Maria Rizzarelli, Una terra che è solo visione. La poesia di Pasolini tra cinema e pittura

Directory of Open Access Journals (Sweden)

Paolo Lago

2016-11-01

Full Text Available La contaminazione tra scrittura e visione, la «natura anfibologica» tra parola e immagine, secondo una definizione dello stesso autore, risulta fondamentale nell’intera opera letteraria di Pier Paolo Pasolini.

Zaustavljanje broda koji nije u vlasništvu osobe odgovorne za pomorsku tražbinu : [prikaz presude

Directory of Open Access Journals (Sweden)

Jasenko Marin

2002-12-01

Full Text Available Načelno, privremeno zaustavljen može biti samo brod čiji je vlasnik protivnik osiguranja, odnosno osoba odgovorna za pomorsku tražbinu čije se osiguranje traži. U skladu s tim nije dopušteno zaustavljanje broda u vlasništvu trgovačkog društva čiji je jedini član osoba odgovorna za pomorsku tražbinu.

Emozionanti mostri femminili tra storia e cinema

Directory of Open Access Journals (Sweden)

Angela Giallongo

2014-10-01

Full Text Available Ricorrendo al concetto chiave di paura, usato come categoria storica, il presente contributo esamina l’antico mito gorgonico in sette film e in alcuni esempi di Teen Movies. L’analisi critica focalizza l’attenzione sull’interdipendenza tra le emozioni negative, gli usi attuali di questa immagine archetipica e la ricerca storica sull’immaginario di genere.

The Evolution of NR TrA (Nova TrA 2008) from 2008 through 2017

Science.gov (United States)

Walter, Frederick M.; Burwitz, Vadim; Kafka, Stella

2018-06-01

The classical nova NR TrA was discovered as an O-type optically-thick classical nova. There is no evidence that it formed dust. Within four years the envelope became sufficiently thin to reveal an eclipsing accretion disk-dominated system with orbitally-modulated permitted lines of C IV, N V, and O VI. XMM observations reveal a non-eclipsing soft X-ray source and a deeply-eclipsing UV continuum. We will present the first ten years of optical spectral evolution of this system accompanied by ten years of BVRIJHK photometry, with an eye to deciphering the current nature of the system.

HWMA/RCRA Closure Plan for the TRA Fluorinel Dissolution Process Mockup and Gamma Facilities Waste System

International Nuclear Information System (INIS)

K. Winterholler

2007-01-01

This Hazardous Waste Management Act/Resource Conservation and Recovery Act closure plan was developed for the Test Reactor Area Fluorinel Dissolution Process Mockup and Gamma Facilities Waste System, located in Building TRA-641 at the Reactor Technology Complex (RTC), Idaho National Laboratory Site, to meet a further milestone established under the Voluntary Consent Order SITE-TANK-005 Action Plan for Tank System TRA-009. The tank system to be closed is identified as VCO-SITE-TANK-005 Tank System TRA-009. This closure plan presents the closure performance standards and methods for achieving those standards

Different foods in larvicultura of traíra (Hoplias malabaricus

Directory of Open Access Journals (Sweden)

Samuel Louzada Pereira

2015-10-01

Full Text Available ABSTRACT. Pereira S.L., Mendonça P.P., Pellanda A.S., Matielo M.D. & Gon- çalves Junior L.P. [Different foods in larvicultura of traíra (Hoplias malabaricus.] Utilização de diferentes alimentos na larvicultura de traíra (Hoplias malabaricus. Revista Brasileira de Medicina Veterinária, 37(3:233-238, 2015. Universidade Estadual do Norte Fluminense Darcy Ribeiro, Avenida Alberto Lamego, 2000, Parque Califórnia, Campos dos Goytacazes, RJ 28013-602, Brasil. E-mail: samuell_lp@hotmail.com The feeding in the larviculture of species carnivorous view point for closing of the technological packages of rearing culture. Developed in the sector of Aquicultura of the IFES - Campus of Alegre, this work it aimed at to compare the performance with four diet feed as first exogenous feeding for traíra (Hoplias malabaricus, parameters evaluated: Survival, length final (CF, final weight (PF, tax of specific growth (TCE, development tax specifies (TDE, being put in container with fifteen liters of water, with constant aeration, have five larva of traíra/container. The delineation entire was aleatory with four treatments and five repetitions. Being the diet feeds represented for T1: Nauplios de Artemia sp.; T2: microworm of oats (Pannagrelos redivivus; T3: Wild Zooplâncton; e the inert food represented by T4: Commercial ration in dust with 55% of crude protein and 4,200 Kcal de ED/kg of ration. The water exchange was of 80% daily, the average temperature was of 27.5±1°C. The indices of survival in the T1, T2, T3 and T4, had been 84%, 72%, 100% and 92%, respectively. The date had been submitted analyze it statistics ANOVA and test of Tukey (P<0.01. Wild Zooplâncton was biggest CTF, PF, GP, TCE and TDE. Did not have difference statistics between the Artemia sp. the ration for TCE and TDE. The microworm of oats was minor CF, PF, TCE and TDE. The treatment Wild zooplankton (T3 showed optimum diet food among the other diet feeds tested for the development and

La memoria del trauma della Shoah nella costruzione dell’identità europea

Directory of Open Access Journals (Sweden)

David Meghnagi

2009-12-01

Full Text Available Il trauma della Shoah ha richiesto decenni per essere elaborato collettivamente, riemergendo dalla lunga rimozione che ha coinvolto lo stesso mondo ebraico. Tale tragico evento oramai rappresenta un mito di fondazione dell’ identità europea: essa è ciò che il mondo non avrebbe più voluto che si ripetesse, il simbolo del male assoluto.L’Autore si interroga su come abbia fatto l’ebraismo a sopravvivere a questa catastrofe e si addentra nei processi di elaborazione collettiva del lutto. Da una iniziale tendenza a rimuovere o negare l’esperienza per non esserne sopraffatti, si è arrivati gradualmente alla consapevolezza dell’accaduto per integrarlo nella memoria.  La tessitura dei ricordi è avvenuta nel dialogo tra le generazioni: il lutto è un momento importante di riconciliazione e di ricostruzione dell’identità collettiva.Israele è collocato tra Occidente e Oriente, anzi, è al tempo stesso Occidente e Oriente e per tali caratteristiche rappresenta la possibilità vivente di una composizione storica,  politica e morale dei conflitti che insanguinano la regione.

Integrated approach for disease management and growth enhancement of Sesamum indicum L. utilizing Azotobacter chroococcum TRA2 and chemical fertilizer.

Science.gov (United States)

Maheshwari, D K; Dubey, R C; Aeron, Abhinav; Kumar, Bhavesh; Kumar, Sandeep; Tewari, Sakshi; Arora, Naveen Kumar

2012-10-01

Azotobacter chroococcum TRA2, an isolate of wheat rhizosphere displayed plant growth promoting attributes including indole acetic acid, HCN, siderophore production, solubilization of inorganic phosphate and fixation of atmospheric nitrogen. In addition, it showed strong antagonistic effect against Macrophomina phaseolina and Fusarium oxysporum. It also caused degradation and digestion of cell wall components, resulting in hyphal perforations, empty cell (halo) formation, shrinking and lysis of fungal mycelia along with significant degeneration of conidia. Fertilizer adaptive variant strain of A. chroococcum TRA2 was studied with Tn5 induced streptomycin resistant transconjugants of wild type tetracycline-resistant TRA2 (designated TRA2(tetra+strep+)) after different durations. The strain was significantly competent in rhizosphere, as its population increased by 15.29 % in rhizosphere of Sesamum indicum. Seed bacterization with the strain TRA2 resulted in significant increase in vegetative growth parameters and yield of sesame over the non-bacterized seeds. However, application of TRA2 with half dose of fertilizers showed sesame yield almost similar to that obtained by full dose treatment. Moreover, the oil yield increased by 24.20 %, while protein yield increased by 35.92 % in treatment receiving half dose of fertilizer along with TRA2 bacterized seeds, as compared to untreated control.

Clinical use of serum TRA-1-60 as tumor marker in patients with germ cell cancer

DEFF Research Database (Denmark)

Lajer, Henrik; Daugaard, Gedske; Andersson, Anna-Maria

2002-01-01

TRA-1-60 antigen has been related to the presence of embryonal germ cell carcinoma (EC) and carcinoma in situ. Our study further investigated the clinical efficacy of TRA-1-60 as a serum tumor marker for germ cell cancer in the testis. Three groups of patients with germ cell tumors were included:...

Simultaneous spectral and photometric observations of the beat Cepheid U TrA

International Nuclear Information System (INIS)

Niva, G.D.; Schmidt, E.G.

1981-01-01

It was suggested that U TrA was a Cepheid with a modulated light curve. Further photometric and radial-velocity observations have confirmed this behaviour. Unfortunately, the radial velocities are too few in number and too scattered to allow a detailed analysis. This paper presents further photometric and spectroscopic observations of U TrA. The original intent was to obtain enough simultaneous observations to perform a Wesselink analysis similar to the one made for another beat Cepheid, TU Cas. Unfortunately, this has not been possible. However, the data obtained are of high quality and are clearly useful in studies of the modal content and period stability of the star. (author)

Assessment of exposure to traffic pollution using the ExTra index: study of validation

International Nuclear Information System (INIS)

Reungoat, Patrice; Chiron, Mireille; Gauvin, Stephanie; Le Moullec, Y.; Momas, Isabelle

2003-01-01

The ExTra index, produced by the French Scientific Center for Building Physics, evaluates ambient concentrations of transport-related pollutants in front of the work and living places of urban dwellers. This study contributes to the validation of the ExTra index by carrying out measurements in four French cities. It compares nitrogen oxide concentrations (NO x ) measured over 6 weeks with passive samplers, and NO x calculated concentrations using the ExTra index. The study takes into account traffic density, topographical parameters (building height, road, and pavement width), weather conditions (wind direction and strength), and background pollution levels. The model was tested at 100 street canyons sites. There were highly significant correlations (0.90 in Grenoble, 0.95 in Nice, 0.89 in Paris, and 0.89 in Toulouse) and good intraclass correlation coefficients (0.75 in Grenoble, 0.91 in Nice, 0.89 in Paris, and 0.86 in Toulouse) between the two series of values. These results suggest that if the ExTra index were to be applied to all the different residences and workplaces of a subject throughout his (her) life, it could be a useful epidemiological tool for studying the long-term health effects of transport-related emissions and for reconstructing individual exposure to such pollution in order to avoid misclassification

Cartografar é traçar um plano comum

Directory of Open Access Journals (Sweden)

Virgínia Kastrup

2013-08-01

Full Text Available A pesquisa de campo sobre produção da subjetividade enfrenta o problema de construir conhecimento envolvendo pesquisadores e pesquisados, com territórios e semióticas singulares. Surgem questões relativas ao protagonismo dos participantes e a como traçar com eles um plano comum, garantindo o caráter participativo da pesquisa. No contexto do método da cartografia, o artigo tem como objetivo tratar do tema do comum num duplo aspecto. Num primeiro, discute o acesso ao plano comum. Com base em Gilles Deleuze e Felix Guattari, tal plano não é dito homogêneo nem reúne atores que manteriam entre si relações de identidade, mas opera comunicação entre singularidades, sendo pré-individual e coletivo. Num segundo aspecto, aponta que, enquanto pesquisa-intervenção, a cartografia se compromete com a criação de um mundo comum e heterogêneo. O artigo mostra que o traçado do comum tem como diretriz metodológica a tranversalidade e examina os procedimentos de participação, inclusão e tradução.

Torque nos rodados motrizes de um trator agrícola submetido a ensaios de tração

Directory of Open Access Journals (Sweden)

Diego A. Fiorese

2015-09-01

Full Text Available RESUMOA determinação do torque nos rodados motrizes dos tratores agrícolas complementa os ensaios de tração e permite o cálculo da distribuição dos esforços tratórios entre os eixos. O objetivo principal desta pesquisa foi determinar a demanda de torque nos rodados motrizes de um trator com potência do motor de 89 kW, buscando avaliar o torque demandado em função da utilização da tração dianteira assistida (TDA, para distintas marchas e conforme aumento da força de tração. Foram realizados ensaios de tração sobre pista de concreto utilizando-se um torciômetro instalado no eixo traseiro do trator, um carro dinamométrico e instrumentação eletrônica para aquisição de dados. Avaliaram-se a TDA ligada e desligada, quatro marchas (5, 7, 8 e 9 km h-1 e oito cargas na barra de tração (4, 8, 12, 16, 20, 24, 28, 30 kN. Os resultados analisados estatisticamente através de equações de regressão indicaram comportamento similar para todas as marchas sendo que, conforme o aumento da força de tração ocorreu crescimento linear da demanda de torque nos eixos motrizes. Com a TDA ligada nas cargas mais baixas o torque é maior no eixo dianteiro e nas cargas mais altas é maior no eixo traseiro.

Giorgio Perlasca, 'Giusto tra le nazioni' e 'eroe italiano'

NARCIS (Netherlands)

Jansen, M.M.

2008-01-01

Giorgio Perlasca che, fingendosi console spagnolo, nel 1944 salvò più di cinquemila ebrei ungheresi a Budapest, è stato proclamato “Giusto tra le Nazioni” a Yad Vashem nel 1989, dopo di che è seguito il suo riconoscimento all’estero ed in Italia come “uomo giusto” e come “eroe italiano”. Dopo il

La portata etica della tragedia tra Bernard Williams e Martha Nussbaum

Directory of Open Access Journals (Sweden)

Francesco Testini

2015-11-01

Full Text Available Questo breve scritto si propone di ripercorrere sinteticamente alcuni nodi fondamentali del dibattito filosofico tra Bernard Williams e Martha Nussbaum sul significato e sul valore etico della rappresentazione tragica non tanto all’interno del mondo greco quanto per la contemporaneità. Il campo su cui questa analisi intende muoversi è delimitato principalmente da due testi fondamentali come Vergogna e Necessità e l’introduzione alla nuova edizione del 2001, insieme alla prima parte, de La fragilità del bene. Si cercherà di mostrare lo scarto tra queste due diverse concezioni riconducendo ad ognuna il particolare atteggiamento etico che sostiene; di questi diversi punti di vista si cercherà di ricostruire il nesso con le differenti interpretazioni che i due autori forniscono dell’Agamennone di Eschilo e con le diverse reazioni che motivano nei confronti del protagonista e della sua vicenda. Gli obiettivi delle argomentazioni che seguono sono principalmente due: innanzitutto evidenziare come in alcune delle critiche mosse dalla filosofa americana al collega britannico siano rinvenibili spunti fondamentali per quella che si ritiene una più completa comprensione della tragedia come caso limite del conflitto tra soggetto etico e mondo e, in secondo luogo, produrre una giustificazione filosofica ulteriore della reazione motivata da Nussbaum davanti alla condotta di Agamennone che sia compatibile con l’approccio di Williams attraverso una riproposizione del conflitto di valori in termini di conflitto di ruoli.

Exact Tandem Repeats Analyzer (E-TRA): A new program for DNA ...

Indian Academy of Sciences (India)

Unknown

Advanced user defined parameters/options let the researchers use different minimum motif repeats ... E-TRA, we used 5,465,605 human EST sequences derived from 18,814,550 ..... repeat rates of T-cells, embryo and testis were higher.

Abbreviated sampling and analysis plan for planning decontamination and decommissioning at Test Reactor Area (TRA) facilities

International Nuclear Information System (INIS)

1994-10-01

The objective is to sample and analyze for the presence of gamma emitting isotopes and hazardous constituents within certain areas of the Test Reactor Area (TRA), prior to D and D activities. The TRA is composed of three major reactor facilities and three smaller reactors built in support of programs studying the performance of reactor materials and components under high neutron flux conditions. The Materials Testing Reactor (MTR) and Engineering Test Reactor (ETR) facilities are currently pending D/D. Work consists of pre-D and D sampling of designated TRA (primarily ETR) process areas. This report addresses only a limited subset of the samples which will eventually be required to characterize MTR and ETR and plan their D and D. Sampling which is addressed in this document is intended to support planned D and D work which is funded at the present time. Biased samples, based on process knowledge and plant configuration, are to be performed. The multiple process areas which may be potentially sampled will be initially characterized by obtaining data for upstream source areas which, based on facility configuration, would affect downstream and as yet unsampled, process areas. Sampling and analysis will be conducted to determine the level of gamma emitting isotopes and hazardous constituents present in designated areas within buildings TRA-612, 642, 643, 644, 645, 647, 648, 663; and in the soils surrounding Facility TRA-611. These data will be used to plan the D and D and help determine disposition of material by D and D personnel. Both MTR and ETR facilities will eventually be decommissioned by total dismantlement so that the area can be restored to its original condition

Tra cinema e fumetto: due usi del montaggio

Directory of Open Access Journals (Sweden)

Giuseppe Saitta

2016-01-01

Full Text Available Entrambi linguaggi visivi, ove la narrazione si dipana grazie al rapporto di interdipendenza cheogni singola immagine intrattiene con l'immagine che la precede e quella che le succede. Pur dovendo ricorrere dunque a un montaggio di immagini, fumetto e cinema presentano tra di loro grandi differenze, ma anche grandi similitudini. Cercheremo di scoprire quali sono affidandoci all'analisi della duplice trasposizione di "300" da parte di Frank Miller e Zack Snyder.

ART, Stoffenmanager, and TRA: A Systematic Comparison of Exposure Estimates Using the TREXMO Translation System.

Science.gov (United States)

Savic, Nenad; Gasic, Bojan; Vernez, David

2017-12-15

Several occupational exposure models are recommended under the EU's REACH legislation. Due to limited availability of high-quality exposure data, their validation is an ongoing process. It was shown, however, that different models may calculate significantly different estimates and thus lead to potentially dangerous conclusions about chemical risk. In this paper, the between-model translation rules defined in TREXMO were used to generate 319000 different in silico exposure situations in ART, Stoffenmanager, and ECETOC TRA v3. The three models' estimates were computed and the correlation and consistency between them were investigated. The best correlated pair was Stoffenmanager-ART (R, 0.52-0.90), whereas the ART-TRA and Stoffenmanager-TRA correlations were either lower (R, 0.36-0.69) or no correlation was found. Consistency varied significantly according to different exposure types (e.g. vapour versus dust) or settings (near-field versus far-field and indoors versus outdoors). The percentages of generated situations for which estimates differed by more than a factor of 100 ranged from 14 to 97%, 37 to 99%, and 1 to 68% for Stoffenmanager-ART, TRA-ART, and TRA-Stoffenmanager, respectively. Overall, the models were more consistent for vapours than for dusts and solids, near-fields than for far-fields, and indoor than for outdoor exposure. Multiple linear regression analyses evidenced the relationship between the models' parameters and the relative differences between the models' predictions. The relative difference can be used to estimate the consistency between the models. Furthermore, the study showed that the tiered approach is not generally applicable to all exposure situations. These findings emphasize the need for a multiple-model approach to assessing critical exposure scenarios under REACH. Moreover, in combination with occupational exposure measurements, they might also be used for future studies to improve prediction accuracy. © The Author(s) 2017

Estudo comparativo entre traços de argamassa de revestimento utilizadas em Porto Alegre

OpenAIRE

Eduardo Dubaj

2000-01-01

Existe hoje na construção civil uma grande variedade de traços de argamassa para revestimento. Estes traços são, muitas vezes, utilizados de maneira inadequada, não levando-se em consideração as solicitações a que estes revestimentos serão submetidos. Este uso inadequado é muitas vezes o responsável pelo surgimento de manifestações patológicas que conduzem a diminuição da vida útil de um componente ou de uma edificação como um todo, conduzindo a gastos com sua recuperação e até a total insati...

TraLaLa Blip: Community Music for the Electronically Abled

Science.gov (United States)

Reimann, Randolf

2012-01-01

This article presents a personal reflection on the use of electronic music as a vehicle for community music in a disability setting. In order to do this, I draw on my experiences as the founder, facilitator, producer, tutor, sound artist and musician of TraLaLa Blip. I established the group in 2008, after having worked with people with…

OSSERVAZIONI SU UNO SCAMBIO DI POEMETTI TRA PIETRO STANCOVICH E MARTINO FIORANTI

Directory of Open Access Journals (Sweden)

Sandro Cergna

2013-01-01

Full Text Available Il lavoro presenta un’analisi comparata tra due poemetti d’occasione in dialetto istroveneto dell’Istria sud-occidentale. I componimenti, scritti nel 1826 dal dignanese Martino Fioranti e dal canonico di Barbana Pietro Stancovich, rappresentano un’importante attestazione della presenza di un’attività poetica in quella che rappresentava all’epoca la koiné del territorio istriano, cioè l’idioma di diretta derivazione veneziana. I poemetti rivestono scarsa importanza a livello letterario. Più interessanti si rivelano, invece, se osservati da una prospettiva storica e documentaristica, attraverso la quale ci si svela l’ambiente, il costume dell’epoca, e soprattutto il rapporto di cordiale amicizia che univa i due poeti. In chiusura del lavoro si dà un breve confronto tra il poemetto e i tre sonetti di Martino Fioranti, rinvenuti nell’archivio della Biblioteca universitaria di Pola.

Work life balance tra limiti istituzionali e pratiche innovative

Directory of Open Access Journals (Sweden)

Giovanna Campanella

2017-12-01

Full Text Available Come rispondono le politiche di conciliazione cura-lavoro alle esigenze delle lavoratrici e dei lavoratori di nuova generazione: sempre più precari, poveri e instabili dal punto di vista reddituale e/o professionale? Con un sostanziale immobilismo politico.  Questo è il quadro che viene fuori da una rassegna delle principali politiche sociali italiane volte a supporto della genitorialità e alla garanzia dell’occupazione femminile. Il contributo mette in luce i limiti di tali politiche e coglie gli aspetti innovativi di pratiche che si sviluppano dal basso.  Al contempo, una riflessione al margine lascia aperta una importante questione sul rapporto tra flessibilità e conciliazione, ovvero tra organizzazione del lavoro e tempi di cura per la famiglia. Nell’era della rivoluzione digitale,  individuamo forti resistenze al cambiamento, sia da parte delle istituzioni, ma anche e soprattutto dal mondo produttivo, che vanta si modelli “agili” di forme di lavoro da un punto di vista formale (vedi il lavoro agile/ smart working ma che dal punto di vista sostanziale rimane radicato a modelli di contrattazione standar che non agevola né la condizioine lavorativa da un punto di vista di tutele né la conciliaizone cura lavoro e quindi l’occupazione femminile.

Unique Helicase Determinants in the Essential Conjugative TraI Factor from Salmonella enterica Serovar Typhimurium Plasmid pCU1

Energy Technology Data Exchange (ETDEWEB)

McLaughlin, Krystle J.; Nash, Rebekah P.; Redinbo, Mathew R. (UNC)

2014-06-16

The widespread development of multidrug-resistant bacteria is a major health emergency. Conjugative DNA plasmids, which harbor a wide range of antibiotic resistance genes, also encode the protein factors necessary to orchestrate the propagation of plasmid DNA between bacterial cells through conjugative transfer. Successful conjugative DNA transfer depends on key catalytic components to nick one strand of the duplex DNA plasmid and separate the DNA strands while cell-to-cell transfer occurs. The TraI protein from the conjugative Salmonella plasmid pCU1 fulfills these key catalytic roles, as it contains both single-stranded DNA-nicking relaxase and ATP-dependent helicase domains within a single, 1,078-residue polypeptide. In this work, we unraveled the helicase determinants of Salmonella pCU1 TraI through DNA binding, ATPase, and DNA strand separation assays. TraI binds DNA substrates with high affinity in a manner influenced by nucleic acid length and the presence of a DNA hairpin structure adjacent to the nick site. TraI selectively hydrolyzes ATP, and mutations in conserved helicase motifs eliminate ATPase activity. Surprisingly, the absence of a relatively short (144-residue) domain at the extreme C terminus of the protein severely diminishes ATP-dependent strand separation. Collectively, these data define the helicase motifs of the conjugative factor TraI from Salmonella pCU1 and reveal a previously uncharacterized C-terminal functional domain that uncouples ATP hydrolysis from strand separation activity.

Candidate Essential Genes in Burkholderia cenocepacia J2315 Identified by Genome-Wide TraDIS

KAUST Repository

Wong, Yee-Chin

2016-08-22

Burkholderia cenocepacia infection often leads to fatal cepacia syndrome in cystic fibrosis patients. However, antibiotic therapy rarely results in complete eradication of the pathogen due to its intrinsic resistance to many clinically available antibiotics. Recent attention has turned to the identification of essential genes as the proteins encoded by these genes may serve as potential targets for development of novel antimicrobials. In this study, we utilized TraDIS (Transposon Directed Insertion-site Sequencing) as a genome-wide screening tool to facilitate the identification of B. cenocepacia genes essential for its growth and viability. A transposon mutant pool consisting of approximately 500,000 mutants was successfully constructed, with more than 400,000 unique transposon insertion sites identified by computational analysis of TraDIS datasets. The saturated library allowed for the identification of 383 genes that were predicted to be essential in B. cenocepacia. We extended the application of TraDIS to identify conditionally essential genes required for in vitro growth and revealed an additional repertoire of 439 genes to be crucial for B. cenocepacia growth under nutrient-depleted conditions. The library of B. cenocepacia mutants can subsequently be subjected to various biologically related conditions to facilitate the discovery of genes involved in niche adaptation as well as pathogenicity and virulence.

Candidate Essential Genes in Burkholderia cenocepacia J2315 Identified by Genome-Wide TraDIS

KAUST Repository

Wong, Yee-Chin; Abd El Ghany, Moataz; Naeem, Raeece; Lee, Kok-Wei; Tan, Yung-Chie; Pain, Arnab; Nathan, Sheila

2016-01-01

Burkholderia cenocepacia infection often leads to fatal cepacia syndrome in cystic fibrosis patients. However, antibiotic therapy rarely results in complete eradication of the pathogen due to its intrinsic resistance to many clinically available antibiotics. Recent attention has turned to the identification of essential genes as the proteins encoded by these genes may serve as potential targets for development of novel antimicrobials. In this study, we utilized TraDIS (Transposon Directed Insertion-site Sequencing) as a genome-wide screening tool to facilitate the identification of B. cenocepacia genes essential for its growth and viability. A transposon mutant pool consisting of approximately 500,000 mutants was successfully constructed, with more than 400,000 unique transposon insertion sites identified by computational analysis of TraDIS datasets. The saturated library allowed for the identification of 383 genes that were predicted to be essential in B. cenocepacia. We extended the application of TraDIS to identify conditionally essential genes required for in vitro growth and revealed an additional repertoire of 439 genes to be crucial for B. cenocepacia growth under nutrient-depleted conditions. The library of B. cenocepacia mutants can subsequently be subjected to various biologically related conditions to facilitate the discovery of genes involved in niche adaptation as well as pathogenicity and virulence.

Vestite alla turchesca. Travestimenti orientali nella drammaturgia italiana e francese tra Sei e Settecento

Directory of Open Access Journals (Sweden)

Stefano Agostino Moretti

2011-11-01

Full Text Available Da secoli il Mar Mediterraneo rappresenta un confine tra due mondi. Gli orientalisti li chiamavano e continuano a chiamarli mondo “arabo” e mondo “cristiano”. Questo contributo vuole mostrare come, in tempi non sospetti, l’Italia rappresentasse un ponte tra queste due culture. Grazie agli strumenti della storiografia contemporanea, attenta alla vita quotidiana e agli “archivi del corpo”, scopriamo che durante il XVI e il XVII secolo gli incontri tra musulmani e cristiani fossero molto frequenti e spesso felici. Il teatro comico italiano fu il genere letterario che, prima e meglio di ogni altro, riuscì a cogliere e a descrivere tale fenomeno con tutte le implicazioni politiche, religiose e identitarie, restituendone in pieno uno degli elementi sovente sottaciuti e censurati, ovvero la perturbante carica erotica del “diverso”. Uno degli espedienti che riassumono con maggiore efficacia questo  rapporto identitario e culturale è rappresentato dall’uso del travestimento. Paragonando alcune commedie italiane della prima metà del Seicento con il teatro “orientalista” di Bonarelli, Molière e Goldoni, possiamo osservare la nascita e la crescita di una visione stereotipata e libresca dell’altro, là dove i “panni turcheschi” generavano negli spettatori paura e desiderio.

Candidate essential genes in Burkholderia cenocepacia J2315 identified by genome-wide TraDIS

Directory of Open Access Journals (Sweden)

Yee-Chin Wong

2016-08-01

Full Text Available Burkholderia cenocepacia infection often leads to fatal cepacia syndrome in cystic fibrosis patients. However, antibiotic therapy rarely results in complete eradication of the pathogen due to its intrinsic resistance to many clinically available antibiotics. Recent attention has turned to the identification of essential genes as the proteins encoded by these genes may serve as potential targets for development of novel antimicrobials. In this study, we utilized TraDIS (Transposon Directed Insertion-site Sequencing as a genome-wide screening tool to facilitate the identification of B. cenocepacia genes essential for its growth and viability. A transposon mutant pool consisting of approximately 500,000 mutants was successfully constructed, with more than 400,000 unique transposon insertion sites identified by computational analysis of TraDIS datasets. The saturated library allowed for the identification of 383 genes that were predicted to be essential in B. cenocepacia. We extended the application of TraDIS to identify conditionally essential genes required for in vitro growth and revealed an additional repertoire of 439 genes to be crucial for B. cenocepacia growth under nutrient-depleted conditions. The library of B. cenocepacia mutants can subsequently be subjected to various biologically related conditions to facilitate the discovery of genes involved in niche adaptation as well as pathogenicity and virulence.

‘Tarasca’. Tra Napoli, Venezia e l’Europa

Directory of Open Access Journals (Sweden)

Piermario Vescovo

2014-12-01

Full Text Available This paper reconsiders some important episodes of the history of drama and theater of the imagination spread between Naples and Madrid or more generally between Italy and Spain with reference to the Tarasca (procession of Corpus Domini, ideally through six ‘stations’. In this Spanish procession we find on a female dragon the effigies of Gennaro and Gaetano Sacchi, uncle and father of the more famous Antonio, whose stories and travels are one of the matters of this paper. The other matters are focused on the relationship between Carlo Goldoni and the Neapolitans Domenico Barone and Domenico Lalli, and on the Venetian reinvention of Pulcinella’s mask by Giandomenico Tiepolo, passing through Madrid.Col riferimento a una processione legata prevalentemente al Corpus Domini, attraverso sei ‘stazioni’ ideali, il contributo riconsidera alcuni rilevanti episodi di storia dello spettacolo e di diffusione dell’immaginazione teatrale tra Napoli e Madrid, o più in generale tra l’Italia e la Spagna. Nella processione madrilena – sopra un drago femmina semovente (la Tarasca, appunto – si ritrovano le effigi di Gennaro e Gaetano Sacchi, zio e padre del più celebre Antonio, le cui vicende e le cui peregrinazioni costituiscono il filo principale del racconto; gli altri sono costituiti dai rapporti di Carlo Goldoni coi napoletani Domenico Barone e Domenico Lalli e dalla reinvenzione veneziana – passando per Madrid – della maschera di Pulcinella da parte di Giandomenico Tiepolo.

Le Kāmasūtra et la « pulsion shastrique » en Inde

OpenAIRE

Naudou, Elizabeth

2013-01-01

Le mot « shastrique » fait référence au traité (śāstra) d’où sont issus les Kāmasūtra, (plus généralement appelé le Kāmasūtra), « aphorismes sur l’amour » : le Kāmaśāstra, « traité sur l’amour ». Qui dit śāstra, dit, en Inde, exposé religieux ou scientifique, d’où l’expression « pulsion shastrique » que l’on pourrait rendre par « pulsion encyclopédique énumérative et classificatoire ». Le but de cet exposé est de replacer le texte dans cette structure mentale typiquement indienne, qui reflète...

Uso de inseticidas para o controle da traça-do-tomateiro e traça-das-crucíferas: um estudo de caso Use of insecticides for controlling the South American Tomato Pinworm and the Diamondback Moth: a case study

Directory of Open Access Journals (Sweden)

Marina Castelo Branco

2001-03-01

Full Text Available Em agosto de 1999, produtores de tomate e brássicas do Núcleo Rural da Taquara tiveram seus cultivos seriamente comprometidos devido à impossibilidade de controle da traça-do-tomateiro e da traça-das-crucíferas. Diversos inseticidas, alguns com o mesmo princípio ativo ou pertencentes ao mesmo grupo químico, eram aplicados de uma a sete vezes por semana sem qualquer eficiência no controle das pragas. Lavouras foram abandonadas em diferentes estádios de desenvolvimento. A fim de definir uma estratégia de controle que viabilizasse a produção de tomate e brássicas na região, foi avaliado em laboratório a eficiência da dose comercial de alguns inseticidas usados no controle das duas pragas. Para isso, foram coletadas duas populações de traça-do-tomateiro e uma população de traça-das-crucíferas. Para traça-do-tomateiro, cartap, abamectin, lufenuron, acefate e deltametrina causaram respectivamente 100, 90, 67, 2 e 0% de mortalidade das larvas. Para traça-das-crucíferas, B. thuringiensis, abamectin, cartap, acefate and deltametrina causaram 100; 96; 86; 79 e 5% de mortalidade respectivamente. De acordo com estes resultados foi recomendada a suspensão imediata do uso de piretróides e organofosforados para o controle das duas pragas. Abamectin e cartap foram recomendados para o controle da traça-do-tomateiro e B. thuringiensis para o controle de traça-das-crucíferas.In August 1999, at the "Núcleo Rural da Taquara", Federal District, Brazil, tomato and brassica crops were severely damaged by the South American Tomato Pinworm (Tuta absoluta and the Diamondback Moth (Plutella xylostella. During that time growers related that they had been spraying insecticides one to seven times per week without controlling the pests. In the fields it was observed that there were crops with different ages and levels of chemical residues which allowed the pests to multiplicate continuously. Then it was decided that the first step to solve the

Indigenous Engagement in Tropical River Research in Australia: The TRaCK Program

Directory of Open Access Journals (Sweden)

Sue E. Jackson

2015-05-01

Full Text Available The literature on scientific-Indigenous ecological knowledge collaborations rarely analyses programmatic efforts undertaken by multi-disciplinary research groups over very large geographic scales. The TRaCK (Tropical Rivers and Coastal Knowledge research program was established to provide the science and knowledge needed by governments, industries, and communities to sustainably manage northern Australia’s rivers and estuaries. A number of policies and procedures were developed to ensure that the needs of Indigenous people of the multi-jurisdictional region were addressed and to enhance the benefits they might derive from participating in the research. An overarching Indigenous Engagement Strategy undergirded the program’s engagement activities, providing guidance on matters relating to the protection of intellectual property, negotiation of research agreements, remuneration for Indigenous expertise, and communications standards. This article reviews the achievements and shortcomings of the TRaCK experience of Indigenous engagement and highlights lessons for researchers and research organisations contemplating applied environmental science initiatives of this scale and scope.

AA.VV., La Giustizia nella Letteratura e nello Spettacolo Siciliani tra ...

African Journals Online (AJOL)

User

ruolo e i significati attribuiti al concetto di Giustizia nella. Letteratura e nello Spettacolo Siciliani tra '800 e '900. Da Verga a Sciascia costituisce il volume che raccoglie, a cura di Angelo. Zappulla, gli Atti del convegno su questo fondamentale tema. La centralità del tema Giustizia, nelle più diverse forme del fervore culturale ...

Relação cinemática em um trator 4x2 com tração dianteira auxiliar equipado com pneus radiais na eficiência de tração Kinematic relation on radial tires in a front wheel assist tractor on traction efficience

Directory of Open Access Journals (Sweden)

Mauro Fernando Ferreira

2000-12-01

Full Text Available Diferentes combinações de pressões internas dos pneus do trator pode afetar a interferência entre eixos motrizes dos tratores agrícolas, principalmente com pneus do tipo radial. Um trator 4x2 com tração dianteira auxiliar foi analisado quanto a seu desempenho em tração. Pneus de carcaça radial com diferentes pressões internas foram utilizados, com o objetivo de variar as relações cinemá ticas entre os eixos. Mediram-se o patinamento das rodas dianteiras e traseiras, a resistência ao rolamento e a força de tração, em duas condições de solo (firme e solto. Os resultados obtidos permitiram verificar que a eficiência de tração não foi significativamente influenciada pela variação das relações cinemáticas de 0,962 a 1,102. As máximas eficiências de tração ocorreram com relaçõ es cinemáticas variáveis dentro da faixa estudada e de acordo com as cargas impostas à barra de tração.Different combinations of tractor tire inflating pressure may affect interference between tractor axles, mainly with radial tires type. A front wheel assist tractor was studied in its traction performance. Radial tires with different inflation pressure were used, changing kinematic relations between axles. The measured parameters were: front and rear slip, rolling resistence and drawbar pull in two soil conditions (firm and loose. The results indicate that traction efficience was not significantly influenced by kinematic relations variation between 0.962 to 1.102. The maximum traction efficiency ocurred within the range studied and according to drawbar pull.

Tra ufficialità e Samizdat: Viktor Sosnora

Directory of Open Access Journals (Sweden)

Noemi Albanese

2015-07-01

Full Text Available La figura di Viktor Sosnora si presenta come una delle più particolari nel panorama letterario della Leningrado della seconda metà del Novecento. A metà tra mondo ufficiale e quello dell'underground, fu anche uno dei pochissimi autori ai quali, in epoca sovietica, fu concesso di viaggiare in Europa ed entrare in contatto con il mondo intellettuale coevo. La sua ricerca estetica e stilistica parte dalle tematiche antico russe per innovarle dall'interno grazie ad un gusto per la lingua estremamente contemporaneo;ciò si tradusse in sperimentazioni poetiche sempre più ardite che resero impossibile la pubblicazione ufficiale dei suoi testi, divenuti invece oggetto di culto negli ambienti del Samizdat.

