near Kozloduy NPP have been chosen for comparing, for which there are more detailed investigations of the anthropogenic radiation effects. Analysis of the background radiation is made, specific soil and water samples are tested. The alterations in the radiation conditions of the Devin region are analysed. Some conclusions and predictions for the trends in further alterations of the background radiation are made. As a result a draft regional program for environment protection reclamation is prepared. (V.K.)

  14. A radiation condition in some regions with more pronounced effect of the Chernobyl accident. Otnosno radiatsionnoto systoyanie v nyakoi rajoni s po-izrazeno vliyanie ot avariyata v Chernobil i ot AETS 'Kozloduj'

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, I V; Ivanov, I M

    1993-01-01

    The radioecological condition of the Devin region situated in the Rodopes mountain (Bulgaria) has been investigated for the period October 1992 - March 1993. It is believed that the Rodopes were more significantly affected by the Chernobyl accident in comparison with other regions of Bulgaria. Some regions near Kozloduy NPP have been chosen for comparing, for which there are more detailed investigations of the anthropogenic radiation effects. Analysis of the background radiation is made, specific soil and water samples are tested. The alterations in the radiation conditions of the Devin region are analysed. Some conclusions and predictions for the trends in further alterations of the background radiation are made. As a result a draft regional program for environment protection reclamation is prepared. (V.K.).

  15. Spectroscopic characterization of Yb.sup.3+./sup. - doped laser materials at cryogenic temperatures

    Czech Academy of Sciences Publication Activity Database

    Körner, J.; Jambunathan, Venkatesan; Hein, J.; Seifert, R.; Loeser, M.; Siebold, M.; Schramm, U.; Sikocinski, Pawel; Lucianetti, Antonio; Mocek, Tomáš; Kaluza, M.C.

    2014-01-01

    Roč. 116, č. 1 (2014), s. 75-81 ISSN 0946-2171 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : ytterbium * YAG * LuAG * CaF2 * FP15-glass * absorption * emission * gain * cross-section * cryogenic temperature Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.856, year: 2014 http://dx.doi.org/10.1007/s00340-013-5650-8

  16. Dicty_cDB: Contig-U05027-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available au_evk_975886 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE814922 ) EST_scau_e...vk_965902 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE812759 ) EST_scau_evk_973993 scauevk mixed_tissue Sebaste...s... 60 1e-04 1 ( GE812758 ) EST_scau_evk_963625 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE8089...60 ) EST_scau_evk_977800 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE808959 )... EST_scau_evk_962440 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE806311 ) EST_scau_evk_971428 scauevk mixed_tissue Sebaste

  17. Efficient neutron production from sub-nanosecond laser pulse accelerating deuterons on target front side

    Czech Academy of Sciences Publication Activity Database

    Klír, Daniel; Krása, Josef; Cikhardt, Jakub; Dudžák, Roman; Krouský, Eduard; Pfeifer, Miroslav; Řezáč, Karel; Sila, O.; Skála, Jiří; Ullschmied, Jiří; Velyhan, Andriy

    2015-01-01

    Roč. 22, č. 9 (2015), s. 093117-093117 ISSN 1070-664X R&D Projects: GA ČR GAP205/12/0454; GA MŠk(CZ) LG13029; GA MŠk LM2010014; GA MŠk EE2.3.20.0279 Grant - others:LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : plasma * femtosecond laser * nuclear-fusion * ion-beams * hot-electrons Subject RIV: BL - Plasma and Gas Discharge Physics; BL - Plasma and Gas Discharge Physics (FZU-D) OBOR OECD: Fluids and plasma physics (including surface physics); Fluids and plasma physics (including surface physics) (FZU-D) Impact factor: 2.207, year: 2015 http://scitation.aip.org/content/aip/journal/pop/22/9/10.1063/1.4931460

  18. Imaging of transfection and intracellular release of intact, non-labeled DNA using fluorescent nanodiamonds

    Czech Academy of Sciences Publication Activity Database

    Petráková, Vladimíra; Benson, Veronika; Bunček, M.; Fišerová, Anna; Ledvina, Miroslav; Štursa, Jan; Cígler, Petr; Nesládek, M.

    2016-01-01

    Roč. 8, č. 23 (2016), s. 12002-12012 ISSN 2040-3364 R&D Projects: GA MZd(CZ) NV15-33094A; GA MŠk LM2015056 Grant - others:OP VK(XE) CZ.1.07/2.3.00/20.0306 Institutional support: RVO:68378271 ; RVO:61388971 ; RVO:61389005 ; RVO:61388963 Keywords : single-particle tracking * resonance energy-transfer * sirna delivery * gene delivery * correlation spectroscopy * endosomal escape * mass-production * drug-delivery * quantum dots * living cells Subject RIV: BM - Solid Matter Physics ; Magnetism; CC - Organic Chemistry (UOCHB-X); EE - Microbiology, Virology (MBU-M); BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 7.367, year: 2016

  19. Pilot experiment on proton acceleration using the 25 TW femtosecond Ti:Sapphire laser system at PALS

    Czech Academy of Sciences Publication Activity Database

    Prokůpek, Jan; Margarone, Daniele; Hřebíček, Jan; Krůs, Miroslav; Velyhan, Andriy; Pšikal, J.; Pfeifer, Miroslav; Mocek, Tomáš; Krása, Josef; Ullschmied, Jiří; Jungwirth, Karel; Korn, Georg; Rus, Bedřich

    2012-01-01

    Roč. 690, Oct (2012), s. 48-52 ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk ED2.1.00/01.0027; GA ČR(CZ) GAP205/11/1165; GA MŠk EE.2.3.20.0087; GA MŠk LM2010014 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; AVČR(CZ) M100101210 Institutional research plan: CEZ:AV0Z10100523; CEZ:AV0Z20430508 Keywords : laser driven acceleration * proton beams * ion diagnostics Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.142, year: 2012

  20. Photothermal method for absorption measurements in anisotropic crystals

    Czech Academy of Sciences Publication Activity Database

    Stubenvoll, M.; Schäfer, B.; Mann, K.; Novák, Ondřej

    2016-01-01

    Roč. 87, č. 2 (2016), 1-7, č. článku 023904. ISSN 0034-6748 R&D Projects: GA ČR GA16-12960S; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : wave-front deformation * bulk absorption * gray-tracking * barium borate * duv-optics * ktp Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.515, year: 2016

  1. Measurement of the target current by inductive probe during laser interaction on terawatt laser system PALS

    Czech Academy of Sciences Publication Activity Database

    Cikhardt, Jakub; Krása, Josef; De Marco, Massimo; Pfeifer, Miroslav; Velyhan, Andriy; Krouský, Eduard; Cikhardtová, B.; Klír, Daniel; Řezáč, Karel; Ullschmied, Jiří; Skála, Jiří; Kubeš, P.; Kravárik, J.

    2014-01-01

    Roč. 85, č. 10 (2014), s. 103507-103507 ISSN 0034-6748 R&D Projects: GA MŠk LM2010014; GA MŠk(CZ) LG13029; GA ČR GAP205/12/0454; GA MŠk EE2.3.20.0279 Grant - others:LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : laser PALS * laser-target interaction * target current * inductive probe Subject RIV: BL - Plasma and Gas Discharge Physics; BL - Plasma and Gas Discharge Physics (FZU-D) Impact factor: 1.614, year: 2014 http://dx.doi.org/10.1063/1.4898016

  2. Microchip laser operation of Yb-doped gallium garnets

    Czech Academy of Sciences Publication Activity Database

    Serres, J.M.; Jambunathan, Venkatesan; Loiko, P.; Mateos, X.; Yu, H.; Zhang, H.; Liu, J.; Lucianetti, Antonio; Mocek, Tomáš; Yumashev, K.; Griebner, U.; Petrov, V.; Aguilo, M.; Diaz, F.

    2016-01-01

    Roč. 6, č. 1 (2016), s. 46-57 ISSN 2159-3930 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA ČR GA14-01660S Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : thermal-conductivity * crystal * temperature * Y 3 AL 5 O 12 * YAG * performance * CNGG Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 2.591, year: 2016

  3. Graphene Q-Switched Compact Yb:YAG Laser

    Czech Academy of Sciences Publication Activity Database

    Serres, J.M.; Jambunathan, Venkatesan; Mateos, X.; Loiko, P.; Lucianetti, Antonio; Mocek, Tomáš; Yumashev, K.; Petrov, V.; Griebner, U.; Aguilo, M.; Diaz, F.

    2015-01-01

    Roč. 7, č. 5 (2015), s. 1-8, č. článku 1503307. ISSN 1943-0655 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA ČR GA14-01660S Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : graphene * saturable absorber * Q-switched laser Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 2.177, year: 2015

  4. Effect of repressing of briquettes at high hydrostatic pressures on fine structure of carbide fraction in compacts and sintered BK10 alloy

    International Nuclear Information System (INIS)

    Chernyj, Yu.F.; Mikhajlenko, G.P.; Labinskaya, N.G.; Vangengeim, S.D.; Fal'kovskij, V.A.; Lavrukhina, L.I.

    1977-01-01

    The effect was studied of the repressing at high hydrostatic pressures of preforms of hard alloy powder mixture with different degree of fineness on changes in fine structure of the carbide phase of compacts and the VK10 sintered alloy. X-ray diffraction method was used. Sufficient widening of diffraction lines of the WC phase in compacts and in a sintered alloy with the increase in hydrostatic pressure testifies to the fact of the production of more inperfect carbide substructure mainly due to fragmentation subgrains. The effect of processing pressure manifests itself to a greater extent in compacts of the coarse-ground mixture; in the sintered alloy the repressing pressure effect ''is being smoothed'' to some extent. The density of dislocation in the compacts and the sintered alloy were evaluated quantatively depending on the hydrostatic pressure values during processing of preforms

  5. Infrared photometry of galaxies in the Butcher-Oemler cluster 0024+1654

    International Nuclear Information System (INIS)

    Lilly, S.J.; Gunn, J.E.

    1985-01-01

    Infrared photometry is presented for 21 galaxies that are spectroscopically confirmed members of the Butcher-Oemler cluster C10024+1654 at z=0.39. These data are combined with optical CCD photometry and transformed to produce rest-frame UBVK colours. The distribution of colours in the (U-V)/(V-K) plane is analysed. The 11 'red' galaxies have colours that are broadly similar to those of nearby elliptical galaxies. All but one of the 10 'blue' galaxies have the colours of nearby spiral galaxies, including one Im-type galaxy, and other interpretations, e.g. a young age, may be discounted. The (V-K) colour of the remaining 'blue' galaxy, however, suggests the presence of a substantial intermediate age (approx. 1 Gyr) stellar population. (author)

  6. Bubble Dynamics and Shock Waves

    CERN Document Server

    2013-01-01

    This volume of the Shock Wave Science and Technology Reference Library is concerned with the interplay between bubble dynamics and shock waves. It is divided into four parts containing twelve chapters written by eminent scientists. Topics discussed include shock wave emission by laser generated bubbles (W Lauterborn, A Vogel), pulsating bubbles near boundaries (DM Leppinen, QX Wang, JR Blake), interaction of shock waves with bubble clouds (CD Ohl, SW Ohl), shock propagation in polydispersed bubbly liquids by model equations (K Ando, T Colonius, CE Brennen. T Yano, T Kanagawa,  M Watanabe, S Fujikawa) and by DNS (G Tryggvason, S Dabiri), shocks in cavitating flows (NA Adams, SJ Schmidt, CF Delale, GH Schnerr, S Pasinlioglu) together with applications involving encapsulated bubble dynamics in imaging (AA Doinikov, A Novell, JM Escoffre, A Bouakaz),  shock wave lithotripsy (P Zhong), sterilization of ships’ ballast water (A Abe, H Mimura) and bubbly flow model of volcano eruptions ((VK Kedrinskii, K Takayama...

  7. Deuterium–deuterium nuclear reaction induced by high intensity laser pulses

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cavallaro, S.; Cutroneo, M.; Giuffrida, L.; Krása, Josef; Margarone, Daniele; Velyhan, Andriy; Kravarik, J.; Ullschmied, Jiří; Wolowski, J.; Szydlowski, A.; Rosinski, M.

    2013-01-01

    Roč. 272, May (2013), s. 42-45 ISSN 0169-4332 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087; GA MŠk(CZ) LC528 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OPVK 3 Laser Zdroj(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; 7FP LASERLAB-EUROPE(XE) 228334 Program:EE; FP7 Keywords : D–D fusion * cross-section * laser-plasma Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013

  8. Seidel aberrations in grating pulse stretchers

    Czech Academy of Sciences Publication Activity Database

    Vyhlídka, Štěpán; Kramer, Daniel; Kalinchenko, Galina; Rus, Bedřich

    2016-01-01

    Roč. 24, č. 26 (2016), s. 30421-30432 ISSN 1094-4087 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 LaserSys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : ultrafast optics * pulse compression Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.307, year: 2016

  9. Pulse synchronization system for picosecond pulse-pumped OPCPA with femtosecond-level relative timing jitter

    Czech Academy of Sciences Publication Activity Database

    Batysta, František; Antipenkov, Roman; Green, Jonathan T.; Naylon, Jack A.; Novák, Jakub; Mazanec, Tomáš; Hříbek, Petr; Zervos, Charalampos; Bakule, Pavel; Rus, Bedřich

    2014-01-01

    Roč. 22, č. 24 (2014), s. 30281-30286 ISSN 1094-4087 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk ED3.1.00/10.0210 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 LaserSys(XE) CZ.1.07/2.3.00/20.0091; CCIT: Centrum pro inovace a transfer technologií(XE) CZ.1.05/3.1.00/10.0210 Institutional support: RVO:68378271 Keywords : laser stabilization * optical amplifiers * lasers diode-pumped * parametric oscillators and amplifiers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.488, year: 2014

  10. Vitamin K-antagonists accelerate atherosclerotic calcification and induce a vulnerable plaque phenotype.

    Directory of Open Access Journals (Sweden)

    Leon J Schurgers

    Full Text Available Vitamin K-antagonists (VKA are treatment of choice and standard care for patients with venous thrombosis and thromboembolic risk. In experimental animal models as well as humans, VKA have been shown to promote medial elastocalcinosis. As vascular calcification is considered an independent risk factor for plaque instability, we here investigated the effect of VKA on coronary calcification in patients and on calcification of atherosclerotic plaques in the ApoE(-/- model of atherosclerosis.A total of 266 patients (133 VKA users and 133 gender and Framingham Risk Score matched non-VKA users underwent 64-slice MDCT to assess the degree of coronary artery disease (CAD. VKA-users developed significantly more calcified coronary plaques as compared to non-VKA users. ApoE(-/- mice (10 weeks received a Western type diet (WTD for 12 weeks, after which mice were fed a WTD supplemented with vitamin K(1 (VK(1, 1.5 mg/g or vitamin K(1 and warfarin (VK(1&W; 1.5 mg/g & 3.0 mg/g for 1 or 4 weeks, after which mice were sacrificed. Warfarin significantly increased frequency and extent of vascular calcification. Also, plaque calcification comprised microcalcification of the intimal layer. Furthermore, warfarin treatment decreased plaque expression of calcification regulatory protein carboxylated matrix Gla-protein, increased apoptosis and, surprisingly outward plaque remodeling, without affecting overall plaque burden.VKA use is associated with coronary artery plaque calcification in patients with suspected CAD and causes changes in plaque morphology with features of plaque vulnerability in ApoE(-/- mice. Our findings underscore the need for alternative anticoagulants that do not interfere with the vitamin K cycle.