The equation of state of n-pentane in the atomistic model TraPPE-EH

Science.gov (United States)

Valeev, B. U.; Pisarev, V. V.

2018-01-01

In this work, we study the vapor-liquid equilibrium in n-pentane. We use the TraPPE-EH (transferable potentials for phase equilibria-explicit hydrogen) forcefield, where each hydrogen and carbon atom is considered as independent center of force. The fluid behavior was investigated with different values of density and temperature by molecular dynamics method. The n-pentane evaporation curve was calculated in the temperature range of 290 to 390 K. The densities of the coexisting phases are also calculated. The compression curve at 370 K was calculated and isothermal bulk modulus was found. The simulated properties of n-pentane are in good agreement with data from a database of the National Institute of Standards and Technology, so the TraPPE-EH model can be recommended for simulations of hydrocarbons.

Progettazione e disciplina dell’esoscheletro : l'inestricabile co-evoluzione tra umani e robot

NARCIS (Netherlands)

Fosch Villaronga, Eduard; Özcan, Beste; Pirni, A.

2017-01-01

Quest’articolo descrive come sia stretto il legame tra esseri umani e l’evoluzione degli esoscheletri in termini di design, di regolamentazione e di necessità umane. Mentre gli attuali esoscheletri sono ingombranti e pesanti, i progressi nei materiali e nel design concettuale cambieranno

La tradizione nella scienza il progresso scientifico come equilibrio dialettico tra idee innovatrici e tradizione in una raccolta di saggi inediti

CERN Document Server

Heisenberg, Werner

1982-01-01

In questa raccolta di saggi (inediti per l'Italia), da lui stesso selezionati poco prima della morte, Heisenberg analizza da varie angolazioni i rapporti tra progresso scientifico e tradizione : la storia della scienza è soprattutto una storia di idee, e da un giusto equilibrio dialettico tra i nuovi concetti e la tradizione, che costituisce la base ideale per discuterli, scaturisce il progress scientifico.

Traços de resistência na obra de Augusto Roa Bastos

Directory of Open Access Journals (Sweden)

Carlos Henrique Lopes Almeida

2017-01-01

Full Text Available Este estudo tem como proposta a análise de alguns traços de resistência presentes em algumas das produções literárias do autor paraguaio Augusto Roa Bastos. As obras escolhidas são Vigilia del Almirante (2008 e a trilogia Yo, el supremo (2003, El fiscal (2008 e El hijo del hombre (2003. O primeiro romance trata da volta ao período do descobrimento e desenvolve uma confrontação entre Colombo, os cronistas e o narrador. A trilogia se ocupa do cenários belicosos da história paraguaia e de alguns ditadores e suas relações com o poder. O tratamento dado a essa matéria histórica nas narrativas supracitadas pode ser entendida como traços de resistência, bem como alguns artifícios narrativos aplicados pelo autor. A análise será realizada a partir das discussões sobre Resistência e descobrimento propostos por Galeano (1989, Bitterli (2012 e Grützmacher (2009.

Incerta glòria di Joan Sales tra filologia, storia e traduzione

Directory of Open Access Journals (Sweden)

Patrizio Rigobon

2015-12-01

Full Text Available In questo saggio si fa una riflessione sull’opera di Joan Sales Incerta glòria e particolarmente si vede le conessione tra filologia, storia e traduzione. This article makes a reflection on the work of Joan Sales, Incerta glòria, and it particularly affects the connection between philology, history and translation.

A auto-percepção do envelhecimento e os traços de personalidade em idosos

OpenAIRE

Yassine, Ismael Macedo Correia

2011-01-01

Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2011 O presente estudo foca a auto-percepção do envelhecimento e os traços de personalidade, assumindo como principais objectivos: (1) a exploração da relação entre auto-percepção do processo de envelhecimento por parte dos idosos (com mais de 60 anos de idade) e os traços de personalidade e, (2) a compreensão das dimensõe...

An Examination of Factors Influencing Students Selection of Business Majors Using TRA Framework

Science.gov (United States)

Kumar, Anil; Kumar, Poonam

2013-01-01

Making decisions regarding the selection of a business major is both very important and challenging for students. An understanding of this decision-making process can be valuable for students, parents, and university programs. The current study applies the Theory of Reasoned Action (TRA) consumer decision-making model to examine factors that…

InTraCert. Inception report. The role of an integrated tradable green certificate system in a liberalising market

International Nuclear Information System (INIS)

Boots, M.G.; Schaeffer, G.J.; De Zoeten, C.; Mitchell, C.; Anderson, T.; Morthorst, P.E.; Nielsen, L.; Gual, M.; Del Rio, P.; Cadenas, A.; Hernandez, F.; Kuehn, I.; Braeur, W.; Stronzik, M.

2000-12-01

The InTraCert project aims to explore the possibility of integrating the existing and planned Tradable Green Certificate (TGC) schemes in the European Union and, therefore, creating a plausible unified market for TGCs. Particular attention will be paid to the possibilities of integrating TGCs for green electricity, heat and gas. Furthermore, it intents to examine the possible interactions arising from such a system with more direct GHG abatement measures, i.e. Carbon Emissions Trading (CET). The scope of the InTraCert project requires specific information for EU-15 countries regarding, on the one hand, Renewable Energy Sources (RES) used for electricity, gas and heat generation and. on the other, GHG emission levels and national strategies. In order to account for this information need. specific country inventories have been designed and carried out by InTraCert members in this first phase of the project. The inventory shows that Belgium, Italy, Denmark, the Netherlands, Austria, Sweden and the UK seriously want to implement a TGC system. The systems will indeed be nationally oriented; hardly any provisions for international trade in the different TGCs will be put in place. An essential prerequisite for efficient cross border trade is agreement on the carbon credit that comes with RE production. What is the size of the carbon credit and will this credit be attached to the TGC while traded? These will be the main questions to be answered in the next phase of the InTraCert project. 8 refs

First tier modeling of consumer dermal exposure to substances in consumer articles under REACH: a quantitative evaluation of the ECETOC TRA for consumers tool.

Science.gov (United States)

Delmaar, J E; Bokkers, B G H; ter Burg, W; van Engelen, J G M

2013-02-01

The demonstration of safe use of chemicals in consumer products, as required under REACH, is proposed to follow a tiered process. In the first tier, simple conservative methods and assumptions should be made to quickly verify whether risks for a particular use are expected. The ECETOC TRA Consumer Exposure Tool was developed to assist in first tier risk assessments for substances in consumer products. The ECETOC TRA is not a prioritization tool, but is meant as a first screening. Therefore, the exposure assessment needs to cover all products/articles in a specific category. For the assessment of the dermal exposure for substances in articles, ECETOC TRA uses the concept of a 'contact layer', a hypothetical layer that limits the exposure to a substance contained in the product. For each product/article category, ECETOC TRA proposes default values for the thickness of this contact layer. As relevant experimental exposure data is currently lacking, default values are based on expert judgment alone. In this paper it is verified whether this concept meets the requirement of being a conservative exposure evaluation method. This is done by confronting the ECETOC TRA expert judgment based predictions with a mechanistic emission model, based on the well established theory of diffusion of substances in materials. Diffusion models have been applied and tested in many applications of emission modeling. Experimentally determined input data for a number of material and substance combinations are available. The estimated emissions provide information on the range of emissions that could occur in reality. First tier tools such as ECETOC TRA tool are required to cover all products/articles in a category and to provide estimates that are at least as high as is expected on the basis of current scientific knowledge. Since this was not the case, it is concluded that the ECETOC TRA does not provide a proper conservative estimation method for the dermal exposure to articles. An

Field Sampling Plan for the HWMA/RCRA Closure Certification of the TRA-731 Caustic and Acid Storage Tank System - 1997 Notice of Violation Consent Order

International Nuclear Information System (INIS)

Evans, S.K.

2002-01-01

This Field Sampling Plan for the HWMA/RCRA Closure Certification of the TRA-731 Caustic and Acid Storage Tank System is one of two documents that comprise the Sampling and Analysis Plan for the HWMA/RCRA closure certification of the TRA-731 caustic and acid storage tank system at the Idaho National Engineering and Environmental Laboratory. This plan, which provides information about sampling design, required analyses, and sample collection and handling procedures, is to be used in conjunction with the Quality Assurance Project Plan for the HWMA/RCRA Closure Certification of the TRA-731 Caustic and Acid Storage Tank System

Quality Assurance Project Plan for the HWMA/RCRA Closure Certification of the TRA-731 Caustic and Acid Storage Tank System - 1997 Notice of Violation Consent Order; TOPICAL

International Nuclear Information System (INIS)

Evans, S.K.

2002-01-01

This Quality Assurance Project Plan for the HWMA/RCRA Closure Certification of the TRA- 731 Caustic and Acid Storage Tank System is one of two documents that comprise the Sampling and Analysis Plan for the HWMA/RCRA closure certification of the TRA-731 caustic and acid storage tank system at the Idaho National Engineering and Environmental Laboratory. This plan, which provides information about the project description, project organization, and quality assurance and quality control procedures, is to be used in conjunction with the Field Sampling Plan for the HWMA/RCRA Closure Certification of the TRA-731 Caustic and Acid Storage Tank System. This Quality Assurance Project Plan specifies the procedures for obtaining the data of known quality required by the closure activities for the TRA-731 caustic and acid storage tank system

L’università italiana tra continuità e discontinuità. Intervista a Mauro Moretti

Directory of Open Access Journals (Sweden)

Alessandro Breccia

2017-07-01

Full Text Available L’intervista a Mauro Moretti inquadra il tema del dossier a partire dalle fonti per la storia delle università italiane nel secondo Novecento. Passa poi ad indicare alcuni tra i principali aspetti da indagare anche per definire al meglio una possibile cronologia

pTRA - A reporter system for monitoring the intracellular dynamics of gene expression.

Science.gov (United States)

Wagner, Sabine G; Ziegler, Martin; Löwe, Hannes; Kremling, Andreas; Pflüger-Grau, Katharina

2018-01-01

The presence of standardised tools and methods to measure and represent accurately biological parts and functions is a prerequisite for successful metabolic engineering and crucial to understand and predict the behaviour of synthetic genetic circuits. Many synthetic gene networks are based on transcriptional circuits, thus information on transcriptional and translational activity is important for understanding and fine-tuning the synthetic function. To this end, we have developed a toolkit to analyse systematically the transcriptional and translational activity of a specific synthetic part in vivo. It is based on the plasmid pTRA and allows the assignment of specific transcriptional and translational outputs to the gene(s) of interest (GOI) and to compare different genetic setups. By this, the optimal combination of transcriptional strength and translational activity can be identified. The design is tested in a case study using the gene encoding the fluorescent mCherry protein as GOI. We show the intracellular dynamics of mRNA and protein formation and discuss the potential and shortcomings of the pTRA plasmid.

Generalizzazione cartografica tra ricerca e applicazione La Cartografia Tecnica Regionale delle Marche

Directory of Open Access Journals (Sweden)

Stefano Bellesi

2007-03-01

Full Text Available Il problema della generalizzazione cartografica è uno dei temi principe nel dibattito cartografico tra gli addetti ai lavori. La cartografia multiscala rappresenta infatti una delle chimere dell’era digitale e, man mano che i DB cartografici si sono popolati di informazioni, ha dimostrato la sua realtà. L’orientamento è quello di automatizzare al massimo tutte le procedure prendendo in considerazione quelle che sono le esigenze della rappresentazione.

Considerazioni sul problema dei rigassificatori tra aggregazione del consenso e conflitto ambientale

OpenAIRE

Lodoli, Flavio

2011-01-01

2009/2010 Considerazioni sul problema dei Rigassificatori tra Aggregazione del Consenso e Conflitto Ambientale 1. Il nostro Paese, per scelta politica e per una sostanziale limitata capacità di innovazione del mondo industriale, ha una quota attuale di produzione di energia da fonti rinnovabili poco significativa nonostante gli investimenti, i contributi e le agevolazioni fiscali che dovrebbero incentivare opportunamente ad esempio, l’utilizzo dell’energia solare che rappresenta una...

The Thrombin Receptor Antagonist for Clinical Event Reduction in Acute Coronary Syndrome (TRA*CER) trial: study design and rationale.

Science.gov (United States)

2009-09-01

The protease-activated receptor 1 (PAR-1), the main platelet receptor for thrombin, represents a novel target for treatment of arterial thrombosis, and SCH 530348 is an orally active, selective, competitive PAR-1 antagonist. We designed TRA*CER to evaluate the efficacy and safety of SCH 530348 compared with placebo in addition to standard of care in patients with non-ST-segment elevation (NSTE) acute coronary syndromes (ACS) and high-risk features. TRA*CER is a prospective, randomized, double-blind, multicenter, phase III trial with an original estimated sample size of 10,000 subjects. Our primary objective is to demonstrate that SCH 530348 in addition to standard of care will reduce the incidence of the composite of cardiovascular death, myocardial infarction (MI), stroke, recurrent ischemia with rehospitalization, and urgent coronary revascularization compared with standard of care alone. Our key secondary objective is to determine whether SCH 530348 will reduce the composite of cardiovascular death, MI, or stroke compared with standard of care alone. Secondary objectives related to safety are the composite of moderate and severe GUSTO bleeding and clinically significant TIMI bleeding. The trial will continue until a predetermined minimum number of centrally adjudicated primary and key secondary end point events have occurred and all subjects have participated in the study for at least 1 year. The TRA*CER trial is part of the large phase III SCH 530348 development program that includes a concomitant evaluation in secondary prevention. TRA*CER will define efficacy and safety of the novel platelet PAR-1 inhibitor SCH 530348 in the treatment of high-risk patients with NSTE ACS in the setting of current treatment strategies.

A photometric analysis of the neglected EW-type binary V336 TrA

Science.gov (United States)

Kriwattanawong, W.; Sarotsakulchai, T.; Maungkorn, S.; Reichart, D. E.; Haislip, J. B.; Kouprianov, V. V.; LaCluyze, A. P.; Moore, J. P.

2018-05-01

This study presents an analysis of photometric light curves and absolute parameters for the EW-type binary V336 TrA. VRI imaging observations were taken in 2013 by using the robotic telescopes PROMPT 4 and PROMPT 5 at Cerro Tololo Inter-American Observatory (CTIO), Chile. The observed light curves were fitted by using the Wilson-Devinney method. The results showed that V336 TrA is a W-type contact binary with a mass ratio of q = 1.396. The binary is a weak contact system with a fill-out factor of f = 15.69%. The system contains components with masses of 0.653 M⊙ and 0.912 M⊙ for the hotter and the cooler, respectively. The location of the secondary (less massive) component on the log M - log L diagram was found to be near the TAMS. The component has evolved to be oversize and overluminous. The orbital angular momentum of the binary was found to be log Jo = 51.61 cgs, less than all detached systems for same mass. The system has undergone angular momentum and/or mass loss, during the binary evolution from the detached to contact system.

CDC 1604-A translator from the SLANG autocode for the TRA computer

International Nuclear Information System (INIS)

Belyaev, A.V.

1976-01-01

A SLANG - TRA translator has been devised for faster, easier programing. The program is realized on a SDS-1604A computer, input data are read from 80 column punch cards and translated into the standard Hollerith 026 code. Programs are processed in batches. A SDS-1604A teletype enables the operator to control the translation. The translator makes it possible to evaluate program processing time. The translator's high speed simplifies program editing and saves manpower

Pawedness Trait Test (PaTRaT—A New Paradigm to Evaluate Paw Preference and Dexterity in Rats

Directory of Open Access Journals (Sweden)

Ana M. Cunha

2017-10-01

Full Text Available In rodents, dexterity is commonly analyzed in preference paradigms in which animals are given the chance to use either the left or the right front paws to manipulate food. However, paw preference and dexterity at population and individual levels are controversial as results are incongruent across paradigms. We have therefore developed a semi-quantitative method—the pawdeness trait test (PaTRaT—to evaluate paw preference degree in rats. The PaTRaT consists in a classification system, ranging from +4 to −4 where increasingly positive and negative values reflect the bias for left or right paw use, respectively. Sprague-Dawley male rats were confined into a metal rectangular mesh cylinder, from which they can see, smell and reach sugared rewards with their paws. Due to its size, the reward could only cross the mesh if aligned with its diagonal, imposing additional coordination. Animals were allowed to retrieve 10 rewards per session in a total of four sessions while their behavior was recorded. PaTRaT was repeated 4 and 8 weeks after the first evaluation. To exclude potential bias, rats were also tested for paw fine movement and general locomotion in other behavioral paradigms as well as impulsivity (variable delay-to-signal, VDS, memory and cognitive flexibility (water maze. At the population level 54% of the animals presented a rightward bias. Individually, all animals presented marked side-preferences, >2 and <−2 for left- and right-sided bias, respectively, and this preference was stable across the three evaluations. Inter-rater consistency was very high between two experienced raters and substantial when two additional inexperienced raters were included. Left- and right-biased animals presented no differences in the ability to perform fine movements with any of the forelimbs (staircase and general locomotor performance. Additionally, these groups performed similarly in executive function and memory tasks. In conclusion, PaTRaT is able

Una community emergente tra progettazione territorio e infrastrutture La prima conferenza Autodesk degli utenti italiani

Directory of Open Access Journals (Sweden)

Redazione Redazione

2005-10-01

Full Text Available La prima edizione dell’Autodesk User Conference dedicata aiSistemi Informativi Territoriali ed alla progettazione delle infrastrutture, tenutasi a Roma il 29 settembre 2005, diventerà l’appuntamento fisso sulla convergenza tra tecnologie CAD e GISche molti reclamavano da tempo.

La narrazione orale tra bambini ed adulti: da flusso continuo a vena carsica?

Directory of Open Access Journals (Sweden)

Milena Bernardi

2010-02-01

Full Text Available Con il segmento di ricerca che viene presentato nella sua prima fase si prende in esame l’ipotesi di un processo, in atto da tempo, di trasformazione e/o di declino della narrazione orale nel rapporto quotidiano tra adulti e bambini, inteso, in questo specifico contesto, come “spia” dei mutamenti degli stili educativi e degli interscambi tra famiglie ed operatori dei servizi in relazione all’alleanza educativa. La complessità dei filoni di studio che rimandano alla voce “narrazione” negli ambiti delle scienze umane esige la precisazione della curvatura “narrativa” scelta per la ricerca in corso: curvatura che appartiene all’epistemologia della letteratura per l’infanzia e della pedagogia della narrazione in quanto permette di imboccare la strada della ricerca pedagogica rivolta innanzi tutto ai significati che il narrare assume nella relazione educativa e poi ai modi ed alle forme della narrazione che coinvolgono l’infanzia. In un’epoca di grande vitalità e visibilità delle narrazioni, tra cui abbondano le produzioni scritte, illustrate, filmate per l’infanzia, sembra esserci una zona marginale e quasi sommersa della comunicazione narrante che rischia di sfumare in una sorta di oblio. E’ la zona della narrazione orale esperita in praesentia da bambini ed adulti insieme, tessuta con fili di parole che restituiscono senso all’intero arco delle esperienze, tentando di riordinare il disordine che spesso connota la realtà, interpretando, stabilendo connessioni, impregnando di quel senso i vissuti, i fatti, le relazioni, le cose e le parole stesse, ancora, nelle voci. Del rischio e delle conseguenze che possono derivare dalla sua mancanza si occupa questo contributo di ricerca che, dal punto di vista metodologico, si è avvalso e si avvale sia di analisi condotte sul corpus dei testi sia della raccolta di dati e informazioni tramite incontri condotti con la modalità del focus group, con educatrici e genitori.

Metronomic chemotherapy in the neoadjuvant setting: results of two parallel feasibility trials (TraQme and TAME) in patients with HER2+ and HER2− locally advanced breast cancer

International Nuclear Information System (INIS)

Petry, V.; Gagliato, D.M.; Leal, A.I.C.; Arai, R.J.; Longo, E.; Andrade, F.; Ricci, M.D.; Piato, J.R.; Barroso-Sousa, R.; Hoff, P.M.; Mano, M.S.

2015-01-01

Neoadjuvant chemotherapy has practical and theoretical advantages over adjuvant chemotherapy strategy in breast cancer (BC) management. Moreover, metronomic delivery has a more favorable toxicity profile. The present study examined the feasibility of neoadjuvant metronomic chemotherapy in two cohorts [HER2+ (TraQme) and HER2− (TAME)] of locally advanced BC. Twenty patients were prospectively enrolled (TraQme, n=9; TAME, n=11). Both cohorts received weekly paclitaxel at 100 mg/m 2 during 8 weeks followed by weekly doxorubicin at 24 mg/m 2 for 9 weeks in combination with oral cyclophosphamide at 100 mg/day (fixed dose). The HER2+ cohort received weekly trastuzumab. The study was interrupted because of safety issues. Thirty-six percent of patients in the TAME cohort and all patients from the TraQme cohort had stage III BC. Of note, 33% from the TraQme cohort and 66% from the TAME cohort displayed hormone receptor positivity in tumor tissue. The pathological complete response rates were 55% and 18% among patients enrolled in the TraQme and TAME cohorts, respectively. Patients in the TraQme cohort had more advanced BC stages at diagnosis, higher-grade pathological classification, and more tumors lacking hormone receptor expression, compared to the TAME cohort. The toxicity profile was also different. Two patients in the TraQme cohort developed pneumonitis, and in the TAME cohort we observed more hematological toxicity and hand-foot syndrome. The neoadjuvant metronomic chemotherapy regimen evaluated in this trial was highly effective in achieving a tumor response, especially in the HER2+ cohort. Pneumonitis was a serious, unexpected adverse event observed in this group. Further larger and randomized trials are warranted to evaluate the association between metronomic chemotherapy and trastuzumab treatment

Metronomic chemotherapy in the neoadjuvant setting: results of two parallel feasibility trials (TraQme and TAME) in patients with HER2+ and HER2− locally advanced breast cancer

Energy Technology Data Exchange (ETDEWEB)

Petry, V.; Gagliato, D.M.; Leal, A.I.C.; Arai, R.J.; Longo, E. [Divisão de Oncologia Médica, Instituto do Câncer do Estado de São Paulo, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil); Andrade, F. [Núcleo de Mastologia, Hospital Sírio Libanês, São Paulo, SP (Brazil); Ricci, M.D.; Piato, J.R.; Barroso-Sousa, R.; Hoff, P.M.; Mano, M.S. [Divisão de Oncologia Médica, Instituto do Câncer do Estado de São Paulo, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil)

2015-03-06

Neoadjuvant chemotherapy has practical and theoretical advantages over adjuvant chemotherapy strategy in breast cancer (BC) management. Moreover, metronomic delivery has a more favorable toxicity profile. The present study examined the feasibility of neoadjuvant metronomic chemotherapy in two cohorts [HER2+ (TraQme) and HER2− (TAME)] of locally advanced BC. Twenty patients were prospectively enrolled (TraQme, n=9; TAME, n=11). Both cohorts received weekly paclitaxel at 100 mg/m{sup 2} during 8 weeks followed by weekly doxorubicin at 24 mg/m{sup 2} for 9 weeks in combination with oral cyclophosphamide at 100 mg/day (fixed dose). The HER2+ cohort received weekly trastuzumab. The study was interrupted because of safety issues. Thirty-six percent of patients in the TAME cohort and all patients from the TraQme cohort had stage III BC. Of note, 33% from the TraQme cohort and 66% from the TAME cohort displayed hormone receptor positivity in tumor tissue. The pathological complete response rates were 55% and 18% among patients enrolled in the TraQme and TAME cohorts, respectively. Patients in the TraQme cohort had more advanced BC stages at diagnosis, higher-grade pathological classification, and more tumors lacking hormone receptor expression, compared to the TAME cohort. The toxicity profile was also different. Two patients in the TraQme cohort developed pneumonitis, and in the TAME cohort we observed more hematological toxicity and hand-foot syndrome. The neoadjuvant metronomic chemotherapy regimen evaluated in this trial was highly effective in achieving a tumor response, especially in the HER2+ cohort. Pneumonitis was a serious, unexpected adverse event observed in this group. Further larger and randomized trials are warranted to evaluate the association between metronomic chemotherapy and trastuzumab treatment.

Estudo da aderência de arames da armadura de tração em conectores de dutos flexíveis

OpenAIRE

Marcelo Badini Daflon

2010-01-01

Este projeto tem o objetivo de apresentar o estudo dos arames da armadura de tração que são empregados no transporte de óleo, gás e umbilicais hidráulicos na indústria petrolífera. Este estudo foi desenvolvido sob a necessidade de melhor ancoragem dos arames da armadura de tração de modo a garantir que, mesmo após a ruptura do arame dentro do conector não haverá o escorregamento do mesmo provocando a queda do duto flexível. Assim sendo, foi estabelecido o estudo de aderência da interface dos ...

Pathways of topological rank analysis (PoTRA): a novel method to detect pathways involved in hepatocellular carcinoma.

Science.gov (United States)

Li, Chaoxing; Liu, Li; Dinu, Valentin

2018-01-01

Complex diseases such as cancer are usually the result of a combination of environmental factors and one or several biological pathways consisting of sets of genes. Each biological pathway exerts its function by delivering signaling through the gene network. Theoretically, a pathway is supposed to have a robust topological structure under normal physiological conditions. However, the pathway's topological structure could be altered under some pathological condition. It is well known that a normal biological network includes a small number of well-connected hub nodes and a large number of nodes that are non-hubs. In addition, it is reported that the loss of connectivity is a common topological trait of cancer networks, which is an assumption of our method. Hence, from normal to cancer, the process of the network losing connectivity might be the process of disrupting the structure of the network, namely, the number of hub genes might be altered in cancer compared to that in normal or the distribution of topological ranks of genes might be altered. Based on this, we propose a new PageRank-based method called Pathways of Topological Rank Analysis (PoTRA) to detect pathways involved in cancer. We use PageRank to measure the relative topological ranks of genes in each biological pathway, then select hub genes for each pathway, and use Fisher's exact test to test if the number of hub genes in each pathway is altered from normal to cancer. Alternatively, if the distribution of topological ranks of gene in a pathway is altered between normal and cancer, this pathway might also be involved in cancer. Hence, we use the Kolmogorov-Smirnov test to detect pathways that have an altered distribution of topological ranks of genes between two phenotypes. We apply PoTRA to study hepatocellular carcinoma (HCC) and several subtypes of HCC. Very interestingly, we discover that all significant pathways in HCC are cancer-associated generally, while several significant pathways in subtypes

Emanuele KANCEFF, "L’immagine della Sicilia nei resoconti di viaggio del Settecento. Tra classicità ed emozione romantica", 2015

Directory of Open Access Journals (Sweden)

Pino Menzio

2015-06-01

Full Text Available Emanuele KANCEFF, "L’immagine della Sicilia nei resoconti di viaggio del Settecento. Tra classicità ed emozione romantica", Scicli, Edizioni di storia e studi sociali, 2015 [Book Review

Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

Directory of Open Access Journals (Sweden)

Massimo Melillo

2015-07-01

Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

Tra il mediterraneo e il fonte battesimale: Musulmani a Napoli nel XVI secolo

OpenAIRE

Varriale, Gennaro

2013-01-01

Il saggio analizza la presenza di musulmani a Napoli durante il Cinquecento, quando la capitale vive una profonda trasformazione urbanistica, che è vincolata alla immigrazione di comunità esogene e al conflitto contro il Turco. Le ostilità tra la Casa d’Austria e la Sublime Porta condizionano inevitabilmente la vita dei maomettani, che appartengono a tre grandi categorie: schiavi, franchi o esuli. Secondo la propria condizione gli islamici occupano diversi spazi cittadini. I musulmani di Napo...

Pianeti tra le note appunti di un astronomo divulgatore

CERN Document Server

Adamo, Angelo

2010-01-01

Una stella, otto pianeti, un centinaio di lune e una miriade di corpi minori tra plutini, asteroidi, comete, satelliti artificiali. E per ognuno di questi oggetti, spiegazioni scientifiche che condividono la scena con narrazioni dettate dal mito, con visioni della fanstascienza e con suggestioni sonore scaturite dalla penna di grandi compositori. L'autore prova a districarsi nella babele di idiomi più o meno precisi che da sempre vengono usati dagli uomini per descrivere il Sistema Solare nell'intento di spiegarlo e di rendere il freddo spazio interplanetario un posto più accogliente. La letteratura, la fisica, il fumetto, l'illustrazione, la musica finalmente cooperano per delineare un possibile percorso, una traiettoria fra le tante, che condurrà il lettore dalle origini del linguaggio fino alla nube di Oort.

Estudo de resistência à tração de três sistemas adesivos associados a resina composta em superfícies dentinárias

Directory of Open Access Journals (Sweden)

MATOS Adriana Bona

2001-01-01

Full Text Available Este trabalho teve como objetivo comparar a resistência à tração de três sistemas adesivos associados a resina composta aderidos à superfície dentinária. Quarenta e cinco superfícies de dentina foram obtidas a partir de molares humanos extraídos, sobre elas foi preparado "smear layer" e foram divididas em 3 grupos: G1 adesivo autocondicionante + resina micro-híbrida; G2 adesivo de componente único + ácido e resina micro-híbrida e G3 adesivo convencional (ácido + "primer" + bond + resina micro-híbrida, aplicados de acordo com as instruções dos fabricantes. Os corpos-de-prova foram preparados para teste de tração, imersos em água destilada por 24 horas a 37ºC. Findo este tempo, o teste de tração foi realizado em máquina de ensaio Inströn com velocidade constante de 0,5 mm/min. Os resultados foram expressos em MPa e submetidos a análise de variância (p < 0,05. Os autores concluíram que: o tipo de sistema adesivo influenciou na resistência à tração das resinas compostas testadas; o sistema adesivo de componente único apresentou os melhores resultados de resistência adesiva.

Conjugative Plasmid Transfer in Xylella fastidiosa Is Dependent on tra and trb Operon Functions

OpenAIRE

Burbank, Lindsey P.; Van Horn, Christopher R.

2017-01-01

The insect-transmitted plant pathogen Xylella fastidiosa is capable of efficient horizontal gene transfer (HGT) and recombination. Natural transformation occurs at high rates in X. fastidiosa, but there also is evidence that certain strains of X. fastidiosa carry native plasmids equipped with transfer and mobilization genes, suggesting conjugation as an additional mechanism of HGT in some instances. Two operons, tra and trb, putatively encoding a conjugative type IV secretion system, are foun...

I parchi eolici: la complessa interazione tra natura, uomo e tecnologia - The wind farms: the complex interaction among nature, man and technology

Directory of Open Access Journals (Sweden)

Massimiliano Masullo

2015-10-01

Full Text Available Sin dai tempi antichi l’uomo ha costruito macchine che, sfruttando l’energia del vento, lo hanno aiutato a nutrire se stesso, la terra e a svolgere lavorazioni complesse. Con la scoperta dell’elettricità la funzione di queste macchine è cambiata radicalmente. Negli ultimi venti anni, politiche d'incentivazione hanno portato allo sviluppo di impianti eolici ed alla loro diffusione sul territorio, determinando una interazione sempre più intensa fra turbine eoliche, ambiente circostante ed uomo. Questo articolo presentata una rassegna dei principali fattori che determinano o modificano la percezione dell’impatto che queste macchine hanno sull’uomo e sull’ambiente circostante. ------ Since ancient times the man has built machines which exploiting the energy of the wind have helped to feed himself, the land and carry out complex operations. With the discovery of electricity the function of these machines is changed radically. In the last twenty years, incentive policies have led to the development of wind farms and their diffusion over the territory, resulting in a more intense interaction between wind turbines, environment and man. This article presents a review of the main factors that determine or affect the perception of the impact that these machines have on humans and the surrounding environment.

Pathways of topological rank analysis (PoTRA: a novel method to detect pathways involved in hepatocellular carcinoma

Directory of Open Access Journals (Sweden)

Chaoxing Li

2018-04-01

Full Text Available Complex diseases such as cancer are usually the result of a combination of environmental factors and one or several biological pathways consisting of sets of genes. Each biological pathway exerts its function by delivering signaling through the gene network. Theoretically, a pathway is supposed to have a robust topological structure under normal physiological conditions. However, the pathway’s topological structure could be altered under some pathological condition. It is well known that a normal biological network includes a small number of well-connected hub nodes and a large number of nodes that are non-hubs. In addition, it is reported that the loss of connectivity is a common topological trait of cancer networks, which is an assumption of our method. Hence, from normal to cancer, the process of the network losing connectivity might be the process of disrupting the structure of the network, namely, the number of hub genes might be altered in cancer compared to that in normal or the distribution of topological ranks of genes might be altered. Based on this, we propose a new PageRank-based method called Pathways of Topological Rank Analysis (PoTRA to detect pathways involved in cancer. We use PageRank to measure the relative topological ranks of genes in each biological pathway, then select hub genes for each pathway, and use Fisher’s exact test to test if the number of hub genes in each pathway is altered from normal to cancer. Alternatively, if the distribution of topological ranks of gene in a pathway is altered between normal and cancer, this pathway might also be involved in cancer. Hence, we use the Kolmogorov–Smirnov test to detect pathways that have an altered distribution of topological ranks of genes between two phenotypes. We apply PoTRA to study hepatocellular carcinoma (HCC and several subtypes of HCC. Very interestingly, we discover that all significant pathways in HCC are cancer-associated generally, while several

Musei post-etnografici: Le trasformazioni dei rapporti tra antropologia e museo in Francia

Directory of Open Access Journals (Sweden)

Benoît de L'Estoile

2016-08-01

Full Text Available L’articolo riflette sulle trasformazioni contemporanee dei rapporti tra antropologia e museo in Francia alla luce dell’apertura negli ultimi anni del Musée du quai Branly, del Musée des Civilisations de l'Europe et de la Méditerranée (MUCEM, e del rinnovamento del Musée de l'Homme. La relazione tra musei e antropologia, storicamente più stretta in Francia che in altri contesti nazionali, spiega l’intensità delle reazioni suscitate da queste trasformazioni. La ricostruzione della successione dei progetti di musei etnografici, e in particolare l’ideale del ‘museo-laboratorio’, dimostra il ruolo duraturo del paradigma enciclopedico-naturalista. L’esaurimento del paradigma naturalista, tanto negli stessi musei di storia naturale come il Muséum National d'Histoire Naturelle di Parigi quanto nei musei etnografici, ha prodotto una trasformazione del ruolo dei musei, sancito dal passaggio da un discorso museografico centrato sulla scienza e il razionalismo ad un approccio estetizzante fondato sulle emozioni. Allo stesso tempo, il paradigma naturalista ed evoluzionista rinasce nel nuovo Musée de l'Homme, inaugurato nel 2015. Questi nuovi musei, che possono essere definiti come ‘post-etnografici’, non sono ancora riusciti a fare i conti con la storia e con il loro passato coloniale. Nel contempo, l’antropologia francese si trova di fronte alla sfida di reinventarsi come ‘antropologia post-museo’.

Accademie teatrali fiorentine nel quartiere di Santa Croce tra Sei e Settecento: tra attori dilettanti, gioco d’azzardo e primi tentativi impresariali

Directory of Open Access Journals (Sweden)

Francesca Fantappiè

2011-10-01

Full Text Available Il saggio approfondisce il funzionamento delle accademie teatrali fiorentine a cavallo tra XvII e XvIII secolo sotto più punti di vista: localizzazione dei teatri, repertorio e circolazione degli interpreti, aspetti di amministrazione economica, rapporti con il potere e, nella fattispecie, con la dinastia medicea. Emerge la concentrazione nel quartiere di Santa Croce di Firenze di una buona parte delle accademie di dilettanti, che per alcuni decenni offrono una produzione drammaturgica alternativa a quella del teatro degli attori professionisti, esclusi dal mercato fiorentino nell’ultima fase medicea. Sulle motivazioni di questo fenomeno sono qui proposte ipotesi alternative alla vulgata storiografica che vede in questi anni il nadir culturale nella storia del Granducato e della famiglia al potere. Ci si sofferma, inoltre, sul problema di una possibile definizione di sistema teatrale fiorentino, con particolare attenzione alla disanima dei primi tentativi di adozione di un modello impresariale nel teatro in musica.

Il Bosone di Higgs

CERN Multimedia

Hemmer, Sabine

2018-01-01

Poster di ATLAS sul bosone di Higgs indirizzato al pubblico generico, che spiega il meccanismo di Brout-Englert-Higgs e la sua importanza. Spiega anche il ruolo del Bosone di Higgs, come viene cercato, il percorso della sua scoperta e cosa viene dopo la scoperta. Disponibile anche in Francese (http://cds.cern.ch/record/1697501) e Inglese (http://cds.cern.ch/record/1697389). Non esitate a utilizzarlo nelle sedi dei vostri Istituti e negli eventi divulgativi! Il poster è in formato A0. Cliccate sull'immagine per scaricare il .pdf ad alta qualità e stamparlo dove preferite. Per qualisasi domanda o commento potete contattare atlas-outreach-coordination@cern.ch

Efeitos do ruído de tráfego na saúde: para além das "moléstias"

Directory of Open Access Journals (Sweden)

Julio Díaz Jiménez

2015-12-01

Full Text Available Os transtornos auditivos têm sido tradicionalmente associados ao ruído laboral das pessoas expostas. Recentemente, o ruído produzido nas proximidades de aeroportos foi relacionado com diferentes patologias, sobretudo as cardiovasculares. Nos últimos anos, o ruído ambiental das grandes cidades, principalmente devido ao tráfego, foi relacionado com diversas patologias, tanto de natureza cardiovascular, como respiratória e inclusivamente com diabetes. Neste trabalho, para além se fazer uma breve descrição dos estudos que relacionam o ruído ambiental com a morbilidade e os diferentes mecanismos biológicos implicados, possíveis de explicar nessas associações; apresentam-se os resultados de um conjunto de investigações que, mediante a Análise de Séries Temporais, relacionam o ruído de tráfego na cidade de Madrid com a mortalidade diária por causas circulatórias, respiratórias e diabetes na faixa etária de maiores de 65 anos. Assim como a mortalidade anual atribuída ao ruído de tráfego em Madrid e a sua comparação com a atribuição às PM2,5.

Erosão na cultura do milho em sucessão à aveia preta e pousio descoberto, em preparo convencional e plantio direto, com tração animal e tratorizada

Directory of Open Access Journals (Sweden)

R. Levien

2001-09-01

Full Text Available Empregando chuva simulada em Argissolo Vermelho distrófico arênico, com declividade média de 0,12 m m-1, avaliou-se a erosão na cultura do milho (Zea mays L. em preparo convencional e plantio direto, utilizando tração animal e tratorizada, antecedida de pousio descoberto e aveia preta (Avena strigosa Schieb no inverno, no período compreendido entre 1994 e 1995. Chuvas simuladas na intensidade de 64 mm h-1 e duração de 60 a 105 min foram aplicadas em quatro épocas: logo após a semeadura, 30 e 60 dias após a emergência e logo após a colheita do milho. A cobertura do solo propiciada pela cultura de inverno foi reduzida em 90% após o preparo convencional, independentemente da forma de tração. As perdas de solo e água medidas durante o desenvolvimento do milho foram sempre maiores sob preparo convencional do que sob plantio direto, independentemente da forma de tração, exceto logo após a colheita, quando a resteva estava uniformemente distribuída na superfície do solo. No preparo convencional, a erosão na cultura do milho foi, na média das formas de tração, 45% menor, quando antecedida de aveia preta no inverno do que quando antecedida de pousio descoberto. Por sua vez, a cultura do milho, por si só, reduziu a erosão em 60%, na média das formas de tração, comparada à do solo descoberto. A forma de tração influenciou a erosão somente no preparo convencional, com a animal apresentando perdas totais de solo 55 e 15% inferiores à tratorizada, respectivamente na cultura do milho e em solo descoberto. A perda de água por enxurrada foi mais afetada pela forma de tração no preparo convencional, totalizando, em média, 44% na animal e 57% na tratorizada, em relação ao volume total de chuva aplicado.

Ressenya a Delle Donne, Fulvio & Torró, Jaume (eds. L’immagine di Alfonso il Magnanimo tra letteratura e storia, tra Corona d’Aragona e Italia - La imatge d’Algons el Magnànim en la literatura i la Historiografia entre la Corona d’Aragó i Itàlia, Florència, SISMEL -Edizioni del Galluzzo , 2016, XII + 300 p. ISBN: 978-88-8450-691-7

Directory of Open Access Journals (Sweden)

Marta Marfany Simó

2016-12-01

Full Text Available Review to Delle Donne, Fulvio & Torró, Jaume (eds. L’immagine di Alfonso il Magnanimo tra letteratura e storia, tra Corona d’Aragona e Italia - La imatge d’Algons el Magnànim en la literatura i la Historiografia entre la Corona d’Aragó i Itàlia, Firenze, SISMEL -Edizioni del Galluzzo , 2016, XII + 300 p. ISBN: 978-88-8450-691-7

Influência da auto-percepção do envelhecimento e dos traços de personalidade na satisfação com a reforma

OpenAIRE

Fragoso, Nuno Miguel do Rosário Mendes

2013-01-01

Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2013 O presente trabalho foca-se no estudo da influência da auto-perceção do envelhecimento e dos traços de personalidade na satisfação com a reforma, numa amostra de idosos oriundos da comunidade e sem psicopatologia diagnosticada. Tem como objetivos: (1) analisar a auto-perceção do envelhecimento, os traços de personalidade e a s...

Changes in stature during and after spinal traction in young male subjects Alterações na estatura antes e após a tração vertebral em homens jovens

Directory of Open Access Journals (Sweden)

ALF Rodacki

2007-02-01

Full Text Available BACKGROUND: Spinal traction is a relatively popular procedure for increasing the intervertebral space by applying separating forces. The parameters of time and magnitude of the traction forces may influence the outcomes from this procedure and need to be investigated. The duration of the benefits derived from traction is unknown and needs to be determined so that physiotherapists can provide better and more effective treatments. OBJECTIVE: This study analyzed the relationship between load magnitude and time during spinal traction in relation to stature variations. Traction effect duration was also analyzed. METHOD: Fifteen healthy male subjects (23.1 ± 5.77 years; 1.80 ± 0.17 m and 87.0 ± 9.6 kg were assessed under three traction conditions (0, 30 and 60% of body weight, BW of 42 minutes. Stature variation was used to determine intervertebral disc height variation. Stature was assessed every 7 minutes during traction of 42 minutes and every 5 minutes for 45 minutes after traction ceased. RESULTS: 0 and 30% BW traction produced similar gains (6.09 ± 1.89 mm, 5.70 ± 1.88 mm, respectively; p>0.05, while these were smaller (pCONTEXTUALIZAÇÃO: A tração sobre a coluna vertebral é um procedimento relativamente popular para aumentar o espaço inter-vertebral pela aplicação de forças de separação. Os parâmetros de tempo e magnitude da força aplicada podem influenciar os resultados desse procedimento e ainda precisam ser investigados. A duração dos benefícios derivados da tração não é conhecida e precisa ser determinada para que fisioterapeutas possam prover tratamentos melhores e mais eficientes. OBJETIVO: Este estudo analisou a relação entre a magnitude de carga e de tempo durante a tração vertebral sobre as variações de estatura, bem como a duração deste efeito. MÉTODOS: Quinze sujeitos saudáveis do sexo masculino (23,1 ± 5,77 anos; 1,80 ± 0,17 m e 87,0 ± 9,6 Kg foram mensurados sob três condições (0, 30 e 60% PC

Condutas desviantes e traços de personalidade: testagem de um modelo causal

OpenAIRE

Vasconcelos,Tatiana Cristina; Gouveia,Valdiney Veloso; Pimentel,Carlos Eduardo; Pessoa,Viviany Silva

2008-01-01

A meta principal deste estudo foi comprovar a adequação de um modelo causal à explicação de comportamentos socialmente desviantes (condutas anti-sociais e delitivas), considerando a contribuição dos traços de personalidade (neuroticismo, extroversão e busca de sensações). Para tanto, participaram 755 estudantes do Ensino Médio e Superior, sendo a maioria do sexo feminino (50,3%), de escolas privadas (53,0%) e com idades variando de 16 a 26 anos (média=20,1; desvio-padrão=3,12). Estes responde...

Management of rare, low anal anterior fistula exception to Goodsall′s rule with Kṣārasūtra

Directory of Open Access Journals (Sweden)

Pradeep S Shindhe

2014-01-01

Full Text Available Anal fistula (bhagandara is a chronic inflammatory condition, a tubular structure opening in the ano-rectal canal at one end and surface of perineum/peri-anal skin on the other end. Typically, fistula has two openings, one internal and other external associated with chronic on/off pus discharge on/off pain, pruritis and sometimes passing of stool from external opening. This affects predominantly male patients due to various etiologies viz., repeated peri-anal infections, Crohn′s disease, HIV infection, etc., Complex and atypical variety is encountered in very few patients, which require special treatment for cure. The condition poses difficulty for a surgeon in treating due to issues like patient hesitation, trouble in preparing kṣārasūtra, natural and routine infection with urine, stool etc., and dearth of surgical experts and technique. We would like to report a complex and atypical, single case of anterior, low anal fistula with tract reaching to median raphe of scrotum, which was managed successfully by limited application of kṣārasūtra.

Resistência à tração entre amálgama e resina composta em diferentes condições de oxidação - estudo in vitro

Directory of Open Access Journals (Sweden)

YOUSSEF Michel Nicolau

1999-01-01

Full Text Available Este trabalho estuda in vitro a resistência à tração de corpos-de-prova de amálgama-resina composta unidos pelo adesivo dental Scotchbond Multi-Uso Plus. Os corpos-de-prova foram divididos em três grupos de dez, sendo que cada corpo era o resultado da união de dois discos, um de amálgama e outro de resina composta. Esses discos foram obtidos dentro de cilindros de baquelite e sofreram acabamento superficial com lixa de grana 600. Pretendeu-se simular a técnica do amalcomp e verificar a resistência à tração entre o amálgama e a resina composta em diferentes condições de oxidação do amálgama. Dos resultados obtidos e mediante análise de variância e teste de Tukey a 5%, pôde-se concluir que: o Grupo 3, que ficou na saliva artificial por trinta dias e portanto sofreu maior oxidação, apresenta resistência à tração superior e estatisticamente significante em relação aos grupos 1 e 2; o Grupo 2, que ficou na saliva por sete dias e sofreu menor oxidação, não apresenta resistência à tração estatisticamente superior ao Grupo 1 de amálgama recém-condensado.

Il problema dei debiti internazionali nel periodo tra le due guerre mondiali. (The international debt problem in the interwar period

Directory of Open Access Journals (Sweden)

M. DE CECCO

2013-12-01

Full Text Available Grande attenzione è stata recentemente dedicata al problema attuale del debito del terzo mondo e le sue implicazioni per il sistema bancario internazionale . Una rassegna di eventi simili a volte precedenti in passato dimostra che gli operatori dei mercati finanziari internazionali hanno la memoria corta , poiché la maggior parte degli aspetti della crisi si sono verificati in passato. Questo è confermato dal considerare il problema del debito internazionale tra la prima e la seconda guerra mondiale . La principale differenza tra allora e adesso è che il periodo tra le due guerre fu un periodo di transizione da un sistema di commercio dominato daòòa sterlina ad uno dominato  dal dollaro statunitense . Molti dei problemi di oggi derivano da questa continua dominazione dollaroConsiderable attention has recently been paid to the current problem of third world debt and its implications for the international banking system. A review of similar events at previous times in the past shows that operators in international financial markets have very short memories, since most of the aspects of the current crisis have occurred in the past. This is borne out by considering the international debt problem between the first and second world wars. The major difference between then and now is that the interwar period was a time of transition from a sterling-dominated trading system to one dominated by the US dollar. Many of today's problems stem from this continuing dollar domination.JEL: N24

Estimativa do risco de traça-verde Palpita vitrealis (Rossi) amplificada por contaminante?

OpenAIRE

Mateus, Helena; Pereira, Cândido; Cardoso, Miguel; Manteigas, Ana; Sequeira, Manuel; Figueiredo, Elisabete; Luz, J.P.; Mexia, António

2012-01-01

A monitorização da população de traça-verde foi efectuada, em olivais da Cova da Beira, em armadilhas com três formulações comerciais de feromona sexual: Russell (em armadilha funil tricolor) e SEDQ e Suterra (ambas em armadilha delta). As contagens, semanais, decorreram: nas armadilhas iscadas com feromona SEDQ, entre Março e Novembro de 2010; nas armadilhas com feromona Russell e Suterra, de Setembro a Novembro. As capturas variaram de 0 a 4 indivíduos/armadilha/semana. Nas armadilhas com S...

Estimativa do risco de Traça-Verde, Palpita vitrealis (Rossi) amplificada por contaminate?

OpenAIRE

Mateus, Helena; Pereira, Cândido; Cardoso, Miguel; Manteigas, Ana; Sequeira, Manuel; Figueiredo, Elisabete; Luz, João Pedro; Mexia, António

2012-01-01

A monitorização da população de traça-verde foi efectuada, em olivais da Cova da Beira, em armadilhas com três formulações comerciais de feromona sexual: Russell (em armadilha funil tricolor) e SEDQ e Suterra (ambas em armadilha delta). As contagens, semanais, decorreram: nas armadilhas iscadas com feromona SEDQ, entre Março e Novembro de 2010; nas armadilhas com feromona Russell e Suterra, de Setembro a Novembro. As capturas variaram de 0 a 4 indivíduos/armadilha/semana. Nas armadilhas com S...

Numerical Calculation of Coherent Synchrotron Radiation Effects Using TraFiC4

International Nuclear Information System (INIS)

Kabel, Andreas C.

2000-01-01

Coherent synchrotron radiation (CSR) occurs when short bunches travel on strongly bent trajectories. Its effects on high-quality beams can be severe and are well understood qualitatively. For quantitative results, however, one has to rely on numerical methods. There exist several simulation codes utilizing different approaches. The authors describe in some detail the code TraFiC 4 developed at DESY for design and analysis purposes, which approaches the problem from first principles and solves the equations of motion either perturbatively or self-consistently. They present some calculational results and comparison with experimental data. Also, they give examples of how the code can be used to design beamlines with minimal emittance growth due to CSR

Análise radiográfica da coluna cervical em indivíduos assintomáticos submetidos a tração manual Radiographic analysis of the cervical spine in healthy individuals submitted to manual traction

Directory of Open Access Journals (Sweden)

Roger Burgo de Souza

2008-08-01

Full Text Available OBJETIVO: Avaliar, radiograficamente, o efeito da tração manual sobre o comprimento da coluna cervical. MATERIAIS E MÉTODOS: Cinqüenta e cinco participantes de ambos os gêneros - 12 masculinos (22% e 43 femininos (78% - sem história de distúrbios cervicais contituíram a amostra deste estudo. Eles foram submetidos a dois procedimentos radiológicos, um antes e outro durante a tração manual sustentada por 120 segundos. As distâncias entre as bordas anteriores e posteriores da segunda à sétima vértebras cervicais foram mensuradas e comparadas antes e durante a tração manual. RESULTADOS: A mediana da distância anterior antes da tração foi de 8,40 cm e durante a tração aumentou para 8,50 cm (p=0,002. A mediana da distância posterior antes da tração foi de 8,35 cm e durante a tração aumentou para 8,50 cm (pOBJECTIVE: To evaluate radiographically the effect of manual traction on the length of the cervical spine in healthy individuals. MATERIALS AND METHODS: The sample of the present study included 55 individuals - 12 men (22% and 43 women (78% - with no previous history of cervical disorders, submitted to two radiological procedures previously and during manual traction sustained for 120 seconds. Distances between the anterior and posterior edges from the second to the seventh cervical vertebrae were measured and compared before and during manual traction. RESULTS: The median of pre-traction anterior length was 8.40 cm, increasing to 8.50 cm during the traction (p=0.002; and the median of pre-traction posterior length was 8.35 cm, increasing to 8.50 cm during traction (p<0.001. CONCLUSION: Application of manual traction resulted in a statistically significant increase in the length the cervical spine in healthy individuals.

Traços estereotípicos associados a pessoas jovens e idosas em Portugal

OpenAIRE

Marques, Sibila; Lima, Maria Luísa; Novo, Rosa

2006-01-01

O objectivo geral deste trabalho foi o de recolher os atributos estereotípicos do grupo das pessoas jovens e idosas em Portugal. Foi conduzido um estudo em que se procedeu ao controlo do sexo dos alvos e da pertença etária dos participantes. Na primeira fase do estudo, 67 pessoas jovens e 85 pessoas idosas realizaram uma tarefa de geração espontânea de traços culturalmente associados a pessoas jovens e idosas de ambos os sexos. No segunda fase do estudo, 62 pessoas jovens e 62 pes...

Numerical modelling of the V-J combinations of the T cell receptor TRA/TRD locus.

Directory of Open Access Journals (Sweden)

Florence Thuderoz

2010-02-01

Full Text Available T-Cell antigen Receptor (TR repertoire is generated through rearrangements of V and J genes encoding alpha and beta chains. The quantification and frequency for every V-J combination during ontogeny and development of the immune system remain to be precisely established. We have addressed this issue by building a model able to account for Valpha-Jalpha gene rearrangements during thymus development of mice. So we developed a numerical model on the whole TRA/TRD locus, based on experimental data, to estimate how Valpha and Jalpha genes become accessible to rearrangements. The progressive opening of the locus to V-J gene recombinations is modeled through windows of accessibility of different sizes and with different speeds of progression. Furthermore, the possibility of successive secondary V-J rearrangements was included in the modelling. The model points out some unbalanced V-J associations resulting from a preferential access to gene rearrangements and from a non-uniform partition of the accessibility of the J genes, depending on their location in the locus. The model shows that 3 to 4 successive rearrangements are sufficient to explain the use of all the V and J genes of the locus. Finally, the model provides information on both the kinetics of rearrangements and frequencies of each V-J associations. The model accounts for the essential features of the observed rearrangements on the TRA/TRD locus and may provide a reference for the repertoire of the V-J combinatorial diversity.

Numerical Modelling Of The V-J Combinations Of The T Cell Receptor TRA/TRD Locus

Science.gov (United States)

Dariz, Aurélie; Baum, Thierry Pascal; Hierle, Vivien; Demongeot, Jacques; Marche, Patrice Noël; Jouvin-Marche, Evelyne

2010-01-01

T-Cell antigen Receptor (TR) repertoire is generated through rearrangements of V and J genes encoding α and β chains. The quantification and frequency for every V-J combination during ontogeny and development of the immune system remain to be precisely established. We have addressed this issue by building a model able to account for Vα-Jα gene rearrangements during thymus development of mice. So we developed a numerical model on the whole TRA/TRD locus, based on experimental data, to estimate how Vα and Jα genes become accessible to rearrangements. The progressive opening of the locus to V-J gene recombinations is modeled through windows of accessibility of different sizes and with different speeds of progression. Furthermore, the possibility of successive secondary V-J rearrangements was included in the modelling. The model points out some unbalanced V-J associations resulting from a preferential access to gene rearrangements and from a non-uniform partition of the accessibility of the J genes, depending on their location in the locus. The model shows that 3 to 4 successive rearrangements are sufficient to explain the use of all the V and J genes of the locus. Finally, the model provides information on both the kinetics of rearrangements and frequencies of each V-J associations. The model accounts for the essential features of the observed rearrangements on the TRA/TRD locus and may provide a reference for the repertoire of the V-J combinatorial diversity. PMID:20174554

Educational Program Status of Premarital Counseling Centers in Hamadan Province Based on Theory of Reasoned Action (TRA

Directory of Open Access Journals (Sweden)

Mohamad Mahdi Hazavehei

2013-09-01

Full Text Available Background & Objective: Divorce, unwanted pregnancies, and unsuccessful marriages create mental, emotional, physical, and financial problems for individuals, families, and ultimately the community. Premarital education and counseling is one of the most effective ways for the prevention of such problems. The purpose of this study was to describe and evaluate the effectiveness of a premarital educational program by using the TRA (Theory of Reasoned Action. Materials and Methods: Four hundred couples who attended premarital education and counseling classes voluntarily participated in this descriptive and analytical study. Variables such as attitude, subjective norms, and intention, were collected by using a validated questionnaire based on the TRA components. The questionnaire was filled out before and after the educational classes. Results: The mean age of the couples was 23.16 ± 5.64 years old. Statistically significant differences were found in knowledge, attitude, and subjective norms before and after participation in the classes (p value 0.05. Conclusion: Although the mean knowledge and attitude of the couples under study increased after the classes, the increase was not high and only 20% of the couples gained acceptable knowledge. The effectiveness of such classes in the current manner is very low. Application of appropriate educational methods and media-based models and theories is highly recommended.

Comportamentos de risco para os transtornos alimentares e traços perfeccionistas em atletas de atletismo

Directory of Open Access Journals (Sweden)

Leonardo de Sousa Fortes

Full Text Available Resumo O objetivo do estudo foi analisar a influência do perfeccionismo nos comportamentos de risco para os transtornos alimentares de atletas adolescentes do sexo feminino da modalidade atletismo. Fizeram parte do estudo 52 atletas da modalidade de atletismo de clubes da cidade de São Paulo/SP com idade entre 12 e 17 anos. Utilizaram-se as subescalas do Eating Attitudes Test (EAT-26 e a Multidimensional Perfectionism Scale (MPS para avaliar os comportamentos de risco para os transtornos alimentares e os traços perfeccionistas, respectivamente. Conduziu-se a regressão linear múltipla stepwise para analisar a influência dos perfeccionismo nos comportamentos de risco para os transtornos alimentares. Os resultados indicaram influência da MPS nos escores das subescalas Dieta (F(1, 44 = 5,74; p = 0,05 e Autocontrole Oral (F(1, 44 = 6,13; p = 0,04 do EAT-26. No entanto, não foi evidenciado impacto da MPS nos escores da subescala Bulimia e Preocupação com 0 Alimenta (F(1, 44 = 1,26; p = 0,22. Assim, em razão da investigação apresentar delineamento transversal, pressupõe-se que as atletas de atletismo com traços perfeccionistas podem estar mais susceptíveis para a restrição alimentar e a influência ambiental para a ingesta alimentar.

Reconhecer e traduzir traços de Sêneca em Shakespeare

Directory of Open Access Journals (Sweden)

Renata Cazarini de Freitas

2014-07-01

  O filósofo Sêneca (c.4 a.C.-65 d.C. é autor de oito tragédias latinas às quais se atribui, regra geral, elevado grau de “influência” na literatura dramática produzida na Inglaterra da virada do século XVI para o XVII. Sem recorrer ao usual método de localizar citações ou equivalências textuais, propõe-se aqui reconhecer os traços da elocução senequiana em Shakespeare a partir da identificação de dispositivos da retórica antiga e de suas correspondências em cenas específicas de Richard III, Hamlet e The Tempest. A tradução dessas peças a partir do latim ou do inglês deve refletir o domínio e a intenção dos autores no uso de tais expedientes retóricos.

Uso de traçadores fluorescentes para determinar características de transporte e dispersão no Rio Piabanha (RJ para a modelagem quali-quantitativa pelo HEC-RAS

Directory of Open Access Journals (Sweden)

Paulo Vitor Ribeiro Marques da Silva

Full Text Available RESUMO Um estudo de campo foi realizado em um trecho de aproximadamente 70 km do rio Piabanha, localizado entre Petrópolis e Areal, na região serrana do Estado do Rio de Janeiro, para estimar as características de transporte e dispersão de contaminantes usando técnicas de traçadores fluorescentes. A análise dos resultados de dois trabalhos de campo, realizados no outono de 2012, permitiu determinar os valores de tempo de trânsito, vazão líquida, velocidade média e coeficiente de dispersão longitudinal. Utilizou-se os dados de vazão e velocidade média obtidos nos ensaios com traçadores para calibrar o modelo hidrodinâmico unidimensional Hydrologic Engineering Center’s River Analysis System (HEC-RAS. Considerando que parâmetros hidráulicos obtidos por métodos clássicos em rios com geometria muito irregular, como a do rio Piabanha, não são adequados para representar as características médias de um trecho, os ensaios com traçadores representaram uma boa alternativa para obtenção de parâmetros necessários a modelos hidrodinâmicos. Os resultados obtidos pelo modelo HEC-RAS apresentaram ótima concordância com os dados obtidos por meio dos ensaios com traçadores fluorescentes.

A valoração de traços de concordância dentro do DP Concord features valuing within DP

Directory of Open Access Journals (Sweden)

Telma M.V. Magalhães

2004-06-01

Full Text Available Este trabalho argumenta em favor da valoração dos traços de concordância dentro do DP em termos da operação Agree (Chomsky, 1999 sem a necessidade de estipular nenhum outro mecanismo para tanto. Mostro que Agree dá conta da valoração de traços tanto no nível da sentença quanto no nível do DP, contra a sugestão de Chomsky (1999 de que concordância no DP envolveria algum outro mecanismo de checagem.This paper argues in favor of a concord features valuing within the DP in terms of the Agree operation (Chomsky, 1999, with no recourse to any other mechanism. I show that Agree accounts for feature valuing both in the sentence level as well as in the DP, contrary to Chomsky's (1999 suggestion that concord in DP should involve some other checking mechanism.

Sulla cortesia linguistica: un’analisi sociopragmatica di un’intervista tra Fabio Fazio e Antonio Di Pietro

Directory of Open Access Journals (Sweden)

Edoardo Natale

2011-12-01

Full Text Available O presente artigo esboça uma análise do ato linguístico da discordância, segundo uma perspectiva sociopragmática, com o objetivo de estabelecer as diferenças conversacionais e culturais. Privilegiou-se a discordância como traço saliente porque ela permite analisar a qualidade da cortesia linguística presente numa interação ocorrida no programa televisivo “Che tempo che fa”, entre Fabio F

La dinamica tra appartenere e differenziarsi: elementi della trasformazione nella terapia ‘a geometria variabile’ con adolescenti migranti

Directory of Open Access Journals (Sweden)

Graziana Mangiacavallo

2015-01-01

Full Text Available In questo lavoro sarà affrontata la dinamica tra processo di appartenenza e differenziazione in età adolescenziale, attraverso l’esemplificazione di un caso clinico. Tale dinamica è resa complessa dal fatto che il caso in oggetto, rimanda a trame culturali della migrazione. Tale lavoro prende in esame la possibilità dell’utilizzo di strategie integrate, come la consultazione culturale, alla luce del modello a ‘geometria variabile.

Simulation of a small computer of the TRA-1001 type on the BESM computer

International Nuclear Information System (INIS)

Galaktionov, V.V.

1975-01-01

Considered are the purpose and probable simulation ways of one computer by the other. The emulator (simulation program) is given for a small computer of TRA-1001 type on BESM-6 computer. The simulated computer basic elements are the following: memory (8 K words), central processor, input-output program channel, interruption circuit, computer panel. The work with the input-output devices, teletypes ASP-33, FS-1500 is also simulated. Under actual operation the emulator has been used for translating the programs prepared on punched cards with the aid of translator SLANG-1 by BESM-6 computer. The translator alignment from language COPLAN has been realized with the aid of the emulator

... e no começo era a fome: três movimentos da dietética na criação do homem

Directory of Open Access Journals (Sweden)

Henrique Figueiredo Carneiro

Full Text Available Curiosamente, os mitos que conhecemos para dar conta da existencia humana tocam indiscutivelmente a presença da dietética, como condição inerente à hominização do vivente. Isso pode ser constatado nos mitos do Gênesis, de Theuth e do Pai da horda primitiva, mediante o texto "Totem e tabu". Essa constatação torna atual o aforismo de Schiller, ressaltando que a fome e o amor aparecem como a mola do universo. Essa questão, impõe, de princípio, uma reflexão sobre a importância do traço da dietética como uma marca na qual o homem constrói, mediante essa ação, um sentido à existência. Com isso, trabalhamos com a hipótese de que a dietética pos-sibilita uma referência epistêmica constante para o entendimento do lugar que o homem ocupa subjetivamente em determinada época; e, sobretudo, apresenta-se como uma linha de trabalho psicanalítico promissora, quando ratifica o sujeito como um produto da passagem realizada da natureza à cultura.

Alla scoperta della crittografia quantistica

CERN Document Server

Filoramo, Eva; Pasquero, Claudia

2006-01-01

La crittografia si sviluppa e perfeziona per rispondere all'esigenza di segretezza nella trasmissione delle informazioni. La crittografia quantistica consente, al contrario di quella correntemente usata, di inviare messaggi che non potranno essere decifrati e di vanificare al massimo i tentativi di una loro intercettazione. Partendo dalla storia dei codici segreti, il libro affronta gli sviluppi pertinenti della teoria quantistica, per approdare infine alla più avanzata ricerca scientifica e tecnologica. Lo scopo è quello di richiamare l'attenzione su un tema le cui applicazioni pratiche coprono molti settori d'interesse strategico e sono destinate, nel prossimo futuro, a rivoluzionare i metodi di scambio delle informazioni.

La «speciale provvidenza» nella caduta di una falena: ibridismi woolfiani tra saggio e short story

Directory of Open Access Journals (Sweden)

Paolo Bugliani

2016-05-01

Full Text Available Il contributo intende mettere in luce le dinamiche di ibridazione tra i generi saggio e novella nella prosa breve di Virginia Woolf, in particolare in quegli esemplari di saggi che presentano delle caratteristiche smaccatamente immaginifiche e narrative che li distanziano nettamente dall’ideale di saggio quale «breve testo nonfinzionale in prosa». Nota al grande pubblico proprio per la sua programmatica ricerca di codici espressivi sempre nuovi e per le sperimentazioni con i generi più disparati, nel caso della prosa breve Woolf riesce con successo a infrangere i confini tra argomentativo e narrativo per giungere a una forma mediana che trae la sua identità sia dalla fiction che dalla nonfiction. Tramite un’analisi di alcune tra le short stories e i saggi più significativi, il contributo vuole essere uno spunto per una più ampia riflessione su quanto la mescolanza di stilemi diversi sia non solo un tratto letterario tipico della letteratura modernista, quanto piuttosto la risposta a una necessità di trovare una via altra nel panorama letterario, quasi una pulsione creativa primigenia che, nel caso delle contaminazioni tra saggio e narrativa breve, può essere affiancata al concetto di saggismo proposto da Robert Musil. The Death of the Moth, Street Haunting e molti altri saggi woolfiani permettono quindi di ricalibrare le demarcazioni fra generi, e di ripensare gli idealtipi che nella mentalità comune sono assurti a modelli e per l’uno e per l’altro dei due generi brevi in prosa, che in questa sede rappresentano i limiti estremi dello spettro di analisi. My paper aims at evaluating the hybridizing techniques that V. Woolf deployed in her shorter prose to blur the edges between the essay and the short story, in particular in those essayistic specimens that present some markedly imaginative features which undermine the ideal of the essay as a «brief, nonfictional prose piece». Woolf is justly renowned for her programmatic and

Conjugative Plasmid Transfer in Xylella fastidiosa Is Dependent on tra and trb Operon Functions.

Science.gov (United States)

Burbank, Lindsey P; Van Horn, Christopher R

2017-11-01

The insect-transmitted plant pathogen Xylella fastidiosa is capable of efficient horizontal gene transfer (HGT) and recombination. Natural transformation occurs at high rates in X. fastidiosa , but there also is evidence that certain strains of X. fastidiosa carry native plasmids equipped with transfer and mobilization genes, suggesting conjugation as an additional mechanism of HGT in some instances. Two operons, tra and trb , putatively encoding a conjugative type IV secretion system, are found in some but not all X. fastidiosa isolates, often on native plasmids. X. fastidiosa strains that carry the conjugative transfer genes can belong to different subspecies and frequently differ in host ranges. Using X. fastidiosa strain M23 ( X. fastidiosa subsp. fastidiosa ) or Dixon ( X. fastidiosa subsp. multiplex ) as the donor strain and Temecula ( X. fastidiosa subsp. fastidiosa ) as the recipient strain, plasmid transfer was characterized using the mobilizable broad-host-range vector pBBR5pemIK. Transfer of plasmid pBBR5pemIK was observed under in vitro conditions with both donor strains and was dependent on both tra and trb operon functions. A conjugative mechanism likely contributes to gene transfer between diverse strains of X. fastidiosa , possibly facilitating adaptation to new environments or different hosts. IMPORTANCE Xylella fastidiosa is an important plant pathogen worldwide, infecting a wide range of different plant species. The emergence of new diseases caused by X. fastidiosa , or host switching of existing strains, is thought to be primarily due to the high frequency of HGT and recombination in this pathogen. Transfer of plasmids by a conjugative mechanism enables movement of larger amounts of genetic material at one time, compared with other routes of gene transfer such as natural transformation. Establishing the prevalence and functionality of this mechanism in X. fastidiosa contributes to a better understanding of HGT, adaptation, and disease emergence

Uso do verbo PEGAR na perífrase [PEGAR (E V2]: traços semântico-pragmáticos

Directory of Open Access Journals (Sweden)

Dayane da Silva Grilo

2013-06-01

Full Text Available Neste estudo, com fundamentação nos pressupostos teóricos do funcionalismo norte-americano, abordamos o uso do verbo PEGAR na perífrase [PEGAR (E V2], em que PEGAR é o verbo auxiliar gramatical V1 e V2 é o verbo nuclear lexical. Temos como objetivo analisar traços semântico-pragmáticos vinculados à perífrase [PEGAR (E V2] no português brasileiro contemporâneo, buscando indícios que contribuam para a descrição da função desempenhada por PEGAR nessa perífrase. Para tanto, fazemos uso de dados de fala extraídos dos corpora Discurso & Gramática referentes a Natal (RN e ao Rio de Janeiro (RJ. Os resultados, obtidos através de análise quantitativa, revelam que PEGAR desempenha, na maioria das ocorrências, a função de indicar aspecto global, salientando um conjunto de traços semântico-pragmáticos como pontualidade, subtaneidade e/ou uma tomada de iniciativa do agente (no papel sintático de sujeito da perífrase.

Abdominal adipose tissue distribution in obese children. US versus CT measurements; Valutazione della distribuzione del tessuto adiposo addominale nei bambini obesi. Confronto tra ecografia e Tomografia Computerizzata

Energy Technology Data Exchange (ETDEWEB)

Ferrozzi, F.; Zuccoli, G.; Tognini, G.; Castriota-Scanderbeg, A.; Bacchini, E. [Parma Univ., Parma (Italy). Ist. di Scienze Radiologiche; Bernasconi, S. [Modena Univ., Modena (Italy). Clinica Pediatrica; Campani, R. [Pavia Univ., Pavia (Italy). Ist. di Radiologia

1999-12-01

Computed Tomography (CT) and, more recently, ultrasound (US), have proved excellent tools for quantifying adipose tissue distribution. Body fat distribution is an important factor in the treatment of obesity and its complications. In this work it is investigated the correlation between CT and US measurements in pediatric obesity. Forty obese children and adolescents aged 4.1-14.8 years were submitted to CT and US. Intra-abdominal, subcutaneous and total body fat were calculated (in cm{sup 2}), with the CT image analysis software. The rectus muscle-spine and rectus muscle-aorta distances, as indicative of visceral fat thickness, were measured on US images with(out) compression. The distance between skin fat and fat-rectus muscle interfaces was measured as subcutaneous fat thickness. US-CT findings have been compared with other morphometric variables-i.e., patient's (ideal) body weight and skin fold measures. A statistically significant correlation was found between the CT measurement of visceral fat and the aorta-rectus muscle and rectus muscle-spine distances (r=0.80 and 0.74, respectively). The US measurements of subcutaneous fat were correlated with CT subcutaneous fat area (r=0.82). No correlation was found between overweight, as calculated by body mass index, and CT or US fat. In conclusions, the findings indicate that US is as useful as CT in evaluating body fat distribution in pediatric obesity. [Italian] La TC e piu' recentemente l'ecografia si sono dimostrate eccellenti tecniche di valutazione della quantita' e della distribuzione del tessuto adiposo corporeo. La compartimentazione del grasso corporeo ha, infatti, importanti implicazioni per il trattamento dell'obesita' e delle sue complicanze. Scopo dello studio e' stato quello di correlare i risultati ottenuti con la TC con quelli ecografici nella valutazione dell'obesita' del paziente pediatrico. Quaranta bambini obesi con eta' compresa tra 4,1 e 14

Avaliação de traços de personalidade em pacientes com fobia social Evaluation of personality traits in social phobia patients

Directory of Open Access Journals (Sweden)

Mariângela Gentil Savoia

2010-01-01

Full Text Available CONTEXTO: Os sintomas de transtornos de personalidade (Eixo II comumente encontrados em pacientes com fobia social se sobrepõem com os sintomas que descrevem o transtorno pelo Eixo I. OBJETIVO: O presente estudo teve por objetivo avaliar traços de personalidade em pacientes com diagnóstico de fobia social. MÉTODO: Cento e oito sujeitos com idade entre 18 e 65 anos foram avaliados pelo Inventário de Temperamento e Caráter de Cloninger. RESULTADO: Os pacientes com fobia social diferiram dos dados normativos nos seguintes traços de personalidade: Busca à Novidade, Fuga de Danos, Persistência, Autodirecionamento e Autotranscendência. CONCLUSÃO: Esses achados apontam para uma sobreposição entre a descrição dos traços de personalidade citados por Cloninger e a descrição dos sintomas de fobia social do DSM-IV, Eixo I.BACKGROUND: The symptoms of personality disorders (Axis II commonly found in social phobia patients overlap highly with the symptoms that typify the Axis I disorder and are thus linked to diagnostic process in symptomatic patients. OBJECTIVE: The aim of the present study was to evaluate personality traits of social phobia patients. METHOD: One hundred and eight subjects were selected, from 18 to 65 years of age, who fulfilled the criteria of social phobia. The Cloninger's Temperament and Character Inventory (TCI was applied. RESULTS: Social phobia patients differed in normalized data in the following personality traits: Novelty Seeking, Harm Avoidance, Persistence, Self Directedness, and Self-Transcendence. DISCUSSION: These findings point to a high overlap between Cloninger's description of the observed predominant personality traits and DSM-IV Axis I symptoms description for social phobia.

A Caenorhabditis elegans wild type defies the temperature-size rule owing to a single nucleotide polymorphism in tra-3.

Directory of Open Access Journals (Sweden)

Jan E Kammenga

2007-03-01

Full Text Available Ectotherms rely for their body heat on surrounding temperatures. A key question in biology is why most ectotherms mature at a larger size at lower temperatures, a phenomenon known as the temperature-size rule. Since temperature affects virtually all processes in a living organism, current theories to explain this phenomenon are diverse and complex and assert often from opposing assumptions. Although widely studied, the molecular genetic control of the temperature-size rule is unknown. We found that the Caenorhabditis elegans wild-type N2 complied with the temperature-size rule, whereas wild-type CB4856 defied it. Using a candidate gene approach based on an N2 x CB4856 recombinant inbred panel in combination with mutant analysis, complementation, and transgenic studies, we show that a single nucleotide polymorphism in tra-3 leads to mutation F96L in the encoded calpain-like protease. This mutation attenuates the ability of CB4856 to grow larger at low temperature. Homology modelling predicts that F96L reduces TRA-3 activity by destabilizing the DII-A domain. The data show that size adaptation of ectotherms to temperature changes may be less complex than previously thought because a subtle wild-type polymorphism modulates the temperature responsiveness of body size. These findings provide a novel step toward the molecular understanding of the temperature-size rule, which has puzzled biologists for decades.

Ecological-floristic analysis of soil algae and cyanobacteria on the Tra-Tau and Yurak-Tau Mounts, Bashkiria

Science.gov (United States)

Bakieva, G. R.; Khaibullina, L. S.; Gaisina, L. A.; Kabirov, R. R.