  11. Komodo dragon-inspired synthetic peptide DRGN-1 promotes wound-healing of a mixed-biofilm infected wound.

    Science.gov (United States)

    M C Chung, Ezra; Dean, Scott N; Propst, Crystal N; Bishop, Barney M; van Hoek, Monique L

    2017-01-01

    Cationic antimicrobial peptides are multifunctional molecules that have a high potential as therapeutic agents. We have identified a histone H1-derived peptide from the Komodo dragon ( Varanus komodoensis) , called VK25. Using this peptide as inspiration, we designed a synthetic peptide called DRGN-1. We evaluated the antimicrobial and anti-biofilm activity of both peptides against Pseudomonas aeruginosa and Staphylococcus aureus . DRGN-1, more than VK25, exhibited potent antimicrobial and anti-biofilm activity, and permeabilized bacterial membranes. Wound healing was significantly enhanced by DRGN-1 in both uninfected and mixed biofilm ( Pseudomonas aeruginosa and Staphylococcus aureus )-infected murine wounds. In a scratch wound closure assay used to elucidate the wound healing mechanism, the peptide promoted the migration of HEKa keratinocyte cells, which was inhibited by mitomycin C (proliferation inhibitor) and AG1478 (epidermal growth factor receptor inhibitor). DRGN-1 also activated the EGFR-STAT1/3 pathway. Thus, DRGN-1 is a candidate for use as a topical wound treatment. Wound infections are a major concern; made increasingly complicated by the emerging, rapid spread of bacterial resistance. The novel synthetic peptide DRGN-1 (inspired by a peptide identified from Komodo dragon) exhibits pathogen-directed and host-directed activities in promoting the clearance and healing of polymicrobial ( Pseudomonas aeruginosa & Staphylococcus aureus ) biofilm infected wounds. The effectiveness of this peptide cannot be attributed solely to its ability to act upon the bacteria and disrupt the biofilm, but also reflects the peptide's ability to promsote keratinocyte migration. When applied in a murine model, infected wounds treated with DRGN-1 healed significantly faster than did untreated wounds, or wounds treated with other peptides. The host-directed mechanism of action was determined to be via the EGFR-STAT1/3 pathway. The pathogen-directed mechanism of action was

  12. Proteasome inhibitors activate autophagy involving inhibition of PI3K-Akt-mTOR pathway as an anti-oxidation defense in human RPE cells.

    Directory of Open Access Journals (Sweden)

    Bingrong Tang

    Full Text Available The two major intracellular protein degradation systems, the ubiquitin-proteasome system (UPS and autophagy, work collaboratively in many biological processes including development, apoptosis, aging, and countering oxidative injuries. We report here that, in human retinal pigment epithelial cells (RPE, ARPE-19 cells, proteasome inhibitors, clasto-lactacystinβ-lactone (LA or epoxomicin (Epo, at non-lethal doses, increased the protein levels of autophagy-specific genes Atg5 and Atg7 and enhanced the conversion of microtubule-associated protein light chain (LC3 from LC3-I to its lipidative form, LC3-II, which was enhanced by co-addition of the saturated concentration of Bafilomycin A1 (Baf. Detection of co-localization for LC3 staining and labeled-lysosome further confirmed autophagic flux induced by LA or Epo. LA or Epo reduced the phosphorylation of the protein kinase B (Akt, a downstream target of phosphatidylinositol-3-kinases (PI3K, and mammalian target of rapamycin (mTOR in ARPE-19 cells; by contrast, the induced changes of autophagy substrate, p62, showed biphasic pattern. The autophagy inhibitor, Baf, attenuated the reduction in oxidative injury conferred by treatment with low doses of LA and Epo in ARPE-19 cells exposed to menadione (VK3 or 4-hydroxynonenal (4-HNE. Knockdown of Atg7 with siRNA in ARPE-19 cells reduced the protective effects of LA or Epo against VK3. Overall, our results suggest that treatment with low levels of proteasome inhibitors confers resistance to oxidative injury by a pathway involving inhibition of the PI3K-Akt-mTOR pathway and activation of autophagy.

  13. Glutathione reductase: solvent equilibrium and kinetic isotope effects

    International Nuclear Information System (INIS)

    Wong, K.K.; Vanoni, M.A.; Blanchard, J.S.

    1988-01-01

    Glutathione reductase catalyzes the NADPH-dependent reduction of oxidized glutathione (GSSG). The kinetic mechanism is ping-pong, and we have investigated the rate-limiting nature of proton-transfer steps in the reactions catalyzed by the spinach, yeast, and human erythrocyte glutathione reductases using a combination of alternate substrate and solvent kinetic isotope effects. With NADPH or GSSG as the variable substrate, at a fixed, saturating concentration of the other substrate, solvent kinetic isotope effects were observed on V but not V/K. Plots of Vm vs mole fraction of D 2 O (proton inventories) were linear in both cases for the yeast, spinach, and human erythrocyte enzymes. When solvent kinetic isotope effect studies were performed with DTNB instead of GSSG as an alternate substrate, a solvent kinetic isotope effect of 1.0 was observed. Solvent kinetic isotope effect measurements were also performed on the asymmetric disulfides GSSNB and GSSNP by using human erythrocyte glutathione reductase. The Km values for GSSNB and GSSNP were 70 microM and 13 microM, respectively, and V values were 62 and 57% of the one calculated for GSSG, respectively. Both of these substrates yield solvent kinetic isotope effects greater than 1.0 on both V and V/K and linear proton inventories, indicating that a single proton-transfer step is still rate limiting. These data are discussed in relationship to the chemical mechanism of GSSG reduction and the identity of the proton-transfer step whose rate is sensitive to solvent isotopic composition. Finally, the solvent equilibrium isotope effect measured with yeast glutathione reductase is 4.98, which allows us to calculate a fractionation factor for the thiol moiety of GSH of 0.456

  14. Ra reactor operation plan for 1976 - Annex 6; Prilog 6 - Plan rada reaktora RA za 1976. godinu

    Energy Technology Data Exchange (ETDEWEB)

    Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1976-01-15

    Contrary to previous years the RA reactor operation plan for 1976 is conditioned by more uncertainties than ever for the following reasons. It is planned for February to repair the components in order to eliminate the consequences of leaking from the vertical experimental channel VK-4 which happened in december 1975. Apart from this, measurements related to transfer of the core to highly enriched fuel under minimum power are foreseen to be performed in February. In April, it would be indispensable to locate the point of He gas leaking and its prevention. Core transfer to highly enriched fuel is planned for April for testing of the fuel elements under operating conditions and step by step increase of the power density up to the nominal power. Complete plan for core transfer would be available by the end of February 1976. It is planned to make-up for the mentioned delays from May-December 1976. [Serbo-Croat] Za razliku od prethodnih godina izrada plana rada reaktora RA za 1976. godinu vezana je za mnogo vise neizvesnosti nego ikada ranije iz sledecih razloga. U februaru se vrsi remont opreme i uklanjanja posledica procurivanja vertikalnog eksperimentalog kanala VK-4, koje se dogodilo decembra 1975. Sem toga u februaru se vrse merenja na minimalnim snagama u sklopu priprema za prelazak na novo gorivo. U aprilu ce biti neophodno lociranje mesta gde istice He gas kao i otklanjanje uzroka ovog curenja. Planirano je da se u aprilu ubaci novo gorivo u jezgro u cilju testiranja pod radnim uslovima uz postepeno povecanje snage do nominalne. Planirano je da se smanjeni obim rada usled navedenih uslova nadoknadi u potpunosti u periodu maj-decembar 1976.

  15. Systemic retinoids for the chemoprevention of cutaneous squamous cell carcinoma and verrucal keratosis in a cohort of patients on BRAF inhibitors.

    Science.gov (United States)

    Anforth, R; Blumetti, T C M P; Clements, A; Kefford, R; Long, G V; Fernandez-Peñas, P

    2013-12-01

    The treatment of metastatic melanoma has changed greatly with the development of inhibitors targeted at the mutated BRAF kinase present in up to 50% of metastatic melanoma cases. These agents, vemurafenib and dabrafenib, have been shown to increase median survival. Unfortunately, they have also been associated with the development of verrucal keratosis (VK) and cutaneous squamous cell carcinoma (cuSCC). These lesions require surgical excision, and when a large number of these lesions need to be treated, it can significantly affect the patient's quality of life. To determine if acitretin is suitable as a chemopreventative agent against the development of verrucal keratosis and cuSCC, in patients on BRAF inhibitors. Patients treated with a BRAF inhibitor, vemurafenib or dabrafenib, for stage IV metastatic melanoma, who had undergone more than five surgical excisions to remove lesions suggestive of cuSCC, were offered the opportunity to commence acitretin as a chemopreventative agent. Patients were evaluated every 4 weeks. Clinical and histological data were collected. Eight patients, who had a total of 24 cuSCC removed, were included in the study. After commencement of acitretin, only five cuSCC were excised from two patients. The most significant reduction was in a patient who had developed 13 cuSCC over 10 months and only two cuSCC 3 months after commencing acitretin. No modifications in the dose of the BRAF inhibitor were made as a result of cuSCC in any of these patients. Acitretin should be considered as a chemopreventative agent for VK and cuSCC in patients taking BRAF inhibitors, before considering dosage reductions. © 2013 British Association of Dermatologists.

  16. Entamoeba Clone-Recognition Experiments: Morphometrics, Aggregative Behavior, and Cell-Signaling Characterization.

    Science.gov (United States)

    Espinosa, Avelina; Paz-Y-Miño-C, Guillermo; Hackey, Meagan; Rutherford, Scott

    2016-05-01

    Studies on clone- and kin-discrimination in protists have proliferated during the past decade. We report clone-recognition experiments in seven Entamoeba lineages (E. invadens IP-1, E. invadens VK-1:NS, E. terrapinae, E. moshkovskii Laredo, E. moshkovskii Snake, E. histolytica HM-1:IMSS and E. dispar). First, we characterized morphometrically each clone (length, width, and cell-surface area) and documented how they differed statistically from one another (as per single-variable or canonical-discriminant analyses). Second, we demonstrated that amebas themselves could discriminate self (clone) from different (themselves vs. other clones). In mix-cell-line cultures between closely-related (E. invadens IP-1 vs. E. invadens VK-1:NS) or distant-phylogenetic clones (E. terrapinae vs. E. moshkovskii Laredo), amebas consistently aggregated with same-clone members. Third, we identified six putative cell-signals secreted by the amebas (RasGap/Ankyrin, coronin-WD40, actin, protein kinases, heat shock 70, and ubiquitin) and which known functions in Entamoeba spp. included: cell proliferation, cell adhesion, cell movement, and stress-induced encystation. To our knowledge, this is the first multi-clone characterization of Entamoeba spp. morphometrics, aggregative behavior, and cell-signaling secretion in the context of clone-recognition. Protists allow us to study cell-cell recognition from ecological and evolutionary perspectives. Modern protistan lineages can be central to studies about the origins and evolution of multicellularity. © 2016 The Author(s) Journal of Eukaryotic Microbiology © 2016 International Society of Protistologists.

  17. The signaling role for chloride in the bidirectional communication between neurons and astrocytes.

    Science.gov (United States)

    Wilson, Corinne S; Mongin, Alexander A

    2018-01-09

    It is well known that the electrical signaling in neuronal networks is modulated by chloride (Cl - ) fluxes via the inhibitory GABA A and glycine receptors. Here, we discuss the putative contribution of Cl - fluxes and intracellular Cl - to other forms of information transfer in the CNS, namely the bidirectional communication between neurons and astrocytes. The manuscript (i) summarizes the generic functions of Cl - in cellular physiology, (ii) recaps molecular identities and properties of Cl - transporters and channels in neurons and astrocytes, and (iii) analyzes emerging studies implicating Cl - in the modulation of neuroglial communication. The existing literature suggests that neurons can alter astrocytic Cl - levels in a number of ways; via (a) the release of neurotransmitters and activation of glial transporters that have intrinsic Cl - conductance, (b) the metabotropic receptor-driven changes in activity of the electroneutral cation-Cl - cotransporter NKCC1, and (c) the transient, activity-dependent changes in glial cell volume which open the volume-regulated Cl - /anion channel VRAC. Reciprocally, astrocytes are thought to alter neuronal [Cl - ] i through either (a) VRAC-mediated release of the inhibitory gliotransmitters, GABA and taurine, which open neuronal GABA A and glycine receptor/Cl - channels, or (b) the gliotransmitter-driven stimulation of NKCC1. The most important recent developments in this area are the identification of the molecular composition and functional heterogeneity of brain VRAC channels, and the discovery of a new cytosolic [Cl - ] sensor - the Wnk family protein kinases. With new work in the field, our understanding of the role of Cl - in information processing within the CNS is expected to be significantly updated. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. Aldosterone signaling regulates the over-expression of claudin-4 and -8 at the distal nephron from type 1 diabetic rats.

    Directory of Open Access Journals (Sweden)

    Eduardo Molina-Jijón

    Full Text Available Hyperglycemia in diabetes alters tight junction (TJ proteins in the kidney. We evaluated the participation of aldosterone (ALD, and the effect of spironolactone (SPL, a mineralocorticoid receptor antagonist, on the expressions of claudin-2, -4, -5 and -8, and occludin in glomeruli, proximal and distal tubules isolated from diabetic rats. Type 1 diabetes was induced in female Wistar rats by a single tail vein injection of streptozotocin (STZ, and SPL was administrated daily by gavage, from days 3-21. Twenty-one days after STZ injection the rats were sacrificed. In diabetic rats, the serum ALD levels were increased, and SPL-treatment did not have effect on these levels or in hyperglycemia, however, proteinuria decreased in SPL-treated diabetic rats. Glomerular damage, evaluated by nephrin and Wilm's tumor 1 (WT1 protein expressions, and proximal tubular damage, evaluated by kidney injury molecule 1 (Kim-1 and heat shock protein 72 kDa (Hsp72 expressions, were ameliorated by SPL. Also, SPL prevented decrement in claudin-5 in glomeruli, and claudin-2 and occludin in proximal tubules by decreasing oxidative stress, evaluated by superoxide anion (O2●- production, and oxidative stress markers. In distal tubules, SPL ameliorated increase in mRNA, protein expression, and phosphorylation in threonine residues of claudin-4 and -8, through a serum and glucocorticoid-induced kinase 1 (SGK1, and with-no-lysine kinase 4 (WNK4 signaling pathway. In conclusion, this is the first study that demonstrates that ALD modulates the expression of renal TJ proteins in diabetes, and that the blockade of its actions with SPL, may be a promising therapeutic strategy to prevent alterations of TJ proteins in diabetic nephropathy.

  19. Molecules based on M(v) (M=Mo, W) and Ni(II) ions: a new class of trigonal bipyramidal cluster and confirmation of SMM behavior for the pentadecanuclear molecule {NiII[NiII(tmphen)(MeOH)]6[Ni(H2O)3]2[micro-CN]30[WV(CN)3]6}.

    Science.gov (United States)

    Hilfiger, Matthew G; Zhao, Hanhua; Prosvirin, Andrey; Wernsdorfer, Wolfgang; Dunbar, Kim R

    2009-07-14

    The preparation, single crystal X-ray crystallography, and magnetic properties are reported for four new clusters based on [M'V(CN)8]3- octacyanometallates (M'=Mo, W). Reactions of [M'V(CN)8]3- with mononuclear NiII ions in the presence of the tmphen blocking ligand (tmphen=3,4,7,8-tetramethyl-1,10-phenanthroline) in a 2:3:6 ratio, respectively, lead to the formation of the trigonal bipyramidal clusters [NiII(tmphen)2]3[M'V(CN)8]2. Analogous reactions with the same starting materials performed in a 2:3:2 ratio, respectively, produce pentadecanuclear clusters of the type {NiII[NiII(tmphen)(MeOH)]6[Ni(H2O)3]2[micro-CN]30[WV(CN)3]6}. The W2Ni3 (1) and Mo2Ni3(2) pentanuclear clusters and the W6Ni9 (3) and Mo6Ni9 (4) pentadecanuclear molecules are isostructural to each other and crystallize in the space groups P2(1)/c and R3 respectively. Magnetic measurements indicate that the ground states for the trigonal bipyamidal clusters are S=4 as a consequence of ferromagnetic coupling with JW-Ni=9.5 cm(-1), JMo-Ni=10 cm(-1). The pentadecanuclear clusters exhibit ferromagnetic coupling as well, which leads to S=12 ground states (JW-Ni=12 cm(-1), JMo-Ni=12.2 cm(-1)). Reduced magnetization studies on the W-Ni analogues support the conclusion that they exhibit a negative axial anisotropy term; the fits give D values of -0.24 cm(-1) for the W2Ni3 cluster and D=-0.04 cm(-1)for the W6Ni9 cluster. AC susceptibility measurements indicate the beginning of an out-of-phase signal for the W2Ni3 and the W6Ni9 compounds, but detailed low temperature studies on small crystals by the microSQUID technique indicate that only the pentadecanuclear cluster exhibits hysteresis in accord with SMM behavior. Neither Mo cluster reveals any evidence for slow paramagnetic relaxation at low temperatures.