2012-09-01

The species composition of the soil algae and cyanobacteria in the Tra-Tau and Yurak-Tau mountains is represented by 136 species belonging to five phyla: Cyanobacteria (56 species), Chlorophyta (52 species), Xanthophyta (13 species), Bacillariophyta (12 species), and Eustigmatophyta (3 species). Hantzschia amphioxys var. amphioxys, Hantzschia amphioxys var. constricta, Klebsormidium flaccidum, Leptolyngbya foveolarum, Luticola mutica, Navicula minima var. minima, Nostoc punctiforme, Phormidium jadinianum, Phormidium autumnale, and Pinnularia borealis were identified more often than other species. The composition of the algal flora depended on the soil properties; the higher plants also had a significant influence on the species composition of the soil algae.

Traço e estado de ansiedade de nutrizes com indicadores de hipogalactia e nutrizes com galactia normal

OpenAIRE

Aragaki, Ilva Marico Mizumoto; Silva, Isília Aparecida; Santos, Jair Lício Ferreira dos

2006-01-01

Este estudo objetivou identificar e comparar o traço e estado de ansiedade, no 10º dia pós-parto e estado de ansiedade no 30º dia puerperal, das nutrizes primíparas e multíparas que apresentaram indicadores de hipogalactia e nutrizes com galactia normal; verificar possíveis relações entre o estado de ansiedade das nutrizes nesses dois momentos com a presença dos indicadores de hipogalactia. É um estudo exploratório/descritivo, cujos dados foram obtidos com 168 nutrizes e seus filhos, por meio...

Genomic and expression analyses of Tursiops truncatus T cell receptor gamma (TRG) and alpha/delta (TRA/TRD) loci reveal a similar basic public γδ repertoire in dolphin and human.

Science.gov (United States)

Linguiti, Giovanna; Antonacci, Rachele; Tasco, Gianluca; Grande, Francesco; Casadio, Rita; Massari, Serafina; Castelli, Vito; Consiglio, Arianna; Lefranc, Marie-Paule; Ciccarese, Salvatrice

2016-08-15

The bottlenose dolphin (Tursiops truncatus) is a mammal that belongs to the Cetartiodactyla and have lived in marine ecosystems for nearly 60 millions years. Despite its popularity, our knowledge about its adaptive immunity and evolution is very limited. Furthermore, nothing is known about the genomics and evolution of dolphin antigen receptor immunity. Here we report a evolutionary and expression study of Tursiops truncatus T cell receptor gamma (TRG) and alpha/delta (TRA/TRD) genes. We have identified in silico the TRG and TRA/TRD genes and analyzed the relevant mature transcripts in blood and in skin from four subjects. The dolphin TRG locus is the smallest and simplest of all mammalian loci as yet studied. It shows a genomic organization comprising two variable (V1 and V2), three joining (J1, J2 and J3) and a single constant (C), genes. Despite the fragmented nature of the genome assemblies, we deduced the TRA/TRD locus organization, with the recent TRDV1 subgroup genes duplications, as it is expected in artiodactyls. Expression analysis from blood of a subject allowed us to assign unambiguously eight TRAV genes to those annotated in the genomic sequence and to twelve new genes, belonging to five different subgroups. All transcripts were productive and no relevant biases towards TRAV-J rearrangements are observed. Blood and skin from four unrelated subjects expression data provide evidence for an unusual ratio of productive/unproductive transcripts which arise from the TRG V-J gene rearrangement and for a "public" gamma delta TR repertoire. The productive cDNA sequences, shared both in the same and in different individuals, include biases of the TRGV1 and TRGJ2 genes. The high frequency of TRGV1-J2/TRDV1- D1-J4 productive rearrangements in dolphins may represent an interesting oligo-clonal population comparable to that found in human with the TRGV9- JP/TRDV2-D-J T cells and in primates. Although the features of the TRG and TRA/TRD loci organization reflect

Il popolo tra realtà politica e finzione ideologica

Directory of Open Access Journals (Sweden)

Roberto Gatti

2012-10-01

Full Text Available Ci si può chiedere quale sia il motivo che spinge ad affrontare la non facile prova consistente nel delineare un percorso di riflessione in chiave filosofica intorno al concetto di “popolo” prendendo in esame il periodo che va dalla prima alla tarda modernità, sino a sfiorare (almeno l’epoca della quale noi, uomini e donne del presente, siamo protagonisti, il più delle volte molto perplessi e parecchio disorientati.Il perché sta nel tentativo di mostrare che, per quanto questo lungo periodo sia, a proposito del nostro argomento, parecchio complesso e contraddistinto da un esteso pluralismo di punti di vista, presenta però, a mio avviso, almeno una caratteristica unitaria. Si tratta della difficoltà di articolare teoreticamente un concetto di “popolo” sul quale non gravino quei limiti sui quali vorrei concentrare l’attenzione: limiti ovviamente non secondari, ma tali da compromettere gravemente il concetto in questione.In tutto il tragitto che proverò a tracciare, non vorrei semplicemente procedere prendendo nota dei punti oscuri rinvenibili in questa o quella concezione di “popolo”, e così mettere in atto una sorta d’incolore e, tutto sommato, ridondante elenco che collochi uno dopo l’altro gli autori come in una galleria dei nobili fallimenti della filosofia politica dal ‘500 a oggi. La posta in gioco è ben diversa. La presento, per ora molto concisamente, come segue.Nel De republica di Cicerone – importante sintesi di una già consolidata tradizione – è evidente la corrispondenza concettuale tra “res publica” e “populus”: la società politica si dà solo in presenza di un’associazione tenuta insieme “per accordo nell’osservare la giustizia” e “per comunanza di interessi”. Il popolo, che si forma a causa della “naturale inclinazione a vivere bene” presente in ogni essere umano, esprime, nella sua unità etico-giuridica, il senso propriamente politico insito nel condurre un�

DISTORSIONI GEOMETRICHE DELLA CARTOGRAFIA STORICA: ANALISI DI ALCUNE CARTOGRAFIE REALIZZATE TRA IL 1500 ED IL 1700 RELATIVE AL GOLFO DI TRIESTE

OpenAIRE

Mauro, Giovanni

2016-01-01

È ben nota l'importanza dell'apparato iconografico proprio della cartografia storica, il cui limite generalmente lamentato è relativo all'accuratezza geometrica. Nel presente contributo, mediante l'utilizzo di un software dedicato, disponibile gratuitamente in rete (Mapanalyst), si punta ad analizzare la precisione geometrica di alcune cartografie storiche (carte realizzate tra l'inizio del 1500 e la fine del 1700) relative al Golfo di Trieste. Utilizzando una serie di punti do...

Biobanche in bilico tra proprietà privata e beni comuni: brevetti o open data sharing? Biobanks on Balance between Private Property and Commons: Patents or Open Data sharing?

Directory of Open Access Journals (Sweden)

Antonella De Robbio

2010-12-01

Full Text Available

La diffusione e la condivisione dei dati contenuti nelle Biobanche è studiato attraverso lo statuto normativo di queste istituzioni, con particolare attenzione al diritto d'autore. Queste istituzioni sono rappresentate da un complesso organizzato di campioni biologici umani con finalità diagnostiche, terapeutiche e di ricerca. Data la relativa novità dell'argomento, il loro statuto è molto controverso e particolarmente complicato è il caso dello sfruttamento di eventuali scoperte.

La titolarità della proprietà dei materiali (cellule, tessuti o organi e la titolarità della proprietà della biobanca, intesa come entità che si occupa della gestione della banca dati, è infatti fondamentale al fine di determinare eventuali diritti su ricerche brevettabili. In Europa esiste il diritto sui generis, che stabilisce i diritti per il costitutore della banca dati, il quale stanzia un investimento economico al fine di costituire un insieme organizzato di informazioni. Tuttavia, il principale problema di questo tipo di banche dati è legato alla qualità dell'oggetto brevettabile: la materia organica, vivente ed autoreplicante.

Al riguardo, vi è una netta contrapposizione tra coloro che spingono per la privatizzazione di questi beni biologici, al fine del loro possibile sfruttamento commerciale, e coloro che si rifanno ai modelli di open data sharing, che considerano Commons, "beni comuni", anche questo tipo di materiali organici. La tendenza generale risulta essere la seconda, proteggere il corpo umano e il suo genoma da ogni forma di sfruttamento economico, pur riconoscendo in alcuni casi la possibilità di profitti connessi con la proprietà intellettuale derivante dall'opera dell'ingegno.

The circulation and sharing of contents in biobanks is approached with the study of the normative statutes of these institutions, with careful attention to copyright. Such institutions are an

A AUTORIA, O DISPOSITIVO E A ÉTICA: OS LIMITES DA (DESSUBJETIVAÇÃO NA ESCRITA

Directory of Open Access Journals (Sweden)

Atilio BUTTURI JUNIOR

Full Text Available RESUMO Este texto tem como objetivo oferecer uma releitura do conceito de autoria de Michel Foucault, definido e comentado a partir de três textos fundamentais: A Arqueologia do Saber, O que é um autor? e A Ordem do Discurso. A hipótese é de que a autoria pode ser lida como um dispositivo – o dispositivo da autoria ou autoral – e que, dessa perspectiva, pode ser problematizado a partir do conceito de resistência e da preocupação ética do chamado “último Foucault”. Para defender tal hipótese, recorre-se inicialmente à descrição do conceito do dispositivo e do conceito de autoria, na arqueogenealogia e segundo alguns comentadores. Depois, traça-se uma discussão entre o dispositivo da autoria e as possibilidades de resistência e de criação subjetiva, presentes em conceitos como epimeleia heautou, crítica ou dessubjetivação. Por fim, sugere-se que o dispositivo da autoria pode ser lido ainda foucaultianamente, desde que segundo a ordem de uma política e de uma luta agonística entre os viventes e os dispositivos.

Estado da Arte nos Quitinozoários: Designação da Ordem, Afinidades Biológicas, Paleoambiente e Breve Histórico no Âmbito das Bacias do Amazonas e do Paraná

Directory of Open Access Journals (Sweden)

Hilda Leonor Coevas de Azevedo-Soares

2005-01-01

Full Text Available Interpretados sob diversas óticas variando conforme o pensamento científico dos pesquisadores, os quitinozoários constituem um grupo enigmático tanto no que diz respeito ao seu significado como as suas afinidades biológicas. Distribuídos desde o Ordoviciano (Tremadociano até o final Devoniano, estes organismos são hoje ferramentas primordiais na datação desses estratos assim como na prospecção de depósitos de combustíveis fósseis. O presente trabalho levantará, portanto, aspectos da atualidade sobre o estado da arte dos quitinozoários tendo como base à designação da ordem Chitinozoa criada por A. Eisenack em 1931 e posteriormente reformulada pelo mesmo em 1972, com a divisão nas ordens Prosomatifera e Operculifera. Além de suas possíveis afinidades biológicas (filogenia com outros grupos fósseis e viventes como rotíferos e cnidários. No Brasil estes ocorrem desde o final do Ordoviciano? ao Devoniano, desta feita traçaremos um breve histórico sobre os trabalhos desenvolvidos nos últimos cinqüenta anos em duas de suas principais bacias paleozóicas: Amazonas e Paraná.

L’alienazione della donna tra esibizione e occultamento del corpo: dall’oscenità alla costruzione tecnica

Directory of Open Access Journals (Sweden)

Ines Testoni

2013-06-01

Full Text Available L’articolo discute della contrapposizione tra la modalità italiana di considerare il corpo della donna, quale mero oggetto di desiderio sessuale, attraverso la sua esibizione e ildenudamento mediatici versus quella musulmana che, invece, lo nasconde sotto khimar,jilbab o burqa. L'analisi fa perno sui diritti umani fondamentali che nel loro percorsostorico, promuovono il primato dell’individuo e della sua autodeterminazione, per arri-vare a considerare i concetti di alienazione e di oscenità e verificare come le due posi-zioni siano in continuità. Si discute, quindi, delle possibili cause che, anche nell’attualesocietà occidentale, potrebbero ripristinare forme di tradizionalismo, a partire dalla stessa volontà delle donne.

Desenvolvimento e exigências térmicas de Trichogramma pretiosum Riley, criados em duas traças do tomateiro

Directory of Open Access Journals (Sweden)

PRATISSOLI DIRCEU

2000-01-01

Full Text Available Estudou-se a biologia de Trichogramma pretiosum em ovos de Phthorimaea operculella (Zeller e Tuta absoluta (Meyrick em diferentes temperaturas (18, 20, 22, 25, 30 e 32ºC, 70±10% de umidade relativa e fotofase de 14 horas, com o objetivo de se determinarem as exigências térmicas, bem como o número de gerações durante o ano. Houve correlação inversa entre a duração do ciclo e o aumento de temperatura na faixa térmica estudada. A razão sexual, no entanto, não foi afetada pela temperatura quando o hospedeiro foi T. absoluta. A viabilidade de T. pretiosum, criado em P. operculella foi mais afetada que em T. absoluta. A exigência térmica, calculada pelo método da hipérbole, foi maior no tocante a T. absoluta (131,3 graus dia em relação a P. operculella (120,9 graus dia, e o limiar térmico inferior, respectivamente, 12,98 e 13,53°C. No que tange a ambas as espécies de traças, a longevidade do parasitóide sempre obedeceu à distribuição de Weibull. O potencial de aumento foi avaliado, em ambas as espécies de traças, com base no número de gerações anuais.

Quam maximis potest itineribus: andata e ritorno della costruzione tra immagine e modello nello spazio grafico della geometria descrittiva

Directory of Open Access Journals (Sweden)

Matteo Ballarin

2012-06-01

Full Text Available Il contributo testimonia una strategia d'insegnamento congiunto del rilievo architettonico, della geometria descrittiva e del disegno digitale concepita come un viaggio di andata e ritorno tra immagine e modello. Iniziando dalla fotogrammetria elementare e dalle tecniche di foto-modellazione offerte da software (gratuiti e dotati di un'interfaccia sufficientemente  intuitiva si possono poi introdurre – col metodo di Monge – le tecniche del rilievo topografico, giungendo alla costruzione interdefinita di un unico modello digitale degli oggetti del rilievo. Il circolo didattico si chiude poi costruendo rappresentazioni tabulari tradizionali dei modelli.

Modelo de oposições múltiplas modificado: abordagem baseada em traços distintivos Modified multiple oppositions' model: approach based on distinctive features

Directory of Open Access Journals (Sweden)

Karina Carlesso Pagliarin

2009-01-01

Full Text Available O objetivo deste trabalho foi propor uma abordagem com enfoque em traços distintivos para o Modelo de Oposições Múltiplas e testar sua aplicação em um sujeito falante do Português Brasileiro. O Modelo foi aplicado em um sujeito do sexo masculino, com desvio fonológico moderado-severo e idade de seis anos e meio. Após avaliação fonológica, procedeu-se à seleção dos sons-alvo. Considerou-se o sistema fonológico inicial, bem como os traços distintivos alterados ([+voz], [+soante], [+aproximante], [coronal/±anterior], [-contínuo]. Os traços com maior número de alterações eram [+voz, +soante, +aproximante], justificando a escolha dos seguintes sons-alvo para tratamento: /r/ x /l/ x // x // x /z/, em onset medial.Tendo como base a aplicação desse modelo em falantes do inglês, percebeu-se a necessidade de introduzir alguns procedimentos, como: a escolha dos sons-alvo a partir dos traços distintivos alterados e a estrutura da sessão terapêutica. Ao final, o sujeito foi reavaliado a fim de verificar as aquisições no sistema fonológico. Após dez sessões de fonoterapia,o sujeito adquiriu os fonemas /l, , , z/, generalizando-os para outras posições na palavra (/Z/ e /l/ em onset inicial. Verificou-se, também, a ocorrência de generalização para a mesma classe e para outras classes de sons (/b/, /d/, /g/, /v/. No entanto, o fonema /r/ não foi adquirido. Esta proposta mostrou-se efetiva, pois o sujeito apresentou melhora em seu sistema fonológico com poucas sessões terapêuticas. Pôde-se observar que o Modelo de Oposições Múltiplas, utilizando a abordagem com base em traços distintivos é eficaz, pois favoreceu diversas mudanças fonológicas.The aim of this study was to propose an approach based on distinctive features for the Multiple Oppositions Model, and to test its application on a Brazilian Portuguese speaker. The model was used with a male subject with moderate-severe phonological disorder and six years

The influence of spirituality and religiosity on breast cancer screening delay in African American women: application of the Theory of Reasoned Action and Planned Behavior (TRA/TPB).

Science.gov (United States)

Gullate, Mary

2006-01-01

African American women (AAW) are 25% more likely to present with late stage breast cancer and 20% more likely to die from their disease than Caucasian women. Researchers report that a treatment delay of 3 months is a significant factor in breast cancer mortality. Socioeconomic factors, lack of access and knowledge, spiritual and religious beliefs, fear and fatalism are reported as contributing factors to screening delays. Studies have primarily applied the Health Belief Model (HBM) and modified versions like the Champion HBM to preventive health practices. Neither have significant inclusion of spirituality or religiosity. The TRA/TPB focus on beliefs, intent and attitude as individual determinants of the likelihood of performing a specific behavior; but have not had wide utility in studies related to screening delays among AAW. This paper explores the utility of applying the TRA/TPB as the theoretical framework for determining cultural relevance of spirituality and religiosity to screening delays among AAW.

Investigation of antioxidant potential of peptide fractions from the Tra Catfish by-product-derived hydrolysate using Alcalase® 2.4 L FG

Science.gov (United States)

Vo, Tam D. L.; Chung, Duy T. M.; Doan, Kien T.; Le, Duy T.; Trinh, Hung V.

2017-09-01

In this study, the antioxidant capacity of peptide fractions isolated from the Tra Catfish (Pangasius hypophthalmus) by-product-derived proteolysate using ultrafiltration centrifugal devices with 5 distinct molecular-weight cutoffs (MWCOs) of 1 kDa, 3 kDa, 5 kDa, 10 kDa, and 30 kDa was investigated. Firstly, the chemical composition of the Tra Catfish by-products was analyzed. The result showed that the Tra Catfish by-products contained 58.5% moisture, 33.9% crude protein, 50.1% crude lipid and 15.8% ash (on dry weight basis). Secondly, the effects of hydrolysis time, enzyme content on the antioxidant potential of the proteolysate were studied using DPPH• (2,2-diphenyl-1-picrylhydrazyl) radical scavenging method (DPPH• SM) and FRAP (Ferric Reducing Antioxidant Potential) method. Alcalase® 2.4 L FG was used for hydrolysis. The result of antioxidant activity of the hydrolysate showed that the 50% DPPH• inhibition concentration (IC50) of the hydrolysate reached about 6775 µg/mL which was 1645-fold higher than that of vitamin C and 17-fold higher than that of BHT (ButylatedHydroxytoluene) with the degree of hydrolysis (DH) of the hydrolysate of 14.6% when hydrolysis time was 5 hours, enzyme/substrate (E/S) ratio was 30 U/g protein, hydrolysis temperature was 55°C, and pH was 7.5. The antioxidant potential of hydrolysate using FRAP method reached about 52.12 µM Trolox equivalent which was 53-fold and 18-fold lower than those of vitamin C and BHT, respectively, when the hydrolysis time was 5 h, enzyme/substrate ratio was 30 U/g protein, temperature was 500C, and pH level was 8. Next, the proteolysate was further fractionated using MWCOs of 1 kDa, 3 kDa, 5 kDa, 10 kDa, and 30 kDa and the peptide fractions were investigated for their antioxidant activity. The result showed that the <1 kDa fraction showed strongest antioxidant activity with the IC50 of 1313.31 ± 50.65 µg/mL and FRAP value of 906.90 ± 44.32 µM Trolox equivalent. The second strongest fraction

Um caso de discriminação genética: o traço falciforme no Brasil Genetic Discrimination: sickle cell trait in Brazil

Directory of Open Access Journals (Sweden)

Cristiano Guedes

2007-01-01

Full Text Available Este artigo discute um caso de discriminação genética envolvendo uma atleta brasileira de voleibol identificada como portadora do traço falciforme. O traço falciforme é uma das características genéticas mais prevalentes na população brasileira, mas não �� descrito como uma doença genética. O avanço da genética clínica vem provocando uma popularização dos testes genéticos em diferentes contextos de promoção da saúde. Ao criticar o argumento da Confederação Brasileira de Vôlei de que o exame para o traço falciforme seria uma medida de proteção à saúde dos atletas, o objetivo do artigo foi demonstrar como a popularização da informação genética não pode prescindir do aconselhamento genético e de garantias éticas. A análise mostrou que a exclusão da atleta da seleção oficial de vôlei não se justificou por medidas de proteção à saúde, mas por discriminação genética.This paper analyses a case of genetic discrimination of a Brazilian volleyball athlete. A routine exam identified the sickle cell trait in her blood. The sickle cell trait is one of the most prevalent genetic information in Brazilian population, but it not considered a genetic disease. The advancement of clinical genetic promotes a popularization of genetic tests in different health care initiatives. The aims of this paper are: 1 to criticize the argument supporting the test for sickle cell trait as a health care initiative; 2 to demonstrate how the popularization of genetic information demands genetic counseling and ethical protections. The analysis demonstrates how the athlete exclusion from the official volleyball team is not supported by medicine and is a case of genetic discrimination.

La formazione di un’aristocrazia: monache e monasteri femminili a Venezia tra IX e XIII secolo

Directory of Open Access Journals (Sweden)

Rapetti, Anna

2014-06-01

Full Text Available This paper examines the processes that shaped the identity of the Venetian aristocracy from the 9th to the 13th centuries and the role played by the relationship between patrician families and some female monasteries. The important female monastery of San Zaccaria and some other nunneries created in the lagoon between the 12th and the 13th centuries are taken into account in the analysis of the formation of Venetian aristocracy from this innovative perspective. By analysing the behaviour of the aristocratic families towards these nunneries, the paper points out how Venetian ruling groups made use of the long-term relationship with nuns as a particularly useful instrument of political competition. The article also shows how some female monasteries were relevant social actors in the process of defi nition of Venetian identity, largely coinciding with their own ruling groups, and in particular with the aristocracy, and with the exercise of power.[it] L’articolo si propone di esaminare il processo di definizione dell’identità del ceto dirigente di Venezia nel periodo IX-XIII secolo e il ruolo occupato dalle relazioni tra le famiglie dell’aristocrazia che costituivano quel ceto e alcuni monasteri femminili. In questa prospettiva, innovativa nell’analisi della formazione dell’aristocrazia di Venezia, si prenderà in esame l’importante monastero femminile di San Zaccaria e si farà inoltre riferimento ad alcuni altri, sorti sulle isole della laguna tra XII e XIII secolo, espressione di un clima religioso e sociale nuovo e particolare. Attraverso l’analisi dei comportamenti adottati dalle famiglie aristocratiche nei confronti di questi monasteri, si dimostra che il ceto dirigente veneziano si servì delle relazioni costanti con le monache come di uno strumento della lotta politica particolarmente utilizzato dalle famiglie dell’aristocrazia della città. Si osserva anche che alcuni monasteri femminili furono a loro volta soggetti attivi

Jinekomasti tedavisinde ‘liposuction’ – artroskopik kıkırdak traşlayıcı kombinasyonu

OpenAIRE

Ersoy, Burak; Aköz, Tayfun

2014-01-01

Giriş: Uzun süredir mevcut jinekomasti tanısı konulan erişkin erkeklerde tek etkin tedavi seçeneği cerrahidir. Jinekomastinin düzeltilmesine ilişkin birçok farklı cerrahi teknik tarif edilmiştir. Bu çalışmada, ameliyat izini en az düzeyde tutmak amacıyla artroskopik traşlayıcı cihazın konvansiyonel LPS uygulamasına kombine edildiği jinekomasti düzeltici cerrahi yöntemin tanıtılması ve sunulan cerrahi teknikle elde edilen sonuçların değerlendirilmesi hedeflenmiştir. Gereç ve Yöntem: 2012 ve 2...

Proliferative sickle cell retinopathy associated with sickle cell trait and gestational diabetes: case report Retinopatia falciforme proliferativa associada a traço falciforme e diabetes gestacional: relato de caso

Directory of Open Access Journals (Sweden)

Jefferson Augusto Santana Ribeiro

2009-06-01

Full Text Available Proliferative sickle cell retinopathy is an uncommon complication in individuals with sickle cell trait (AS. However, the risk for proliferative retinopathy development is increased in patients with AS hemoglobinopathy associated with systemic conditions or ocular trauma. A case of a patient with AS hemoglobinopathy who developed proliferative sickle cell retinopathy after the occurrence of gestational diabetes and pregnancy-induced hypertension is reported. Hemoglobin electrophoresis revealed presence of A2 5.0%, S 35.0% and A 53.2%. The present case emphasizes the importance of evaluating systemic comorbidities in patients with sickle cell trait during pregnancy since sickle cell retinopathy can progress rapidly, as well as the importance of regular eye fundus examination in these patients.Retinopatia falciforme proliferativa é uma complicação incomum em indivíduos com traço falciforme, havendo, porém, risco aumentado de desenvolver retinopatia proliferativa em pacientes com hemoglobinopatia AS associada a condições sistêmicas ou trauma ocular. Neste artigo será apresentado um caso de paciente com diabetes gestacional, hipertensão arterial sistêmica associada à gravidez e traço falciforme. Eletroforese de hemoglobinas revelou a presença de A2 5,0%, S 35,0% e A 53,2%. Este caso ressalta a importância da avaliação de comorbidades sistêmicas em pacientes com traço falciforme no período gestacional, uma vez que pode ocorrer rápida progressão da retinopatia falciforme, devendo-se realizar também exames regulares do fundo de olho nestes pacientes.

Resistência à tração de emendas dentadas de madeira de Manilkara huberi para o emprego em madeira laminada colada

Directory of Open Access Journals (Sweden)

Julio Cesar Molina

Full Text Available Resumo A utilização de elementos estruturais de madeira laminada (ou lamelada colada (MLC requer um estudo experimental das combinações entre a espécie de madeira e o adesivo utilizado. Este trabalho objetivou o estudo da combinação espécie-adesivo na resistência a tração e na falha da linha de cola de corpos de prova de madeira de maçaranduba (Manilkara huberi confeccionados com e sem emendas dentadas finger joint. As colagens foram realizadas com lâminas sem tratamento preservativo, com aproximadamente 12% de umidade e com o emprego do adesivo mono-componente do tipo poliuretano Purbond HB 712. A gramatura de adesivo utilizada nas emendas dentadas foi linha simples de cola com aproximadamente 200 g m-2 e pressão de contato igual a 10 MPa. Após sete dias de cura do adesivo foram realizados testes de tração nos corpos de prova com e sem emendas dentadas, possibilitando julgar, também por meio da análise de variância, a eficiência das emendas testadas. Os resultados da experimentação revelaram a ineficiência da interface entre o adesivo e a madeira de analisada, pois a ruptura ocorreu na linha de cola, categorizando modo de ruptura do tipo 1, que corresponde à pior situação de falha.

Influência da auto-percepção do envelhecimento e dos traços de personalidade na sintomatologia depressiva em idosos

OpenAIRE

Lourenço, Sara Tatiana Ferreira

2012-01-01

Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2012 O presente trabalho refere-se ao estudo da influência da auto-percepção do envelhecimento e dos traços de personalidade na sintomatologia depressiva, numa amostra de adultos mais velhos, em meio não institucional e sem psicopatologia diagnosticada. Tem como objectivos: (1) analisar a auto-percepção do envelhecimento; (2) anali...

Efeitos da orientação genetica fornecida a doadores de sangue com o traço falciforme : riscos e beneficios

OpenAIRE

Roberto Benedito de Paiva e Silva

1995-01-01

Resumo: A triagem populacional de heterozigotos assintomáticos para fins de orientação genética é um procedimento bastante controvertido, por envolver o risco de rotulação, discriminação, estigmatização, perda de auto-estima e invasão de privacidade. Assim sendo, investigou-se no presente trabalho os efeitos da orientação genética fornecida a doadores de sangue portadores do traço falciforme (heterozigotos AS). Foram convidados, por carta, 92 doadores AS para receber orientação genética gratu...

Personality traits and treatment outcome in obsessive-compulsive disorder Traços de personalidade e resposta terapêutica no transtorno obsessivo-compulsivo

Directory of Open Access Journals (Sweden)

Felipe Corchs

2008-09-01

ão respondem a tratamentos de primeira linha. Não obstante, não existem estudos comparando diretamente traços de personalidade entre pacientes responsivos e refratários ao tratamento do transtorno obsessivo-compulsivo. Este estudo investiga diferenças nos traços da personalidade baseados no Inventário de Temperamento e Caráter de Cloninger (TCI entre dois grupos de pacientes com transtorno obsessivo-compulsivo classificados segundo desfecho terapêutico: responsivos e refratários. MÉTODO: Quarenta e cinco pacientes refratários e 44 responsivos foram selecionados. Os indivíduos foram considerados responsivos se, após tratamento com terapêutica convencional, apresentaram diminuição de ao menos 40% no escore inicial da Yale-Brown Obsessive Compulsive Scale, foram classificados como "melhor" ou "muito melhor" na Clinical Global Impressions; e mantiveram melhora por pelo menos um ano. Os refratários eram os pacientes que não atingiram redução de ao menos 25% na Yale-Brown Obsessive Compulsive Scale e tiveram a melhoria menor que "mínima" na Clinical Global Impressions após o tratamento com ao menos três inibidores seletivos da recaptura de serotonina, incluindo clomipramina, e ao menos 20 horas da terapia cognitiva-comportamental. Os traços da personalidade foram avaliados através do Temperament and Character Inventory. RESULTADOS: Refratários pontuaram menos em autodirecionamento e tenderam a pontuar mais em persistência. CONCLUSÃO: Este estudo sugere que os traços de personalidade, especialmente autodirecionamento, estão associados com a resposta pobre do tratamento em pacientes com transtorno obsessivo-compulsivo.

Oana Sălişteanu Cristea, Introduzione alla dialettologia italiana, Tra lingua e dia­ letto, Editura DAIM, Bucureşti 2002, 160 pagine

Directory of Open Access Journals (Sweden)

Pavao Tekavčić

2002-12-01

Full Text Available La professoressa dall'Ateneo di Bucarest, in cui insegna lessicologia, filologia e dialettologia italiana, ci ha regalato due anni fa un primo volume dedicato all'italiano, Prestito latino - elemento ereditario nel lessico de/la lingua italiana. Doppioni e va­ rianti, Praga 2000. Adesso la studiosa ci offre un' altra opera, citata nel titolo della nos­ tra recensione. 11 libro, diciamolo subito, trascende i limiti della filologia italiana, essendo di notevole interesse e importanza per varie altre discipline linguistiche.

Análise da influência do traço nas propriedades do compósito cimento-madeira

Directory of Open Access Journals (Sweden)

Alessandra Monique Weber

2017-08-01

Full Text Available Os compósitos de cimento com adição de madeira apresentam vantagens, quando comparados a outros materiais convencionais da construção civil, como resistência à água, ao fogo e aos agentes deterioradores. Um dos obstáculos para o uso desse compósito é a inibição causada pela madeira na cura do cimento, devido aos componentes da madeira afetarem as reações, tendo como consequência um compósito de baixa qualidade. Dessa forma, este trabalho teve por objetivo avaliar diferentes traços do compósito cimento-madeira, utilizando resíduos de Pinus spp., por meio de ensaios de laboratório. Foi utilizado o cimento Portland CP II Z 32, relação água/cimento igual a 0,4; o aditivo químico escolhido foi o cloreto de cálcio para acelerar a pega. Para a comparação de desempenho, foram delimitadas quatro dosagens diferentes, com teores de adição de madeira de 10%, 20%, 25% e 33% em relação à massa de cimento. Para a análise, foram feitos ensaios das propriedades físicas e mecânicas para todas as dosagens, sendo, posteriormente, submetidas à análise da variância e teste de Tukey. Os resultados dos ensaios das propriedades físicas e mecânicas dos compósitos demonstraram que, para as relações escolhidas, quanto menor for a adição de madeira melhores serão os resultados das propriedades, mas mesmo os traços com maiores teores de madeira apresentam resultados relevantes, atentando-se apenas para o fato da relação água/cimento ser baixa para os casos analisados, e, devido a isso, ter influenciado negativamente nos resultados.

La salute del christifidelis celiaco tra dieta gluten free e invalidità delle ostie quibus glutinum ablatum est

Directory of Open Access Journals (Sweden)

Tiziana Di Iorio

2015-04-01

SOMMARIO: 1. L’Eucarestia: “augusto” strumento per la salute deichristifideles nell’economia della salvezza - 2. La transustanziazione - 3. La malattia celiaca e l’unico rimedio terapeutico: la dieta gluten free - 4. Ilchristifidelis affetto dalla sprue celiaca tra dieta gluten free e pane mere triticeus - 5. Prime disposizioni sul divieto dell’uso di ostie quibus glutinum ablatum est - 6. La particola con “una minima quantità di glutine” - 7. Le vigenti prescrizioni sulla validità della materia eucaristica e l’uso di ostie a basso contenuto di glutine - 8. La normativa sulla comunione dei celiaci tra sospetti e apprezzamenti - 9. Ultime precisazioni sull’uso del pane con poca quantità di glutine - 10. Conclusioni. The health of the christifidelis celiac between diet gluten free and invalidity of the hosts quibus glutinum ablatum est.  ABSTRACT: The communion of celiac has aroused the attention of the Congregation for the Doctrine of the Faith for the direct connection between gluten, cause of the disease, and bread mere triticeus, precious element of the Eucharist. The complex matter concerns the impelling urgency to allow the christifidelis celiac to follow a super stricte gluten free diet, necessary way to the protection of his mental and physical health, without expelling him from the eucharistic banquet, indispensable instrument of salvation of his own soul. Therefore, in the saving mission of the Church called to the salus animarum of every man, without discriminating exclusions, direct specific norms are emanated to harmonize the dogmatic demands, connected to the Eucharestic, and the therapeutic needs related to mental and physical health of the faithful with the disease. Such norms have faced the validity of the eucharistic matter sealing the invalidity of the hosts quibus glutinum ablatum est, with a meaningful evolution, during the time. It stays, nevertheless, the suspect of an exhaustive solution of the question

Il territorio delle Lipari tra ambiente, cinema e turismo / The territory of Lipari between environment, cinema and tourism

Directory of Open Access Journals (Sweden)

Elena Di Blasi

2016-05-01

Full Text Available Fino agli anni ’50 le Lipari (dette anche Eolie, sfavorite dall’insularità e con un’economia di sussistenza, basata su attività tradizionali, erano dominate da povertà ed emigrazione. Tutto mutò nel 1949, quando una troupe cinematografica, guidata da Rossellini, girò Stromboli, interpretato da Ingrid Bergman: tra i due era nata una storia d’amore. Poco dopo, un’altra troupe utilizzò Vulcano come location dell’omonimo film, con Anna Magnani, ex fiamma di Rossellini. Questi cult passarono alla storia del cinema come la guerra dei vulcani. I due film, con gli scoop legati alle vicende sentimentali dei protagonisti, hanno innescato un nuovo percorso per le Eolie, fuori dall’atavico letargo, che ha determinato un vero e proprio “boom turistico”. Indagando la variegata realtà delle Lipari, lo scopo del presente articolo è quello di dimostrare come, attraverso un’analisi storica del mercato turistico, l’arrivo del cinema nel territorio eoliano abbia innescato importanti processi di sviluppo economico e cambiamento sociale. Questa ricerca vuole, inoltre, evidenziare il rapporto privilegiato tra insularità e cineturismo. Till the late 50s the Aeolian Islands, plagued by insularity and characterized by a subsistence economy based on traditional activities, had been dominated by poverty and emigration. All changed in 1949 when Rossellini shot Stromboli featuring Ingrid Bergman, his new love. Soon after a crew shot in Volcano the homonymous film starring Anna Magnani, Rossellini’s old flame. The two films, gone down in history as the war of volcanoes, and the scoops about the love scandal have drawn a new path for the Aeolian Islands that has taken them to a tourist boom. The present paper aims to show by means of a historical analysis of the local tourist market how the coming of the film industry have triggered processes of economic growth and social change in the Aeolian Islands. This paper also aims to point out the

Gas prices in Europe before oligopoly and liberalization; Il prezzo del gas in Europa tra liberalizzazione e oligopolio

Energy Technology Data Exchange (ETDEWEB)

Bianchi, A.

1998-09-01

The forthcoming incorporation of the EU Directive on the internal gas market shall set the conditions to increase competition among suppliers, thus lowering gas prices in Europe. But, in perspective, the strategic decisions taken by the majors tend to a stronger oligopoly coordination to sustain prices and share the gas price premium provided by environmental constraints and the technical dominance of combined-cycle plants. [Italiano] Con la direttiva comunitaria sul mercato interno del gas si dovrebbero creare le condizioni per una maggiore competizione tra i fornitori e, quindi, per una riduzione dei prezzi del gas in Europa. Le azioni strategiche delle major paiono invece tendere, in prospettiva, a un piu` forte coordinamento oligopolistico per sostenere i prezzi e spartirsi l`incremento di premio del gas garantito dai vincoli ambientali e dal dominio del ciclo combinato.

Resistência à tração de emendas dentadas de madeira de Manilkara huberi para o emprego em madeira laminada colada

OpenAIRE

Molina,Julio Cesar; Calil Neto,Carlito; Christoforo,André Luis

2016-01-01

Resumo A utilização de elementos estruturais de madeira laminada (ou lamelada) colada (MLC) requer um estudo experimental das combinações entre a espécie de madeira e o adesivo utilizado. Este trabalho objetivou o estudo da combinação espécie-adesivo na resistência a tração e na falha da linha de cola de corpos de prova de madeira de maçaranduba (Manilkara huberi) confeccionados com e sem emendas dentadas finger joint. As colagens foram realizadas com lâminas sem tratamento preservativo, com ...