  20. Use of LIDAR Data in the 3D/4D Analyses of the Krakow Fortress Objects

    Science.gov (United States)

    Glowienka, Ewa; Michalowska, Krystyna; Opalinski, Piotr; Hejmanowska, Beata; Mikrut, Slawomir; Kramarczyk, Piotr

    2017-10-01

    The article presents partial results of studies within the framework of the international project "Cultural Heritage Through Time" (CHT2). The subject of the study were forts of the Krakow Fortress, which had been built by the Austrians between 1849-1914 in order to provide defence against the Russians. Research works were aimed at identifying architectural changes occurring in different time periods in relation to selected objects of the Krakow Fortress. For the analysis, the following LIDAR (Light Detection and Ranging) data was applied: Digital Terrain Models (DTM), Digital Surface Model (DSM), as well as the cartographic data: maps and orthophotomaps. All spatial data was obtained from the Polish Main Office of Geodesy and Cartography (Główny Urząd Geodezji i Kartografii - GUGIK). The majority of the cartographic data is available in the form of Web Map Services (WMS) on Geoportal (www.geoportal.gov.pl). The archival data was made available by the Historical Museum of the City of Krakow, or obtained from private collections. In order to conduct a thorough analysis of objects of the Krakow fortress, DTM and DSM data was obtained, either in ASCII format, or in the source *.las (LIDAR) format. On the basis of DTM and DSM, the degree of destruction of selected fortress objects was determined, occurring as a result of the action of demolishing those objects in the interwar period (1920-1939) and in the 1950s. The research has been made on the basis of all available cartographic materials, both archival (plans, maps, photos) and current (topographic map, orthophotomap, etc.) ones. Verification of archival maps and plans was carried out by comparing current digital images of the existing forms of fortifications with designs developed by the Austrians. As a result, it was possible to identify the differences between the original design, and the current state of the objects concerned. The analyses, which have been conducted, also allowed checking the legitimacy of

  1. Changes in flood risk impacted by river training – case study of piedmont section of the Vistula river

    Directory of Open Access Journals (Sweden)

    Łajczak Adam

    2014-12-01

    Full Text Available Zmiany w zagrożeniu powodziowych powodowane przez regulację rzeki na przykładzie przedgórskiego odcinka Wisły. W pracy zanalizowano główne problemy związane z zagrożeniem powodziowym w dolinie przedgórskiego odcinka Wisły (południowa Polska. Ten odcinek rzeki podlega pracom regulacyjnym od połowy XIX wieku. Omówiono wiele problemów wpisujących się w główny nurt dyskusji na temat efektywności stosowanych metod regulacji rzek. Główną uwagę zwrócono na: (1 aktualny stan zagrożenia powodziowego, (2 wielkość odpływu rzeki, (3 zmiany w zagrożeniu powodziowym od początku prac regulacyjnych z uwzględnieniem zmian w geometrii koryta i zmian w wielkości odpływu rzeki odzwierciedlających efekty prac regulacyjnych. Za główną cechę hydrologiczną badanego odcinka Wisły należy uznać znaczny od zapoczątkowania prac regulacyjnych wzrost wielkości przepływu pełnokorytowego, który trwa nadal. Oznacza to, że zmniejsza się ilość wody w rzece, która podczas stanów wyższych od stanu pełnokorytowego może zatapiać strefę międzywala. Tą uwagę uznano za podstawę analizy zmian w zagrożeniu powodziowym w przedgórskim odcinku Wisły. Ocenę tych zmian w badanym odcinku rzeki nie można jednak uznać za jednoznaczną, gdyż niektóre zmiany w warunkach odpływu przyczyniają się do zmniejszenia ryzyka powodzi, podczas gdy inne są odpowiedzialne za jego zwiększenie. W pracy wykorzystano dane z ponad 100-letniego okresu udostępnione przez Państwową Służbę Hydrologiczną, uwzględniono również mapy opublikowane w dużej skali w ostatnich 230 latach, a także wyniki badań terenowych autora.

  2. Protonation mechanism and location of rate-determining steps for the Ascaris suum nicotinamide adenine dinucleotide-malic enzyme reaction from isotope effects and pH studies

    International Nuclear Information System (INIS)

    Kiick, D.M.; Harris, B.G.; Cook, P.F.

    1986-01-01

    The pH dependence of the kinetic parameters and the primary deuterium isotope effects with nicotinamide adenine dinucleotide (NAD) and also thionicotinamide adenine dinucleotide (thio-NAD) as the nucleotide substrates were determined in order to obtain information about the chemical mechanism and location of rate-determining steps for the Ascaris suum NAD-malic enzyme reaction. The maximum velocity with thio-NAD as the nucleotide is pH-independent from pH 4.2 to 9.6, while with NAD, V decreases below a pK of 4.8. V/K for both nucleotides decreases below a pK of 5.6 and above a pK of 8.9. Both the tartronate pKi and V/Kmalate decrease below a pK of 4.8 and above a pK of 8.9. Oxalate is competitive vs. malate above pH 7 and noncompetitive below pH 7 with NAD as the nucleotide. The oxalate Kis increases from a constant value above a pK of 4.9 to another constant value above a pK of 6.7. The oxalate Kii also increases above a pK of 4.9, and this inhibition is enhanced by NADH. In the presence of thio-NAD the inhibition by oxalate is competitive vs. malate below pH 7. For thio-NAD, both DV and D(V/K) are pH-independent and equal to 1.7. With NAD as the nucleotide, DV decreases to 1.0 below a pK of 4.9, while D(V/KNAD) and D(V/Kmalate) are pH-independent. Above pH 7 the isotope effects on V and the V/K values for NAD and malate are equal to 1.45, the pH-independent value of DV above pH 7. Results indicate that substrates bind to only the correctly protonated form of the enzyme. Two enzyme groups are necessary for binding of substrates and catalysis. Both NAD and malate are released from the Michaelis complex at equal rates which are equal to the rate of NADH release from E-NADH above pH 7. Below pH 7 NADH release becomes more rate-determining as the pH decreases until at pH 4.0 it completely limits the overall rate of the reaction

  3. Automated Instrumentation, Monitoring and Visualization of PVM Programs Using AIMS

    Science.gov (United States)

    Mehra, Pankaj; VanVoorst, Brian; Yan, Jerry; Lum, Henry, Jr. (Technical Monitor)

    1994-01-01

    We present views and analysis of the execution of several PVM (Parallel Virtual Machine) codes for Computational Fluid Dynamics on a networks of Sparcstations, including: (1) NAS Parallel Benchmarks CG and MG; (2) a multi-partitioning algorithm for NAS Parallel Benchmark SP; and (3) an overset grid flowsolver. These views and analysis were obtained using our Automated Instrumentation and Monitoring System (AIMS) version 3.0, a toolkit for debugging the performance of PVM programs. We will describe the architecture, operation and application of AIMS. The AIMS toolkit contains: (1) Xinstrument, which can automatically instrument various computational and communication constructs in message-passing parallel programs; (2) Monitor, a library of runtime trace-collection routines; (3) VK (Visual Kernel), an execution-animation tool with source-code clickback; and (4) Tally, a tool for statistical analysis of execution profiles. Currently, Xinstrument can handle C and Fortran 77 programs using PVM 3.2.x; Monitor has been implemented and tested on Sun 4 systems running SunOS 4.1.2; and VK uses XIIR5 and Motif 1.2. Data and views obtained using AIMS clearly illustrate several characteristic features of executing parallel programs on networked workstations: (1) the impact of long message latencies; (2) the impact of multiprogramming overheads and associated load imbalance; (3) cache and virtual-memory effects; and (4) significant skews between workstation clocks. Interestingly, AIMS can compensate for constant skew (zero drift) by calibrating the skew between a parent and its spawned children. In addition, AIMS' skew-compensation algorithm can adjust timestamps in a way that eliminates physically impossible communications (e.g., messages going backwards in time). Our current efforts are directed toward creating new views to explain the observed performance of PVM programs. Some of the features planned for the near future include: (1) ConfigView, showing the physical topology

  4. Two-dimensional thermoelectric Seebeck coefficient of SrTiO3-based superlattices

    International Nuclear Information System (INIS)

    Ohta, Hiromichi

    2008-01-01

    This review provides the origin of the unusually large thermoelectric Seebeck coefficient vertical stroke S vertical stroke of a two-dimensional electron gas confined within a unit cell layer thickness (∝0.4 nm) of a SrTi 0.8 Nb 0.2 O 3 layer of artificial superlattices of SrTiO 3 /SrTi 0.8 Nb 0.2 O 3 [H. Ohta et al., Nature Mater. 6, 129 (2007)]. The vertical stroke S vertical stroke 2D values of the[(SrTiO 3 ) 17 /(SrTi 0.8 Nb 0.2 O 3 ) y ] 20 superlattice increase proportional to y -0.5 , and reach 290 μV K -1 (y=1) at room temperature, which is ∝5 times larger than that of the SrTi 0.8 Nb 0.2 O 3 bulk (vertical stroke S vertical stroke 3D =61 μVK -1 ), proving that the density of states in the ground state for SrTiO 3 increases in inverse proportion to y. The critical barrier thickness for quantum electron confinement is also clarified to be 6.25 nm (16 unit cells of SrTiO 3 ). Significant structural changes are not observed in the superlattice after annealing at 900 K in a vacuum. The value of vertical stroke S vertical stroke 2D of the superlattice gradually increases with temperature and reaches 450 μVK -1 at 900 K, which is ∝3 times larger than that of bulk SrTi 0.8 Nb 0.2 O 3 . These observations provide clear evidence that the [(SrTiO 3 ) 17 /(SrTi 0.8 Nb 0.2 O 3 ) 1 ] 20 superlattice is stable and exhibits a giant vertical stroke S vertical stroke even at high temperature. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  5. Relative Abundance and Plasmodium Infection Rates of Malaria Vectors in and around Jabalpur, a Malaria Endemic Region in Madhya Pradesh State, Central India.

    Science.gov (United States)

    Singh, Neeru; Mishra, Ashok K; Chand, Sunil K; Bharti, Praveen K; Singh, Mrigendra P; Nanda, Nutan; Singh, Om P; Sodagiri, Kranti; Udhyakumar, Venkatachalam

    2015-01-01

    This study was undertaken in two Primary Health Centers (PHCs) of malaria endemic district Jabalpur in Madhya Pradesh (Central India). In this study we had investigated the relative frequencies of the different anopheline species collected within the study areas by using indoor resting catches, CDC light trap and human landing methods. Sibling species of malaria vectors were identified by cytogenetic and molecular techniques. The role of each vector and its sibling species in the transmission of the different Plasmodium species was ascertained by using sporozoite ELISA. A total of 52,857 specimens comprising of 17 anopheline species were collected by three different methods (39,964 by indoor resting collections, 1059 by human landing and 11,834 by CDC light trap). Anopheles culicifacies was most predominant species in all collections (55, 71 and 32% in indoor resting, human landing and light trap collections respectively) followed by An. subpictus and An. annularis. All five sibling species of An. culicifacies viz. species A, B, C, D and E were found while only species T and S of An. fluviatilis were collected. The overall sporozoite rate in An. culicifacies and An. fluviatilis were 0.42% (0.25% for P. falciparum and 0.17% for P. vivax) and 0.90% (0.45% for P. falciparum and 0.45% for P. vivax) respectively. An. culicifacies and An. fluviatilis were found harbouring both P. vivax variants VK-210 and VK-247, and P. falciparum. An. culicifacies sibling species C and D were incriminated as vectors during most part of the year while sibling species T of An. fluviatilis was identified as potential vector in monsoon and post monsoon season. An. culicifacies species C (59%) was the most abundant species followed by An. culicifacies D (24%), B (8.7%), E (6.7%) and A (1.5%). Among An. fluviatilis sibling species, species T was common (99%) and only few specimens of S were found. Our study provides crucial information on the prevalence of An. culicifacies and An. fluviatilis

  6. Relative Abundance and Plasmodium Infection Rates of Malaria Vectors in and around Jabalpur, a Malaria Endemic Region in Madhya Pradesh State, Central India.

    Directory of Open Access Journals (Sweden)

    Neeru Singh

    Full Text Available This study was undertaken in two Primary Health Centers (PHCs of malaria endemic district Jabalpur in Madhya Pradesh (Central India.In this study we had investigated the relative frequencies of the different anopheline species collected within the study areas by using indoor resting catches, CDC light trap and human landing methods. Sibling species of malaria vectors were identified by cytogenetic and molecular techniques. The role of each vector and its sibling species in the transmission of the different Plasmodium species was ascertained by using sporozoite ELISA.A total of 52,857 specimens comprising of 17 anopheline species were collected by three different methods (39,964 by indoor resting collections, 1059 by human landing and 11,834 by CDC light trap. Anopheles culicifacies was most predominant species in all collections (55, 71 and 32% in indoor resting, human landing and light trap collections respectively followed by An. subpictus and An. annularis. All five sibling species of An. culicifacies viz. species A, B, C, D and E were found while only species T and S of An. fluviatilis were collected. The overall sporozoite rate in An. culicifacies and An. fluviatilis were 0.42% (0.25% for P. falciparum and 0.17% for P. vivax and 0.90% (0.45% for P. falciparum and 0.45% for P. vivax respectively. An. culicifacies and An. fluviatilis were found harbouring both P. vivax variants VK-210 and VK-247, and P. falciparum. An. culicifacies sibling species C and D were incriminated as vectors during most part of the year while sibling species T of An. fluviatilis was identified as potential vector in monsoon and post monsoon season.An. culicifacies species C (59% was the most abundant species followed by An. culicifacies D (24%, B (8.7%, E (6.7% and A (1.5%. Among An. fluviatilis sibling species, species T was common (99% and only few specimens of S were found. Our study provides crucial information on the prevalence of An. culicifacies and An

  7. Stimuli-sensitive nanoparticles for multiple anti-HIV microbicides

    Energy Technology Data Exchange (ETDEWEB)

    Giri, Namita; Oh, Byeongtaek; Lee, Chi H., E-mail: leech@umkc.edu [University of Missouri at Kansas City, Division of Pharmaceutical Sciences (United States)

    2016-05-15

    This study is aimed to develop and evaluate an advanced intravaginal formulation for the delivery of multiple anti-HIV microbicides. Novel stimuli-sensitive nanoparticles (NPs) which protected the encapsulated drugs from being degraded in acidic pH conditions were made of Eudragit S-100{sup ®} (ES100{sup ®}), a pH-sensitive polymer. ES100{sup ®} NPs were prepared using the quasi-emulsion solvent diffusion technique and loaded with two microbicides namely Tenofovir (TNF) and Etravirine (ETV). The effects of various fabrication parameters on the formulation properties were evaluated for the optimization of ES100{sup ®} NPs. The morphology of the ES100{sup ®} NPs was examined by scanning electron microscopy. The cytotoxicity of NPs containing microbicides individually or in a combination was assessed using cell viability and trans-epithelial electrical resistance (TEER) measurements. The cellular uptake rates of the model microbicides by human vaginal epithelial cells, VK2 E6/E7 cells, were evaluated using confocal microscopy and florescence-assisted cell sorting technique. ES100{sup ®} NPs had a spherical shape, smooth surface, and uniform texture with a little aggregation. The average particle size for NPs loaded with TNF ranged from 125 to 230 nm, whereas those for ETV-loaded NPs ranged from 160 to 280 nm. ES100{sup ®} NPs had zeta potential in the range of −5 to −10 mV. In-vitro release studies displayed the potential benefits of ES100{sup ®} NPs in retaining and protecting the loaded microbicides at vaginal pH (acidic), but immediately releasing them as the pH changes to neutral or 7.4 (physiological pH). Cell viability studies demonstrated that ES100{sup ®} NPs did not exert any cytotoxicity individually or in a combination of both microbicides. TEER measurements confirmed that ES100{sup ®} NPs loaded with TNF and ETV did not cause any changes in the barrier integrity of VK2 E6/E7 cell monolayer. The cellular uptake study revealed that ES100{sup

  8. Phase 1/2a Trial of Plasmodium vivax Malaria Vaccine Candidate VMP001/AS01B in Malaria-Naive Adults: Safety, Immunogenicity, and Efficacy.

    Directory of Open Access Journals (Sweden)

    Jason W Bennett

    2016-02-01

    Full Text Available A vaccine to prevent infection and disease caused by Plasmodium vivax is needed both to reduce the morbidity caused by this parasite and as a key component in efforts to eradicate malaria worldwide. Vivax malaria protein 1 (VMP001, a novel chimeric protein that incorporates the amino- and carboxy- terminal regions of the circumsporozoite protein (CSP and a truncated repeat region that contains repeat sequences from both the VK210 (type 1 and the VK247 (type 2 parasites, was developed as a vaccine candidate for global use.We conducted a first-in-human Phase 1 dose escalation vaccine study with controlled human malaria infection (CHMI of VMP001 formulated in the GSK Adjuvant System AS01B. A total of 30 volunteers divided into 3 groups (10 per group were given 3 intramuscular injections of 15 μg, 30 μg, or 60 μg respectively of VMP001, all formulated in 500 μL of AS01B at each immunization. All vaccinated volunteers participated in a P. vivax CHMI 14 days following the third immunization. Six non-vaccinated subjects served as infectivity controls.The vaccine was shown to be well tolerated and immunogenic. All volunteers generated robust humoral and cellular immune responses to the vaccine antigen. Vaccination did not induce sterile protection; however, a small but significant delay in time to parasitemia was seen in 59% of vaccinated subjects compared to the control group. An association was identified between levels of anti-type 1 repeat antibodies and prepatent period.This trial was the first to assess the efficacy of a P. vivax CSP vaccine candidate by CHMI. The association of type 1 repeat-specific antibody responses with delay in the prepatency period suggests that augmenting the immune responses to this domain may improve strain-specific vaccine efficacy. The availability of a P. vivax CHMI model will accelerate the process of P. vivax vaccine development, allowing better selection of candidate vaccines for advancement to field trials.

  9. [Effects of socializing piglets in lactation on behaviour, including tail-biting, in growing and finishing pigs].

    Science.gov (United States)

    Klein, Sandrina; Patzkéwitsch, Dorian; Reese, Sven; Erhard, Michael

    2016-06-16

    The aim of this study was to determine whether early socialising of piglets influences the later behaviour and the risk of tail biting in growing and finishing pigs. The behaviour of 183 animals (divided in three successive runs) was recorded from birth until the end of the fattening period. Furthermore, the condition of the teats of the sows as well as the integument and tails of the growing and finishing pigs were evaluated. To socialize the piglets, four litters of the experimental group (V) were provided with additional space (walkway) by opening "piglet-doors" (day 10 postpartum of the youngest litter). The piglets of the control group (K) were reared in conventional farrowing crates located in the same compartment of the stable. Post-weaning, the piglets were assigned to three groups: the experimental group (V/V, two litters of group V), the control group (K/K, two litters of group K) and the mixed group (V/K, one litter of group V and one litter of group K). After opening the "piglet-doors", piglets of group V displayed significantly more playing behaviour than piglets of group K. Additionally, the agonistic behaviour increased in group V. Post-weaning, at allocation and mixing, animals of group V/V showed significantly less agonistic behaviour than pigs of group K/K. Tail-biting behaviour occurred in all three groups, but only in runs two and three. On the 100th day of the fattening period, 58.7% of the pigs of group V/V, 51.7% of group V/K and 43.3% of group K/K still had intact tails. In pigs of group K/K, the tails were significantly shorter compared to the other two groups. Early socialization enhances piglet welfare in farrowing pens by encouraging playing behaviour. Less agonistic behaviour at allocation could furthermore reduce stress at mixing and allocation. The aim to reduce the incidence of tail-biting could not be achieved. However, socializing piglets in lactation could contribute, in accordance with other measures, to an influence on biting

  10. Probiotic lactobacillus and estrogen effects on vaginal epithelial gene expression responses to Candida albicans.

    Science.gov (United States)

    Wagner, R Doug; Johnson, Shemedia J

    2012-06-20

    Vaginal epithelial cells have receptors, signal transduction mechanisms, and cytokine secretion capabilities to recruit host defenses against Candida albicans infections. This research evaluates how probiotic lactobacilli affect the defensive epithelial response. This study used quantitative reverse transcription-polymerase chain reaction assay (qRT-PCR), flow cytometry, and a multiplex immunoassay to observe changes in the regulation of gene expression related to cytokine responses in the VK2 (E6/E7) vaginal epithelial cell line treated with 17β-estradiol, exposed to probiotic Lactobacillus rhamnosus GR-1® and Lactobacillus reuteri RC-14® and challenged with C. albicans. Data were statistically evaluated by repeated measures analysis of variance and paired t-tests where appropriate. C. albicans induced mRNA expression of genes related to inflammatory cytokine responses associated with nuclear factor-kappa B (NF-κB) and mitogen-activated protein kinase (MAPK) signal transduction pathways. 17β-estradiol suppressed expression of interleukin-1α (IL-1α), IL-6, IL-8, and tumor necrosis factor alpha (TNFα) mRNA. Probiotic lactobacilli suppressed C. albicans-induced nuclear factor-kappa B inhibitor kinase kinase alpha (Iκκα), Toll-like receptor-2 (TLR2), TLR6, IL-8, and TNFα, also suggesting inhibition of NF-κB signaling. The lactobacilli induced expression of IL-1α, and IL-1β mRNA, which was not inhibited by curcumin, suggesting that they induce an alternate inflammatory signal transduction pathway to NF-κB, such as the mitogen activated protein kinase and activator protein-1 (MAPK/AP-1) signal transduction pathway. Curcumin inhibited IL-13 secretion, suggesting that expression of this cytokine is mainly regulated by NF-κB signaling in VK2 cells. The results suggest that C. albicans infection induces pro-inflammatory responses in vaginal epithelial cells, and estrogen and lactobacilli suppress expression of NF-κB-related inflammatory genes. Probiotic

  11. HIV gp120 binds to mannose receptor on vaginal epithelial cells and induces production of matrix metalloproteinases.

    Directory of Open Access Journals (Sweden)

    Sashaina E Fanibunda

    Full Text Available BACKGROUND: During sexual transmission of HIV in women, the virus breaches the multi-layered CD4 negative stratified squamous epithelial barrier of the vagina, to infect the sub-epithelial CD4 positive immune cells. However the mechanisms by which HIV gains entry into the sub-epithelial zone is hitherto unknown. We have previously reported human mannose receptor (hMR as a CD4 independent receptor playing a role in HIV transmission on human spermatozoa. The current study was undertaken to investigate the expression of hMR in vaginal epithelial cells, its HIV gp120 binding potential, affinity constants and the induction of matrix metalloproteinases (MMPs downstream of HIV gp120 binding to hMR. PRINCIPAL FINDINGS: Human vaginal epithelial cells and the immortalized vaginal epithelial cell line Vk2/E6E7 were used in this study. hMR mRNA and protein were expressed in vaginal epithelial cells and cell line, with a molecular weight of 155 kDa. HIV gp120 bound to vaginal proteins with high affinity, (Kd = 1.2±0.2 nM for vaginal cells, 1.4±0.2 nM for cell line and the hMR antagonist mannan dose dependently inhibited this binding. Both HIV gp120 binding and hMR exhibited identical patterns of localization in the epithelial cells by immunofluorescence. HIV gp120 bound to immunopurified hMR and affinity constants were 2.9±0.4 nM and 3.2±0.6 nM for vaginal cells and Vk2/E6E7 cell line respectively. HIV gp120 induced an increase in MMP-9 mRNA expression and activity by zymography, which could be inhibited by an anti-hMR antibody. CONCLUSION: hMR expressed by vaginal epithelial cells has high affinity for HIV gp120 and this binding induces production of MMPs. We propose that the induction of MMPs in response to HIV gp120 may lead to degradation of tight junction proteins and the extracellular matrix proteins in the vaginal epithelium and basement membrane, leading to weakening of the epithelial barrier; thereby facilitating transport of HIV across the

  12. Dinámica poblacional y aislamiento de bacterias ácido lácticas en lactosuero fermentado

    Directory of Open Access Journals (Sweden)

    Valeria Martínez-López

    2016-01-01

    Full Text Available Introducción: El consumo de queso producido con leche cruda puede causar daños a la salud debido a la carga microbiana presente en la leche bronca, que puede incluir microorganismos patógenos. Los cultivos iniciadores endémicos de los quesos artesanales podrían mejorar el sabor de quesos fabricados con leche pasteurizada. El objetivo de este trabajo fue estudiar la dinámica poblacional de bacterias ácido lácticas (BAL del suero fermentado de queso de hebra (SFQH y su aislamiento. Método: El suero de queso fue obtenido del proceso artesanal para la elaboración de queso de hebra usando leche cruda (Tuxtepec, Oaxaca, México. Durante 120 h, muestras de SFQH, que fueron obtenidas en diferentes tiempos, se utilizaron para determinar el pH del medio e inocular cajas con medios selectivos MRS, M17, APT y Elliker. Los aislados obtenidos se caracterizaron morfológica y molecularmente. Resultados: La población de BAL se modificó en función del tiempo de fermentación y del pH (4.05 a 3.4 del suero. Se aislaron 22 cepas catalasa negativas y Gram-positivo. El análisis filogenético (ADNr 16S indicó la presencia de cuatro cepas del género Enterococcus (VD, VH, VL, VB y una de Lactobacillus (VK. La cepa VH predominó sobre el resto de los aislados y junto con la cepa VK permanecieron durante todo el bioproceso. Discusión o Conclusión: El cambio en el pH del SFQH permitió aislar cepas de BAL, que podrían utilizarse como cultivos iniciadores para obtener queso de acuerdo a las especificaciones de la NOM-243-SSA1-2010, sin comprometer su calidad sensorial.

  13. Stimuli-sensitive nanoparticles for multiple anti-HIV microbicides

    International Nuclear Information System (INIS)

    Giri, Namita; Oh, Byeongtaek; Lee, Chi H.

    2016-01-01

    This study is aimed to develop and evaluate an advanced intravaginal formulation for the delivery of multiple anti-HIV microbicides. Novel stimuli-sensitive nanoparticles (NPs) which protected the encapsulated drugs from being degraded in acidic pH conditions were made of Eudragit S-100"® (ES100"®), a pH-sensitive polymer. ES100"® NPs were prepared using the quasi-emulsion solvent diffusion technique and loaded with two microbicides namely Tenofovir (TNF) and Etravirine (ETV). The effects of various fabrication parameters on the formulation properties were evaluated for the optimization of ES100"® NPs. The morphology of the ES100"® NPs was examined by scanning electron microscopy. The cytotoxicity of NPs containing microbicides individually or in a combination was assessed using cell viability and trans-epithelial electrical resistance (TEER) measurements. The cellular uptake rates of the model microbicides by human vaginal epithelial cells, VK2 E6/E7 cells, were evaluated using confocal microscopy and florescence-assisted cell sorting technique. ES100"® NPs had a spherical shape, smooth surface, and uniform texture with a little aggregation. The average particle size for NPs loaded with TNF ranged from 125 to 230 nm, whereas those for ETV-loaded NPs ranged from 160 to 280 nm. ES100"® NPs had zeta potential in the range of −5 to −10 mV. In-vitro release studies displayed the potential benefits of ES100"® NPs in retaining and protecting the loaded microbicides at vaginal pH (acidic), but immediately releasing them as the pH changes to neutral or 7.4 (physiological pH). Cell viability studies demonstrated that ES100"® NPs did not exert any cytotoxicity individually or in a combination of both microbicides. TEER measurements confirmed that ES100"® NPs loaded with TNF and ETV did not cause any changes in the barrier integrity of VK2 E6/E7 cell monolayer. The cellular uptake study revealed that ES100"® NPs were taken by vaginal epithelial cells through

  14. Gene Expression Profiling of Human Vaginal Cells In Vitro Discriminates Compounds with Pro-Inflammatory and Mucosa-Altering Properties: Novel Biomarkers for Preclinical Testing of HIV Microbicide Candidates.

    Directory of Open Access Journals (Sweden)

    Irina A Zalenskaya

    Full Text Available Inflammation and immune activation of the cervicovaginal mucosa are considered factors that increase susceptibility to HIV infection. Therefore, it is essential to screen candidate anti-HIV microbicides for potential mucosal immunomodulatory/inflammatory effects prior to further clinical development. The goal of this study was to develop an in vitro method for preclinical evaluation of the inflammatory potential of new candidate microbicides using a microarray gene expression profiling strategy.To this end, we compared transcriptomes of human vaginal cells (Vk2/E6E7 treated with well-characterized pro-inflammatory (PIC and non-inflammatory (NIC compounds. PICs included compounds with different mechanisms of action. Gene expression was analyzed using Affymetrix U133 Plus 2 arrays. Data processing was performed using GeneSpring 11.5 (Agilent Technologies, Santa Clara, CA.Microarraray comparative analysis allowed us to generate a panel of 20 genes that were consistently deregulated by PICs compared to NICs, thus distinguishing between these two groups. Functional analysis mapped 14 of these genes to immune and inflammatory responses. This was confirmed by the fact that PICs induced NFkB pathway activation in Vk2 cells. By testing microbicide candidates previously characterized in clinical trials we demonstrated that the selected PIC-associated genes properly identified compounds with mucosa-altering effects. The discriminatory power of these genes was further demonstrated after culturing vaginal cells with vaginal bacteria. Prevotella bivia, prevalent bacteria in the disturbed microbiota of bacterial vaginosis, induced strong upregulation of seven selected PIC-associated genes, while a commensal Lactobacillus gasseri associated to vaginal health did not cause any changes.In vitro evaluation of the immunoinflammatory potential of microbicides using the PIC-associated genes defined in this study could help in the initial screening of candidates prior

  15. Elastic and transport properties of topological semimetal ZrTe

    Science.gov (United States)

    Guo, San-Dong; Wang, Yue-Hua; Lu, Wan-Li

    2017-11-01

    Topological semimetals may have substantial applications in electronics, spintronics, and quantum computation. Recently, ZrTe was predicted as a new type of topological semimetal due to the coexistence of Weyl fermions and massless triply degenerate nodal points. In this work, the elastic and transport properties of ZrTe are investigated by combining the first-principles calculations and semiclassical Boltzmann transport theory. Calculated elastic constants prove the mechanical stability of ZrTe, and the bulk modulus, shear modulus, Young’s modulus, and Poisson’s ratio also are calculated. It is found that spin-orbit coupling (SOC) has slightly enhanced effects on the Seebeck coefficient, which along the a(b) and c directions for pristine ZrTe at 300 K is 46.26 μVK-1 and 80.20 μVK-1, respectively. By comparing the experimental electrical conductivity of ZrTe (300 K) with the calculated value, the scattering time is determined as 1.59 × 10-14 s. The predicted room-temperature electronic thermal conductivity along the a(b) and c directions is 2.37 {{Wm}}-1{{{K}}}-1 and 2.90 {{Wm}}-1{{{K}}}-1, respectively. The room-temperature lattice thermal conductivity is predicted as 17.56 {{Wm}}-1{{{K}}}-1 and 43.08 {{Wm}}-1{{{K}}}-1 along the a(b) and c directions, showing very strong anisotropy. Calculated results show that isotope scattering produces an observable effect on lattice thermal conductivity. To observably reduce lattice thermal conductivity by nanostructures, the characteristic length should be smaller than 70 nm, based on cumulative lattice thermal conductivity with respect to the phonon mean free path (MFP) at 300 K. It is noted that the average room-temperature lattice thermal conductivity of ZrTe is slightly higher than that of isostructural MoP, which is due to larger phonon lifetimes and smaller Grüneisen parameters. Finally, the total thermal conductivity as a function of temperature is predicted for pristine ZrTe. Our works provide valuable

  16. Identification of Differentially Expressed Genes through Integrated Study of Alzheimer's Disease Affected Brain Regions.