Editoriale – Hölderlin: la cesura del vivente

Directory of Open Access Journals (Sweden)

Andrea Mecacci

2012-05-01

Full Text Available This number is dedicated to Hölderlin. Starting from a variety of perspectives this issue aims to underline the main role of the German poet in the definition of modernity: from the marxist Lunačarskij interpretation to Böschenstein’s Celan- Hölderlin analysis. Other tipics are the problem of poetry in modern times (Mecacci, the “living” theme in Hölderlin, Nietzsche and Kant (Portera, the position of Kant’s aesthetic ideas in Hölderlin (Santini and an overview of Peter Weiss’ drama Hölderlin (Castellari. The issue includes also a translation of Patmos hymn and two letters of 1798.

L’amor come stile culturale. Auto-poiesi e strategie emozionali tra i giovani di Bubaque, Guinea Bissau

Directory of Open Access Journals (Sweden)

Lorenzo Bordonaro

2013-07-01

Full Text Available L’antropologia delle emozioni è legata in prevalenza a contesti etnografici descritti, direbbero Gupta e Ferguson (a cura, 1997, come “campi puri”. La maggior parte degli antropologi che lavora sulle emozioni, ha osservato William Reddy (1999, p. 256, utilizzano nelle loro etnografie il presente etnografico e si avvalgono di generalizzazioni che si fondano implicitamente su una concezione dei contesti culturali come ambiti di significati articolati logicamente in un sistema e segnati da confini precisi. Anche quando viene riconosciuta una molteplicità di discorsi contrastanti sulle emozioni, come nell’analisi di Lila Abu-Lughod (1986 delle performance emozionali tra i beduini awlad’ ali, l’ordine culturale all’interno del quale queste collisioni discorsive vengono comunque orchestrate getta un fondato sospetto sull’utilizzabilità degli strumenti di analisi proposti nel “manifesto” di Abu-Lughod e Lutz (a cura, 1990 in contesti meno puri o, forse, meno purificati.

Anorexia: o traço da obstinação na clínica psicanalítica

Directory of Open Access Journals (Sweden)

Isabel Fortes

2011-03-01

Full Text Available Veremos como o traço da "obstinação" na anorexia mental reflete elementos fundamentais para a compreensão dessa patologia. A recusa, na anorexia, possui a função de reação ativa frente a um outro intrusivo. A negação é compreendida a partir de duas vias: como sustentação do desejo próprio ou como um modo de aniquilação do desejo. No entanto, estas duas vias podem ser pensadas não como contradição, mas como uma fecunda aporia. Do mesmo modo, o tema da "obstinação" é de suma importância para a clínica em geral, conduzindo a uma análise da negação como uma forma possível de relação com o desejo.

Resistência de união imediata por tração de diferentes cimentos de ionômero de vidro a uma liga de Ni-Cr = Immediate tensile bond strength of different glass ionomer luting cements to a NiCr alloy

Directory of Open Access Journals (Sweden)

Ferraz, Roberta Penteado

2005-01-01

Full Text Available O objetivo deste estudo foi avaliar a resistência de união imediata por tração de diferentes cimentos de ionômero de vidro: convencional (Vidrion C, Vidrion C Caps, Ketac Cem, resinomodificado (Rely X, Protec Cem e o cimento de Fosfato de Zinco a uma liga de NiCr. Foram confeccionados pares de dispositivos metálicos em NiCr, com superfícies planas, próprios para a cimentação e testes de tração. Foram cimentados 12 pares metálicos de NiCr para cada agente cimentante, preparados de acordo com as recomendações do fabricante, totalizando 72 corpos de prova. Para manter os corpos de prova em posição e com carga constante durante a cimentação utilizou-se uma mesa metálica. Os corpos de prova foram armazenados em água destilada a 37° C durante 1 hora e, em seguida, submetidos aos testes de tração. Os resultados obtidos foram submetidos a ANOVA e Teste de Tukey (p < 0. 05. As médias de resistência, em MPa, encontradas foram: Vidrion C = 8,86; Vidrion C Caps = 10,91; Ketac Cem = 11,48; Rely X = 9,48; Protec Cem = 10,06; Fosfato de Zinco = 2,69. Todos os cimentos de ionômero de vidro testados apresentaram a média de resistência de união imediata por tração maior e estatisticamente significante que o cimento de Fosfato de Zinco. Não houve diferença significativa entre as médias de resistência obtidas para o Ketac-Cem, Vidrion C Caps, Protec Cem e Rely X, porém, o Ketac-Cem apresentou média estatisticamente significante e superior ao Vidrion C

Usvojen prijedlog povećanja iznosa općeg (globalnog ograničenja odgovornosti za pomorske tražbine

Directory of Open Access Journals (Sweden)

Marija Pospišil Miler

2012-12-01

Full Text Available Izmjene Protokola iz 1996. godine (LLMC 1996 Međunarodne konvencije o ograničenju odgovornosti za pomorske tražbine iz 1976. godine (LLMC 1976 usvojene su 19. travnja 2012. na 99. zasjedanju Pravnog odbora IMO-a održanom u Londonu. Tim izmjenama iznos općeg (globalnog ograničenja odgovornosti za pomorske tražbine povećan je za 51% u odnosu na iznose iz čl. 3. LLMC 1996 koji se odnose na čl. 6.1(a i 6.1(b, LLMC 1976, dok iznosi iz čl. 7. Konvencije nisu mijenjani. Povećani iznosi primjenjivat će se od 8. lipnja 2015. godine. U radu se analiziraju razlozi koji su doveli do povećanja iznosa općeg (globalnog ograničenja odgovornosti kao i opravdanost ovog povećanja iznosa ograničenja odgovornosti ako se uzme u obzir da je samo u 1,34% slučajeva šteta prelazila sadašnji iznos ograničenja odgovornosti utvrđen u LLMC 1996. Analiziraju se pravne i ekonomske posljedice ovog povećanja iznosa općeg ograničenja odgovornosti te njegov neposredan utjecaj na druge međunarodne konvencije vezane na iznose općeg ograničenja odgovornosti kao što su Bunker konvencija iz 2001. i Međunarodna konvencija o uklanjanju podrtina iz 2007. godine. Upozorava se, međutim, da tendencija koja vodi prema previsokim iznosima ograničenja odgovornosti može izazvati smanjenje interesa država za ratifikacijom LLMC 1996 što će se negativno odraziti na unifikaciju prava u odnosu na ovo pitanje. U radu se stoga razmatraju rješenja koja bi omogućila pravednu naknadu oštećenima i ostvarenje svrhe instituta ograničenja odgovornosti, a ne bi ugrozila unifikacijska nastojanja.

"Estudo sobre o traço e estado de ansiedade das nutrizes que apresentaram indicadores de hipogalactia e nutrizes com galactia normal"

OpenAIRE

Ilva Marico Mizumoto Aragaki

2002-01-01

A queixa de “pouco leite” ou hipogalactia tem sido apontada como uma das mais freqüentes causas do desmame ou interrupção do aleitamento materno exclusivoe, os baixos volumes de leite têm sido associados à ansiedade materna que poderia provocar alterações na fisiologia da lactação inibindo a produção láctea. Os objetivos deste estudo foram: identificar o traço e estado de ansiedade no 10°dia pós-parto e estado de ansiedade no 30ºdia pós-parto das nutrizes primíparas e multíparas que apresenta...

Relações hierárquicas entre os traços amplos do Big Five Hierarchical relationship between the broad traits of the Big Five

Directory of Open Access Journals (Sweden)

Cristiano Mauro Assis Gomes

2012-01-01

Full Text Available O modelo Big Five sustenta que a personalidade humana é composta por dezenas de fatores específicos. Apesar dessa diversidade, esses fatores confluem para cinco traços amplos que estão em um mesmo nível de hierarquia. O presente estudo apresenta uma hipótese alternativa, postulando níveis entre os traços amplos do modelo. Fizeram parte do estudo 684 estudantes do ensino fundamental e médio de uma escola particular de Belo Horizonte, MG, com idades entre 10 e 18 anos (m = 13,71 e DP= 2,11. Para medir os fatores do Big Five foi utilizado o Inventário de Características de Personalidade, anteriormente chamado de Inventário dos Adjetivos de Personalidade, de Pinheiro, Gomes e Braga (2009. O instrumento mensura oito polaridades das 10 polaridades presentes nos cinco traços amplos do Big Five. Dois modelos foram comparados via método path analysis: um modelo de quatro níveis hierárquicos e um modelo não hierárquico. O modelo hierárquico apresentou adequado grau de ajuste aos dados e mostrou-se superior ao modelo não hierárquico, que não se ajusta aos dados. Implicações são discutidas para o modelo Big Five.The Big Five model sustains that human personality is composed by dozens of specific factors. Despite of diversity, specific factors are integrated in five broad traits that are in the same hierarchical level. The current study presents an alternative hypothesis arguing that there are hierarchical levels between the broad traits of the model. Six hundred and eighty-four junior and high school level students from 10 to 18 years old (M = 13.71 and SD= 2.11 of a private school in the city of Belo Horizonte, Minas Gerais, Brazil participated in the study. The Big Five was measured by an Inventory of Personality Traits, initially named as Personality Adjective Inventory, elaborated by Pinheiro, Gomes and Braga (2009. This instrument measures eight polarities of the ten presented in the Big Five Model. Two models were compared

Prospettive educative per generare e ri-generare le rappresentazioni di genere. Riflessioni da una ricerca.

Directory of Open Access Journals (Sweden)

Stefano Benini

2012-06-01

Full Text Available Lo scritto segue gli esiti di una ricerca qualitativa “rappresentazione di genere” su  172 adolescenti di Bologna e Rimini.  I dati raccolti sono letti da un punto di vista pedagogico al fine di delineare tracce e metodi per facilitare le ragazze e i ragazzi alla scoperta di sé e a progettarsi nel proprio essere e divenire femmine e maschi.

L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo Ibérico e l’azionismo torinese.

OpenAIRE

Bottai, Alessio

2016-01-01

Síntesis L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo ibérico e l’azionismo torinese. Esta investigación tiene como objeto la historia de las relaciones que se mantuvieron durante más de dos décadas entre un grupo de intelectuales italianos, pertenecientes sobre todo a los azionisti, y algunos exponentes del antifranquismo español. Más específicamente, la tesis se centra en las relaciones activas de solidaridad humana y política que vincular...

Tensile bond strength of glass fiber posts luted with different cements Resistência à tração de pinos de fibra de vidro cimentados com diferentes materiais

Directory of Open Access Journals (Sweden)

Gerson Bonfante

2007-06-01

Full Text Available Proper selection of the luting agent is fundamental to avoid failure due to lack of retention in post-retained crowns. The objective of this study was to investigate the tensile bond strength and failure mode of glass fiber posts luted with different cements. Glass fiber posts were luted in 40 mandibular premolars, divided into 4 groups (n = 10: Group 1 - resin-modified glass ionomer RelyX Luting; Group 2 - resin-modified glass ionomer Fuji Plus; Group 3 - resin cement RelyX ARC; Group 4 - resin cement Enforce. Specimens were assessed by tensile strength testing and light microscopy analysis for observation of failure mode. The tensile bond strength values of each group were compared by ANOVA and Tukey test. The significance level was set at 5%. The failure modes were described as percentages. The following tensile strength values were obtained: Group 1 - 247.6 N; Group 2 - 256.7 N; Group 3 - 502.1 N; Group 4 - 477.3 N. There was no statistically significant difference between Groups 1 and 2 or between Groups 3 and 4, yet the resin cements presented significantly higher tensile bond strength values than those presented by the glass ionomer cements. Group 1 displayed 70% of cohesive failures, whereas Groups 2, 3 and 4 exhibited 70% to 80% of adhesive failures at the dentin-cement interface. We concluded that resin cements and glass ionomer cements are able to provide clinically sufficient retention of glass fiber posts, and that glass ionomer cements may be especially indicated when the application of adhesive techniques is difficult.A seleção adequada do agente cimentante é essencial para evitar falhas por perda de retenção em coroas retidas por núcleos. O objetivo deste estudo foi investigar a resistência à tração e o tipo de falha de pinos de fibra de vidro cimentados com diferentes materiais. Cimentaram-se pinos de fibra de vidro em 40 pré-molares inferiores, divididos em 4 grupos (n = 10: Grupo 1 - ionômero de vidro modificado

Accès des femmes autochtones et des paysannes à la justice en ...

International Development Research Centre (IDRC) Digital Library (Canada)

... on ne dispose que de peu de documents sur la manière dont ces femmes vivent l'injustice ... Colombia, South America, Guatemala, North and Central America ... International Water Resources Association, in close collaboration with IDRC, ...

O processamento auditivo e a combinação de traços distintivos na aquisição de fala em crianças com desvios fonológicos Auditory processing and combination of distinctive features in speech acquisition in children with phonological disorders

Directory of Open Access Journals (Sweden)

Victor Gandra Quintas

2011-06-01

Full Text Available OBJETIVO: Investigar a relação entre as habilidades auditivas e as combinações de traços presentes na fala de crianças com desvios fonológicos. MÉTODOS: Participaram da pesquisa 22 crianças com diagnóstico de desvio fonológico, com idades entre 5 e 7 anos e de ambos os gêneros. Foi feita a coleta dos dados de fala por meio do teste Avaliação Fonológica da Criança. A combinação de traços foi observada mediante o Modelo Implicacional de Complexidade de Traços (MICT. Os traços adquiridos consideraram uma produção correta acima de 80%. Foram aplicados ainda os testes: Avaliação Simplificada do Processamento Auditivo (triagem, Teste Dicótico de Dissílabos Alterados (SSW, Teste Dicótico de Dígitos, Teste de Fusão Binaural, Teste de Fala no Ruído e o Teste de Logoaudiometria Pediátrica (PSI. RESULTADOS: Todas as crianças obtiveram 100% de êxito no PSI. Nos testes de fala no ruído e de fusão binaural, bem como na triagem, os sujeitos também obtiveram médias altas. Os testes SSW e Dicótico de Dígitos mostraram escores baixos. A combinação de traços que se mostrou mais alterada foi a [+aproximante,+contínuo], que está na composição do fonema /r/, seguida de [coronal,+contínuo]/(-anterior, que compõem os fonemas /ʃ,ʒ/. CONCLUSÃO: Os resultados obtidos nos testes SSW e Dicótico de Dígitos mostraram haver alteração nas habilidades de ordenação temporal complexa e figura-fundo, bem como memória sensorial defasada. Ao relacionar com os traços, estas alterações encontradas podem comprometer a aquisição destes traços descritos.PURPOSE: To investigate the relationship between auditory abilities and combinations of distinctive features present in the speech of children with phonological disorders. METHODS: Participants were 22 children diagnosed with phonological disorders, of both genders, with ages between 5 and 7 years. Speech data were gathered using the Phonological Assessment of Children. The

Influência de diferentes condições higrotérmicas na resistência à tração de compósitos de fibra de carbono/epóxi modificada Influence of different hygrothermal conditions on the tensile strength of carbon/epoxy 8552 composites

Directory of Open Access Journals (Sweden)

José Antônio P. Cunha

2006-01-01

Full Text Available Este trabalho foi direcionado para a análise dos efeitos higrotérmicos na resistência à tração de compósitos poliméricos termorrígidos. Foram investigados os efeitos da umidade e da temperatura sobre as resistências à tração longitudinal e à tração transversal de compósitos ([0/0]s de fita de carbono unidirecional impregnada com resina epóxi 8552. Os ensaios de resistência à tração longitudinal, realizados à temperatura ambiente, mostraram que as amostras não perderam sua resistência quando condicionadas. Porém, os compósitos apresentaram uma redução na sua resistência quando submetidos à câmara de climatização (80 °C e 90% de umidade e ensaiados à temperatura elevada. Já nos ensaios de tração transversal foi observado que as amostras submetidas à câmara de névoa salina e ensaiadas à temperatura ambiente apresentaram uma pequena redução na sua resistência, porém as amostras submetidas à câmara de climatização mostraram uma redução acentuada na resistência As amostras ensaiadas à temperatura elevada e submetidas à câmara de névoa salina apresentaram uma pequena diminuição na sua resistência (11%. Já uma acentuada diminuição da resistência à tração transversal (51% foi observada quando as amostras de compósitos poliméricos foram submetidas à câmara de climatização e ensaiadas à temperatura elevada. Também foram obtidas fotomicrografias via microscopia eletrônica de varredura (MEV das seções de fraturas das amostras ensaiadas em tração em todos os tipos de condicionamento estudados no presente trabalho. Todos estes fatos mostraram que a matriz polimérica é afetada nos ensaios à temperatura elevada.This work focused the analysis of hygrothermal ageing effects on the tensile strength of thermoset laminated composites. Humidity and temperature effects on the longitudinal and transversal tensile strengths of carbon fiber/epoxy 8552 unidirectional laminates tape

Il riutilizzo dei nuraghi tra Marmilla e Sarcidano in epoca romana

Directory of Open Access Journals (Sweden)

Enrico Trudu

2017-01-01

Full Text Available Riassunto: Il riutilizzo dei nuraghi in epoca romana appare un fenomeno numericamente rilevante e caratteristico delle dinamiche di occupazione delle aree rurali della Sardegna, che risulta ancora di difficile inquadramento. Sono attestate, infatti, diverse finalità di riutilizzo ma non è stato finora possibile tracciare un quadro ipotetico delle modalità e delle finalità complessive di tale riuso, che viene tradizionalmente legato a una continuità di frequentazione di comunità locali e a un processo di acculturazione e romanizzazione più o meno profonda degli etnici indigeni. Nel presente contributo si presentano i dati relativi alle attestazioni di riutilizzo in un’area compresa tra Marmilla e Sarcidano, particolarmente importante per la sua collocazione geografica e strategica, nella quale si evidenzia un interessante quadro diacronico delle dinamiche di riutilizzo e della loro matrice culturale. Abstract: Reuse of nuraghi in Roman age appears as a numerically significant phenomenon and  a characteristic of settlement dynamics in Sardinian rural areas, but  still difficult to classify. Different purposes of reuse are known but has not yet been possible to draw a picture of the mode of operation and of the objectives of such re-use, which is traditionally linked to a continuity of  use related to local communities and to a process of acculturation and Romanization of indigenous ethnic groups. In this paper we present the reuse exemples of an area between Marmilla and Sarcidano, particularly important for its geographical and strategic position, in which is possible to highlight an interesting diachronic picture of reuse dynamics and of the cultural matrix of the phenomenon.

Determinação do coeficiente de reaeração em rios através do uso do traçador gasoso GLP Determination of stream reaeration coefficients by use of GLP gas tracer

Directory of Open Access Journals (Sweden)

Adilson Pinheiro

2012-03-01

Full Text Available A oxigenação da água constitui-se em importante fator no desenvolvimento do fenômeno de autodepuração de rios. A reposição do oxigênio dissolvido pode ser representada pelo coeficiente de reaeração (K2. Neste trabalho foi testado o uso do GLP como fonte do traçador gás propano em ensaios de reaeração. Foram executados 15 ensaios em trechos de rios com características hidrodinâmicas distintas. Os experimentos mostraram que a utilização do GLP como fonte do traçador gasoso é viável, tanto do ponto de vista analítico, quanto do ponto de vista econômico. Do ponto de vista analítico, os resultados foram equiparáveis e até superiores à técnica tradicional de traçador gasoso. Do ponto de vista econômico, houve redução do custo para a realização de cada ensaio.The water oxygenation constitutes an important factor in the development of self-purification phenomenon in rivers. The replenishment of dissolved oxygen in water can be represented by the reaeration coefficient (K2. This work was used propane contained in the GLP as tracer in reaeration tests. The tests showed that the use of LPG is feasible, both from analytical point of view, as of the economic. From an analytical standpoint, the results were comparable and even superior to the traditional technique of tracer gas. From an economic standpoint, the cost to perform each test has been reduced.

Metodologie di rilievo tra ricerca e innovazione tecnologica per un caso di archeologia medievale: Torre Melissa in provincia di Crotone

Directory of Open Access Journals (Sweden)

Francesca Fatta

2017-12-01

Full Text Available   Il complesso di Torre Melissa è uno dei manufatti storici di pregio che si affacciano sulle coste calabresi del mare Jonio. Una torre-castello d’epoca aragonese sottoposta ad un restauro conservativo agli inizi degli anni duemila. In quella occasione, la torre fu rilevata con procedure manuali e l’ausilio di una stazione totale. Nel 2014 si è proceduto con un rilievo eseguito con strumenti digitali d’alta definizione (laser scanner, fotografia digitale e telecamera applicata a drone. La comparazione tra i due rilievi, effettuati con metodologie differenti, mostrano delle disuguaglianze semantiche evidenti che mettono in risalto i progressi delle odierne strumentazioni per la definizione di modelli 3D d’altissima precisione, fondamentali per le pratiche di tutela e valorizzazione di un patrimonio architettonico complesso e stratificato

Study on preparation and effect of oligoβ-glucan and oligochitosan on immune stimulation white patches in the internal organs disease on Tra catfish (Pangasianodon hypophthalmus)

International Nuclear Information System (INIS)

Nguyen Ngoc Duy; Dang Van Phu; Nguyen Thi Kim Lan; Nguyen Quoc Hien; Pham Duy Hai

2015-01-01

Oligoβ-glucan and oligochitosan were prepared by gamma Co-60 irradiation of β-glucan/H_2O_2 and chitosan/H_2O_2 solution. The efficiency of the degradation process was determined by gel permeation chromatography (GPC) method. Results showed that the Mw decreased with increasing concentration of H_2O_2 and doses. For oligoβ-glucan, Mw reduced from 56.7 kDa to 7.1 kDa when β-glucan 10%/H_2O_2 1% solution was irradiated at 14 kGy. For oligochitosan, Mw reduced from 45.5 kDa to 5.0 kDa when chitosan 5%/H_2O_2 0.5% solution was irradiated at 21 kGy. Tra catfish (Pangasianodon hypophthalmus) was fed with oligoβ-glucan and oligochitosan in various concentrations of 0, 50, 100, and 200 mg/kg feed for 45 days and then was challenged with Edwardsiella ictaluri bacteria to investigate immune stimulation effect against white patches in the internal organs disease. The results indicated that oligoβ-glucan and oligochitosan exhibited good immune stimulation effect with optimum concentration of 100 mg/kg feed. Survival rate of Tra catfishes fed with oligochitosan and oligoβ-glucan is 47.62 ± 1.96% and 46.67 ± 2.58%, respectively. In addition, the mixture of oligochitosan 50 mg/kg + oligo?-glucan 50 mg/kg showed the highest survival rate (62.22 ± 1.96%). (author)

ALLA SCOPERTA DEL PACKAGING DESIGN CON IL WEBQUEST

Directory of Open Access Journals (Sweden)

Antonietta Gobbis

2013-01-01

Full Text Available Il seguente saggio tratta le possibilità di presentazione in Università straniere, dove si insegna l’ItalianoL2, di un aspetto culturale italiano di forte impatto all’estero come il design, attraverso l’innovativa metodologia del webquest. L’iniziale parte teorica descrive il webquest come metodo didattico costruttivista, con particolare riferimento alle sue caratteristiche, parti costituenti e tipologie. Nella seconda parte vengono dati esempi concreti di webquest di breve e lunga durata su due prodotti italiani molto famosi di packaging design, che hanno festeggiato il loro anniversario nel 2012: il Bacio Perugina e il Campari Soda. I risultati positivi di entrambi i progetti intendono mostrare i vantaggi di una didattica centrata sull’alunno basata su attività di problem-solving e strategie di cooperative learning.  Discovering packaging design through webquest The following essay deals about the possibilities to introduce a very successful cultural topic like Italian Design in Universities abroad, where Italian is taught as second foreign language, through the innovative methodology of WebQuests. The theoretical part describes WebQuests as constructivist didactic method with reference to its characteristics, main constituent parts  and typologies. In the second part we give concrete examples of short and long term WebQuests about two very famous packaging design Italian products which celebrated in 2012 their anniversary: BacioPerugina and Campari Soda. The positive results of both projects aim to show the advantages of learner-centered teaching methods based on problem-solving activities and cooperative learning strategies.

Risk-Based Disposal Plan for PCB Paint in the TRA Fluorinel Dissolution Process Mockup and Gamma Facilities Canal

Energy Technology Data Exchange (ETDEWEB)

R. A. Montgomery

2008-05-01

This Toxic Substances Control Act Risk-Based Polychlorinated Biphenyl Disposal plan was developed for the Test Reactor Area Fluorinel Dissolution Process Mockup and Gamma Facilities Waste System, located in Building TRA-641 at the Reactor Technology Complex, Idaho National Laboratory Site, to address painted surfaces in the empty canal under 40 CFR 761.62(c) for paint, and under 40 CFR 761.61(c) for PCBs that may have penetrated into the concrete. The canal walls and floor will be painted with two coats of contrasting non-PCB paint and labeled as PCB. The canal is covered with open decking; the access grate is locked shut and signed to indicate PCB contamination in the canal. Access to the canal will require facility manager permission. Protective equipment for personnel and equipment entering the canal will be required. Waste from the canal, generated during ultimate Decontamination and Decommissioning, shall be managed and disposed as PCB Bulk Product Waste.

CHNTRN: a CHaNnel TRaNsport model for simulating sediment and chemical distribution in a stream/river network

Energy Technology Data Exchange (ETDEWEB)

Yeh, G.T.

1983-09-01

This report presents the development of a CHaNnel TRaNsport model for simulating sediment and chemical distribution in a stream/river network. A particular feature of the model is its capability to deal with the network system that may consist of any number of joined and branched streams/rivers of comparable size. The model employs a numerical method - an integrated compartment method (ICM) - which greatly facilitates the setup of the matrix equation for the discrete field approximating the corresponding continuous field. Most of the possible boundary conditions that may be anticipated in real-world problems are considered. These include junctions, prescribed concentration, prescribed dispersive flux, and prescribed total flux. The model is applied to two case studies: (1) a single river and (2) a five-segment river in a watershed. Results indicate that the model can realistically simulate the behavior of the sediment and chemical variations in a stream/river network. 11 references, 10 figures, 3 tables.

Les effets du changement climatique dans le bassin du Congo : la ...

International Development Research Centre (IDRC) Digital Library (Canada)

22 avr. 2016 ... Dans le bassin du fleuve Congo, plus de 80 % des habitants vivent exclusivement de l'agriculture, de la pêche, de l'élevage et de la cueillette, qui sont des activités largement tributaires du climat.

Opće i posebno ograničenje odgovornosti za pomorske tražbine u novijoj stranoj sudskoj praksi

Directory of Open Access Journals (Sweden)

Jasenko Marin

2011-12-01

Full Text Available Tema rada je proučavanje tumačenja i primjene međunarodnih propisa o općem i posebnom ograničenju odgovornosti za pomorske tražbine u novijoj sudskoj praksi. U uvodnom dijelu objašnjava se gospodarska i pravna svrha instituta ograničenja odgovornosti te se daje prikaz njegova uređenja na međunarodnoj razini. Naglašava se njegova ključna uloga u razvitku brodarstva i međunarodne trgovine. Kritički se analiziraju novije ilustrativne odluke stranih sudova u kojima su protumačene i primijenjene nerijetko dvojbene odredbe međunarodnih ugovora kojima je uređena ova materija. Iznose se zaključci o trenutnoj kvaliteti pravnog uređenja toga instituta, uočavaju tendencije njegova budućeg razvitka te predlažu mjere potrebne za njegovu daljnju nadogradnju.

Técnico de enfermagem: o perfil traçado por profissionais da área

Directory of Open Access Journals (Sweden)

Beatriz Lemos Stutz

1999-12-01

Full Text Available A presente investigação tem por finalidade destacar as bases em que se efetivam a qualificação e as nuances que permeiam a atuação do Técnico de Enfermagem na atualidade, no Município de Uberlândia. Optou-se por realizar uma pesquisa qualitativa, tendo como referencial a análise de discurso, utilizando-se como técnica de coleta de dados um roteiro de entrevista semi-estruturado. Foram definidas, quatro categorias básicas de análise: educação-trabalho, currículo, identidade profissional e expectativas. A partir do estudo detalhado destas categorias, é possível refletir sobre a relação educação-trabalho no ensino médio; os aspectos ligados à regulamentação e ao exercício da enfermagem no Brasil; a importância do currículo na organização de experiências do conhecimento; o significado e as influências do trabalho na construção da identidade profissional. Busca-se traçar, em última instância, o perfil do técnico de enfermagem partindo da análise das funções por ele desempenhadas e do modo como vê seu processo de profissionalização.

Pour le plaisir de la chose : analyse de contenu des conceptions et des usages du Kâmasûtra dans l'Occident contemporain

OpenAIRE

Robidas, Josiane

2010-01-01

Ce mémoire a pour but de retracer comment le Kāmasūtra, traité classique hindou sur l'art de vivre et d'aimer, est présenté et véhiculé dans l'Occident depuis sa première traduction, tant pour son interprétation, sa diffusion et sa réception que pour ce qu'il permet comme regards sur les représentations des sexualités occidentales. L'analyse de contenu a été faite à partir d'un corpus très hétérogène, contenant à la fois des traductions, des ouvrages scientifiques (qui permettent notamment la...

Traços Atitudinais da Imagem Corporal e Qualidade de Vida em Indivíduos com Vitiligo Sedentários e Fisicamente Ativos

OpenAIRE

Ferreira, Lucilene

2018-01-01

O vitiligo é uma doença cutânea crônica caracterizada por máculas de cor branca pura e com bordos nítidos de diferentes tamanhos e formas. O objetivo deste trabalho foi verificar se há diferenças entre pessoas com vitiligo que são fisicamente ativas e sedentárias em relação à qualidade de vida e traços atitudinais da imagem corporal – ansiedade físico social, autoestima e apreciação do corpo. Seguidamente, se a frequência da prática de exercícios provoca diferenças nas mesmas variáveis. A amo...

Endiguer la vague de criminalité en Haïti | IDRC - International ...

International Development Research Centre (IDRC) Digital Library (Canada)

être victimes d'une agression physique. De plus, les personnes qui vivent dans ces endroits densément peuplés se plaignent des écarts de conduite de plus en plus fréquents des policiers, notamment les demandes de ...

Publications | Page 13 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

... de crime public masquent les nombreuses façons dont les résidents vivent la violence ... Pondération de la base juridique du droit au logement au Zimbabwe ... Partnership (WLP) — un partenariat international formé de 20 organisations ...

Padrão de oviposição e tabela de vida da traça-do-tomateiro Tuta absoluta (Meyrick (Lepidoptera, Gelechiidae Oviposition pattern and life table of South American tomato pinworm Tuta absoluta (Meyrick (Lepidoptera, Gelechiidae

Directory of Open Access Journals (Sweden)

Maria Alice de Medeiros

2009-01-01

Full Text Available A traça-do-tomateiro apresentou maior oviposição ao colonizar tomateiros cultivados em sistema convencional em relação ao orgânico em estudos prévios realizados no campo. Visando confirmar e entender o padrão observado no campo, aspectos bioecológicos como oviposição e mortalidade de imaturos foram comparados em condições semi-controladas de casa de vegetação com plantas cultivadas em vasos com solo proveniente do sistema orgânico e convencional. Adultos da traça-do-tomateiro foram liberados na casa de vegetação e após 24h, as plantas infestadas foram transferidas para outra casa de vegetação, para acompanhamento de coortes horizontais. Os ovos naturalmente depositados pela traça-do-tomateiro foram localizados na planta e demarcados. Em seguida, a folha foi ensacada. Diariamente as plantas foram observadas, registrando a fase de desenvolvimento do inseto e a ocorrência de morte, até que todos os insetos completassem seu ciclo de vida. A oviposição pela traça-do-tomateiro em plantas com solos oriundos do sistema convencional foi duas vezes maior do que em plantas com solos do sistema orgânico. A curva de sobrevivência da fase imatura e a tabela de vida da traça-do-tomateiro em casa de vegetação mostraram que a sobrevivência em plantas com solo orgânico e convencional não apresentaram diferenças. Assim as diferenças no comportamento de padrão de oviposição observadas a campo provavelmente não estão relacionadas com o desempenho da progênie e podem ser influenciado pelo ambiente proporcionado pelo sistema orgânico de produção.The tomato pinworm presented higher oviposition when colonizing tomato plants cropped in conventional system than in organic system, in previous field studies. Aiming to confirm and to understand the observed pattern in the field, bioecological processes, such as oviposition and mortality of immatures, were compared on ploted plants in soil from organic and conventional systems in

Dio gioca a dadi ?

CERN Document Server

Stewart, Ian

1993-01-01

E' ancora possibile darsi leggi e regole di carattere generale in questa realtà apparentemente disordinata? Si, a patto di adottare il punto di vista della "teoria del caos", un formidabile strumento matematico sviluppato negli ultimi anni che ha dato il via ad una vera e propria rivoluzione scientifica. Steward guida il lettore alla scoperta degli aspetti principali della teoria e delle sue conseguenze più sorprendenti, senza appesantire la trattazione con eccessivi formalismi matematici.

Resistência à traça-do-tomateiro em plantas com altos teores de acilaçúcares nas folhas Resistance to the South American tomato pinworm in tomato plants with high foliar acylsugar contents

Directory of Open Access Journals (Sweden)

Álvaro C Gonçalves Neto

2010-06-01

Full Text Available A traça-do-tomateiro foi constatada pela primeira vez no Brasil em 1980 estando hoje dentre as principais pragas da tomaticultura nacional. O controle desta praga é feito principalmente por inseticidas, sendo realizada em casos extremos, até três pulverizações semanais. Acessos silvestres de tomateiro como S. pennellii LA-716 possuem resistência a pragas, mediada pela presença de acilaçúcares nos folíolos. Os objetivos deste trabalho foram obter genótipos de tomateiro com características comerciais e altos teores foliares de acilaçúcares (AA, e avaliar seus níveis de resistência à traça do tomateiro Tuta absoluta. Os genótipos foram obtidos a partir de populações segregantes (F2 oriundas do cruzamento entre AF-8665 (linhagem elite com baixos teores de AA e as linhagens BPX370E-30-275-11-7, BPX370E-30-275-11-8, BPX370E-30-380-68-6 e BPX370E-30-380-68-8 (linhagens pré-comerciais com altos teores, obtidas a partir do cruzamento interespecífico S. lycopersicum x S. pennellii LA-716. Plantas F2 previamente selecionadas com base nos teores de AA foram clonadas e em seguida testadas quanto à resistência à traça-do-tomateiro. Genótipos selecionados para altos teores de AA expressaram menor ovoposição da traça e níveis inferiores de danos causados à planta pela infestação do microlepidóptero do que genótipos (comerciais ou não com baixos teores de AA. Embora genótipos com altos teores de AA tenham sido mais resistentes à traça do que os demais, seus níveis de resistência podem ser dependentes do background genotípico: clones BPX-410H (alto teor de AA mostraram-se em geral ligeiramente mais resistentes do que o dos clones BPX-370G (também alto teor de AA. Os clones BPX-410H-01pl#281, BPX-410H-04pl#348 e BPX-410H-04pl#481 foram superiores nas avaliações de resistência à traça e são recomendados para a continuidade do programa de melhoramento.The South American tomato pinworm was first detected in Brazil

La meilleure politique : une recherche en télécommunication dans ...

International Development Research Centre (IDRC) Digital Library (Canada)

2 févr. 2011 ... ... et les grands-parents parlent à leurs enfants et petits-enfants qui vivent à des ... dans le village où il a grandi, et cela rendait la communication difficile. .... innovative research on improving maternal and child health in Africa.

Impacto de inseticidas sobre parasitóides da traça-das-crucíferas em repolho, no Distrito Federal

Directory of Open Access Journals (Sweden)

Castelo Branco Marina

2001-01-01

Full Text Available Este trabalho teve como objetivo identificar os parasitóides da Plutella xylostella(L. presentes em áreas de cultivo do Distrito Federal, tratadas ou não com inseticidas, onde larvas do inseto foram coletadas. Foram identificados quatro parasitóides: Apantelessp. (Braconidae, Oomyzus sokolowiskii (Kurdjumov (Eulophidae, Diadegmasp. (Ichneumonidae e Actiasp. (Tachinidae. Onível de parasitismo nas áreas não tratadas com inseticidas variou de 5% a 94%, enquanto em áreas tratadas variou de 11% a 87%. A maior parte das larvas de traça-das-crucíferas foram encontradas nas cabeças de repolho ou na parte inferior das folhas da saia das plantas. Esta distribuição de larvas sobre as plantas deve permitir que estas escapem do contato com o inseticida, e, conseqüentemente, os parasitóides podem sobreviver nas plantas tratadas.

Determinação da redução da resistência à tração em corpos de prova com Weld Line

OpenAIRE

Bom,R.P.; Kalin,A.F.

2008-01-01

Neste trabalho objetivou-se determinar a redução da resistência à tração de corpos de prova com linhas de solda. Os corpos de prova ASTM foram moldados pelo processo de injeção com diferentes temperaturas de plastificação (180 ºC a 280 ºC). O material utilizado foi o polímero termoplástico Polystyrol 158 K da Basf. Este estudo relaciona as linhas de solda em produtos moldados por injeção com a redução da resistência mecânica devido a fragilização na região da linha de solda. Para o desenvolvi...

Monitoramento da contaminação por elementos traço em ostras comercializadas em Recife, Pernambuco, Brasil

Directory of Open Access Journals (Sweden)

Cavalcanti André Dias

2003-01-01

Full Text Available Amostras de ostras comercializadas em Recife, Pernambuco, Brasil, foram monitoradas em relação ao conteúdo de elementos traço (Hg, Zn, Fe, Cu e Mn durante o período de um ano (março/2001 a fevereiro/2002. Mercúrio foi o principal contaminante encontrado nas ostras e o elemento que apresenta maior risco à saúde pública. Foram encontrados valores de concentração de Hg em ostras de até 551,12µg/kg (peso úmido. Esses valores sugerem que a ingestão de ostras deve ser feita com restrições, principalmente, pela população que vive de sua coleta como forma de subsistência, por crianças, e mulheres grávidas. A avaliação dos níveis de mercúrio em frutos do mar é um importante fator para avaliar o risco de contaminação por mercúrio em pessoas não ocupacionalmente expostas.