    Directory of Open Access Journals (Sweden)

    Nisha Puthiyedth

    Full Text Available Alzheimer's disease (AD is the most common form of dementia in older adults that damages the brain and results in impaired memory, thinking and behaviour. The identification of differentially expressed genes and related pathways among affected brain regions can provide more information on the mechanisms of AD. In the past decade, several studies have reported many genes that are associated with AD. This wealth of information has become difficult to follow and interpret as most of the results are conflicting. In that case, it is worth doing an integrated study of multiple datasets that helps to increase the total number of samples and the statistical power in detecting biomarkers. In this study, we present an integrated analysis of five different brain region datasets and introduce new genes that warrant further investigation.The aim of our study is to apply a novel combinatorial optimisation based meta-analysis approach to identify differentially expressed genes that are associated to AD across brain regions. In this study, microarray gene expression data from 161 samples (74 non-demented controls, 87 AD from the Entorhinal Cortex (EC, Hippocampus (HIP, Middle temporal gyrus (MTG, Posterior cingulate cortex (PC, Superior frontal gyrus (SFG and visual cortex (VCX brain regions were integrated and analysed using our method. The results are then compared to two popular meta-analysis methods, RankProd and GeneMeta, and to what can be obtained by analysing the individual datasets.We find genes related with AD that are consistent with existing studies, and new candidate genes not previously related with AD. Our study confirms the up-regualtion of INFAR2 and PTMA along with the down regulation of GPHN, RAB2A, PSMD14 and FGF. Novel genes PSMB2, WNK1, RPL15, SEMA4C, RWDD2A and LARGE are found to be differentially expressed across all brain regions. Further investigation on these genes may provide new insights into the development of AD. In addition, we

  17. Alterations of p75 neurotrophin receptor and Myelin transcription factor 1 in the hippocampus of perinatal phencyclidine treated rats.

    Science.gov (United States)

    Andrews, Jessica L; Newell, Kelly A; Matosin, Natalie; Huang, Xu-Feng; Fernandez-Enright, Francesca

    2015-12-03

    Postnatal administration of phencyclidine (PCP) in rodents causes major disturbances to neurological processes resulting in severe modifications to normal behavioral traits into adulthood. It is routinely used to model psychiatric disorders such as schizophrenia, producing many of the dysfunctional processes in the brain that are present in this devastating disorder, including elevated levels of apoptosis during neurodevelopment and disruptions to myelin and plasticity processes. Lingo-1 (or Leucine-rich repeat and immunoglobulin domain-containing protein) is responsible for negatively regulating neurite outgrowth and the myelination of axons. Recent findings using a postmortem human brain cohort showed that Lingo-1 signaling partners in the Nogo receptor (NgR)/p75/TNF receptor orphan Y (TROY) signaling complex, and downstream signaling partners With No Lysine (K) (WNK1) and Myelin transcription factor 1 (Myt1), play a significant part in schizophrenia pathophysiology. Here we have examined the implication of Lingo-1 and its signaling partners in a neurodevelopmental model of schizophrenia using PCP to determine if these pathways are altered in the hippocampus throughout different stages of neurodevelopment. Male Sprague-Dawley rats were injected subcutaneously with PCP (10mg/kg) or saline solution on postnatal days (PN) 7, 9, and 11. Rats (n=6/group) were sacrificed at PN12, 5weeks, or 14weeks. Relative expression levels of Lingo-1 signaling proteins were examined in the hippocampus of the treated rats. p75 and Myt1 were decreased (0.001≤p≤0.011) in the PCP treated rats at PN12. There were no significant changes in any of the tested proteins at 5weeks (p>0.05). At 14weeks, p75, TROY, and Myt1 were increased in the PCP treated rats (0.014≤p≤0.022). This is the first report of an alteration in Lingo-1 signaling proteins in the rat hippocampus, both directly after PCP treatment in early development and in adulthood. Based on our results, we propose that

  18. The modulation of the phosphorylation status of NKCC1 in organ cultured bovine lenses: Implications for the regulation of fiber cell and overall lens volume.

    Science.gov (United States)

    Vorontsova, Irene; Donaldson, Paul J; Kong, Zhiying; Wickremesinghe, Chiharu; Lam, Leo; Lim, Julie C

    2017-12-01

    In previous work, we have shown the Sodium/Potassium/2 Chloride Cotransporter (NKCC1) to be a key effector of lens fiber cell volume regulation. Since others have shown that the activity of NKCC1 is regulated via its phosphorylation status, the purpose of this study was to investigate whether NKCC1 phosphorylation can be modulated in organ cultured bovine lenses, and to see how this relates to changes in lens wet weight. Western blotting was first used to confirm the expression of NKCC1, phosphorylated NKCC1 (NKCC1-P) and the regulatory kinases WNK/SPAK and phosphatases PP1/PP2A in bovine lenses at the protein level. Changes to NKCC1-P status were then assessed by organ culturing bovine lenses in either isotonic, hypertonic or hypotonic solutions in the presence or absence of the NKCC inhibitor, bumetanide, or phosphatase inhibitors okadaic acid and calyculin A. After 1-22 h of culturing, lenses were weighed, assessed for transparency and the cortical protein fractions analyzed by western blot using antibodies to detect total NKCC1 and NKCC1-P. NKCC1, NKCC1-P, SPAK, PP1 and PP2A were all detected in the membrane fraction of bovine lenses. Under hypertonic conditions, NKCC1 is phosphorylated and activated to mediate a regulatory volume increase. Finally, NKCC1-P signal increased in the presence of phosphatase inhibitors indicating that PP1/PP2A can dephosphorylate NKCC1. These results show that the phosphorylation status and hence activity of NKCC1 is dynamically regulated and that in response to hypertonic stress, NKCC1 activity is increased to effect a regulatory volume increase that limits cell shrinkage. These findings support the view that the lens dynamically regulates ion fluxes to maintain steady state lens volume, and suggest that dysfunction of this regulation maybe an initiating factor in the localized fiber cell swelling that is a characteristic of diabetic lens cataract. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Kale BoRACK1 is involved in the plant response to salt stress and Peronospora brassicae Gaumann.

    Science.gov (United States)

    Li, Da-Hong; Shen, Fu-Jia; Li, Hong-Yan; Li, Wei

    2017-06-01

    The receptor for activated C kinase 1 (RACK1) belongs to a protein subfamily containing a tryptophan-aspartic acid-domain (WD) repeat structure. Compelling evidence indicates that RACK1 can interact with many signal molecules and affect different signal transduction pathways. In this study, a kale (Brassica oleracea var. acephala f.tricolor) RACK1 gene (BoRACK1) was cloned by RT-PCR. The amino acid sequence of BoRACK1 had seven WD repeats in which there were typical GH (glycine-histidine) and WD dipeptides. Comparison with AtRACK1 from Arabidopsis revealed 87.1% identity at the amino acid level. Expression pattern analysis by RT-PCR showed that BoRACK1 was expressed in all analyzed tissues of kale and that its transcription in leaves was down-regulated by salt, abscisic acid, and H 2 O 2 at a high concentration. Overexpression of BoRACK1 in kale led to a reduction in symptoms caused by Peronospora brassicae Gaumann on kale leaves. The expression levels of the pathogenesis-related protein genes, PR-1 and PRB-1, increased 2.5-4-fold in transgenic kale, and reactive oxygen species production was more active than in the wild-type. They also exhibited increased tolerance to salt stress in seed germination. H 2 O 2 may also be involved in the regulation of BoRACK1 during seed germination under salt stress. Quantitative real-time PCR analyses showed that the transcript levels of BoRbohs genes were significantly higher in overexpression of BoRACK1 transgenic lines. Yeast two-hybrid assays showed that BoRACK1 could interact with WNK8, eIF6, RAR1, and SGT1. This study and previous work lead us to believe that BoRACK1 may form a complex with regulators of plant salt and disease resistance to coordinate kale reactions to pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

  20. Podejście psychologiczne w terapii jąkania

    Directory of Open Access Journals (Sweden)

    Agata Błachnio

    2013-06-01

    Full Text Available Praca omawia różne metody stosowane w terapii jąkania z uwzględnieniem podejścia psychologicznego. Jąkanie jest nie tylko zaburzeniem płynności mówienia, objawy występują bowiem na kilku płaszczyznach: neurofizjologicznej, społecznej i psychologicznej. Terapia jąkania ze względu na złożoność tego zaburzenia wymaga podejścia interdyscy‑ plinarnego, w tym szczególnie koncentracji na radzeniu sobie z emocjami pacjenta i obniżeniu związanych z tym za‑ burzeniem patologicznych reakcji lękowych – logofobii. Celem artykułu jest omówienie metod stosowanych w terapii jąkania oraz ocena ich skuteczności. Główny podział metod zakłada istnienie dwóch podejść: pośrednie i bezpośred‑ nie metody. Metody bezpośrednie oddziałują na akt mowy i mają na celu zmniejszenie niepłynności mowy. Wśród nich można wymienić: rytmizację mówienia, wspomaganie wypowiedzi ruchem ręki czy wydłużenie wypowiedzi. Natomiast metody pośrednie stanowią ich uzupełnienie i koncentrują się na obniżeniu lęku oraz redukcji napięcia po‑ jawiającego się u osoby jąkającej się. Należą do nich różnego rodzaju techniki relaksacyjne, metody oparte na wizu‑ alizacji czy treningi autogenne. Zwracają one uwagę na emocje przeżywane przez osoby jąkające się. Ponadto tech‑ niki takie jak muzykoterapia, psychodrama, hipoterapia, desentyzacja i desensybilizacja są skutecznymi sposobami polepszenia funkcjonowania psychospołecznego osób jąkających się. Prezentowany artykuł ma charakter przeglądo‑ wy, może zatem służyć jako podstawa do opracowania i wdrożenia programów terapeutycznych z udziałem logope‑ dy i psychologa.

  1. Wytrzymałość biegowa i pływacka studentów UKW Bydgoszcz = Speeding and swimming endurance of students UKW Bydgoszcz

    Directory of Open Access Journals (Sweden)

    Diana Gwiździel

    2016-08-01

      Streszczenie Do określenia poziomu wytrzymałości pływackiej i biegowej studentów kierunku Turystyka i Rekreacja Uniwersytetu Kazimierza Wielkiego w Bydgoszczy, wybrano metodę eksperymentu pedagogicznego, natomiast, jako technikę wybrano test, a narzędziem do przeprowadzenia badań został test Coopera. W odpowiedzi na główny problem badawczy, na podstawie przeprowadzonych badań można stwierdzić, że poziom wytrzymałości biegowej studentów Turystyki i Rekreacji plasuje się na poziomie dobrym i średnim, gdyż znaczna część grupy uzyskiwała takie wyniki. Natomiast w próbie pływackiej badana grupa wypadła znacznie gorzej, gdyż największa liczba uczestników uzyskała słaby wynik. Nieco mniej osób osiągnęło zadawalający rezultat. Zarówno w próbie biegowej, jak i pływackiej przedstawiciele płci męskiej uzyskiwali lepsze wyniki od przedstawicielek płci żeńskiej. Jednakże najbardziej widoczne różnice między obiema płciami można zaobserwować w próbie pływackiej, w której uczestniczki biegu w większej mierze wyniki słabe albo bardzo słabe, kiedy studenci przeważnie zadawalające. Słowa kluczowe: wytrzymałość, Test Coopera, pływanie.     Abstract To determine the level of endurance swimming and cross-country students of Tourism and Recreation at the University of Bydgoszcz, you chose the method of pedagogical experiment, however, the technique chosen test, and a tool for testing was Cooper test. In response to the major research problem, on the basis of the study it can be concluded that the level of endurance cross-country students of Tourism and Recreation ranks of good and medium, since a significant part of the group it obtained such results. However, in an attempt to swim test group fared much worse, since the largest number of participants received a poor result. Slightly fewer people reached a satisfactory result. Both in an attempt to cross-country, swimming and representatives of the male experienced

  2. Od Redakcji

    Directory of Open Access Journals (Sweden)

    Redakcja Czasopisma "Muzealnictwo"

    2018-02-01

    Full Text Available Rocznik „Muzealnictwo”, wypełniając swoje powinności wobec polskich środowisk muzealnych, już 66 lat opisuje dokonujące się w polskim muzealnictwie przekształcenia, analizuje losy instytucji i ludzi oraz muzealnych kolekcji, śledzi zmiany rozwiązań prawnych – niemierzoną w swym zróżnicowaniu rzeczywistość muzealnego uniwersum. Rok 2018 w dziele wypełniania tych powinności ma miejsce szczególne. Jest to bowiem rok refleksji, które przynosi ze sobą jubileusz 100-lecia odzyskania niepodległego bytu przez państwo polskie; refleksji nad państwem, społeczeństwem, prawem i obyczajem, nad postawami ludzi, ich wyborami, szacowanymi również w perspektywie służby publicznej, wedle kryteriów i wartości cementujących wspólnotę, ale pozwalających również Jednostce na odnalezienie się we Wspólnocie. Jest w tej refleksji miejsce na najbliższe nam muzea w całym zróżnicowaniu ich ustawowej działalności, jest miejsce na lepsze odczytywanie potrzeb publiczności, która coraz liczniej do muzeów przychodzi, dowodząc potrzeby ich istnienia jako instytucji długiego trwania, instytucji podtrzymywania wartości w świecie zmieniającym się tak dynamicznie, jak bodaj nigdy dotąd. W tegorocznym numerze „Muzealnictwa” – poza stałymi i szanującymi Państwa przyzwyczajenia działami, poświęconymi m.in. dziejom kolekcji, legislacji, działalności edukacyjnej czy też digitalizacji – tradycyjnie odnajdą Państwo temat główny. Jest nim Awangarda, postrzegana jako sposób myślenia o zbiorowości i o Sztuce, o powinnościach Sztuki wobec zbiorowości, z ambicjami – niejednokrotnie złudnymi – czynienia świata lepszym. Nieprzypadkowo temat Awangardy otwiera numer „Muzealnictwa” ukazujący się w roku tak istotnym dla naszej zbiorowej Pamięci. Niepodległość jako idea i niepodległość jako codzienność Drugiej Rzeczypospolitej przyniosła ze sobą procesy modernizacyjne, do których odwo

  3. Od ciężkości astmy do kontroli astmy. Metody oceny kontroli astmy

    Directory of Open Access Journals (Sweden)

    Joanna Mikołajczyk

    2009-09-01

    Full Text Available Według pierwszych wytycznych dotyczących postępowania w astmie leczenie astmy zależy od stopnia jej cięż- kości, określonej na podstawie objawów klinicznych i wskaźników czynności płuc. Ponieważ astma jest chorobą o zmiennym przebiegu, duże znaczenie ma jej ciągła ocena kliniczna i dostosowana do niej modyfikacja leczenia. Niestety, stopień ciężkości nie dopasowuje się elastycznie do odpowiedzi na leczenie. Biorąc ten fakt pod uwagę, światowi eksperci zalecają zmianę w postępowaniu z astmą, przedkładając uzyskanie klinicznej kontroli astmy nad ustaleniem stopnia jej ciężkości, wyróżniając astmę kontrolowaną, częściowo kontrolowaną i niekontrolowaną. Uzyskanie stanu pełnej kontroli astmy formułuje się w raporcie GINA 2006 jako główny cel leczenia. Kontrola astmy odnosi się do stopnia opanowania objawów i byłoby najlepiej, gdyby dotyczyła też markerów zapalenia i patofizjologicznych wykładników choroby. Określenie stopnia kontroli choroby zgodnie z obecnymi założeniami stanowi podstawę wyboru i modyfikacji leczenia – właściwe ustalenie stopnia kontroli astmy wpływa na skuteczność leczenia. Obecnie dostępnych jest wiele metod oceny kontroli astmy, wtym ocena parametrów klinicznych (objawy w ciągu dnia, objawy nocne, stosowanie leków rozszerzających oskrzela, ocena czynności płuc (PEF i FEV1, określenie zaawansowania zapalenia w drogach oddechowych (nieswoista nadreaktywność oskrzeli, stężenie tlenku azotu w powietrzu wydechowym, liczba eozynofili w plwocinie indukowanej. Dostępne są także subiektywnie oceniające kontrolę astmy kwestionariusze badawcze oraz szybkie testy kontroli astmy (ACT, ACQ, ATAQ. Z drugiej strony wciąż nie wypracowano jednoznacznego stanowiska, który z parametrów lub jakie połączenia parametrów najbardziej wiarygodnie określają kontrolę astmy. Ze względu na wieloczynnikową patogenezę astmy wydaje się, iż uzyskanie pe

  4. Permeation of deuterium implanted into V-15Cr-5Ti

    Energy Technology Data Exchange (ETDEWEB)

    Anderl, R.A.; Longhurst, G.R.; Struttmann, D.A.

    1987-02-01

    Permeation and reemission of deuterium for the vanadium alloy, V-15Cr-5Ti, was investigated using 3 keV, D/sub 3//sup +/ ion beams from a small accelerator. The experiments consisted of measurement of the deuterium reemission and permeation rates as a function of implantation fluence for 0.5 mm thick specimens heated to temperatures from 623 K to 823 K. Implantation-side surface characterization was made by simultaneous measurements of sputtered ions with a secondary ion mass spectrometer (SIMS). For the experimental conditions used, the steady-state deuterium permeation flux in V-15Cr-5Ti is approximately 18% of the implantation flux. This is approximately 1000 times that seen in the austenitic stainless steel, PCA, and 200 times that seen in the ferritic steel, HT-9, under comparable conditions. Measurement of deuterium diffusivity in V-15Cr-5Ti using permeation break-through times indicates that D = 1.4x10/sup -8/ exp(-0.11 eVkT)(m/sup 2/s), over the temperature range 723 K to 823 K.

  5. Productino of KSR-III Airglow Photometers to Measure MUV Airglows of the Upper Atmosphere Above the Korean Peninsular

    Directory of Open Access Journals (Sweden)

    T. H. Oh

    2002-12-01

    Full Text Available We have constructed two flight models of airglow photometer system (AGP to be onboard Korea Sounding Rocket-III (KSR-III for detection of MUV dayglow above the Korean peninsular. The AGP system is designed to detect dayglow emissions of OI 2972 Å, N_2 VK (0,6 2780Å, N_2 2PG 3150Å and background 3070Å toward the horizon at altitudes between 100 km and 300 km. The AGP system consists of a photometer body, a baffle, an electronic control unit and a battery unit. The MUV dayglow emissions enter through a narrow band interference filter and focusing lens of the photometer, which contains an ultraviolet sensitive photomultiplier tube. The photometer is equipped with an in-flight calibration light source on a circular plane that will rotate at the rocket's apogee. A baffle tube is installed at the entry of the photometer in order to block strong scattering lights from the lower atmosphere. We have carried out laboratory measurements of sensitivity and in-flight calibration light source for the AGP flight models. Although absolute sensitivities of the AGP flight models could not be determined in the country, relative sensitivities among channels are well measured so that observation data during rocket flight in the future can be analyzed with confidence.

  6. Transverse peltier effect in Pb-Bi{sub 2}Te{sub 3} multilayer structures

    Energy Technology Data Exchange (ETDEWEB)

    Reitmaier, Christina; Walther, Franziska; Kyarad, Amir; Lengfellner, Hans [University of Regensburg (Germany)

    2009-07-01

    Metal-semiconductor multilayer structures show, according to model calculations, large anisotropy in their electrical and thermal transport properties. Multilayer stacks consisting of alternating layers of Pb and n-type Bi{sub 2}Te{sub 3} and prepared by a heating procedure displayed large thermoelectric anisotropy up to {delta}S{approx}200 {mu} V/K, depending on the thickness ratio p=d{sub BiTe}/d{sub Pb}, where d{sub BiTe} and d{sub Pb} are the thicknesses of Bi{sub 2}Te{sub 3} and Pb layers, respectively. From multilayer stacks, tilted samples with layers inclined with respect to the sample surface where obtained by cutting stacks obliquely to the stack axis. Non-zero off-diagonal elements in the Seebeck-tensor describing the thermopower of tilted samples allow for the occurance of a transverse Peltier effect. Experimental results demonstrate cooling by the transverse Peltier effect and are compared to model calculations.

  7. Dutch taboo norms.

    Science.gov (United States)

    Roest, Sander A; Visser, Tessa A; Zeelenberg, René

    2018-04-01

    This article provides norms for general taboo, personal taboo, insult, valence, and arousal for 672 Dutch words, including 202 taboo words. Norms were collected using a 7-point Likert scale and based on ratings by psychology students from the Erasmus University Rotterdam in The Netherlands. The sample consisted of 87 psychology students (58 females, 29 males). We obtained high reliability based on split-half analyses. Our norms show high correlations with arousal and valence ratings collected by another Dutch word-norms study (Moors et al.,, Behavior Research Methods, 45, 169-177, 2013). Our results show that the previously found quadratic relation (i.e., U-shaped pattern) between valence and arousal also holds when only taboo words are considered. Additionally, words rated high on taboo tended to be rated low on valence, but some words related to sex rated high on both taboo and valence. Words that rated high on taboo rated high on insult, again with the exception of words related to sex many of which rated low on insult. Finally, words rated high on taboo and insult rated high on arousal. The Dutch Taboo Norms (DTN) database is a useful tool for researchers interested in the effects of taboo words on cognitive processing. The data associated with this paper can be accessed via the Open Science Framework ( https://osf.io/vk782/ ).

  8. [Development and application of electroanalytical methods in biomedical fields].

    Science.gov (United States)

    Kusu, Fumiyo

    2015-01-01

    To summarize our electroanalytical research in the biomedical field over the past 43 years, this review describes studies on specular reflection measurement, redox potential determination, amperometric acid sensing, HPLC with electrochemical detection, and potential oscillation across a liquid membrane. The specular reflection method was used for clarifying the adsorption of neurotransmitters and their related drugs onto a gold electrode and the interaction between dental alloys and compound iodine glycerin. A voltammetric screening test using a redox potential for the antioxidative effect of flavonoids was proposed. Amperometric acid sensing based on the measurement of the reduction prepeak current of 2-methyl-1,4-naphthoquinone (VK3) or 3,5-di-tert-buty1-1,2-benzoquinone (DBBQ) was applied to determine acid values of fats and oils, titrable acidity of coffee, and enzyme activity of lipase, free fatty acids (FFAs) in serum, short-chain fatty acids in feces, etc. The electrode reactions of phenothiazines, catechins, and cholesterol were applied to biomedical analysis using HPLC with electrochemical detection. A three-channel electrochemical detection system was utilized for the sensitive determination of redox compounds in Chinese herbal medicines. The behavior of barbituric acid derivatives was examined based on potential oscillation measurements.

  9. Interaction Mode between Inclusion Complex of Vitamin K3 with γ- Cyclodextrin and Herring-Sperm DNA.

    Science.gov (United States)

    Tang, Yan; Cai, Li; Xue, Kang; Wang, Chunling; Xiong, Xiaoli

    2016-05-03

    Methods including spectroscopy, electronic chemistry and thermodynamics were used to study the inclusion effect between γ-cyclodextrin (CD) and vitamin K3(K3), as well as the interaction mode between herring-sperm DNA (hsDNA) and γ-CD-K3 inclusion complex. The results from ultraviolet spectroscopic method indicated that VK3 and γ-CD formed 1:1 inclusion complex, with the inclusion constant Kf = 1.02 × 10(4) L/mol, which is based on Benesi-Hildebrand's viewpoint. The outcomes from the probe method and Scatchard methods suggested that the interaction mode between γ-CD-K3 and DNA was a mixture mode, which included intercalation and electrostatic binding effects. The binding constants were K (θ)25°C = 2.16 × 10(4) L/mol, and K(θ)37°C = 1.06 × 10(4) L/mol. The thermodynamic functions of the interaction between γ-CD-K3 and DNA were ΔrHm(θ) = -2.74 × 10(4) J/mol, ΔrSm(θ) = 174.74 J·mol(-1)K(-1), therefore, both ΔrHm(θ) (enthalpy) and ΔrSm(θ) (entropy) worked as driven forces in this action.

  10. Analysis of sodium metal by X-ray fluorescence spectrometry (I). Determination of Hf, Mo, Nb, Ta, Ti, V and Zr

    International Nuclear Information System (INIS)

    Diaz-Guerra, J. P.

    1981-01-01

    A method allowing the determination of trace quantities of Hf, Mo, Nb, Ta, Ti, Vi and Zr in sodium metal previous transformation into Na 2 S0 4 is described. The enrichment of the impurities is performed through a coprecipitation technique in sulfuric medium by using Fe 3 + as a collector and cupferron or phenyfluorone as the precipitating reagent. The matrix influence and the best concentration of the collector (10/μ/ml), adequate pH (1,3 or 4, respectively) and optimum filter type (Millipore BSWP02500 or BDWP04700, respectively) have been studied, as well as the precipitation recoveries corresponding to the reagent above. It has been demonstrated the batter efficiency of the cupferron for determining all the Impurities. Detection limits range from 0.01 to 0.2 ppm., depending on the element, for samples 4 g in weight. An automatic spectrometer attached to a 16 K minicomputer and X-ray tube with a gold anode (2250-2700 W) are used. The Interferences between the lines ZrKα (2 n d order) - HfLα and TiKβ - VK α have been studied and the respective correction coefficients have been deduced. (Author) 8 refs

  11. Advanced technologies of production of cemented carbides and composite materials based on them

    International Nuclear Information System (INIS)

    Bondarenko, V.; Pavlotskaya, E.; Martynova, L.; Epik, I.

    2001-01-01

    The paper presents new technological processes of production of W, WC and (Ti, W)C powders, cemented carbides having a controlled carbon content, high-strength nonmagnetic nickel-bonded cemented carbides, cemented carbide-based composites having a wear-resistant antifriction working layer as well as processes of regeneration of cemented carbide waste. It is shown that these technological processes permit radical changes in the production of carbide powders and products of VK, TK, VN and KKhN cemented carbides. The processes of cemented carbide production become ecologically acceptable and free of carbon black, the use of cumbersome mixers is excluded, the power expenditure is reduced and the efficiency of labor increases. It becomes possible to control precisely the carbon content within a two-phase region -carbide-metal. A high wear resistance of parts of friction couples which are lubricated with water, benzine, kerosene, diesel fuel and other low-viscosity liquids, is ensured with increased strength and shock resistance. (author)

  12. Kinetic mechanism and nucleotide specificity of NADH peroxidase

    International Nuclear Information System (INIS)

    Stoll, V.S.; Blanchard, J.S.

    1988-01-01

    NADH peroxidase is a flavoprotein isolated from Streptococcus faecalis which catalyzes the pyridine nucleotide-dependent reduction of hydrogen peroxide to water. Initial velocity, product, and dead-end inhibition studies have been performed at pH 7.5 and support a ping-pong kinetic mechanism. In the absence of hydrogen peroxide, both transhydrogenation between NADH and thioNAD, and isotope exchange between [ 14 C]NADH and NAD, have been demonstrated, although in both these experiments, the maximal velocity of nucleotide exchange was less than 1.5% the maximal velocity of the peroxidatic reaction. We propose that NADH binds tightly to both oxidized and two-electron reduced enzyme. NADH oxidation proceeds stereospecifically with the transfer of the 4S hydrogen to enzyme, and then, via exchange, to water. No primary tritium kinetic isotope effect was observed, and no statistically significant primary deuterium kinetic isotope effects on V/K were determined, although primary deuterium kinetic isotope effects on V were observed in the presence and absence of sodium acetate. NADH peroxidase thus shares with other flavoprotein reductases striking kinetic, spectroscopic, and stereochemical similarities. On this basis, we propose a chemical mechanism for the peroxide cleaving reaction catalyzed by NADH peroxidase which involves the obligate formation of a flavinperoxide, and peroxo bond cleavage by nucleophilic attack by enzymatic dithiols

  13. Effect of on-site Coulomb interaction on electronic and transport properties of 100% spin polarized CoMnVAs

    Energy Technology Data Exchange (ETDEWEB)

    Bhat, Tahir Mohiuddin; Gupta, Dinesh C., E-mail: sosfizix@gmail.com

    2017-08-01

    Highlights: • 100% spin-polarized material important for the application in spintronics. • Ferromagnetic nature. • Ductile in nature for mechanical applications. • Semiconducting behavior with a band gap of 0.55 eV in minority spin channel. • Possibly efficient thermoelectric material. - Abstract: The structural, electronic, magnetic and transport properties of a new quaternary Heusler alloy CoMnVAs have been investigated by employing generalized gradient approximation (GGA), modified Becke-Johnson (mBJ) and GGA with Hubbard U correction (GGA + U). The alloy is energetically more stable in ferromagnetic Y{sub 1} type structure. Elastic parameters reveal high anisotropy and ductile nature of the material. CoMnVAs shows half-metallic ferromagnet character with 100% spin polarization at Fermi level with band gap of 0.55 eV in the minority spin state. The alloy also possesses high electrical conductivity and Seebeck coefficients with 15 μVK{sup −1} at room temperature, achieving a figure of merit of 0.65 at high temperatures. The high degree of ductility, 100% spin polarization and large Seebeck coefficient, makes it an attractive candidate to be used in spin voltage generators and thermoelectric materials.

  14. Hydrolysis of N-succinyl-L,L-diaminopimelic acid by the Haemophilus influenzae dapE-encoded desuccinylase: metal activation, solvent isotope effects, and kinetic mechanism.

    Science.gov (United States)

    Born, T L; Zheng, R; Blanchard, J S

    1998-07-21

    Hydrolysis of N-succinyl-L,L-diaminopimelic acid by the dapE-encoded desuccinylase is required for the bacterial synthesis of lysine and meso-diaminopimelic acid. We have investigated the catalytic mechanism of the recombinant enzyme from Haemophilus influenzae. The desuccinylase was overexpressed in Escherichia coli and purified to homogeneity. Steady-state kinetic experiments verified that the enzyme is metal-dependent, with a Km for N-succinyl-L,L-diaminopimelic acid of 1.3 mM and a turnover number of 200 s-1 in the presence of zinc. The maximal velocity was independent of pH above 7 but decreased with a slope of 1 below pH 7. The pH dependence of V/K was bell-shaped with apparent pKs of 6.5 and 8.3. Both L,L- and D,L-diaminopimelic acid were competitive inhibitors of the substrate, but d,d-diaminopimelic acid was not. Solvent kinetic isotope effect studies yielded inverse isotope effects, with values for D2OV/K of 0.62 and D2OV of 0.78. Determination of metal stoichiometry by ICP-AES indicated one tightly bound metal ion, while sequence homologies suggest the presence of two metal binding sites. On the basis of these observations, we propose a chemical mechanism for this metalloenzyme, which has a number of important structurally defined homologues.

  15. An X-ray fluorescence method for the determination of small quantities of elements collected on filters

    International Nuclear Information System (INIS)

    Bayon, A.; Diaz-Guerra, J.P.

    1981-01-01

    An X-ray fluorescence method for the determination of As, Ba, Co, Cr, Cu, Fe, Hg, Mn, Ni, Pb, Se, U, V and Zn collected on P.V.C. filters in concentration ranges from 0,6 to 1000 μg, depending on the element, is described. A sequential automatic spectrometer with a chromium tube is used for the Ba determination, while As, Hg, Pb, Se and U are better determined with a molybdenum one. For the rest of the elements a tungsten target is prefered. The interferences between AsKαsub(1,2) - PbLαsub(1,2) and CrKαsub(1,2) - Vkβsub(1,3) lines are corrected by applyng specific coefficients. The radial variation of the primary X-ray beam intensity on the irradiated surface has been specially studied with chromium, gold, molybdenum and tungsten tubes. For that purpose different X-ray wavelengths in the range 9,89 A to 0,56 A have been selected. The curves obtained show a rather high heterogeneity for the excitation source. This conclusion implies the need for an homogeneous distribution of elements on the filter. (author)

  16. An X-ray fluorescence method for the determination of small quantities el elements collected on filters; Determinacion de pequenas concentraciones de elementos en filtros por espectrometria de fluorescencia de rayos X

    Energy Technology Data Exchange (ETDEWEB)

    Diaz-Guerra, J. P.; Bayon, A.