Monitoramento da contaminação por elementos traço em ostras comercializadas em Recife, Pernambuco, Brasil

Directory of Open Access Journals (Sweden)

André Dias Cavalcanti

Full Text Available Amostras de ostras comercializadas em Recife, Pernambuco, Brasil, foram monitoradas em relação ao conteúdo de elementos traço (Hg, Zn, Fe, Cu e Mn durante o período de um ano (março/2001 a fevereiro/2002. Mercúrio foi o principal contaminante encontrado nas ostras e o elemento que apresenta maior risco à saúde pública. Foram encontrados valores de concentração de Hg em ostras de até 551,12µg/kg (peso úmido. Esses valores sugerem que a ingestão de ostras deve ser feita com restrições, principalmente, pela população que vive de sua coleta como forma de subsistência, por crianças, e mulheres grávidas. A avaliação dos níveis de mercúrio em frutos do mar é um importante fator para avaliar o risco de contaminação por mercúrio em pessoas não ocupacionalmente expostas.

BI TRA, Doubi. Banque, finance & bourse. Lexique des termes usuels. París: L’harmattan, 2011. 367 p.

Directory of Open Access Journals (Sweden)

Elena Alcalde Peñalver

2014-07-01

Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v1n33p348 Esta obra lexicográfica monolingüe en francés constituye una forma de hacer llegar al público de forma transparente el conocimiento de un campo tan importante y de gran actualidad como es el de la banca, las finanzas y la bolsa. Contar con las últimas novedades en el léxico de este campo es de gran importancia por su continuo dinamismo y grado de innovación. Esto se observa a diario en los diferentes medios de comunicación, que en muchos casos deben ofrecer una explicación que acompañe al término financiero por su alto nivel de especialidad. En este sentido, consideramos de gran utilidad contar con obras como el léxico del profesor Tra, que ofrece explicaciones claras y concisas sobre un gran número de términos del ámbito financiero que aparecen de forma recurrente en los diferentes medios de comunicación

La vocazione territoriale tra approccio sistemico e situazionista: analisi di una collaborazione culture driven tra aziende del made in Italy attraverso il caso del Contratto di Rete Polo Alta Moda Area Vestina / The territorial vocation between the “systemic” approach and the “situationist” approach: analysis of a culture-driven collaboration between Made-in-Italy firms. The case of the network contract of “Polo Alta Moda Area Vestina

Directory of Open Access Journals (Sweden)

Elena Cedrola

2014-06-01

Full Text Available Il presente lavoro si propone di mostrare come una collaborazione culture driven tra aziende del made in Italy possa innescare un processo virtuoso capace di alimentare la competitività d’impresa. Nello specifico, intende verificare la validità di una nuova chiave di lettura dei processi di governance del territorio, detta situazionista, che affianca la concezione prevalente in letteratura, definita unitaria o sistemica. Il punto di discrepanza principale tra le due visioni sembra essere quello della vocazione territoriale. Pur riconoscendo entrambe la presenza di interessi condivisi tra gli attori, la visione situazionista non riconosce alla vocazione la funzione “razionalizzante” riscontrabile nell’approccio sistemico. A seguito di una sintetica review della letteratura sui temi del territorio come cultura condivisa, sulla dimensione reticolare territoriale ed extraterritoriale e sul contratto di rete, verrà introdotto lo studio di un contratto di rete stipulato l’8 giugno 2010 tra le aziende che costituiscono il Polo Alta Moda Area Vestina. Attraverso le evidenze emerse da alcune interviste in profondità, sarà indagato il ruolo dell’azienda Brioni nella duplice veste di key player del territorio e di impresa capofila del contratto di rete analizzato e saranno esaminati gli altri attori che compongono il Polo Alta Moda. Le interviste realizzate hanno coinvolto i manager dell’impresa capofila del contratto di rete, il vice presidente Confindustria Pescara e presidente della Sezione Unificata Sistema Moda Chieti Pescara e il direttore delle fondazioni partecipanti al contratto.   This case study aims to validate how a culture-driven collaboration between firms could trigger the competitiveness of a Country, starting from a specific territorial culture. Specifically, it intends to investigate the validity of a new interpretation of the territorial governance processes, named “situationist”, that supports the prevailing

Les agriculteurs s'adaptent aux changements climatiques en Tunisie ...

International Development Research Centre (IDRC) Digital Library (Canada)

23 août 2011 ... À La Soukra, en Tunisie, des centaines de familles à faible revenu vivent des produits de la terre qu'elles cultivent. Or, depuis quelques décennies, ce mode de vie est menacé par l'urbanisation et les changements climatiques.

Theoretical Study of Molecular Determinants Involved in Signal Binding to the TraR Protein of Agrobacterium tumefaciens

Directory of Open Access Journals (Sweden)

N. Kumar

2005-10-01

Full Text Available N-acylated homoserine lactone (AHL mediated cell-cell communication in bacteria is dependent on the recognition of the cognate signal by its receptor. This interaction allows the receptor-ligand complex to act as a transcriptional activator, controlling the expression of a range of bacterial phenotypes, including virulence factor expression and biofilm formation. One approach to determine the key features of signal- binding is to model the intermolecular interactions between the receptor and ligand using computational-based modeling software (LigandFit. In this communication, we have modeled the crystal structure of the AHL receptor protein TraR and its AHL signal N-(3- oxooctanoyl-homoserine lactone from Agrobacterium tumefaciens and compared it to the previously reported antagonist behaviour of a number of AHL analogues, in an attempt to determine structural constraints for ligand binding. We conclude that (i a common conformation of the AHL in the hydrophobic and hydrophilic region exists for ligand-binding, (ii a tail chain length threshold of 8 carbons is most favourable for ligand-binding affinity, (iii the positive correlation in the docking studies could be used a virtual screening tool.

Escolha do (a parceiro (a ideal por heterossexuais: são seus valores e traços de personalidade uma explicação? Choice of ideal partner by heterosexuals: are their values and personality traits an explanation?

Directory of Open Access Journals (Sweden)

Ana Isabel A. S. de Brito Gomes

2013-01-01

Full Text Available O presente estudo objetivou conhecer em que medida os valores humanos e os traços de personalidade se correlacionam com atributos desejáveis do (a parceiro (a ideal entre heterossexuais. Participaram 205 pessoas (100 mulheres e 105 homens da população geral de João Pessoa (PB. Estes responderam aos seguintes instrumentos: Questionário dos Valores Básicos, Inventário dos Cinco Grandes Fatores e Escala de Atributos do Parceiro Ideal, além de perguntas sociodemográficas. Os valores se correlacionaram de forma teoricamente esperada com os atributos, sendo mais preponderantes do que os traços de personalidade. Quando comparados, homens e mulheres diferiram na importância dada a tais atributos. Finalmente, mostrou-se adequado o modelo hierárquico traços de personalidade → valores → atributos. Estes resultados foram discutidos tomando como referência a perspectiva evolucionista da escolha de parceiro e a teoria funcionalista dos valores humanos.This study aimed to know to which extent human values and personality traits are correlated with desirable attributes of an ideal partner among heterosexuals. Participants were 205 people (100 women and 105 men from the general population of João Pessoa-PB, Brazil. They answered the following instruments: Basic Values Survey, Big Five Inventory, Attributes of Ideal Partner Scale as well as socio-demographic questions. The values were correlated in a theoretically expected way with the attributes of an ideal partner, being more relevant than the personality traits. When they were compared, men and women differed in the importance given to these attributes. Finally, the hierarchical model of personality traits → values → attributes showed to be adequate. The findings were discussed based on the evolutionary perspective on mate choices and the functionalist theory of human values.

La certezza della pena tra lavoro nero e problematiche di integrazione / La certitude de la sanction entre travail au noir et problèmes d'intégration / Sanction Certainty between Illegal Work and Immigration Problems

Directory of Open Access Journals (Sweden)

Bisi Roberta

2010-07-01

Full Text Available L’immissione di nuove popolazioni in una società provoca inevitabilmente sfide a carattere sociale. Affrontare i problemi che la popolazione immigrata pone significa, tra l’altro, considerare che si tratta di un attore sociale che, con i propri comportamenti, le proprie scelte, i propri orientamenti mette in continua discussione i meccanismi logici e le politiche presenti nelle società.

CLIL and CALL for a teacher’s expertise: an international training experience

Directory of Open Access Journals (Sweden)

Letizia Cinganotto

2016-07-01

Full Text Available The paper deals with the link between Content and Language Integrated Learning (CLIL and Computer Assisted Language Learning (CALL, that is the use of ICT to enhance language teaching-learning and the teaching of subject content in a foreign language. Starting from this background, the paper describes an online training initiative promoted by the authors within an international community of peers, made up of teachers, trainers and educators from all over the world, named “Techno-CLIL for EVO 2016”. The initiative was aimed at supporting and guiding participants to discover and experiment digital tools for CLIL lessons, offering the opportunity to share ideas, materials, good practices in an international perspective. Particular attention is devoted to the personal and professional enrichment and growth this training pathway may have helped the 5.000 participants to achieve.CLIL e CALL nell’expertise del docente: un’esperienza di formazione internazionaleIl contributo focalizza l’attenzione sulla correlazione tra Content and Language Integrated Learning (CLIL e Computer Assisted Language Learning (CALL, cioè l’uso delle tecnologie per una maggiore efficacia dell’insegnamento-apprendimento delle lingue o di contenuti disciplinari veicolati in lingua straniera. Partendo da questo background, il contributo descrive una iniziativa di formazione online in lingua inglese promossa dalle autrici all’interno di un contesto internazionale, costituito da una comunità di pratica di docenti, formatori, educatori di tutto il mondo, denominata “Techno-CLIL for EVO 2016”. L’iniziativa mirava a sensibilizzare e guidare i partecipanti nella scoperta e sperimentazione della didattica CLIL in modalità digitale, offrendo l’opportunità di un confronto ed uno scambio di idee, materiali, buone pratiche in una prospettiva internazionale. Particolarmente significative le ricadute che questo percorso ha comportato per i circa 5.000 partecipanti

Potências animadas do traço: fixidez e animação da caricatura no humor gráfico

Directory of Open Access Journals (Sweden)

Benjamim Picado

2012-06-01

Full Text Available Este artigo pretende examinar certos aspectos das relações entre o desenho e a representação de ações, a partir de um exame sobre tirinhas diárias. Estamos especialmente preocupados com a complementaridade entre os traços estilísticos da caricatura e a questão da compreensão sobre a animação potencial de sua apresentação plástica. Trabalhada a partir do sentido de mudança e de expressividade de seus motivos, a representação fisionômica na caricatura cumpre funções preparatórias para os regimes de significação narrativa na arte sequencial. Numa tal perspectiva, a morfologia dos caracteres do humor gráfico seria mais bem explanada se sua graça cômica fosse considerada como parte do problema geral de um estilo “lacunar” ou “expressivo” da caricatura.

Efeito da incorporação de hipoclorito de cálcio em gesso tipo III sobre a estabilidade dimensional, resistência à tração diametral e a compressão

OpenAIRE

Lucas, Matheus Guilherme; Faculdade de Odontologia de Araraquara - UNESP; Ribeiro, João Augusto Rabelo; Faculdade de Odontologia de Araraquara - UNESP; Butignon, Luis Eduardo; Faculdade de Odontologia de Araraquara - UNESP; Arioli Filho, João Neudenir; Faculdade de Odontologia de Araraquara - UNESP

2010-01-01

Neste trabalho foram analisadas as possíveis alterações promovidas pela incorporação de agentes desinfetantes na resistência à compressão, estabilidade dimensional linear e resistência à tração diametral de modelos em gesso. As amostras foram confeccionadas em gesso pedra tipo III e divididas nos seguintes grupos: Grupo 1- controle (espatulado de acordo com as recomendações do fabricante); Grupo 2-...

Nigerian forest communities act to reduce carbon emissions | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

8 juin 2016 ... The collaborative project between One Sky Canadian Institute for Sustainable Living and the African Integral Development Network assessed the perceptions of local communities about carbon emissions offset ... La majorité des habitants de l'Inde vivent dans des régions soumises à un stress hydrique.

Situação epidemiológica da anemia infecciosa equina em equídeos de tração do Distrito Federal

Directory of Open Access Journals (Sweden)

Daniella D.A. Moraes

Full Text Available RESUMO: A anemia infecciosa equina (AIE é uma doença causada por um lentivirus que possui distribuição mundial. Essa enfermidade é um entrave ao desenvolvimento da equinocultura no Brasil devido à obrigatoriedade de eutanásia dos animais positivos. Este trabalho teve como objetivo estimar a prevalência de AIE em equídeos de tração no Distrito Federal, assim como identificar fatores de risco associados à doença. Foram sorteados aleatoriamente 350 proprietários (Unidades Primárias de Amostragem- UPA e foram amostrados todos os equídeos (Unidades secundárias de Amostragem de cada proprietário sorteado, totalizando 496 animais. As amostras sanguíneas foram analisadas no Lanagro/MG por meio da técnica de imunodifusão em ágar gel (IDGA. No momento da coleta de sangue, também foi aplicado um questionário epidemiológico para a análise de possíveis fatores de risco. A prevalência de AIE nas UPA foi estimada em 2,29%, (IC 95%: 1,01-4,2% e nos animais foi de 1,81% (IC 95%: 0,55-3,07%. A prevalência foi significativamente maior em muares do que em equinos. Não foi possível comprovar a presença de nenhum outro fator de risco associado à doença. Este estudo demonstra que a prevalência da AIE em equídeos de tração é baixa no Distrito Federal, porém mais alta do que os dados de vigilância de rotina sugerem, o que justifica a eutanásia dos equídeos reagentes, com a finalidade de promover a erradicação da enfermidade. Ratifica-se a importância da realização de exames periódicos nesses animais e a manutenção das atividades de vigilância.

Estudo da síndrome de tração macular vítreo-retiniana idiopática por meio da tomografia de coerência óptica: relato de casos A study of idiophatic vitreomacular traction syndrome with optical coherence tomography images: cases report

Directory of Open Access Journals (Sweden)

Hélio Paulo Primiano Júnior

2007-02-01

Full Text Available OBJETIVOS: Avaliar alterações estruturais observadas na síndrome de tração macular vítreo-retiniana idiopática (STMI pela tomografia de coerência óptica (OCT, antes e depois da vitrectomia; identificar situações em que a tomografia de coerência óptica fornece informações adicionais da morfologia e patogênese desta doença. MÉTODOS: Imagens tomográficas (OCT Stratus comparativas da estrutura vítreo-retiniana foram realizadas em quatro pacientes, em estágios variados da síndrome de tração macular vítreo-retiniana idiopática. RESULTADOS: A tomografia de coerência óptica Stratus apresenta imagens vítreo-retinianas que auxiliam na conduta e tratamento da síndrome de tração macular vítreo-retiniana idiopatica. CONCLUSÃO: O exame da tomografia de coerência óptica permite boa visualização da arquitetura morfológica do vítreo e da retina na síndrome de tração macular vítreo-retiniana idiopática. Este exame nos auxilia na compreensão da patogênese, no planejamento do tratamento, clínico ou cirúrgico, e na avaliação pós-operatória das alterações estruturais retinianas.PURPOSE: To evaluate the features of idiophatic vitreomacular traction syndrome (VMT with ocular coherence tomography (OCT - Stratus, before and after vitrectomy; to identify situations where ocular coherence tomography provides additional information on disease morphology and pathogenesis. METHODS: Comparative retinal ocular coherence tomography imaging was performed in four patients with different stages of vitreomacular traction syndrome. RESULTS: Standard-resolution ocular coherence tomography Stratus provides vitreous-retinal images that help the management and treatment of vitreomacular traction syndrome. CONCLUSIONS: Standard-resolution ocular coherence tomography allows good visualization of the architectural morphology of the vitreous and retina in vitreomacular traction syndrome. It helps understanding its pathogenesis, planning

Traços identitários da enfermeira-gerente em hospitais privados de Belo Horizonte, Brasil The nurse manager's identity features in private hospitals of Belo Horizonte, Brazil

Directory of Open Access Journals (Sweden)

Maria José Menezes Brito

2008-06-01

Full Text Available Com o propósito de compreender aspectos subjetivos do trabalho da enfermeira-gerente, buscou-se, por meio deste estudo, analisar os traços identitários da enfermeira-gerente no contexto de instituições hospitalares a partir do questionamento fundamentado na apresentação que os sujeitos fazem de si mesmos. Trata-se de um estudo de caso, com abordagem qualitativa, do qual participaram nove enfermeiras-gerente que atuam em quatro instituições hospitalares privadas de médio e grande porte, no município de Belo Horizonte. Os traços identitários foram organizados de acordo com os planos profissional, organizacional e individual, os quais abrangem: preservação e reforço de identidade social da enfermeira, a trajetória profissional como uma evolução da prática da assistência para o exercício da gerência, valorização da experiência prática e permanência em atividades ligadas à prestação da assistência direta ao paciente; identificação com a organização; e questões relativas à vida privada e auto-imagem positiva expressa pelas gerentes. O estudo permitiu a identificação de traços marcantes de um grupo profissional específico, evidenciando a influência das questões de gênero, das relações de poder e da cultura na identidade social dos sujeitos pesquisados.Aiming to understand subjective aspects of the work of nurse managers, this study analyzed their identity features in the context of hospital institutions. These were obtained through a questioning based on the introduction that the subjects make of themselves. It is a case study carried out according to the qualitative approach, in which nine nurse managers participated. They worked at four large- and medium-sized private hospitals in the city of Belo Horizonte. The identity features were organized in accordance with the professional, institutional and individual planes, which encompass: the preservation and reinforcement of the nurse's social identity

Alla scoperta di TV-Glad prima emittente per disabili

DEFF Research Database (Denmark)

Chemi, Tatiana

2006-01-01

the moving story of the first tv-channel for and made by collaborators with handicaps. The Danish broadcast, which is quickly expanding globally, exporting its unique example of tolerance, fantasy and hard work....

Résultats de recherche | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

auteure s'appuie sur une enquête menée auprès de plus de 400 femmes pour mettre au jour les conditions financières médiocres dans lesquelles vivent, en Inde, les femmes séparées ou divorcées. Publication Date. 14 mars ...

Uso de traçadores fluorescentes para determinar características de transporte e dispersão no Rio Piabanha (RJ) para a modelagem quali-quantitativa pelo HEC-RAS

OpenAIRE

Silva, Paulo Vitor Ribeiro Marques da; Pecly, José Otávio Goulart; Azevedo, José Paulo Soares de

2017-01-01

RESUMO Um estudo de campo foi realizado em um trecho de aproximadamente 70 km do rio Piabanha, localizado entre Petrópolis e Areal, na região serrana do Estado do Rio de Janeiro, para estimar as características de transporte e dispersão de contaminantes usando técnicas de traçadores fluorescentes. A análise dos resultados de dois trabalhos de campo, realizados no outono de 2012, permitiu determinar os valores de tempo de trânsito, vazão líquida, velocidade média e coeficiente de dispersão lon...

: tous les projets | Page 137 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

La malnutrition demeure un problème grave au Vietnam et en Thaïlande, surtout dans les hautes terres, où vivent la plupart des minorités ethniques. End Date: 24 janvier 2017. Sujet: MALNUTRITION, INTERVIEWS. Région: Thailand, Viet Nam, Canada. Programme: Agriculture and Food Security. Financement total : CA$ ...

Résultats de recherche | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

auteure s'appuie sur une enquête menée auprès de plus de 400 femmes pour mettre au jour les conditions financières médiocres dans lesquelles vivent, en Inde, les femmes séparées ou divorcées. Publication Date. 14 mars 2013. Nouvelle.

Chemical characteristics and Kraft pulping of tension wood from Eucalyptus globulus labill Características químicas e polpação Kraft de madeira de tração de Eucalyptus globulus labill

Directory of Open Access Journals (Sweden)

María Graciela Aguayo

2012-12-01

Full Text Available Tension (TW and opposite wood (OW of Eucalyptus globulus trees were analyzed for its chemical characteristics and Kraft pulp production. Lignin content was 16% lower and contained 32% more syringyl units in TW than in OW. The increase in syringyl units favoured the formation of β-O-4 bonds that was also higher in TW than in OW (84% vs. 64%, respectively. The effect of these wood features was evaluated in the production of Kraft pulps from both types of wood. At kappa number 16, Kraft pulps obtained from TW demanded less active alkali in delignification and presented slightly higher or similar pulp yield than pulps made with OW. Fiber length, coarseness and intrinsic viscosity were also higher in tension than in opposite pulps. When pulps where refined to 30°SR, TW pulps needed 18% more revolutions in the PFI mill to achieve the same beating degree than OW pulps. Strength properties (tensile, tear and burst indexes were slightly higher or similar in tension as compared with opposite wood pulps. After an OD0(EOD1 bleaching sequence, both pulps achieved up to 89% ISO brightness. Bleached pulps from TW presented higher viscosity and low amount of hexenuronic acids than pulps from OW. Results showed that TW presented high xylans and low lignin content that caused a decrease in alkali consumption, increase pulp strength properties and similar bleaching performance as compared with pulps from OW.Madeira de tração e oposta de árvores de Eucalyptus globulus foram analisadas quanto a suas características químicas e produção de polpa Kraft. A caracterização química da madeira de tração (TW de Eucalyptus globulus Labill. mostrou um conteúdo similar de celulose, alto conteúdo de xilanas e baixo conteúdo de lignina quando comparada com a madeira oposta (OW de uma mesma árvore. O conteúdo de lignina foi 16% menor e contém 32% mais unidades siringila em TW que em OW. O aumento das unidades siringila favoreceu a formação de ligações �

Book review. Un veterinario a spasso per il mondo tra guerre, colonialismo e apartheid. Attilio Pini

Directory of Open Access Journals (Sweden)

Manuel Graziani

2014-12-01

fascista, del fratello maggiore Tebaldo come il padre militare di carriera e poi veterinario. E ancora, le prime docce con l'acqua di mare, la "festa delle bastonate" (una vera battaglia tra somali con finalità propiziatorie di fertilità, fino al viaggio in nave con Filippo Tommaso Marinetti che pare si fosse invaghito della madre Anna. Quello del dott. Pini è un libro ben scritto, dallo stile lineare, fatto di parole pesate col misurino, a volte anche musicali ("Non c'era più il fascio, ma si assisteva all'inizio dello sfascio" e argute (si legga pag. 35 sugli italiani "popolo plaudente" che rendono la lettura assai godibile. Nonostante l'autore si schernisca dicendo di non aver ereditato nessuna delle doti paterne, evidentemente ha ereditato eccome la verve narrativa dal padre Ugo autore, tra l'altro, del libro di memorie Sotto le ceneri dell'impero. Dalle rive del Giuba alle falde del monte Kenya, edito nel 1967 e ancora oggi nel catalogo dell'Editore Mursia.

Gender and Citizenship in the Information Society in Asia | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

Dossiers. Migrant women domestic workers and freedom of communication in Taiwan : a case for barrier-free access to mobile phones as a basic right. Dossiers ... du Pakistan. Environ 70 % des 160 millions de Pakistanais vivent en milieu rural; or, près de 90 % des infrastructures de TIC se trouvent en région urbaine.

Feixes de fibras Lignocelulósicas refinadas mecanicamente em compósitos cimentícios para avaliação da resistência à tração

Directory of Open Access Journals (Sweden)

Flávio Airton knuth

2017-07-01

Full Text Available As fibras vegetais têm características particulares em relação a outros tipos de fibras usadas em compósitos. Os estudos utilizam, em sua maioria, fibras cuja lignina fora previamente removida pelo processo de polpação. Segundo a literatura, a lignina prejudica a ancoragem fibra-matriz. No entanto, sem a lignina, é necessário que seja feito tratamento superficial no conjunto fibroso. Isso por que as fibras sofrem processo de inchamento e retração no interior da matriz devido a seu caráter hidrofílico, o que diminui sua vida útil. No entanto, a despeito das considerações literárias, esse trabalho se propõe a fazer uso da vantagem de proteção, estruturação e impermeabilização que a lignina exerce sobre as fibras vegetais. Isso implica na necessidade de suprir a redução da resistência do compósito, especialmente à tração, que a lignina causa pela sua atuação negativa na ancoragem fibra-matriz. Para tanto, fibras lignocelulósicas extraídas de talos de banana foram submetidas a processo de refinamento mecânico. Segundo a literatura, a fibra sofre modificações na sua parede externa quando submetida a esse refinamento. Ao final do processo, foram obtidas fibras com formato helicoidal e superfície corrugada o que resultou em maior aderência no conjunto fibra-matriz. As fibras submetidas ao maior grau de refinamento aumentaram a resistência do compósito à tração na compressão diametral em 40% em relação a corpo de prova de cimento puro.

Risco de tração excessiva nas lesões tipo distração-flexão da coluna cervical baixa Risk of excessive traction on distraction-flexion-type injuries of the low cervical spine

Directory of Open Access Journals (Sweden)

Tarcísio Eloy Pessoa de Barros Filho

2006-01-01

Full Text Available O estudo em questão visa avaliar a relação entre risco e benefício do uso de tração com halo craniano como alternativa para estabilização nas fraturas-luxações por mecanismo de distração-flexão tipo IV de Allen e Ferguson, considerando a natureza da lesão, seu extenso dano ligamentar e o risco de apresentar distração excessiva e conseqüente lesão da medula espinhal. Para tanto, realizamos uma análise retrospectiva no IOT-HC-FMUSP envolvendo um período de 10 anos, quando 34 casos foram diagnosticados como fratura-luxação por distração-flexão da coluna cervical baixa, sendo 12 deles do tipo IV. Todos foram submetidos à tração esquelética com halo craniano num momento inicial. Durante o controle radiográfico seqüencial, observou-se distração excessiva em sete casos, mesmo com baixo peso inicial (4 kg. Em dois pacientes houve surgimento de nistagmo. Em todos os casos a tração foi retirada e seguiu-se normalização do quadro clínico.This study aims to evaluate the risk/ benefit ratio in the use of traction with cranial halo as an alternative to stabilize fractures-dislocations by Allen & Ferguson's type IV- distraction-flexion mechanism, considering the nature of the injury, its extensive ligament damage and the risk of presenting excessive distraction and resultant spinal cord injury. Thus, we performed a retrospective analysis at IOT-HC-FMUSP comprising a period of 10 years, when 34 cases were diagnosed as fractures-dislocations due to distraction-flexion of the low cervical spine, of which 12 were IV-type. All individuals have been submitted to skeletal traction with cranial halo at an early phase. During sequential X-ray management, an excessive distraction was seen in seven cases, even with initial light weight (4 kg. In two patients, the onset of nistagmus was seen. In all cases, traction was removed, which was followed by stabilization of the clinical picture.

Teoría Reformulada de la Asimilación (TRA): análisis, interpretación, coincidencias y diferencias con la Teoría de la Asimilación de Ausubel

OpenAIRE

Paniagua Pardo, Adriana; Meneses Villagrá, Jesús Ángel

2006-01-01

Se ha realizado un análisis de la Teoría de la Asimilación de Ausubel, la cual constituye la sustentación teórica del aprendizaje significativo. Como producto de dicho análisis se ha planteado una Teoría Reformulada de la Asimilación (TRA). Se establecieron puntos de vista, precisando las coincidencias y diferencias entre la Teoría de la Asimilación de Ausubel y la Teoría Reformulada de la Asimilación. Esta reformulación se concreta en la representación gráfica del comportam...

Velocidade de onda ultrassônica longitudinal e transversal em concretos estruturais de variadas resistências submetidos à compressão simples e à tração por compressão diametral.

OpenAIRE

Andreza Vera Pyrrho de Araújo

2015-01-01

O trabalho discute o padrão de comportamento de ondas ultrassônicas longitudinais (compression waves) e transversais (shear waves) em concretos de variadas resistências submetidos a compressão axial e diametral. Foram ensaiados 112 corpos de prova confeccionados de concretos com variadas resistências a compressão, dentro do intervalo atualmente contemplado pela NBR 6118/2014. Os corpos de provas foram submetidos ao ensaio de compressão simples, tração por compressão diametral e módulo de e...

Organization of a library of standard relocatible programmes, or a processing measurement data module based on computers of the TRA types

International Nuclear Information System (INIS)

Dadi, K.; Dadi, L.; Mateeva, A.; Salamatin, I.M.

1976-01-01

The paper describes the organization of a library of standard programs with binary cade. The library was developed for a measurement module on the basis of a TRA-1001-i computer (Elektronika-100, PDP-8). The library is placed on a external memory (magnetic disk) and has a module structure. The external memory assigned for the library is divided into pages. When loaded into the computer internal memory, several pages are taken as one whole to represent the loading module. The magnetic disk storage capacity being 1.25 million words, the library has a total of ca. 50 10 thousand words (eight cylinders). The work provides regulations for compiling standard programs in SLANG. The library is characterized by the following main features: possibility of being used in memory dynamic distribution mode; possibility of being used for computers with internal memory capacity 4K; no need for intermediary-language coding of displaced program; and possibility of autonomous shift of standard program. The above library is compared with a comprising DES programs library

The Theory of Evolution in contemporary culture. Biological evolution and cultural evolution [with english version

Directory of Open Access Journals (Sweden)

Giorgio Forti

2013-01-01

Full Text Available La teoria dell’Evoluzione biologica alla luce delle conoscenze acquisite dalla biologia molecolare, dall’immunologia e  dall’embriologia: la “mutazione adattativa”, sua scoperta nei batteri e sua realtà negli organismi superiori. Statistica degli eventi rari e “piano intelligente”. Eredità dei caratteri acquisiti durante l’epigenesi: Darwin e Lamarck. Struttura del cervello e mente umana: il ruolo dell’eredità biologica e quello di ambiente, apprendimento ed esperienze nella formazione ed evoluzione della mente personale. Arbitrarietà e ridondanza nell’evoluzione biologica e nell’evoluzione del linguaggio umano.

Valorizzazione di un patrimonio culturale periferico: il progetto "Cuore Verde tra i due Laghi" / The enhancement of the peripherial cultural heritage: the project “Cuore Verde tra i due laghi” (Green Heart between the two Lakes

Directory of Open Access Journals (Sweden)

Antonella Capriello

2015-06-01

Full Text Available Lo studio è indirizzato a esplorare le potenzialità dei metodi partecipativi per la valorizzazione di patrimoni culturali periferici. In rapporto al descritto obiettivo, è stato sviluppato un caso-studio concernente le Comunità rurali tra il Lago Maggiore e il Lago d’Orta. L’area rurale è caratterizzata dalla presenza di un patrimonio culturale periferico rispetto al circuito delle attività turistico-culturali in Piemonte, ma il piano di valorizzazione ha attivato iniziative per vivacizzare il territorio e superare la condizione di marginalità. Il caso-studio si basa sull’applicazione della metodologia Participatory Action Research (PAR per favorire il coinvolgimento di stakeholders locali in posizione marginale. Lo studio individua linee guida per la generalizzazione della metodologia nei processi di valorizzazione di un patrimonio culturale periferico.  The article aims to explore the potential of participative methods to enhance the value of peripheral cultural wealth. Consistent with the described aims, a case study was developed with a focus on the rural communities between Lago Maggiore (Maggiore Lake and Lago d’Orta (Orta Lake. The rural area is characterised by the presence of peripheral cultural heritage comparing tourist and cultural proposals in Piedmont, but a cultural plan has been developed to animate the local context and to overcome the condition of isolation. The case study is based on Participatory Action Research (PAR, involving stakeholders in marginal positions. The results identify best practices to generalize the methodology in order to enhance the value of peripheral cultural wealth.

Efeito de altas temperaturas na resistência à compressão, resistência à tração e módulo de deformação do concreto

Directory of Open Access Journals (Sweden)

A. A. A. de Souza

Full Text Available Este trabalho teve como objetivo a investigação experimental do comportamento do concreto quando submetido a elevadas temperaturas. Um concreto de utilização comum em nossa região, com cimento e agregados usuais, misturados em proporções também usuais (traço, foi submeti- do a temperaturas de 300 °C, 600°C e 900 °C , de maneira a se avaliar prováveis alterações na resistência à compressão, na resistência à tração e no módulo de deformação deste concreto. O efeito do resfriamento rápido do concreto, usual em intervenções de combate a incêndios, foi avaliado; alguns dos corpos-de-prova submetidos às altas temperaturas estipuladas foram resfriados rapidamente e outros foram resfriados len- tamente (ao ambiente. A recuperação provável das propriedades mecânicas analisadas, com a reidratação do concreto - com possível redução após o efeito das altas temperaturas aplicadas - também foi avaliada; corpos-de-prova submetidos às altas temperaturas estipuladas e resfriados lentamente, foram parte imersos em água e parte envoltos em filme plástico e a seguir, cada parte correspondente foi avaliada, em relação às propriedades do concreto pesquisadas, para as idades do concreto de 28, 56, 112 e 224 dias após o resfriamento lento. Ao final deste trabalho, importantes resultados sobre o efeito de altas temperaturas nas propriedades mecânicas do concreto puderam ser obtidos; contribuindo, em muito, para o estabelecimento de parâmetros para o projeto de recuperação de estruturas submetidas ao efeito do fogo.

L’ESSENZA DI HIGGS NELL’IMMINENTE SCOPERTA DI NUOVI MONDI

Directory of Open Access Journals (Sweden)

IACOBUCCI Giuseppe

2013-06-01

Full Text Available High-energy physics is posing a long series of questions, relating elementary particles to the symmetries that govern fundamental forces and to the intimate fabric of our universe. The recent discovery at CERN of the Higgs boson is just the first goal of the rich LHC physics program.

Kapoyt/blu: alla scoperta della storia armena di un colore

Directory of Open Access Journals (Sweden)

Marco Bais

2012-10-01

Full Text Available The study begins with an analysis of the semantics of the Armenian word kapoyt, blue, taking into account its different uses in Armenian literature, e.g. its possible connection with natural elements (lakes, seas, sky, etc., clothes, diseases, precious stones, and toponyms. Great attention has been paid to the metaphorical meanings of kapoyt in Armenian tradition, which are related with feelings such as envy, jealousy, and sorrow. The second part of the study deals with the colour blue as a mean of artistic expression. On the one hand, the symbolism of blue has been investigated through the reflection on the aesthetics of colour found in the works of some Armenian Christian authors of the Middle Ages. On the other, we analyse different types of pigment used by Armenian artists in different times and in different schools, according to the information of ancient handbooks on colour production, and on the basis of data concerning the trade in colouring matters.

Nutrition et sécurité alimentaire dans les hautes terres du Vietnam et ...

International Development Research Centre (IDRC) Digital Library (Canada)

Nutrition et sécurité alimentaire dans les hautes terres du Vietnam et de la Thaïlande. La malnutrition demeure un problème grave au Vietnam et en Thaïlande, surtout dans les hautes terres, où vivent la plupart des minorités ethniques. Ces collectivités connaissent actuellement des changements socioéconomiques ...

Objectif : les zones cruciales au regard des changements climatiques

International Development Research Centre (IDRC) Digital Library (Canada)

ruissellement et les phénomènes climatiques extrêmes constituent des menaces pour les deltas en. Afrique et en Asie du Sud, où sont situées quelques-unes des plus grandes villes de la planète. Des centaines de millions de personnes sont exposées, et tout particulièrement celles qui vivent dans des établissements.

ÉTUDE DE CAS — Chine : Lier agriculteurs et chercheurs en Chine ...

International Development Research Centre (IDRC) Digital Library (Canada)

5 janv. 2011 ... L'élément clé : le renforcement des systèmes locaux d'amélioration des semences. Trop souvent, les agriculteurs et les chercheurs travaillent dans des mondes différents. Les chercheurs produisent des variétés hybrides exotiques en laboratoire qui ne réussissent que parce qu'elles vivent dans des ...

Participation des jeunes femmes à la vie politique au Malawi | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

Conscients de la corrélation entre la pauvreté, la vulnérabilité sociale et les inégalités entre les sexes, les chercheurs se demanderont dans quelle mesure la situation sociale, économique, culturelle et politique des femmes qui vivent en milieu rural au Malawi influe sur la participation, à la vie politique locale, des jeunes ...

Incidence de la diaspora sur les capacités de rétablissement après ...

International Development Research Centre (IDRC) Digital Library (Canada)

Ce projet appuiera la réalisation d'un examen comparatif visant à répondre à la question suivante : en quoi les membres de la diaspora deviennent-ils des agents de changement dans des pays touchés par des crises ou des conflits prolongés ou qui vivent une transition difficile ? À l'aide d'un cadre conceptuel commun, ...

Résultats de recherche | Page 4 | CRDI - Centre de recherches pour ...

International Development Research Centre (IDRC) Digital Library (Canada)

Le chômage persistant chez les jeunes qui vivent dans des collectivités à faible revenu (on les appelle aussi " jeunes à risque ") est relié en partie au mauvais fonctionnement du marché du travail dans les pays en développement. Projet. -. Bourse de recherche postdoctorale sur l'Amérique centrale et les Caraïbes au ...

Biologie et perspectives d'élevage de la crevette géante d'eau ...

African Journals Online (AJOL)

... des thèses et livres portant sur la crevette d'eau douce Macrobrachium en général et de Macrobrachium vollenhovenii en particulier. Les larves vivent exclusivement en eau saumâtre. La nutrition larvaire est basée sur le plancton tandis que les adultes sont omnivores à dominance carnivore. La croissance se fait par des ...