    1981-07-01

    An X-ray fluorescence method for the determination of As, Ba, Co, Cr, Cu, Fe, Hg, Mn, Ni, Pb, Se, U, V and Zn collected on P.V.C. filters in concentration ranges from 0,6 to 1000{mu}g, depending on the element, is described. A sequential automatic spectrometer with a chromium tube is used for tho Ba determination, while As, Hg, Pb, Se and U are bottler determined with a molybdenum one. For the rest of the elements a tungsten target is preferred. The interferences between AsK{sup {alpha}}{sub 1},2- PbL{sup {alpha}}{sub 1},2 and CrK{sup {alpha}}{sub 1},2-Vk{beta}{sub 1},3 lines are corrected by applying specific coefficients. The radial variation of the primary X-ray beam intensity on the irradiated surface has been specially studied with chromium, gold, molybdenum and tungsten tubes. For that purpose different x-ray wavelengths in the range 9,89 A to 0,56 A have been selected. The curves obtained show a rather high heterogeneity for the excitation source. This conclusion implies the need for an homogeneous distribution of elements on the filter. (Author) 7 refs.

  17. Apatone® induces endometrioid ovarian carcinoma (MDAH 2774 cells to undergo karyolysis and cell death by autoschizis: A potent and safe anticancer treatment

    Directory of Open Access Journals (Sweden)

    Jacques Gilloteaux

    2015-12-01

    Full Text Available Ovarian cancers are still the most lethal gynecologic malignancy. As a novel strategy against this poor outcome cytotoxic alterations induced by a pro-oxidant treatment on human ovarian endometrioid carcinoma (MDAH 2774 cells are revisited by using light, scanning and transmission electron microscopy. A series of sequential and concomitant cellular and organelle injuries induced by ascorbate: menadione combination (VC: VK3 or Apatone® is emphasized. This adjuvant or treatment is able to kill majority of these tumor cells through ‘autoschizic cell death’, a mode of cell death different than apoptosis. Autoschizic cell death is significant after a short period of treatment to decrease the ovarian tumor cell population through induced injuries that proceed from membranes to most organelles: karyolysis with nucleolar segregation and fragmentation, autophagy of mitochondria, lysosome and other organelles as well as cytoskeletal defects. The cytoskeletal damages are evidenced by morphology changes that included auto- or self-excised pieces of cytoplasm lacking organelles apparently facilitated by grouping of vacuolated endoplasm. These results obtained against this endometrioid ovary cell line are comforted by other studies using Apatone® against other carcinomas in vitro and in vivo. Altogether these reports support Apatone® as a new drug that can favorably be used as a novel potent, safe, and inexpensive clinical adjuvant or treatment against ovarian cancers. Keywords: Ascorbate, Menadione, Endometrioid ovarian cancer MDAH 2774, Autoschizis cell death, DNA

  18. Weak convergence of Jacobian determinants under asymmetric assumptions

    Directory of Open Access Journals (Sweden)

    Teresa Alberico

    2012-05-01

    Full Text Available Let $\\Om$ be a bounded open set in $\\R^2$ sufficiently smooth and $f_k=(u_k,v_k$ and $f=(u,v$ mappings belong to the Sobolev space $W^{1,2}(\\Om,\\R^2$. We prove that if the sequence of Jacobians $J_{f_k}$ converges to a measure $\\mu$ in sense of measures andif one allows different assumptions on the two components of $f_k$ and $f$, e.g.$$u_k \\rightharpoonup u \\;\\;\\mbox{weakly in} \\;\\; W^{1,2}(\\Om \\qquad \\, v_k \\rightharpoonup v \\;\\;\\mbox{weakly in} \\;\\; W^{1,q}(\\Om$$for some $q\\in(1,2$, then\\begin{equation}\\label{0}d\\mu=J_f\\,dz.\\end{equation}Moreover, we show that this result is optimal in the sense that conclusion fails for $q=1$.On the other hand, we prove that \\eqref{0} remains valid also if one considers the case $q=1$, but it is necessary to require that $u_k$ weakly converges to $u$ in a Zygmund-Sobolev space with a slightly higher degree of regularity than $W^{1,2}(\\Om$ and precisely$$ u_k \\rightharpoonup u \\;\\;\\mbox{weakly in} \\;\\; W^{1,L^2 \\log^\\alpha L}(\\Om$$for some $\\alpha >1$.    

  19. Oral warfarin affects peripheral blood leukocyte IL-6 and TNFα production in rats.

    Science.gov (United States)

    Popov, Aleksandra; Belij, Sandra; Subota, Vesna; Zolotarevski, Lidija; Mirkov, Ivana; Kataranovski, Dragan; Kataranovski, Milena

    2013-01-01

    Warfarin is a Vitamin K (VK) antagonist that affects Vitamin K-dependent (VKD) processes, including blood coagulation, as well as processes unrelated to hemostasis such as bone growth, calcification, and growth of some cell types. In addition, warfarin exerts influence on some non-VKD-related activities, including anti-tumor and immunomodulating activity. With respect to the latter, both immune stimulating and suppressive effects have been noted in different experimental systems. To explore the in vivo immunomodulatory potential of warfarin on one type of activity (i.e., cytokine production) in two different immune cell populations (i.e., mononuclear or polymorphonuclear cells), effects of subchronic oral warfarin intake in rats on pro-inflammatory cytokine (i.e., TNFα, IL-6) production by peripheral blood mononuclear and polymorphonuclear cells (granulocytes) was examined. Differential effects of warfarin intake on TNFα and IL-6 were noted, depending on the type of peripheral blood leukocytes and on the cytokine examined. Specifically, a lack of effect on TNFα and a priming of IL-6 production by mononuclear cells along with a decrease in TNFα and a lack of effect on IL-6 in polymorphonuclear cells were seen in warfarin-exposed hosts. The cell- and cytokine-dependent effects from subchronic oral warfarin intake on peripheral blood leukocytes demonstrated in this study could, possibly, differentially affect reactions mediated by these cells. Ultimately, the observed effects in rats might have implications for those humans who are on long-term/prolonged warfarin therapy.

  20. Stellar oxygen abundances. I - A resolution to the 7774 A O I abundance discrepancy

    Science.gov (United States)

    King, Jeremy R.

    1993-09-01

    We investigate the discrepancy between O/Fe abundance ratios of metal-poor stars derived from the 7774 A O I triplet and O/Fe ratios determined from other oxygen lines. We propose a possible resolution to this discrepancy which also eliminates the correlation of O/Fe and T(eff) found in a recent 7774 A O I analysis. The equivalent widths of Abia & Rebolo (1989) are found to be systematically too high by 25 percent. Arguments are presented that current temperature estimates for halo stars are 150-200 K too low. Using the guidance of both model atmospheres and other empirical color-T(eff) relations, we construct new color temperature relations for metal-poor stars. These relations are tied to the temperature scale of Saxner & Hammarback (1985) for metal-rich stars. We use (b-y) and (V-K) indices to redetermine values of T(eff) for a handful of halo stars. (B-V)-T(eff) relations which do not take into account the effects of metallicity are found to be inadequate. Revised O/Fe ratios are determined using the new temperature scale. The mean abundance ratio of the reanalyzed halo dwarfs is about +0.52. There is no trend of O/Fe with Fe/H or T(eff).

  1. Autotransplantation of a Strange Positioned Impacted Central Incisor in a surgically Prepared Socket: A Miracle Esthetic Concept.

    Science.gov (United States)

    Jaiswara, Chandresh; Srivastava, Vinay K; Dhiman, Neeraj

    2016-01-01

    Esthetics is a prime concern for a young lady. Any anomaly in the anterior tooth may create anxiety and depression. This anxiety and depression may hamper her married life and overall personality. This case report reveals an unerupted right central incisor situated in a strange position, creating space in the maxillary anterior region and giving an unesthetic appearance. Autotransplantation is a method of choice for a strangely positioned impacted central incisor in a new appropriate site. This method offers a new treatment option for some clinical situations if orthodontic approach is not possible. It permits tooth movement to a distant or the opposite side of the same dental arch as well as to the opposite jaw. This procedure also offers potential benefits of reestablishment of normal alveolar process development, esthetics, functions, and arch integrity. This procedure has the potential to become a viable alternative treatment plan for young patients of low socioeconomic status, allowing the reestablish-ment and restoration of a missing tooth and their functions. This article discusses methods of auto-reimplantation of a tooth in a fresh surgically prepared socket, its biological principle, and establishment of functions, esthetics, and phonetics. Jaiswara C, Srivastava VK, Dhiman N. Autotransplantation of a Strange Positioned Impacted Central Incisor in a surgically Prepared Socket: A Miracle Esthetic Concept. Int J Clin Pediatr Dent 2016;9(3):269-272.

  2. Crystal structure and thermoelectric properties of the composite crystal [(Ca sub 1 sub - sub x Sr sub x) sub 2 CoO sub 3] subrho CoO sub 2

    CERN Document Server

    Miyazaki, Y; Ono, Y; Kajitani, T

    2003-01-01

    Polycrystalline samples of [(Ca sub 1 sub - sub x Sr sub x) sub 2 CoO sub 3] sub p CoO sub 2 with 0<=x<=0.20 have been synthesized at 1193 K in flowing oxygen gas. The modulated crystal structure of the samples has been determined in accordance with a four-dimensional formalism from powder neutron diffraction data. With increasing x, the modulation amplitudes in Co-Co conduction paths become less marked. The non-doped sample (x=0) exhibits the resistivity rho=150 mu OMEGA m and the thermoelectric power S=130 mu V/K at 300K. Both the rho and S values decrease with x but the decrease in rho values is steeper than that of the S values. The power factor S sup 2 /rho increase with x, from 110 mu W/m/K sup 2 (x=0) to 140 mu W/m/K sup 2 (x=0.20) at 300K. This improvement in thermoelectric performance can be explained in terms of the reduction of displacive modulation of the Co-Co conduction paths in the CoO sub 2 sheets. (author)

  3. Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI

    Directory of Open Access Journals (Sweden)

    MOHD AFIFI BAHURUDIN SETAMBAH

    2018-05-01

    Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.

  4. Technical and economical prerequisites of special district-heating nuclear power plant development

    International Nuclear Information System (INIS)

    Baturov, B.B.; Boldyrev, V.M.; Losev, V.L.; Sigal, M.V.

    1983-01-01

    Results are presented of technical and economical analysis of advisability of constructing combined Nuclear Power and Heating Plants (NPHP) assuring the possibility of their location near the areas of heat power consumption in case of observing a given degree of radiation safety for population and personnel. Specific features determining the choice of turbine-driven units for such plants are analyzed. Conditions of competiveness of a specialized NPHP with alternative power units, NPHP based on the WWER-1000 reactor and district heating plants (NDHP), are determined. Analysis of design specifications of NPHP with two VK-500 reactor units and structures of capital investments in such a plant reveal that an increase in the total capital investments in the NPHP would not exceed 2% with account of the difference in costs for grid heaters and a corresponding change in dimensions of operation rooms as well as changes in costs of heat removal system (within one site) at the TK turbine replacement by the T turbine

  5. Human vaginal epithelial cells augment autophagy marker genes in response to Candida albicans infection.

    Science.gov (United States)

    Shroff, Ankit; Sequeira, Roicy; Reddy, Kudumula Venkata Rami

    2017-04-01

    Autophagy plays an important role in clearance of intracellular pathogens. However, no information is available on its involvement in vaginal infections such as vulvo-vaginal candidiasis (VVC). VVC is intimately associated with the immune status of the human vaginal epithelial cells (VECs). The objective of our study is to decipher if autophagy process is involved during Candida albicans infection of VECs. In this study, C. albicans infection system was established using human VEC line (VK2/E6E7). Infection-induced change in the expression of autophagy markers like LC3 and LAMP-1 were analyzed by RT-PCR, q-PCR, Western blot, immunofluorescence and transmission electron microscopy (TEM) studies were carried out to ascertain the localization of autophagosomes. Multiplex ELISA was carried out to determine the cytokine profiles. Analysis of LC3 and LAMP-1 expression at mRNA and protein levels at different time points revealed up-regulation of these markers 6 hours post C. albicans infection. LC3 and LAMP-1 puncti were observed in infected VECs after 12 hours. TEM studies showed C. albicans entrapped in autophagosomes. Cytokines-TNF-α and IL-1β were up-regulated in culture supernatants of VECs at 12 hours post-infection. The results suggest that C. albicans invasion led to the activation of autophagy as a host defense mechanism of VECs. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  6. Pozvánka na konferenci "Vzdělávání v ochraně přírody a krajiny"

    Directory of Open Access Journals (Sweden)

    Jiří Dlouhý

    2010-12-01

    Podmínkou účasti na konferenci je registrace na webových stránkách projektu ENVIRUPwww.envirup.upol.cz od 1.12.2010. Na tomto webu budou uveřejněny podrobnější informace a upřesněný program konference na základě výběru konferenčních příspěvků.   Bližší informace: Doc. Ing. Ivo Machar, Ph.D., předseda organizačního výboru ( ivo.machar@upol.cz; tel. +420 585 635 188   V rámci projektu: „Environmentální vzdělávání rozvíjející uplatnění v praxi“ reg. číslo: CZ.1.07/2.2.00/07.0086

  7. Studies on the nature of intermediates in enzyme mechanisms

    International Nuclear Information System (INIS)

    Clark, J.D.

    1988-01-01

    The reaction pathway followed by malate synthase has been studied by the double isotope fractionation method to determine whether the reaction is stepwise or concerted. A primary deuterium kinetic isotope effect ( D V/K) of 1.3 ± 0.1 has been found using [ 2 H 3 ]acetyl-CoA as substrate. The 13 C isotope effect at the aldehydic carbon of glyoxylate has also been measured. For this determination, the malate product was quantitatively transformed into a new sample of malate having the carbon of interest at C-4. This material was decarboxylated to produce the appropriate CO 2 for isotope ratio mass spectrometric analysis. If the essential Zn(II) ion of yeast aldolase interacts with the carbonyl groups of bound substrates, we can expect that these will be more reactive toward reduction by borohydrides than those free in solution. Tritiated sodium borohydride was therefore used to reduce the substrates of yeast aldolase in the presence and absence of enzyme, and the enantiomeric and diastereomeric ratios of the products were analyzed. Experiments were conducted in an effort to distinguish between endocyclic and exocyclic cleavage in the hydrolysis catalyzed by lysozyme. Tritiated sodium borohydride was used in an attempt to trap the putative oxocarbonium intermediate

  8. Zlepšení dispergace křemičitého úletu ve vysokohodnotných betonech

    OpenAIRE

    Janča, Martin

    2017-01-01

    Cílem této práce bylo vytvořit metodu pro zlepšení dispergace křemičitých úletů pro použití ve vysokohodnotných betonech. Tradiční metody použité pro návrh a výrobu vysokohodnotných betonů zdůrazňují odstranění hrubých agregátů. Využívají se speciálně tříděné jemné agregáty při relativně nízkých dávkách, superplastifikátory a křemičitý úlet. Nízkého obsahu záměsové vody bylo dosaženo pomocí použití superplastifikátorů na polykarboxylátové bázi. K samotné dispergaci křemičitého úletu byla vybr...

  9. Species composition and natural infectivity of anthropophilic Anopheles (Diptera: Culicidae) in Córdoba and Antioquia states in northwestern Colombia

    Science.gov (United States)

    Gutiérrez, Lina A; González, John J; Gómez, Giovan F; Castro, Martha I; Rosero, Doris A; Luckhart, Shirley; Conn, Jan E; Correa, Margarita M

    2011-01-01

    Malaria is a serious health problem in Córdoba and Antioquia states in northwestern Colombia, where 64.4% of the total Colombian cases were reported in 2007. Because little entomological information is available in this region, the aim of this work was to identify the Anopheles species composition and natural infectivity of mosquitoes distributed in seven localities with the highest malaria transmission. A total of 1,768 Anopheles mosquitoes were collected using human landing catches from March 2007 to July 2008. Ten species were identified; overall, An. nuneztovari s.l. was the most widespread (62%) and showed the highest average human biting rates. There were six other species of the Nyssorhynchus subgenus: An. albimanus (11.6%), An. darlingi (9.8%), An. braziliensis (6.6%), An. triannulatus s.l. (3.5%), An. albitarsis s.l. and An. oswaldoi s.l. at <1%; and three of the Anopheles subgenus: An. punctimacula, An. pseudopunctipennis s.l. and An. neomaculipalpus at <1% each. Two species from Córdoba, An. nuneztovari and An. darlingi, were detected naturally infected by Plasmodium vivax VK247 using ELISA and confirmed by nested PCR. All species were active indoors and outdoors. These results provide basic information for targeted vector control strategies in these localities. PMID:20140372

  10. First Principle Quantum Description of the Energetics Associated with LaBr3, LaCl3, and Ce Doped Scintillators

    International Nuclear Information System (INIS)

    Michael E. McIlwain; Da Gao; Nick Thompson

    2007-01-01

    Considerable interest is given to the excellent scintillation properties of cerium doped lanthanum chloride (LaCl3) and lanthanum bromide (LaBr3). The scintillation efficiencies are much greater than other materials, even those containing cerium. This high efficiency is attributed to the high mobility of electrons and holes, unique placement of the cerium 5d states within the band gap, and energy of the band gap. To better understand the scintillation process and better define the nature of the Self Trapped Exciton (STE) within these unique scintillation materials, density functional theory (DFT), and Ab-initio (HF-MP2) calculations are reported. DFT calculations have yielded a qualitative description of the orbital composition and energy distribution of the band structure in the crystalline material. MP2 and single configuration interaction calculations have provided quantitative values for the band gap and provided energies for the possible range of excited states created following hole and electron creation. Based on this theoretical treatment, one possible description of the STE is the combination of Vk center (Br2-1) and LaBr+1 species that recombine to form a distorted geometry LaBr3* (triplet state). Depending on the distance between the LaBr and Br2, the STE emission band can be reproduced

  11. An X-ray fluorescence method for the determination of small quantities el elements collected on filters

    International Nuclear Information System (INIS)

    Diaz-Guerra, J.P.; Bayon, A.

    1981-01-01

    An X-ray fluorescence method for the determination of As, Ba, Co, Cr, Cu, Fe, Hg, Mn, Ni, Pb, Se, U, V and Zn collected on P.V.C. filters in concentration ranges from 0,6 to 1000μg, depending on the element, is described. A sequential automatic spectrometer with a chromium tube is used for tho Ba determination, while As, Hg, Pb, Se and U are bottler determined with a molybdenum one. For the rest of the elements a tungsten target is preferred. The interferences between AsK α 1 ,2- PbL α 1 ,2 and CrK α 1 ,2-Vkβ 1 ,3 lines are corrected by applying specific coefficients. The radial variation of the primary X-ray beam intensity on the irradiated surface has been specially studied with chromium, gold, molybdenum and tungsten tubes. For that purpose different x-ray wavelengths in the range 9,89 A to 0,56 A have been selected. The curves obtained show a rather high heterogeneity for the excitation source. This conclusion implies the need for an homogeneous distribution of elements on the filter. (Author) 7 refs

  12. Principles elaboration and creation of information-analytical system ''RI Operation Safety with SSC RIAR Research Reactors''

    International Nuclear Information System (INIS)

    Ivanov, V.B.; Grachev, A.F.; Kinsky, O.M.; Makin, P.S.; Okhrimenko, A.I.; Demidov, L.I.; Karpyuk, V.I.; Afonin, V.K.; Iskanderov, R.G.

    1995-01-01

    In this paper an approach is described, which is accepted at elaboration and creation of computer-aided control system of technological process (CCS TP) at the installations with research reactors. The tasks and the main technological requirements to elaborated information-analytical system, are formulated, based on the accepted approach, experience of computer-aided systems and analysis of technological processes at reactor installations (RI) of SSC RIAR. The system includes the following installations: the SM-3, the VK-50, the RBT-10, the BOR-60 and the MIR. Based on the given example there is a classification and the purposes of the modern system of information personnel support of research reactors are formulated as well as approaches to its creation, including creation of determined models of the processes, which are realized in simulators and statistic methods of time series. According to the accepted approaches the results of systematic-technical synthesis and modern states with system simulation are described. (author). 17 refs, 3 figs, 4 tabs

  13. Analysis of sodium metal by X-ray fluorescence spectrometry (I). Determination of Hf, Mo, Nb, Ta, Ti, V and Zr; Analisis de sodio metal por espectrometria de fluorescencia de rayos X. Determinacion de Hf, Mo, Nb, Ta, Ti, V y Zr

    Energy Technology Data Exchange (ETDEWEB)

    Diaz-Guerra, J P

    1981-07-01

    A method allowing the determination of trace quantities of Hf, Mo, Nb, Ta, Ti, Vi and Zr in sodium metal previous transformation into Na{sub 2}S0{sub 4} is described. The enrichment of the impurities is performed through a coprecipitation technique in sulfuric medium by using Fe{sup 3}+ as a collector and cupferron or phenyfluorone as the precipitating reagent. The matrix influence and the best concentration of the collector (10/{mu}/ml), adequate pH (1,3 or 4, respectively) and optimum filter type (Millipore BSWP02500 or BDWP04700, respectively) have been studied, as well as the precipitation recoveries corresponding to the reagent above. It has been demonstrated the batter efficiency of the cupferron for determining all the Impurities. Detection limits range from 0.01 to 0.2 ppm., depending on the element, for samples 4 g in weight. An automatic spectrometer attached to a 16 K minicomputer and X-ray tube with a gold anode (2250-2700 W) are used. The Interferences between the lines ZrK{alpha} (2{sup n}d order) - HfL{alpha} and TiK{beta} - VK {alpha} have been studied and the respective correction coefficients have been deduced. (Author) 8 refs.

  14. Fuzzy Modeling to Evaluate the Effect of Temperature on Batch Transesterification of Jatropha Curcas for Biodiesel Production

    Directory of Open Access Journals (Sweden)

    Vipan Kumar Sohpal

    2011-05-01

    Full Text Available Biodiesel is an alternative source of fuel that can be synthesized from edible, non-edible and waste oils through transesterification. Firstly Transesterification reaction of Jatropha Curcas oil with butanol in the ratio of 1:25 investigated by using of sodium hydroxide catalyst with mixing intensity of 250 rpm in isothermal batch reactor. Secondly the fuzzy model of the temperature is developed. Performance was evaluated by comparing fuzzy model with the batch kinetic data. Fuzzy models were developed using adaptive neurofuzzy inference system (ANFIS. © 2011 BCREC UNDIP. All rights reserved(Received: 27th January 2011, Revised: 13rd February 2011; Accepted: 16th February 2011[How to Cite: V.K. Sohpal, A. Singh, A. Dey. (2011. Fuzzy Modeling to Evaluate the Effect of Temperature on Batch Transesterification of Jatropha Curcas for Biodiesel Production. Bulletin of Chemical Reaction Engineering and Catalysis, 6(1: 31-38. doi:10.9767/bcrec.6.1.816.31-38][How to Link / DOI: http://dx.doi.org/10.9767/bcrec.6.1.816.31-38 || or local:  http://ejournal.undip.ac.id/index.php/bcrec/article/view/816 ] | View in 

  15. Angiotensin I-Converting Enzyme Inhibitor Derived from Cross-Linked Oyster Protein

    Directory of Open Access Journals (Sweden)

    Cheng-Liang Xie

    2014-01-01

    Full Text Available Following cross-linking by microbial transglutaminase, modified oyster proteins were hydrolyzed to improve inhibitory activity against angiotensin-converting enzyme (ACE inhibitory activity with the use of a single protease, or a combination of six proteases. The oyster hydrolysate with the lowest 50% ACE inhibitory concentration (IC50 of 0.40 mg/mL was obtained by two-step hydrolysis of the cross-linked oyster protein using Protamex and Neutrase. Five ACE inhibitory peptides were purified from the oyster hydrolysate using a multistep chromatographic procedure comprised of ion-exchange, size exclusion, and reversed-phase liquid chromatography. Their sequences were identified as TAY, VK, KY, FYN, and YA, using automated Edman degradation and mass spectrometry. These peptides were synthesized, and their IC50 values were measured to be 16.7, 29.0, 51.5, 68.2, and 93.9 μM, respectively. Toxicity of the peptides on the HepG2 cell line was not detected. The oyster hydrolysate also significantly decreased the systolic blood pressure of spontaneously hypertensive rats (SHR. The antihypertensive effect of the oyster hydrolysate on SHR was rapid and long-lasting, compared to commercially obtained sardine hydrolysate. These results suggest that the oyster hydrolysate could be a source of effective nutraceuticals against hypertension.

  16. Hypothermia due to limbic system involvement and longitudinal myelitis in a case of Japanese encephalitis: a case report from India

    Directory of Open Access Journals (Sweden)

    Narayanan S

    2017-04-01

    Full Text Available Santhosh Narayanan,1 NK Thulaseedharan,1 Gomathy Subramaniam,2 Geetha Panarkandy,1 VK Shameer,1 Arathi Narayanan1 1Department of General Medicine, 2Department of Radiodiagnosis, Government Medical College, Kozhikode, Kerala, India Abstract: Japanese encephalitis (JE is an infectious encephalitis prevalent in Asia. It usually presents with fever, headache, convulsions and extrapyramidal symptoms. Limbic system involvement and hypothermia though common in autoimmune encephalitis have never been reported in JE. We report a case of an 18-year-old girl with no previous comorbidities who presented to us with a history of fever and headache for 1 week duration. She developed bilateral lateral rectus palsy and asymmetric flaccid weakness of all four limbs, after 2 days of admission, which was followed by altered sensorium and intermittent hypothermia. Neuroimaging revealed longitudinal myelitis extending from pons till the L1 level along with bilateral thalamic hemorrhage in brain. Cerebrospinal fluid (CSF was positive for IgM antibody to JE virus. She was treated with supportive measures, but she developed intractable hypothermia and seizures and succumbed to illness after 2 weeks of admission. Keywords: Japanese encephalitis, hypothermia, limbic system

  17. The Thermal Neutron Beam Option for NECTAR at MLZ

    Science.gov (United States)

    Mühlbauer, M. J.; Bücherl, T.; Genreith, C.; Knapp, M.; Schulz, M.; Söllradl, S.; Wagner, F. M.; Ehrenberg, H.

    The beam port SR10 at the neutron source FRM II of Heinz Maier-Leibnitz Zentrum (MLZ) is equipped with a moveable assembly of two uranium plates, which can be placed in front of the entrance window of the beam tube via remote control. With these plates placed in their operating position the thermal neutron spectrum produced by the neutron source FRM II is converted to fission neutrons with 1.9 MeV of mean energy. This fission neutron spectrum is routinely used for medical applications at the irradiation facility MEDAPP, for neutron radiography and tomography experiments at the facility NECTAR and for materials testing. If, however, the uranium plates are in their stand-by position far off the tip of the beam tube and the so-called permanent filter for thermal neutrons is removed, thermal neutrons originating from the moderator tank enter the beam tube and a thermal spectrum becomes available for irradiation or activation of samples. By installing a temporary flight tube the beam may be used for thermal neutron radiography and tomography experiments at NECTAR. The thermal neutron beam option not only adds a pure thermal neutron spectrum to the energy ranges available for neutron imaging at MLZ instruments but it also is an unique possibility to combine two quite different neutron energy ranges at a single instrument including their respective advantages. The thermal neutron beam option for NECTAR is funded by BMBF in frame of research project 05K16VK3.

  18. Comparative Evaluation of the Antimicrobial Properties of Glass Ionomer Cements with and without Chlorhexidine Gluconate.

    Science.gov (United States)

    Yadiki, Josna Vinutha; Jampanapalli, Sharada Reddy; Konda, Suhasini; Inguva, Hema Chandrika; Chimata, Vamsi Krishna

    2016-01-01

    Chlorhexidine gluconate is a widely used antimicrobial agent. Adding chlorhexidine and quaternary ammonium compounds to filling materials, such as composite resins, acrylic resins, and glass ionomer cements increases the antibacterial property of restorative materials. This study includes antibacterial property of glass ionomer restorative cements with chlorhexidine gluconate. The primary objective of our study was to compare the antimicrobial properties of two commercially available glass ionomer cements with and without chlorhexidine gluconate on strains of mutans streptococci. Two glass ionomers (Fuji II Conventional and Fuji IX) were used. Chlorhexidine gluconate was mixed with glass ionomer cements, and antimicrobial properties against mutans streptococci were assessed by agar diffusion. The tested bacterial strain was inhibited and the antimicrobial properties decreased with time. The highest amount of antimicrobial activity with mean inhibitory zone was found in Fuji II with chlorhexidine gluconate followed by Fuji IX with chlorhexidine gluconate, Fuji II without chlorhexidine gluconate, and Fuji IX without chlorhexidine gluconate. The results of the study confirmed that the addition of 5% chlorhexidine gluconate to Fuji II and Fuji IX glass ionomer cements resulted in a restorative material that had increased antimicrobial properties over the conventional glass ionomer cements alone for Streptococcus mutans. How to cite this article: Yadiki JV, Jampanapalli SR , Konda S, Inguva HC, Chimata VK. Comparative Evaluation of the Antimicrobial Properties of Glass Ionomer Cements with and without Chlorhexidine Gluconate. Int J Clin Pediatr Dent 2016;9(2):99-103.

  19. Development of Communication in Children with Autism Spectrum Disorders in the United States and Russia

    Directory of Open Access Journals (Sweden)

    Esterbrook R.L.,

    2016-10-01

    Full Text Available The article presents an analysis of theoretical principles and methodological approaches within the framework of research schools both in the United States and Russia; these schools provide the basis for the development of effective learning and communication skills for children with Autism Spectrum Disorders (ASD. The authors consider the indicators for communication disorders in children with ASD, as well as the main strategies for overcoming them in the context of utilizing verbal behavior analysis (B.F. Skinner, M.L. Sundberg, J.W. Partington, and M.L. Barbera - USA, the tradition of cultural-historical psychology (L.S. Vygotsky, D.B. Elkonin, B.D. Elkonin - Russia, reflective-activity approach (A.N. Leontiev, V.K. Zaretsky – Russia, the theory of systemic dynamic localization of higher mental functions(A.R. Luria – Russia, and method of ”replacing ontogenesis” (B.A. Arkhipov, A.V. Semenovich Russia. Despite the differences in methodologies used by American and Russian scholars, the most important idea is that the researchers and practitioners of both schools have common goal: to concentrate their efforts on developing social interaction skills in children with ASD, which helps them to better adjust in their lives and function in the social environment

  20. Engineering a degradable polyurethane intravaginal ring for sustained delivery of dapivirine.

    Science.gov (United States)

    Kaur, Manpreet; Gupta, Kavita M; Poursaid, Azadeh E; Karra, Prasoona; Mahalingam, Alamelu; Aliyar, Hyder A; Kiser, Patrick F

    2011-06-01

    We describe the engineering of a degradable intravaginal ring (IVR) for the delivery of the potent HIV-1 reverse transcriptase inhibitor dapivirine. The degradable polymer used in fabricating the device incorporated poly(caprolactone) ester blocks in a poly(tetramethylene ether) glycol ABA type polyurethane backbone. The polymer was designed to maintain its structure for 1 month during usage and then degrade in the environment post-disposal. In vitro release of dapivirine showed zero-order kinetics for up to 1 month and significant levels of drug release into engineered vaginal tissue. The mechanical properties of the degradable IVR were comparable to those of a widely used contraceptive intravaginal ring upon exposure to simulated vaginal conditions. Incubation under simulated vaginal conditions for a month caused minimal degradation with minimal effect on the mechanical properties of the ring and polymer. The cytotoxicity evaluation of the drug-loaded IVRs against Vk2/E6E7 human vaginal epithelial cells, Lactobacillus jensenii, and engineered vaginal tissue constructs showed the degradable polyurethane to be non-toxic. In vitro evaluation of inflammatory potential monitored through the levels of inflammatory cytokines IL-8, IL-1α, IL-6, IL-1β, and MIP-3α when engineered EpiVaginal™ tissue was incubated with the polyurethanes suggested that the degradable polyurethane was comparable to commercial medical grade polyurethane. These results are encouraging for further development of this degradable IVR for topical vaginal delivery of microbicides.