Difficultés scolaires et séparation des parents

OpenAIRE

Henri-Panabière, Gaële

2011-01-01

Répartition des collégiens dans les classes de difficultés scolaires selon que les parents vivent ensemble ou non… …dans la population d’ensemble (N=629 sans les non-réponses) …et dans la sous-population des parents diplômé(s) du supérieur (N=251 sans les non-réponses)

Le Honduras se démarque dans la lutte contre la maladie de Chagas

International Development Research Centre (IDRC) Digital Library (Canada)

25 janv. 2011 ... ... en partenariat avec la fondation nationale du logement, ont grandement contribué à la lutte contre la transmission de la maladie de Chagas. À ce jour, 45 % des habitants du comté vivent dans de nouvelles maisons faites de matériaux − murs d'adobe, planchers de ciment, toits de zinc − qui n'attirent pas ...

Réduction de la malnutrition et retour à une diversité biologique et ...

International Development Research Centre (IDRC) Digital Library (Canada)

Le défi. En Inde, beaucoup de personnes pauvres vivent dans des régions rurales fortement tributaires de l'agriculture. Or, la grande diversité des cultures traditionnellement pratiquées dans ces régions est aujourd'hui fréquemment mise à mal par les politiques gouvernementales, qui encouragent la culture du riz et du blé.

Uma abordagem centrada no usuário para o projeto de máquinas agrícolas de tração animal An user centered approach to the design of animal traction agricultural machinery

Directory of Open Access Journals (Sweden)

Eduardo Romeiro Filho

2012-01-01

Full Text Available Este artigo apresenta um estudo realizado como parte do projeto de uma semeadora-adubadora à tração animal, utilizando princípios relacionados a disciplinas como Usabilidade, Ergonomia e Antropotecnologia, dentro de uma perspectiva de Design para Sustentabilidade (DfS e desenvolvimento de produtos adequados à Base da Pirâmide (BoP. O estudo forneceu subsídios para uma série de alterações a serem introduzidas no equipamento, tendo em vista a melhoria das condições de trabalho em pequenas propriedades de agricultura familiar. A partir desta abordagem na análise de um implemento existente, são sugeridas formas de adequação do produto e apresentada uma proposta para uma nova semeadora-adubadora à tração animal.This paper presents a study conducted as a part of the design of an Animal Traction Sewing Machine using principles related to Usability, Ergonomics, and Antropotechnology focusing on Design for Sustainability (DfS and product development suitable for the Base of the Pyramid (BoP. The present study provided information for a series of design changes in the equipment in order to improve working conditions in small family farming properties. From this approach to the analysis of an existing implement, ways of adjusting the product are suggested, and a proposal for a novel Animal Traction Sowing Machine is presented.

I lectores medioevali tra il libro e il testo

Directory of Open Access Journals (Sweden)

Federica Riviello

2012-06-01

Full Text Available L’intento del lavoro è di problematizzare alcuni aspetti, generalmente ritenuti emblematici, della relazione tra i litterati medievali e il libro – nelle sue declinazioni di Testo sacro, Libro della natura e auctoritates. L’impiego, come strumenti di lavoro, di concetti di recente elaborazione e di osservazioni di pensatori contemporanei sull’argomento, non è finalizzato ad attualizzare tale relazione, quanto piuttosto ad ampliare i punti di vista su di essa e a metterne alla prova la capacità di offrire originali spunti di riflessione. Le proposte teoriche di Jacques Derrida, Michel Foucault e Roland Barthes sono qui adoperate come esemplificazioni di un’interpretazione che ha storicamente reso quasi paradigmatico il modo di leggere dei docti, specialmente altomedievali. Tuttavia, alcune definizioni della Scrittura – il libro per eccellenza – proposte da questi ultimi, nonché la teorizzazione del suo quadruplice senso sembrano smussare la radicalità di queste osservazioni. Concetti quali “funzione-autore” di Foucault e “testo” di Barthes sono invece adottati per considerare all’interno di una diversa cornice teorica il confronto dei doctores, in particolare bassomedievali, con le cosiddette auctoritates. Nella visione ordinaria la reverenza nei confronti dell’autore, divino o umano, la ricerca e la riproposizione fedele di un significato univoco dell’opera aldilà dei segni, naturali o culturali, che lo veicolano costituiscono tratti tipici dell’atteggiamento dei lettori medievali. A fronte di questi aspetti, tuttavia, è possibile sottolinearne altri eterodossi e perlopiù trascurati, quali la rilevanza attribuita all’interpretazione, prassi ineludibile e da disciplinare, al ruolo del lettore e alla sua fruizione attiva e produttiva dei testi. The aim of the work is to problematize some aspects generally considered representative of the relationship between medieval savants and the book - in its variations

Stratégies fondées sur les citoyens - collaboration avec les ...

International Development Research Centre (IDRC) Digital Library (Canada)

Dans le cadre de ce projet, on cherchera à comprendre le climat d'insécurité au sein des collectivités touchées par la violence à Medellín, en Colombie, du point de vue de ceux qui le vivent (les populations vulnérables). Travaillant de concert avec des membres de la collectivité, les chercheurs relèveront les principaux ...

: tous les projets | Page 294 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Ce projet appuiera la réalisation d'un examen comparatif visant à répondre à la question suivante : en quoi les membres de la diaspora deviennent-ils des agents de changement dans des pays touchés par des crises ou des conflits prolongés ou qui vivent une transition difficile ? Date de début : 1 juillet 2011. End Date: 1 ...

: tous les projets | Page 293 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Ce projet appuiera la réalisation d'un examen comparatif visant à répondre à la question suivante : en quoi les membres de la diaspora deviennent-ils des agents de changement dans des pays touchés par des crises ou des conflits prolongés ou qui vivent une transition difficile ? Date de début : 1 juillet 2011. End Date: 1 ...

Aperçu sur l'adaptation

International Development Research Centre (IDRC) Digital Library (Canada)

De nombreuses régions de l'Afrique subissent depuis plusieurs décennies, des aléas climatiques. Cependant les effets de ces aléas ne sont pas vécus partout avec la même acuité. La menace est particulièrement élevée en. Afrique subsaharienne. Dans le Bassin du Congo, plus de 80% des populations vivent ...

Agropolis : The Social, Political and Environmental Dimensions of ...

International Development Research Centre (IDRC) Digital Library (Canada)

L'agriculture urbaine est une pratique de plus en plus répandue dans les villes du monde entier, et il est crucial d'en assurer la viabilité, en particulier pour les pauvres qui vivent en milieu urbain dans les pays en développement. Ce livre présente les premières constatations de projets de recherche originaux menés sur le ...

A primeira obra de linguística produzida no Brasil: Traços Geraes de Linguistica (1880 de Júlio Ribeiro

Directory of Open Access Journals (Sweden)

José Edicarlos de Aquino

2018-03-01

Full Text Available Trazemos para análise um texto até agora apagado na história das ideias linguísticas no Brasil, o livro Traços Geraes de Linguistica (1880, de Júlio Ribeiro, que tem como fato significativo ter sido a primeira obra de linguística produzida no país. Apresentamos Júlio Ribeiro como um autor de linguística a par das questões do seu tempo, que trata de temas como a sede da linguagem articulada, o aparelho da fonação, a origem, a evolução e a tipologia das línguas e a história das ciências da linguagem, retomando e inovando a gramática histórica, e também como um historiador das ciências da linguagem, que apresenta interpretações particulares da história do conhecimento sobre a linguagem e as línguas. Mostramos que, por esse gesto de reformular as teorias linguísticas e a sua história, Júlio Ribeiro insere a língua portuguesa e as línguas indígenas brasileiras nas questões gerais do conhecimento científico sobre a linguagem no século XIX.

Desempenho na barra de tração de um trator agrícola de pneus, alimentado com misturas de óleo diesel e óleo de soja reutilizado

Directory of Open Access Journals (Sweden)

Wagner da Cunha Siqueira

2013-12-01

Full Text Available O petróleo é a principal fonte de energia para motores de combustão interna, possibilitando sua transformação em energia mecânica. A dependência do petróleo conduz à necessidade de alternativas, mediante o cultivo de matérias-primas renováveis. Os problemas atuais são os custos dos biocombustíveis, que são maiores que dos derivados do petróleo, e o fato de que não existem muitos motores de combustão adequados ao uso de óleos vegetais. Em vista disso, são necessárias mais investigações quanto às técnicas de produção e de refino dos biocombustíveis e, ainda, à adequação de motores ao uso de óleos vegetais, para que estes possam ser uma alternativa viável. O objetivo deste trabalho foi caracterizar as diferentes misturas e avaliar o desempenho de um trator agrícola de pneus, utilizando misturas de óleo Diesel (OD com óleo de soja reutilizável (OSR. Primeiramente, foi realizado um estudo de densidade, viscosidade das misturas e comportamento da temperatura do OD no sistema de alimentação de combustível no motor. Após as análises, verificou-se, por meio de ensaios na barra de tração, o desempenho das misturas de OD e OSR. As principais conclusões deste trabalho foram: a densidade e viscosidade das misturas sofrem variações com o aumento da quantidade de OSR e com a variação da temperatura. Para as avaliações na barra de tração, os melhores resultados observados no rendimento do trator foram verificados com o aumento das percentagens de mistura (25% OSR, para carga N, 25, 75 e 100% OSR, para a quarta marcha, como carga, e 75 e 100% OSR, para a terceira, segunda e primeira marcha, como carga.

Lutte contre les cerscosporioses du bananier aux Antilles françaises : Banatrace, un système d'information géographique multi-acteurs pour la gestion et la traçabilité des épandages aériens

OpenAIRE

DUMAS, Marine; DUMAS, Marine

2011-01-01

Comment un système d’information géographique peut-il aider à améliorer la fiabilité des traitements aériens contre les maladies fongiques du bananier tout en réduisant leur impact environnemental ? Des réponses aux Antilles françaises avec l’outil informatique multi-acteurs Banatrace, conçu pour aider les gestionnaires à répondre aux différents besoins de traçabilité imposée par la réglementation récente sur les épandages aériens.

Ethnobotanique des plantes médicinales chez les bergers peuls de ...

African Journals Online (AJOL)

Objectif: Le savoir indigène à Widou Thiengoly est entre les mains des bergers qui vivent dans des écosystèmes souvent fragilisés. Il est normal de préserver ce savoir nomade et ancestral. Méthodologie et résultats: Ainsi, nous avons mené des enquêtes auprès des bergers peuls de Widou. Un guide d'entretien a été ...

Publications | Page 156 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

... and Community Diversity. La mer des Caraïbes est la deuxième au monde pour sa superficie et sa région englobe plus de 30 pays insulaires et continentaux où vivent près de 35 millions d'habitants. Outre son territoire fragmenté, cette région se caractérise par sa grande diversité linguistique et culturelle, ce phénomène.

Changements climatiques et infiltrations d'eau salée le long du ...

International Development Research Centre (IDRC) Digital Library (Canada)

La Méditerranée orientale est très exposée aux infiltrations d'eau salée dans les aquifères (qui contiennent de l'eau douce) se trouvant sur son littoral. La dégradation des aquifères pourrait entraîner de graves conséquences socioéconomiques pour les personnes qui vivent en ces lieux. Le projet consistera à étudier ...

Tribolium castaneum Transformer-2 regulates sex determination and development in both males and females.

Science.gov (United States)

Shukla, Jayendra Nath; Palli, Subba Reddy

2013-12-01

Tribolium castaneum Transformer (TcTra) is essential for female sex determination and maintenance through the regulation of sex-specific splicing of doublesex (dsx) pre-mRNA. In females, TcTra also regulates the sex-specific splicing of its own pre-mRNA to ensure continuous production of functional Tra protein. Transformer protein is absent in males and hence dsx pre-mRNA is spliced in a default mode. The mechanisms by which males inhibit the production of functional Tra protein are not known. Here, we report on functional characterization of transformer-2 (tra-2) gene (an ortholog of Drosophila transformer-2) in T. castaneum. RNA interference-mediated knockdown in the expression of gene coding for tra-2 in female pupae or adults resulted in the production of male-specific isoform of dsx and both female and male isoforms of tra suggesting that Tra-2 is essential for the female-specific splicing of tra and dsx pre-mRNAs. Interestingly, knockdown of tra-2 in males did not affect the splicing of dsx but resulted in the production of both female and male isoforms of tra suggesting that Tra-2 suppresses female-specific splicing of tra pre-mRNA in males. This dual regulation of sex-specific splicing of tra pre-mRNA ensures a tight regulation of sex determination and maintenance. These data suggest a critical role for Tra-2 in suppression of female sex determination cascade in males. In addition, RNAi studies showed that Tra-2 is also required for successful embryonic and larval development in both sexes. Copyright © 2013 Elsevier Ltd. All rights reserved.

Uso do feromônio sexual sintético para captura de machos da traça-das-crucíferas

Directory of Open Access Journals (Sweden)

MICHEREFF MIRIAN FERNANDES FURTADO

2000-01-01

Full Text Available Este trabalho teve como objetivo estudar a atração dos machos da traça-das-crucíferas (Plutella xylostella L., Lepidoptera: Yponomeutidae por diferentes formulações do feromônio sexual sintético. Os tratamentos consistiram em: 1 formulação comercial; 2 Z11,16:Ald; 3 Z11,16:Ac; 4 mistura 7:3 de 2+3; 5 mistura 5:5 de 2+3; 6 septos de borracha com hexano (testemunha; e 7 cinco fêmeas virgens. A formulação comercial do feromônio sexual sintético propiciou maior captura de machos, não diferindo significativamente de fêmeas virgens e da mistura 5:5 utilizadas como isca. Os componentes isoladamente foram pouco atrativos aos machos. Foram testados cinco modelos de armadilhas. A armadilha Pherocon 1 CP (33,2 machos/armadilha/noite foi a mais eficiente na captura de machos, seguida pelas armadilhas Cilíndrica Aberta, Cilíndrica Fechada, Delta e Redonda Aberta. Três alturas de instalação da armadilha foram avaliadas. Ocorreu significativamente maior captura de machos na altura do ápice das plantas (30 cm do solo. As alturas de 5 e 60 cm não diferiram entre si.

Liberamente tratto da... Storie, codici, tragitti, mediazioni tra letteratura e cinema Loosely adapted from… Stories, codes, travels, mediations between literature and cinema

Directory of Open Access Journals (Sweden)

Donata Meneghelli

2012-12-01

Full Text Available

Il saggio, a partire da una ricognizione della più recente letteratura critica sull’argomento, vuole proporre una riflessione critica sull’adattamento, sui confini che delimitano tale pratica e, in particolare, sulle questioni specifiche messe in gioco dall’adattamento cinematografico dei testi letterari, all’interno del più vasto campo dei rapporti tra letteratura e cinema. Tali questioni investono in primo luogo l’adattamento dei testi del canone, i ‘grandi’ testi della tradizione occidentale: è soprattutto in questo contesto che viene chiamata in causa la nozione di fedeltà. ‘Fedeltà’ è un termine apparentemente neutrale, che in realtà nasconde sempre un’implicita gerarchia e un atteggiamento difensivo nei confronti di una supposta superiorità assiologica della letteratura come forma ‘alta’, dotata di una dignità, di un’indipendenza creativa che mancherebbero al cinema in quanto arte popolare e di massa.

Starting from a survey of the most recent studies on the topic, the essay proposes a critical reflection on adaptation and the (possible borders of this cultural practice. It particularly focuses on the issues raised by cinematic adaptation of literary texts, a phenomenon which needs to be contextualized in the larger field of relationships between literature and cinema. Such issues, however, do not emerge in the same way for any text: they are especially urgent when we tackle the cinematic adaptation of

Bebês: o irresistível poder da graciosidade. Um estudo sobre o significado evolutivo dos traços infantis Babies: the irresistible power of cuteness. A study concerning the evolutionary function of infantile traits

Directory of Open Access Journals (Sweden)

Monique Leitão

2010-04-01

Full Text Available Os bebês, em geral, despertam ternura e comportamentos de cuidado nas pessoas. O objetivo deste trabalho foi discutir a atração provocada pelos traços infantis, tendo como referencial teórico os quatro níveis de explicação de Tinbergen. Do ponto de vista dos mecanismos que desencadeiam essa atração neonatal, avaliamos a importância da aparência do infante para eliciar as respostas de cuidado parental. Considerando a função adaptativa desta característica, discutimos os processos evolutivos que moldaram as preferências pelos atributos infantis, além da história filogenética do favoritismo pelos sinais morfológicos de filhotes. Apresentamos, ainda, dados sobre o desenvolvimento deste traço comportamental ao longo da vida. Tomadas em conjunto, estas informações provêem uma análise de por que achamos os bebês tão irresistíveis.Babies generally elicit tenderness and caretaking behaviors on people. The aim of this study is to discuss the attraction towards babyish features, taking Tinbergen's four questions as a theoretical benchmark. Concerning the mechanisms implicated in this neonatal attraction, we evaluated the importance of children´s morphology on eliciting parental responses. Considering the adaptive function of this characteristic, we discuss the evolutionary process that shaped the preferences towards infantile traits as well as the phylogeny of the preference towards infant´s morphological traits. It was also presented data about the development of this behavioral trait across life span. The information provided here suggests a reason why we find babies such irresistible creatures.

Le aree rurali dell’Appennino Ligure tra età romana e tardomedioevo. Ricerche storiche e archeologiche in alta Valle Scrivia / The rural areas of the Ligurian Appennines between Roman period and the Late Middle Ages. Historical and archaeological research in Valle Scrivia

Directory of Open Access Journals (Sweden)

Giovanni Battista Parodi

2015-12-01

Full Text Available La ricerca è incentrata sull’analisi delle forme e delle dinamiche del popolamento, delle strutture e dell’organizzazione del territorio dell’alta Valle Scrivia (area appenninica ubicata tra Genova e la pianura che mai è stata oggetto di ricerche sistematiche tra la tarda antichità e il XV secolo, alla luce delle fonti storiche, cartografiche e archeologiche. In particolare, la realizzazione di indagini di superficie e shovel tests ha consentito di ampliare e approfondire la conoscenza del comprensorio nel periodo in esame, fornendo interessanti spunti per lo studio delle aree rurali appenniniche. Gli elementi raccolti sono confl uiti all’interno di un database e di una piattaforma GIS appositamente creata. The research focuses on the analysis of settlement forms and dynamics, structures and organisation of upper Valle Scrivia (an area in the Apennines located between Genoa and the Po Valley that has never been the object of systematic studies between Late Antiquity and the 15th century in light of historical, cartographic and archaeological sources. In particular, carrying out surface surveys and shovel tests allowed to widen and increase the knowledge of the area in the period examined and provided interesting ideas for the study of rural areas in the Apennines. The elements that were gathered were inserted into a database and a GIS platform created on purpose.

Maternal provision of transformer-2 is required for female development and embryo viability in the wasp Nasonia vitripennis.

Science.gov (United States)

Geuverink, Elzemiek; Rensink, Anna H; Rondeel, Inge; Beukeboom, Leo W; van de Zande, Louis; Verhulst, Eveline C

2017-11-01

In insect sex determination a primary signal starts the genetic sex determination cascade that, in most insect orders, is subsequently transduced down the cascade by a transformer (tra) ortholog. Only a female-specifically spliced tra mRNA yields a functional TRA-protein that forms a complex with TRA2, encoded by a transformer-2 (tra2) ortholog, to act as a sex specific splicing regulator of the downstream transcription factors doublesex (dsx) and fruitless (fru). Here, we identify the tra2 ortholog of the haplodiploid parasitoid wasp N. vitripennis (Nv-tra2) and confirm its function in N. vitripennis sex determination. Knock down of Nv-tra2 by parental RNA interference (pRNAi) results in complete sex reversal of diploid offspring from female to male, indicating the requirement of Nv-tra2 for female sex determination. As Nv-tra2 pRNAi leads to frequent lethality in early developmental stages, maternal provision of Nv-tra2 transcripts is apparently also required for another, non-sex determining function during embryogenesis. In addition, lethality following Nv-tra2 pRNAi appears more pronounced in diploid than in haploid offspring. This diploid lethal effect was also observed following Nv-tra pRNAi, which served as a positive control in our experiments. As diploid embryos from fertilized eggs have a paternal chromosome set in addition to the maternal one, this suggests that either the presence of this paternal chromosome set or the dosage effect resulting from the diploid state is incompatible with the induced male development in N. vitripennis caused by either Nv-tra2 or Nv-tra pRNAi. The role of Nv-tra2 in activating the female sex determination pathway yields more insight into the sex determination mechanism of Nasonia. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

Conservation and Sex-Specific Splicing of the transformer Gene in the Calliphorids Cochliomyia hominivorax, Cochliomyia macellaria and Lucilia sericata

Science.gov (United States)

Li, Fang; Vensko, Steven P.; Belikoff, Esther J.; Scott, Maxwell J.

2013-01-01

Transformer (TRA) promotes female development in several dipteran species including the Australian sheep blowfly Lucilia cuprina, the Mediterranean fruit fly, housefly and Drosophila melanogaster. tra transcripts are sex-specifically spliced such that only the female form encodes full length functional protein. The presence of six predicted TRA/TRA2 binding sites in the sex-specific female intron of the L. cuprina gene suggested that tra splicing is auto-regulated as in medfly and housefly. With the aim of identifying conserved motifs that may play a role in tra sex-specific splicing, here we have isolated and characterized the tra gene from three additional blowfly species, L. sericata, Cochliomyia hominivorax and C. macellaria. The blowfly adult male and female transcripts differ in the choice of splice donor site in the first intron, with males using a site downstream of the site used in females. The tra genes all contain a single TRA/TRA2 site in the male exon and a cluster of four to five sites in the male intron. However, overall the sex-specific intron sequences are poorly conserved in closely related blowflies. The most conserved regions are around the exon/intron junctions, the 3′ end of the intron and near the cluster of TRA/TRA2 sites. We propose a model for sex specific regulation of tra splicing that incorporates the conserved features identified in this study. In L. sericata embryos, the male tra transcript was first detected at around the time of cellular blastoderm formation. RNAi experiments showed that tra is required for female development in L. sericata and C. macellaria. The isolation of the tra gene from the New World screwworm fly C. hominivorax, a major livestock pest, will facilitate the development of a “male-only” strain for genetic control programs. PMID:23409170

Carrara e le sue cave. Alla scoperta dei paesaggi del marmo

Directory of Open Access Journals (Sweden)

Francesco Alberti

2015-11-01

Full Text Available The article describes the strategic master plan drawn in 2007 by P. Giorgieri and F. Alberti, along with a marketing study by SL&A (Rome, for promoting tourism through the places of white marble in Carrara - quarries, sculpture ateliers, exhibition spaces, villages and trails of old quarries, etc.. The proposal is part of the Integrated Plan for Urban Sustainable Development (PIUSS presented with success by the Municipality to the Region Tuscany in 2010, for the allocation of the European structural funds. The plan is structured on six touristic itineraries, some of which follow the routes of the old “Marble Railway”, linking the town center with the extraction areas (with their active or dismissed quarries belonging to different times and the footpaths of the Park of the Apuan Alps.

Effect of the gene transformer of Anastrepha on the somatic sexual development of Drosophila.

Science.gov (United States)

Ruiz, María-Fernanda; Sánchez, Lucas

2010-01-01

The gene transformer (tra) is the key regulatory memory device for sex determination in tephritid insects. The present manuscript addressed the question about the functional conservation of the tephritid Anastrepha Transformer protein to direct somatic sexual development in Drosophila (Drosophilidae). The transformer cDNA of Anastrepha encoding the putative full-length Tra protein was cloned in pUAST and introduced into Drosophila melanogaster. To express this protein, the GAL4-UAS system was used. The Anastrepha Tra protein induced the female-specific splicing of both dsx and fru pre-mRNAs in Drosophila XY male flies, so that these became transformed into females, though this transformation was incomplete (the sexually dimorphic foreleg basitarsus and the external terminalia were monitored). It was found that the degree of female transformation directly depended on the dose of Anastrepha tra and Drosophila transformer-2 (tra-2) genes, and that the Anastrepha Tra-Drosophila Tra2 complex is not as efficient as the Drosophila Tra-Tra2 complex at inducing the female-specific splicing of Drosophila dsx pre-mRNA. This can explain why the Anastrepha Tra protein cannot fully substitute for the endogenous Drosophila Tra protein.

La traduzione e la nuova letteratura. Il modernismo novecentista (tra nazionalismo e interculturalità

Directory of Open Access Journals (Sweden)

Rosario Gennaro

2015-05-01

Full Text Available «Gli scrittori italiani siano all’interno e soprattutto all’estero i portatori del nuovo tipo di civiltà italiana. Spetta agli scrittori di fare quello che si può chiamare ‘imperialismo spirituale’». Questo afferma Mussolini nel 1925, ricollegandosi a un vasto dibattito sull’“espansione culturale”. L’articolo, affrontando il dibattito sulla traduzione sviluppatisi intorno al novecentismo di Bontempelli, esamina: a il progetto di nuova letteratura messo in campo dal novecentismo; b il ruolo cruciale che vi svolgono la traduzione e il commercio letterario internazionale; c il senso del nesso asserito da Bontempelli fra traducibilità e valore letterario; c le obiezioni opposte dagli avversari; d la vera posta di tali contrasti (l’egemonia nel canone letterario; e l’uso strumentale della cultura da parte del fascismo per fini di politica estera; f lo strumentale ricorso degli scrittori alla politica per fini di lotta letteraria; g la compatibilità tra apertura internazionale, traduzione, nazionalismo, imperialismo nel modernismo culturale di metà anni Venti. «Italian writers should be the mouthpieces, both in Italy and abroad, of the new brand of Italian civilization. It is the writers’ task to promote what we may call ‘spiritual imperialism’.» Thus spoke Mussolini in 1925, joining a widespread debate on “cultural expansion.” By addressing the discussion on translation that developed around Bontempelli’s “Novecentismo”, the article examines the following issues: a the project of a new literature promoted by “Novecentismo”; b the crucial role played by translation and international literary trade in this project; c the meaning of the nexus that Bontempelli posited between translatability and literary value; c the opponents’ objections; d the actual implications of such contrasts (i.e. the issue of hegemony within the establishment of a literary canon; e Fascism’s deceptively instrumental use

Seleção indireta para teor de 2-tridecanona em tomateiros segregantes e sua relação com a resistência à traça-do-tomateiro Indirect selection to 2-tridecanone content and its relation to tomato pinworm resistance

Directory of Open Access Journals (Sweden)

Cláudia Regina Gontijo Labory

1999-05-01

Full Text Available Este trabalho teve como objetivo verificar a relação entre o teor de 2-tridecanona (2-TD em materiais selecionados e o nível de resistência à traça-do-tomateiro (Tuta absoluta (Meyrick, 1917 (Lepidoptera: Gelechiidae em gerações avançadas de Lycopersicon spp. derivado de cruzamentos interespecíficos. Foi usada uma população de tomateiros segregantes (geração F4RC2 para 2-TD, uma metilcetona que confere resistência à traça-do-tomateiro. Genótipos foram selecionados e avaliados quanto à resistência do tipo não-preferência: três materiais com alto teor do aleloquímico 2-TD (HI1, HI2, HI3 e dois materiais com baixo teor (LO1, LO2, além das testemunhas. Após infestação controlada, foram avaliados: contagem do número de ovos postos, evolução da lesão nos folíolos, porcentagem de folíolos atacados, e índice geral de lesão causada pela traça. Plantas com alto teor de 2-TD (HI1 e HI3 tiveram uma baixa progressão das lesões ocasionadas pelo ataque de T. absoluta. A planta LO1 foi muito atacada pela praga, o mesmo não ocorrendo com a planta LO2, que foi infestada acidentalmente por ácaros do gênero Tetranychus, acarretando, provavelmente, uma disputa de nicho ecológico entre os dois artrópodes. Concluiu-se que altos teores de 2-TD estão ligados a mecanismos de resistência à traça-do-tomateiro do tipo não-preferência por oviposição e alimentação.This work had the objective to verify the relation between 2-tridecanone (2-TD in selected plants and resistance level to tomato pinworm (Tutaabsoluta (Meyrick, 1917 (Lepidoptera: Gelechiidae in advanced generations of Lycopersicon spp. interspecific crosses. It was used a tomato population (F4RC2 generation segregant for 2-TD, a methyl ketone that controls the resistance of the tomato pinworm. Materials were selected and evaluated for a non-preference mechanism of resistance. Three genotypes with high level of the allelochemic 2-TD (HI1, HI2, HI3, two with low

Progetto EURAMET: HLT03 DUTy - Dosimetria per terapie ultrasonore. Confronto tra metodi di misura - EURAMET: HLT03 DUTy - Dosimetry for ultrasound therapy. Intercomparison of methods

Directory of Open Access Journals (Sweden)

Giovanni Durando

2016-03-01

Full Text Available La mancanza di una definizione della dose ultrasonora rende di fatto impossibile la valutazione della più appropriata “quantità” energia ceduta ai tessuti dal fascio ultrasonoro emesso da un trasduttore durante una terapia. Il progetto di ricerca “Dosimetry for Ultrasound Therapy - DUTy”, finanziato dal programma di ricerca EURAMET EMRP, aveva tra i suoi principali obiettivi, oltre al confronto interlaboratorio che validasse le capacità metrologiche dei laboratori partecipanti, la ricerca della definizione di dose ultrasonora che consentisse la definizione di un piano terapeutico specifico per ogni paziente. ------ Standardized and traceable dose has not yet been developed for medical ultrasound applications. This means that the ‘amount’ of ultrasound required for a particular therapy cannot be calculated and that the ‘amount’ actually delivered quantified. The aim of EURAMET EMRP project “Dosimetry for Ultrasound Therapy - DUTy” project was developing the metrological infrastructure (definitions, validated measurement and modelling methods which underpins the specification of dose for therapeutic ultrasound applications allowing appropriate treatment planning and risk assessment.

Traçando mapas: a teoria histórico-cultural e as contribuições para a pesquisa com crianças e suas espacialidades

Directory of Open Access Journals (Sweden)

Jader Janer Moreira Lopes

2015-04-01

Full Text Available Este texto busca fazer uma reflexão sobre as pesquisas sistematizadas no campo da infância, tendo como enfoque principal as estratégias de pesquisas “com crianças”. O recorte ao qual nos dedicamos são as relações que as crianças estabelecem com o meio, tendo como foco principal as suas espacialidades. A partir das contribuições de pesquisas que se aportam em estratégias de natureza qualitativas e fundamentadas nos aportes da teoria históricas cultural, elege-se o conceito de vivência (perejivanie como mote em torno do qual nossos trabalhos são desenvolvidos. Para isso, traça-se, inicialmente, a origem da pesquisa com base em paradigmas positivistas e evidenciam-se alguns caminhos que buscaram romper com essa perspectiva: os postulados etnográficos de Malinovky e Boas; o Interacionismo simbólico, cujo precursor é George Herbert Mead; a Etnometodologia de Harold Garfinkel; as contribuições de Marx e os princípios estabelecidos por Vigotski e seus colaboradores.

Mesure et réduction du fossé numérique entre les sexes dans les ...

International Development Research Centre (IDRC) Digital Library (Canada)

Environ 70 % des 160 millions de Pakistanais vivent en milieu rural; or, près de 90 % des infrastructures de TIC se trouvent en région urbaine. Par conséquent, une très grande partie de la population n'a pas accès au potentiel des TIC en matière de développement humain. Cette disparité d'accès entre divers groupes de la ...

2143-IJBCS-Article-Dr Hermine Zime-Diawara

African Journals Online (AJOL)

hp

Sur ces. 130 personnes, 108 ont suivi le traitement en intégralité et ont honoré rigoureusement les rendez-vous définis. Tous ces malades sont nés et vivent en zone d'endémie au Bénin. L'échantillon était constitué de 53,7% de femmes contre 46,3% d'hommes. Le sexe ratio de l'était donc de 1,16 en faveur des femmes.

Coastal Resource Management in the Wider Caribbean : Resilience ...

International Development Research Centre (IDRC) Digital Library (Canada)

1 janv. 2010 ... La mer des Caraïbes est la deuxième au monde pour sa superficie et sa région englobe plus de 30 pays insulaires et continentaux où vivent près de 35 millions d'habitants. Outre son territoire fragmenté, cette région se caractérise par sa grande diversité linguistique et culturelle, ce phénomène étant ...

Interventions communautaires durables visant à améliorer l ...

International Development Research Centre (IDRC) Digital Library (Canada)

L'urbanisation rapide est l'un des grands défis du XXIe siècle. Environ 12 000 personnes vivent dans la paroisse de Banda, dans la partie est de Kampala. Ce secteur marécageux est propice à l'éclosion d'épidémies de choléra. Le grand nombre de cas de malaria, de dysenterie, de diarrhée et de malnutrition fait en sorte ...

L’enigma dei raggi cosmici le più grandi energie dell’universo

CERN Document Server

De Angelis, Alessandro

2012-01-01

Grazie ad avventurosi studi fu possibile dimostrare un secolo fa che parte della radiazione naturale che si osserva sulla Terra è di natura extraterrestre: era la scoperta dei cosiddetti “raggi cosmici”, particelle che arrivano da misteriosi acceleratori nell’universo, probabilmente buchi neri supermassicci e resti di supernova, a energie anche centinaia di milioni di volte di quelle a cui riusciamo a produrle con i più potenti acceleratori della Terra. A cent’anni dalle prime scoperte questo libro si propone, con l’aiuto di documenti scoperti recentemente, di raccontare la vera storia di questa appassionante avventura scientifica e le frontiere dell'esplorazione dei raggi cosmici.

L’Igea delle Terme Milano: il contesto di rinvenimento

Directory of Open Access Journals (Sweden)

Pietro Mecozzi

2012-01-01

Full Text Available Lʹarticolo prende in esame il contesto di rinvenimento della testa marmorea di Igea recentemente scoperta a Gortina. In particolare intende fornire un quadro generale delle diverse fasi evolutive delle cosiddette Terme Milano e dell’area da esse occupata, dal punto di vista stratigrafico e cronologico. L’attenzione è volta per lo più alle ultime campagne di scavo, che hanno interessato l’area orientale delle Terme. L’articolo presenta inoltre una descrizione specifica del muro all’interno del quale è stata rinvenuta la scultura ed i confronti con altre strutture simili e coeve rinvenute nel sito di Gortina, con particolare attenzione alla comune tecnica costruttiva.

Diavolo di una particella perchè il bosone di Higgs cambierà la nostra vita

CERN Document Server

Menasce, Dario

2013-01-01

Lo scienziato del Cern Dario Menasce ha partecipato direttamente agli esperimenti che hanno condotto alla scoperta del Bosone di Higgs, ma , prima di condurre il lettore all'interno dell'LHC e dei suoi misteri, con coinvolgimento e grande serietà guida il lettore attraverso i momenti più importanti delle ricerche della fisica tramite l'intervento dei grandi scienziati del passato e del presente, che hanno infine permesso di arrivare a definire il Modello Standard delle particelle, il primo passo verso l'ipotetica Teoria del Tutto. Un testo molto utile per chi vuole sondare il mondo dell'ultrasottile, che riprendo in più occasioni anche come manuale di consultazione e approfondimento.

Traçando diferentes linhas para o balé: perspectivas políticas do movimento do coreógrafo William Forsythe (1949

Directory of Open Access Journals (Sweden)

Rousejanny Silva Ferreira

2017-05-01

Full Text Available Este artigo problematiza a feitura e sentidos do balé na contemporaneidade a partir do diálogo entre os estudos da dança e da performance. Como norte desta pesquisa, recorro ao pesquisador André Lepecki para traçar algumas linhas políticas do movimento na dança cênica, focando na expressão do balé e seu desenvolvimento potencial com o coreógrafo norte americano William Forsythe, a frente do Frankfurt Ballet na década de 1990. Forsythe problematizou pontos conceituais e composicionais do balé que desencadearam uma série de questões sobre o modo de entendê-lo na contemporaneidade. ABSTRACT This article discusses the making and contemporary ballet's senses from the dialogue between dance and performance studies. As North of this research, turn to the researcher André Lepecki to plot some political lines of movement in scenic dance, focusing on expression of the ballet and its development potential with the American choreographer William Forsythe, the Frankfurt Ballet in late 1990. Forsythe discussed conceptual and compositional points of the Ballet that triggered a series of questions on how to understand him in contemporary times. KEYWORDS: Ballet; dance studies; William Forsythe.

Identification of a transformer homolog in the acorn worm, Saccoglossus kowalevskii, and analysis of its activity in insect cells.

Science.gov (United States)

Suzuki, Masataka G; Tochigi, Mayuko; Sakaguchi, Honami; Aoki, Fugaku; Miyamoto, Norio

2015-06-01

The transformer (tra) gene is an intermediate component of the sex determination hierarchy in many insect species. The homolog of tra is also found in two branchiopod crustacean species but is not known outside arthropods. We have isolated a tra homolog in the acorn worm, Saccoglossus kowalevskii, which is a hemichordate belonging to the deuterostome superphylum. The full-length complementary DNA (cDNA) of the S. kowalevskii tra homolog (Sktra) has a 3786-bp open reading frame that encodes a 1261-amino acid sequence including a TRA-CAM domain and an arginine/serine (RS)-rich domain, both of which are characteristic of TRA orthologs. Reverse transcription PCR (RT-PCR) analyses demonstrated that Sktra showed no differences in expression patterns between testes and ovaries, but its expression level was approximately 7.5-fold higher in the testes than in the ovaries. TRA, together with the protein product of the transformer-2 (tra-2) gene, assembles on doublesex (dsx) pre-messenger RNA (mRNA) via the cis-regulatory element, enhancing female-specific splicing of dsx in Drosophila. To understand functional conservation of the SkTRA protein as a dsx-splicing activator, we investigated whether SkTRA is capable of inducing female-specific splicing of the Drosophila dsx. Ectopic expression of Sktra cDNA in insect cultured cells did not induce the female-specific splicing of dsx. On the other hand, forced expression of Sktra-2 (a tra-2 homolog of S. kowalevskii) was able to induce the female-specific dsx splicing. These results demonstrate that the function as a dsx-splicing activator is not conserved in SkTRA even though SkTRA-2 is capable of functionally replacing the Drosophila TRA-2. We have also found a tra homolog in an echinoderm genome. This study provides the first evidence that that tra is conserved not only in arthropods but also in basal species of deuterostoms.

Utilização da tração halo-craniana pré-operatória no tratamento de deformidades vertebrais de alto valor angular Uso de tracción halo gravitacional en el tratamiento quirúrgico de las deformidades graves de la columna vertebral Halo gravity preoperative traction in severe spine deformities treatment

Directory of Open Access Journals (Sweden)

Maximiliano Aguiar Porto

2010-09-01

Full Text Available OBJETIVOS: avaliar o resultado do tratamento cirúrgico das deformidades acentuadas da coluna vertebral por meio da utilização da tração halo-gravitacional. MÉTODOS: foram estudados 17 pacientes portadores de diferentes patologias (6 congênitas, 2 pós-neoplasia, 2 neurofibromatoses, 1 idiopática, 1 raquitismo e 5 neuromusculares submetidos a cirurgia para correção de deformidade de alto valor angular na coluna vertebral. A idade no momento da cirurgia variou de 6 a 26 anos (média de 13,75 anos±4,5. Os parâmetros clínicos avaliados foram o sexo, a idade, o tempo e o peso da tração. Os parâmetros radiográficos estudados foram: a medida da escoliose, da cifose e a altura da coluna vertebral. Os parâmetros radiográficos foram avaliados no período pré-operatório, durante a tração, e no pós-operatório. RESULTADOS: o tempo de tração variou de 14 a 106 dias (34,5±20,83 e a porcentagem de peso da tração em relação ao peso corporal variou de 12,5 a 50% (30%±9,36. A média inicial das escolioses foi de 98,6±25,7º(medida Cobb, reduzido para 83,5º±28,5º durante a tração e para 77º±29,4º no pós-operatório, com a média de correção de 27º, sendo 63% destes ocorridos no período do uso do halo. A média inicial da cifose foi de 86,3±32,08º (Cobb, reduzido para 62,2º±19,9º durante a tração e para 60º±20,9º no pós-operatório, com a média de correção de 26º, sendo 92% durante a tração. CONCLUSÃO: o tratamento cirúrgico das deformidades acentuadas da coluna vertebral, por meio da tração halo-gravitacional pré-operatória, é um método que melhora o ângulo de Cobb reduzindo a correção aguda intraoperatória assim como seus riscos de lesão neurológica.OBJETIVOS: evaluar el resultado del tratamiento quirúrgico en deformidades graves de la columna vertebral con el uso de tracción halo gravitacional. MÉTODOS: fueron estudiados 17 pacientes portadores de diferentes patologías (seis cong

The Social Service between Values and Welfare Policies (Il Servizio Sociale tra Valori e Politiche di Welfare

Directory of Open Access Journals (Sweden)

Francesca D'Atri

2017-07-01

Full Text Available Main values of social work guide and select the everyday work of professional social worker, within institutional and non-institutional contexts, for people and with people facing different conditions of fragility and poverty, acting more innovative intervention strategies that respond to the real needs of the individual, the family system and, in general terms, the local community. In such a perspective, SIA (Support for Active Inclusion is a measure of poverty alleviation which provides for economic benefits to families in poor economic situations. To enjoy this benefit, the applicant's family will have to attend a personalized social and employing activation project, through a pact between services and families, aimed to overcoming poverty and gradually regaining autonomy. Sunto I valori che sono alla base del servizio sociale guidano e orientano il lavoro dell’assistente sociale che quotidianamente opera, all’interno di contesti sia istituzionali che non istituzionali, con le persone e per le persone per il superamento delle situazioni di fragilità e povertà, mettendo in atto strategie d’intervento sempre più innovative e rispondenti ai reali bisogni dell’individuo, del sistema familiare e, in termini più generali, della comunità locale. In quest’ottica il SIA (sostegno per l’inclusione attiva è una misura di contrasto alla povertà che prevede l’erogazione di un beneficio economico alle famiglie in condizioni economiche disagiate. Per godere di questo beneficio, il nucleo familiare del richiedente dovrà aderire ad un progetto personalizzato di attivazione sociale e lavorativa, tramite un patto tra servizi e famiglie, teso al superamento della condizione di povertà e alla  riconquista graduale dell’autonomia. Parole chiave: Valori, Servizio Sociale, Povertà, Famiglia, Progetto

Traça Tuta absoluta (Meyrick em cultivares de tomateiro tratadas com extratos aquosos de Trichilia pallida Swartz Tuta absoluta (Meyrick on tomato cultivars treated with aqueous extracts of Trichilia pallida Swartz

Directory of Open Access Journals (Sweden)

José Djair Vendramim

2001-09-01

Full Text Available A traça Tuta absoluta (Meyrick é atualmente uma das principais pragas do tomateiro no Brasil. Com o objetivo de obter um método de controle eficiente e não poluente, avaliou-se a atividade dos extratos aquosos de folhas e ramos de Trichilia pallida Swartz associados a duas cultivares de tomateiro (Santa Clara e IPA-5 sobre essa praga. Acompanhou-se o desenvolvimento do inseto em folhas de cada uma das cultivares previamente submersas nos extratos a 1% de concentração, avaliando-se a duração e viabilidade das fases larval e pupal e o peso de pupas. A cultivar IPA-5 provocou alongamento da fase larval e, quando associada aos extratos de folhas e de ramos, reduziu a viabilidade pupal do inseto. Os extratos de folhas e de ramos também alongaram o período larval de T. absoluta, na cultivar Santa Clara. O extrato de folhas foi mais prejudicial ao desenvolvimento da traça do que o extrato de ramos dessa planta, reduzindo a viabilidade larval em ambas as cultivares.The tomato pinworm Tuta absoluta (Meyrick is one of the main tomato pests in Brazil. With the objective of obtaining an efficient and not pollutant method of control, the activity of aqueous extracts of Trichilia pallida Swartz leaves and twigs on this pest was studied associated to the tomato cultivars Santa Clara and IPA-5. The development of the insect was observed on leaves of each cultivar, previously treated with extracts at 1% of concentration. Length and viability of larval and pupal stages and pupal weight were evaluated. The larval period of the insect was more prolonged on 'IPA-5' and, when associated with leaf and twig extracts, reduced pupal viability. Leaf and twig extracts also prolonged the larval stage in 'Santa Clara'. The leaf extract affected more negatively the insect development than the twig extract, reducing larval viability on both cultivars.

Quorum-Dependent Mannopine-Inducible Conjugative Transfer of an Agrobacterium Opine-Catabolic Plasmid

Science.gov (United States)

Wetzel, Margaret E.; Kim, Kun-Soo; Miller, Marilyn; Olsen, Gary J.

2014-01-01

The Ti plasmid in Agrobacterium tumefaciens strain 15955 carries two alleles of traR that regulate conjugative transfer. The first is a functional allele, called traR, that is transcriptionally induced by the opine octopine. The second, trlR, is a nonfunctional, dominant-negative mutant located in an operon that is inducible by the opine mannopine (MOP). Based on these findings, we predicted that there exist wild-type agrobacterial strains harboring plasmids in which MOP induces a functional traR and, hence, conjugation. We analyzed 11 MOP-utilizing field isolates and found five where MOP induced transfer of the MOP-catabolic element and increased production of the acyl-homoserine lactone (acyl-HSL) quormone. The transmissible elements in these five strains represent a set of highly related plasmids. Sequence analysis of one such plasmid, pAoF64/95, revealed that the 176-kb element is not a Ti plasmid but carries genes for catabolism of MOP, mannopinic acid (MOA), agropinic acid (AGA), and the agrocinopines. The plasmid additionally carries all of the genes required for conjugative transfer, including the regulatory genes traR, traI, and traM. The traR gene, however, is not located in the MOP catabolism region. The gene, instead, is monocistronic and located within the tra-trb-rep gene cluster. A traR mutant failed to transfer the plasmid and produced little to no quormone even when grown with MOP, indicating that TraRpAoF64/95 is the activator of the tra regulon. A traM mutant was constitutive for transfer and acyl-HSL production, indicating that the anti-activator function of TraM is conserved. PMID:24363349

Acylsugars in tomato leaflets confer resistance to the South American tomato pinworm, Tuta absoluta Meyr Acilaçúcares presentes em folíolos de tomateiro conferem resistência à traça do tomateiro, Tuta absoluta Meyr

Directory of Open Access Journals (Sweden)

Juliano Tadeu Vilela de Resende

2006-02-01

'LA-716'. Na população F2 foram selecionados 4 genótipos com alto teor de acilaçúcares e um com baixo teor. Esses genótipos seleccionados, juntamente com as linhagens parentais e as testemunhas TOM-600 (linhagem com alto teor de 2-tridecanona e resistente a T. absoluta e TOM-556 (linhagem com baixo teor de acilaçúcares foram submetidos à infestação natural da traça no campo e avaliados quanto a danos na planta, lesões nos folíolos e porcentagem de folíolos atacados. Na população F2RC1 [=(Lycopersicon esculentum 'TOM-584' ´ F2] foram selecionados 4 genótipos com altos teores de acilaçúcares nos folíolos e dois genótipos com baixos teores. Esses genótipos, juntamente com as linhagens parentais e as testemunhas, foram submetidos à infestação em gaiolas, em casa de vegetação. Avaliou-se a ovoposição da traça, os danos na planta e lesões1nos folíolos. Os genótipos F2 BPX-370Bpl#25, BPX- 370Bpl#30, BPX-370Bpl#79 e F2RC1 BPX-370B pl#30-380 e BPX-370B pl#30-271, a exemplo do acesso selvagem LA-716, demonstraram bons níveis de resistência. Com o aumento do tempo de exposição à traça, o efeito dos acilaçúcares nos folíolos mostrou- se mais efetivo. Os teores de acilaçúcares mostraram-se alta e negativamente correlacionados com as características avaliadas, relacionadas à resistência à traça.

ÉTUDE DE CAS — Équateur : Apprendre à partager les ressources ...

International Development Research Centre (IDRC) Digital Library (Canada)

15 déc. 2010 ... Les forêts des nuages qui jouxtent le páramo font partie des écosystèmes andins les plus rares — 60 % des diverses espèces végétales qui y vivent ne se .... Cette action concertée, et la prise de conscience par les autorités d'Espejo des répercussions de leurs gestes, ont permis dès lors de surveiller plus ...

167 Biologie de reproduction du cerf de Barbarie (Cervus elaphus ...

African Journals Online (AJOL)

oumani

Résumé. La biologie de reproduction des cerfs de Barbarie (Cervus elaphus barabrus) a été étudiée dans le parc d'El Feidja et la réserve de Mhebès sur des populations qui vivent respectivement en état de captivité et semi captivité. Il ressort de cette étude que la période de rut débute en fin août-début septembre.

Truth and Philology. Prolegomena to a critical-historicist theory of a neo-humanism

Directory of Open Access Journals (Sweden)

Giuseppe Cacciatore

2011-11-01

Full Text Available Basando le sue riflessioni su di un’attenta analisi dell’opera di Said e di Auerbach, non dimenticando di toccare i punti essenziali della filosofia vichiana, riferimento imprescindibile per entrambi i pensatori, l’A. indica nella modalità conoscitiva propria della filologia vivente – intesa come scienza storica – uno strumento efficace per sviluppare e sostenere un pensiero critico autonomo non pedissequo verso la tradizione e diretto a costituire il nerbo fondativo di un nuovo umanesimo.

Dye tracer and morphophysical properties to observe water flow in a Gleyic Luvisol Fluxo de água em um Gleyic Luvisol usando traçador e sua relação com as propriedades físicas e morfológicas do solo

Directory of Open Access Journals (Sweden)

Monica Martins Silva Salvador

2011-04-01

Full Text Available The understanding of the preferential water flow and solute transport is important with regard to losses of nutrients and pesticides that affect the quality of the groundwater or surface water resources. Experiments using the brilliant blue dye tracer, a tension infiltrometer (TI and a double square infiltrometer (DI were carried out in the experimental field site located around 15 km southeast of the city of Rostock (North-Eastern Germany on arable land in a Pleistocene lowland landscape where corn (Zea mays L. and barley (Hordeum spp. had been cultivated. One day after dye the infiltration, a pit was dug and vertical profiles were prepared in the TI and DI sites to assess the dye pathways in the subsoil of a Gleyic Luvisol. We wanted to examine if the mottled red and white (bleached colour-pattern of the Gleyic Luvisol subsoil resulting from temporally stagnant water could be related to flow paths as visualized by dye tracing and if the soil colour could be related to other physical soil properties. Biogenic soil structures were the main transport routes conducting water and solutes into great depth in short time. These pathways had lower bulk density and less cone resistance than the adjacent red or white (bleached areas of the Gleyic Luvisol subsoil. The red areas were involved in transport because their water contents increased after as compared to before infiltration. However, the measured physical soil properties did not differ between white and red areas. We assume that red areas participate in transport at least by imbibing water from the adjacent biogenic flow paths.O fluxo preferencial de água e o transporte de solutos relacionam-se com perdas de nutrientes e pesticidas e afetam a qualidade de águas subterrâneas. Foram realizados experimentos utilizando o traçador Brilhante Blue, um infiltrômetro de tensão (TI e um infiltrômetro com "duplos quadrados" (DI num campo experimental localizado a cerca de 15 km a sudeste da cidade de

Prognostic value of transformer 2β expression in prostate cancer.

Science.gov (United States)

Diao, Yan; Wu, Dong; Dai, Zhijun; Kang, Huafeng; Wang, Ziming; Wang, Xijing

2015-01-01

Deregulation of transformer 2β (Tra2β) has been implicated in several cancers. However, the role of Tra2β expression in prostate cancer (PCa) is unclear. Therefore, this study was to investigate the expression of Tra2β in PCa and evaluated its association with clinicopathological variables and prognosis. Thirty paired fresh PCa samples were analyzed for Tra2β expression by Western blot analysis. Immunohistochemistry (IHC) assay was performed in 160 PCa samples after radical prostatectomy and adjacent non-cancerous tissues. Tra2β protein expression was divided into high expression group and low expression group by IHC. We also investigated the association of Tra2β expression with clinical and pathologic parameters. Kaplan-Meier plots and Cox proportional hazards regression model were used to analyze the association between Tra2β protein expression and prognosis of PCa patients. Our results showed that Tra2β was significantly upregulated in PCa tissues by western blot and IHC. Our data indicated that high expression of Tra2β was significantly associated with lymph node metastasis (P=0.002), clinical stage (P=0.015), preoperative prostate-specific antigen (P=0.003), Gleason score (P=0.001), and biochemical recurrence (P=0.021). High Tra2β expression was a significant predictor of poor biochemical recurrence free survival and overall survival both in univariate and multivariate analysis. We show that Tra2β was significantly upregulated in PCa patients after radical prostatectomy, and multivariate analysis confirmed Tra2β as an independent prognostic factor.

Force Field Benchmark of the TraPPE_UA for Polar Liquids: Density, Heat of Vaporization, Dielectric Constant, Surface Tension, Volumetric Expansion Coefficient, and Isothermal Compressibility.

Science.gov (United States)

Núñez-Rojas, Edgar; Aguilar-Pineda, Jorge Alberto; Pérez de la Luz, Alexander; de Jesús González, Edith Nadir; Alejandre, José

2018-02-08

The transferable potential for a phase equilibria force field in its united-atom version, TraPPE_UA, is evaluated for 41 polar liquids that include alcohols, thiols, ethers, sulfides, aldehydes, ketones, and esters to determine its ability to reproduce experimental properties that were not included in the parametrization procedure. The intermolecular force field parameters for pure components were fit to reproduce experimental boiling temperature, vapor-liquid coexisting densities, and critical point (temperature, density, and pressure) using Monte Carlo simulations in different ensembles. The properties calculated in this work are liquid density, heat of vaporization, dielectric constant, surface tension, volumetric expansion coefficient, and isothermal compressibility. Molecular dynamics simulations were performed in the gas and liquid phases, and also at the liquid-vapor interface. We found that relative error between calculated and experimental data is 1.2% for density, 6% for heat of vaporization, and 6.2% for surface tension, in good agreement with the experimental data. The dielectric constant is systematically underestimated, and the relative error is 37%. Evaluating the performance of the force field to reproduce the volumetric expansion coefficient and isothermal compressibility requires more experimental data.

Application of the Spielberger's State-Trait Anger Expression Inventory in clinical patients Aplicação do inventário de expressão de raiva estado-traço de Spielberger em pacientes clínicos

Directory of Open Access Journals (Sweden)

Flávia Barros de Azevedo

2010-04-01

Full Text Available OBJECTIVE: To examine the factor structure of the Portuguese version of State-Trait Anger Expression Inventory (STAXI in clinical patients. METHOD: 400 subjects from an internal medicine outpatient unit and 200 from a medical ward were recruited. Patients answered questions about clinical data, the STAXI, and the Beck Depression Inventory (BDI. Raw score of the STAXI was submitted to reliability assessment and factor analysis. RESULTS: Internal consistency using the Cronbach's alpha coefficient was of 0.84. The STAXI significantly correlated with BDI at r=0.352 (pOBJETIVO: Avaliar o construto e as propriedades psicométricas da versão em português do Inventário de Expressão de Raiva Estado-Traço (STAXI em pacientes clínicos. MÉTODO: 400 indivíduos de uma unidade ambulatorial e 200 de uma enfermaria de clínica médica foram recrutados. Foram coletadas informações sobre aspectos clínicos, o STAXI e o Inventário de Depressão de Beck (BDI. Os escores brutos do STAXI foram submetidos à análise de confiabilidade e análise fatorial. RESULTADOS: A consistência interna pelo coeficiente alfa de Cronbach foi de 0,84. O STAXI se correlacionou significativamente com BDI (r=0,352; p<0,01. A análise de Componentes Principais identificou cinco fatores significativos: Raiva-traço, Raiva-estado, Controle-de-raiva, Raiva-para-fora e Raiva-para-dentro. Esse modelo estrutural é similar ao apresentado originalmente por Spielberger. CONCLUSÃO: A versão em português do STAXI apresenta uma estrutura fatorial adequada que permite a avaliação das dimensões da raiva em pacientes clínicos.

The Sex Determination Gene transformer Regulates Male-Female Differences in Drosophila Body Size.

Science.gov (United States)

Rideout, Elizabeth J; Narsaiya, Marcus S; Grewal, Savraj S

2015-12-01

Almost all animals show sex differences in body size. For example, in Drosophila, females are larger than males. Although Drosophila is widely used as a model to study growth, the mechanisms underlying this male-female difference in size remain unclear. Here, we describe a novel role for the sex determination gene transformer (tra) in promoting female body growth. Normally, Tra is expressed only in females. We find that loss of Tra in female larvae decreases body size, while ectopic Tra expression in males increases body size. Although we find that Tra exerts autonomous effects on cell size, we also discovered that Tra expression in the fat body augments female body size in a non cell-autonomous manner. These effects of Tra do not require its only known targets doublesex and fruitless. Instead, Tra expression in the female fat body promotes growth by stimulating the secretion of insulin-like peptides from insulin producing cells in the brain. Our data suggest a model of sex-specific growth in which body size is regulated by a previously unrecognized branch of the sex determination pathway, and identify Tra as a novel link between sex and the conserved insulin signaling pathway.

The Sex Determination Gene transformer Regulates Male-Female Differences in Drosophila Body Size.

Directory of Open Access Journals (Sweden)

Elizabeth J Rideout

2015-12-01

Full Text Available Almost all animals show sex differences in body size. For example, in Drosophila, females are larger than males. Although Drosophila is widely used as a model to study growth, the mechanisms underlying this male-female difference in size remain unclear. Here, we describe a novel role for the sex determination gene transformer (tra in promoting female body growth. Normally, Tra is expressed only in females. We find that loss of Tra in female larvae decreases body size, while ectopic Tra expression in males increases body size. Although we find that Tra exerts autonomous effects on cell size, we also discovered that Tra expression in the fat body augments female body size in a non cell-autonomous manner. These effects of Tra do not require its only known targets doublesex and fruitless. Instead, Tra expression in the female fat body promotes growth by stimulating the secretion of insulin-like peptides from insulin producing cells in the brain. Our data suggest a model of sex-specific growth in which body size is regulated by a previously unrecognized branch of the sex determination pathway, and identify Tra as a novel link between sex and the conserved insulin signaling pathway.

Preface: The Oligotrophy to the UlTra-oligotrophy PACific Experiment (OUTPACE cruise, 18 February to 3 April 2015)

Science.gov (United States)

Moutin, Thierry; Michelangelo Doglioli, Andrea; de Verneil, Alain; Bonnet, Sophie

2017-07-01

The overall goal of OUTPACE (Oligotrophy to UlTra-oligotrophy PACific Experiment) was to obtain a successful representation of the interactions between planktonic organisms and the cycle of biogenic elements in the western tropical South Pacific Ocean across trophic and N2 fixation gradients. Within the context of climate change, it is necessary to better quantify the ability of the oligotrophic ocean to sequester carbon through biological processes. OUTPACE was organized around three main objectives, which were (1) to perform a zonal characterization of the biogeochemistry and biological diversity of the western tropical South Pacific during austral summer conditions, (2) to study the production and fate of organic matter (including carbon export) in three contrasting trophic regimes (increasing oligotrophy) with a particular emphasis on the role of dinitrogen fixation, and (3) to obtain a representation of the main biogeochemical fluxes and dynamics of the planktonic trophic network. The international OUTPACE cruise took place between 18 February and 3 April 2015 aboard the RV L'Atalante and involved 60 scientists (30 onboard). The west-east transect covered ˜ 4000 km from the western part of the Melanesian archipelago (New Caledonia) to the western boundary of the South Pacific gyre (French Polynesia). Following an adaptive strategy, the transect initially designed along the 19° S parallel was adapted along-route to incorporate information coming from satellite measurements of sea surface temperature, chlorophyll a concentration, currents, and diazotroph quantification. After providing a general context and describing previous work done in this area, this introductory paper elucidates the objectives of OUTPACE, the implementation plan of the cruise and water mass and climatological characteristics and concludes with a general overview of the other papers that will be published in this special issue.

Choice of tracers for the evaluation of spray deposits Escolha de traçadores para avaliação de depósitos de pulverização

Directory of Open Access Journals (Sweden)

Luiz Antonio Palladini

2005-10-01

Full Text Available Tracer substances, used to evaluate spraying effectiveness, ordinarily modify the surface tension of aqueous solutions. This study aimed to establish a method of using tracers to evaluate distribution and amount of spray deposits, adjusted to the surface tension of the spraying solution. The following products were tested: 0.15% Brilliant Blue, 0.15% Saturn Yellow in 0.015% Vixilperse lignosulfonate, and 0.005% sodium fluorescein, and mixtures of Brilliant Blue plus Saturn Yellow and Brilliant Blue plus sodium fluorescein at the same concentrations. Solutions were deposited on citrus leaves and stability was determined by measuring fluorescence and optical density of solutions without drying, dried in the dark and exposed to sunlight for 2, 4 and 8 h. These values were compared to those obtained directly in water. The static surface tension of the tracer solution was determined by weighing droplets formed during a period of 20 to 40 seconds. The Brilliant Blue and Saturn Yellow mixture at 0.15% was stable under all conditions tested. It was not absorbed by the leaves and maintained the same surface tension as that of water, thus permitting concentration adjustment to the same levels used for agrochemical products, and allowing the development of a qualitative method based on visual evaluation of the distribution of the pigment under ultraviolet light and of a quantitative method based on the determination of the amount of the dye deposited in the same solution. Spray deposition could be evaluated at different surface tensions of the spraying solution, simulating the effect of agrochemical formulations.As substâncias traçadoras são usadas para avaliar a eficácia de pulverizações mas, normalmente, elas modificam a tensão superficial de soluções aquosas. O trabalho objetivou definir um método para avaliar a distribuição e a quantidade de produto depositada em pulverizações, utilizando-se substâncias traçadoras, com a possibilidade

An atlas of classification. Signage between open shelves, the Web and the catalogue

Directory of Open Access Journals (Sweden)

Andrea Fabbrizzi

2014-05-01

Questa segnaletica è fondata sulla comunicazione cross-mediale, e integra le modalità comunicative della biblioteca a vari livelli, sia nel contesto dello stesso medium, sia tra media diversi: tra i cartelli sulle testate degli scaffali, tra questi cartelli e il sito web della biblioteca, tra il sito web e il catalogo. Per questo sistema integrato sono particolarmente adatti i dispositivi mobili come i tablet e gli smartphone, perché danno la possibilità di accedere al Web mentre ci si muove tra gli scaffali. Il collegamento diretto tra gli scaffali aperti classificati e il catalogo è reso possibile dai codici QR stampati sui cartelli.

Meccanica quantistica e senso comune

CERN Document Server

Albert, David Z

2002-01-01

Come base di una tecnologia di consumo che comprende il laser e il transistor, la meccanica quantistica è tutt'altro che nuova (il "quanto di energia" è familiare anche ai profani), e resta però, nei suoi fondamenti concettuali, un enigma inquietante. Visti da vicino, i fenomeni più semplici pongono continue sfide alla logica e al senso comune, e se la scoperta da parte di Einstein che lo spazio e il tempo sono di fatto un "continuum" deformabile colse il mondo di sorpresa, la nuova meccanica, rivelando un elemento di incertezza e di imprevedibilità al fondo delle cose, fu un vero e proprio trauma, dal quale la fisica non si è mai del tutto ripresa.

Utility of the theory of reasoned action and theory of planned behavior for predicting Chinese adolescent smoking.

Science.gov (United States)

Guo, Qian; Johnson, C Anderson; Unger, Jennifer B; Lee, Liming; Xie, Bin; Chou, Chih-Ping; Palmer, Paula H; Sun, Ping; Gallaher, Peggy; Pentz, MaryAnn

2007-05-01

One third of smokers worldwide live in China. Identifying predictors of smoking is important for prevention program development. This study explored whether the Theory of Reasoned Action (TRA) and Theory of Planned Behavior (TPB) predict adolescent smoking in China. Data were obtained from 14,434 middle and high school students (48.6% boys, 51.4% girls) in seven geographically varied cities in China. TRA and TPB were tested by multilevel mediation modeling, and compared by multilevel analyses and likelihood ratio tests. Perceived behavioral control was tested as a main effect in TPB and a moderation effect in TRA. The mediation effects of smoking intention were supported in both models (p<0.001). TPB accounted for significantly more variance than TRA (p<0.001). Perceived behavioral control significantly interacted with attitudes and social norms in TRA (p<0.001). Therefore, TRA and TPB are applicable to China to predict adolescent smoking. TPB is superior to TRA for the prediction and TRA can better predict smoking among students with lower than higher perceived behavioral control.

Multiple assessment of the soil cover in the area of natural monuments Tra-Tau and Yurak-Tau monadnocks under conditions of technogenic loads

Science.gov (United States)

Gabbasova, I. M.; Suleymanov, R. R.; Khabirov, I. K.; Komissarov, M. A.; Garipov, T. T.; Sidorova, L. V.; Nazyrova, F. I.

2014-02-01

The soil cover of Tra-Tau and Yurak-Tau shikhans (monadnocks) has been examined. Leached and typical medium-deep chernozems are developed on colluvial fans on the footslopes and on the lower parts of slopes, whereas typical calcareous thin slightly and moderately gravelly chernozems are developed on the upper and medium parts of slopes. The leached and typical chernozems of the footslopes correspond to zonal soils of the adjacent plain areas, though they have some specific features related to the local topographic conditions. These soils are somewhat thinner than plain chernozems and are characterized by the perfect granular water-stable structure, the high content of humus of the humate type, the high content of exchangeable cations, strong acid-base buffering, and high enzymatic activity. These features predetermine their high tolerance towards technogenic impacts. The concentrations of highly hazardous substances of the first toxicity class (mercury, arsenic, lead, and cadmium) and of moderately hazardous substances of the second toxicity class (copper, zinc, and nickel), as well as the concentrations of low-hazardous elements (manganese and iron) in these soils do not exceed provisional maximum permissible concentrations of these substances in soils irrespectively of the slope aspect. No changes in the physicochemical and biological properties of the soils under the impact of technogenic loads from Sterlitamak industrial center have been identified.

Outcomes of patients with chronic lung disease and severe aortic stenosis treated with transcatheter versus surgical aortic valve replacement or standard therapy: insights from the PARTNER trial (placement of AoRTic TraNscathetER Valve).

Science.gov (United States)

Dvir, Danny; Waksman, Ron; Barbash, Israel M; Kodali, Susheel K; Svensson, Lars G; Tuzcu, E Murat; Xu, Ke; Minha, Sa'ar; Alu, Maria C; Szeto, Wilson Y; Thourani, Vinod H; Makkar, Raj; Kapadia, Samir; Satler, Lowell F; Webb, John G; Leon, Martin B; Pichard, Augusto D

2014-01-28

The study aimed to evaluate the impact of chronic lung disease (CLD) on outcomes of severe aortic stenosis patients across all treatment modalities. Outcomes of patients with CLD undergoing transcatheter aortic valve replacement (TAVR) have not been systematically examined. All patients who underwent TAVR in the PARTNER (Placement of AoRTic TraNscathetER Valve) trial, including the continued access registry (n = 2,553; 1,108 with CLD), were evaluated according to CLD clinical severity. Additionally, outcomes of CLD patients included in the randomization arms of the PARTNER trial were compared: Cohort A patients (high-risk operable) treated by either TAVR (n = 149) or surgical aortic valve replacement (SAVR); (n = 138); and Cohort B patients (inoperable) treated by either TAVR (n = 72) or standard therapy only (n = 95). Among all TAVR-treated patients, at 1-year follow-up, patients with CLD had higher mortality than those without it (23.4% vs. 19.6%, p = 0.02). Baseline characteristics of CLD patients who underwent TAVR were similar to respective controls. In Cohort A, 2-year all-cause death rates were similar (TAVR 35.2% and SAVR 33.6%, p = 0.92), whereas in Cohort B, the death rate was lower after TAVR (52.0% vs. 69.6% after standard therapy only, p = 0.04). Independent predictors for mortality in CLD patients undergoing TAVR included poor mobility (6-min walk test CLD patients undergoing TAVR have worse outcomes than patients without CLD, TAVR is better in these patients than standard therapy and is similar to SAVR. Although patients with CLD undergoing TAVR had worse outcomes than patients without CLD, TAVR performed better in these patients than standard therapy and was similar to SAVR. However, CLD patients who were either poorly mobile or oxygen-dependent had poor outcomes. (THE PARTNER TRIAL: Placement of AoRTic TraNscathetER Valve Trial; NCT00530894). Copyright © 2014 American College of Cardiology Foundation. Published by Elsevier Inc. All rights

AcEST: DK948281 [AcEST

Lifescience Database Archive (English)

Full Text Available r|A9TMK2|A9TMK2_PHYPA Predicted protein OS=Physcomitrella paten... 87 7e-16 tr|A9ZPL1|A9ZPL1_WHEAT Agmatin...e coumaroyltransferase (Fragment) ... 84 6e-15 tr|A9ZPJ9|A9ZPJ9_WHEAT Agmatine coum...aroyltransferase (Fragment) ... 84 6e-15 tr|A9ZPK0|A9ZPK0_WHEAT Agmatine coumaroyltransferase (Fragment) ...... 84 8e-15 tr|A9ZPK8|A9ZPK8_WHEAT Agmatine coumaroyltransferase (Fragment) ... 83 ...2e-14 tr|A9ZPL0|A9ZPL0_WHEAT Agmatine coumaroyltransferase (Fragment) ... 82 2e-14 tr|A9ZPK4|A9ZPK4_WHEAT Agmatine

The interaction between electricity, heat and gas in a tradable green certificate system. Paper for the analysis phase of InTraCert

International Nuclear Information System (INIS)

Boots, M.G.; Schaeffer, G.J.; De Zoeten, C.

2001-08-01

The InTraCert project aims to explore the possibility of integrating the existing and planned Tradable Green Certificate (TGC) schemes in the European Union and, therefore, creating a plausible unified market for TGCs. In particular, attention was paid to the possibilities of integrating TGCs for green electricity, green heat and biogas. Specific issues at stake when taking green heat and biogas into account in a green certificate system were analyzed. The analysis shows that production-based issuing of certificates is preferred, although for practical reasons it is easier to start with grid-based (and 'electricity-only') certificates. Conversion between different certificates and units are of main concern when green heat and biogas are included in the system. The kWh seems to be a convenient unit to issue the certificates. It should be possible to exchange certificates for new certificates, i.e. 'redemption for conversion' (conversion of the certificates in parallel with the conversion of the physical energy flow), as opposed to the redemption of certificates to fulfil an obligation. Mandatory demand, or the obligation, should suitably be put on consumers and stated in general terms. The consumer may then decide on the preferred energy mix to fulfil his obligation. Countries may allow for the possibility to comply with the obligation using foreign certificates and restrict the import of TGCs that they judge to be unacceptable. However, for substantial international trade to take place, some harmonisation, e.g. for issuing certificates, is required. 6 refs

[Expression analysis of a transformer gene in Daphnia pulex after RNAi].

Science.gov (United States)

Guo, C Y; Chen, P; Zhang, M M; Ning, J J; Wang, С L; Wang, D L; Zhao, Y L

2016-01-01

In order to explore the importance of the transformer (tra) gene in reproductive mode switching in Daphnia pulex, we studied the effect of silencing of this gene using RNA interference (RNAi). We obtained Dptra dsRNA by constructing and using a dsRNA expression vector and transcription method in vitro. D. pulex individuals in different reproductive modes were treated by soaking in a solution of Dptra dsRNA. We then assayed the expression of the endogenous Dptra mRNA after RNAi treatment using RT-PCR and obtained the suppression ratio. Expression of the tra gene in the RNAi groups was down-regulated compared with the controls after 16 h (p < 0.05). We also analyzed the effect of RNAi on the expression of the TRA protein using Western blot, which showed that the expression level of the TRA protein was reduced after RNAi treatment. Our experimental results showed that soaking of D. pulex adults in tra-specific dsRNA transcribed in vitro can specifically reduce the level of tra mRNA and also reduce the expression of the TRA protein, demonstrating effective in vivo silencing of the tra gene.

Inseticidas para controle da traça-das-crucíferas: como os agricultores os utilizam no Distrito Federal?

Directory of Open Access Journals (Sweden)

Castelo Branco Marina

2002-01-01

Full Text Available No DF, o controle da traça-das-crucíferas (TDC é feito por inseticidas. O modo de utilização destes produtos em lavouras de brássicas não é bem documentado. Devido a isto, agricultores de duas áreas de produção foram entrevistados e descreveram as formas de utilização de agrotóxicos em seus cultivos. Doze produtos comerciais diferentes, pertencentes a cinco grupos químicos, eram utilizados. Cinco inseticidas não eram registrados para brássicas. Trinta e oito por cento dos agricultores usavam agrotóxicos uma vez por semana e 21% duas vezes. Este último procedimento é considerado inadequado pois as pulverizações são consideradas excessivas. Cinqüenta e três por cento dos agricultores usavam apenas um inseticida, o que contribui para a rápida seleção de populações resistentes de TDC; 34% empregavam dois inseticidas, em rotação. Em alguns casos, a rotação era feita com produtos de grupos químicos diferentes, o recomendado; em outros, produtos comerciais, com o mesmo ingrediente ativo eram utilizados. Esta última prática não é efetiva porque não retarda a seleção de populações resistentes. A necessidade de se respeitar o período de carência dos inseticidas era desconhecida por 92% dos agricultores, o que pode significar alimentos com resíduos acima do tolerado. No geral, foi observado que os agricultores possuem poucas informações técnicas sobre os inseticidas e pouco acesso aos resultados de pesquisa. Soluções para os problemas observados são discutidas.

Substance use avoidance among Iranian male adolescents: a comparison of three versions of the theory of reasoned action.

Science.gov (United States)

Tavousi, Mahmoud; Montazeri, Ali; Hidarnia, Alireza; Hajizadeh, Ebrahim; Taremian, Farhad; Haerimehrizi, Aliasghar

2015-08-01

The theory of reasoned action (TRA) is one of the most common models in predicting health-related behaviors and is used more often in health education studies. This study aimed to add two control constructs (perceived behavioral control - PBC and self-efficacy - SE) to the TRA and compare them using the structural equation modeling (SEM) for substance use avoidance among Iranian male adolescents in order to find out which model was a better fit in predicting the intention. This was a cross-sectional study carried out in Tehran, Iran. Data were collected from a random sample of high school male students (15-19 years of age) using a questionnaire containing items related to the TRA plus items reflecting two additional constructs (SE and PBC). In all, 433 students completed the questionnaires. The results obtained from SEM indicated a better fit to the data for the TRA with SE compared to the TPB (TRA with PBC) and TRA (χ2/df=2.55, RMSEA=0.072, CFI=0.96, NFI=0.94, NNFI=0.95, SRMR=0.058). Comparing SE and PBC, the results showed that self-efficacy was a better control construct in improving the TRA and predicting substance use avoidance intention (41%). The TRA with SE had a better model fit than TPB and the original version of the TRA.

The Antinociceptive Effects of Tramadol and/or Gabapentin on Rat Neuropathic Pain Induced by a Chronic Constriction Injury.

Science.gov (United States)

Corona-Ramos, Janette Nallely; De la O-Arciniega, Minarda; Déciga-Campos, Myrna; Medina-López, José Raúl; Domínguez-Ramírez, Adriana Miriam; Jaramillo-Morales, Osmar Antonio; Espinosa-Juárez, Josué Vidal; López-Muñoz, Francisco Javier

2016-08-01

Preclinical Research The current work evaluates the interaction between two commonly used drugs, tramadol (Tra) and gabapentin (Gbp). Dose-response curves (DRC) and isobolographic analysis were used to confirm their synergistic antihyperalgesic and anti-allodynic responses in a rat neuropathic pain model involving chronic constriction injury of the sciatic nerve and in von Frey and acetone tests. Tra and Gbp produced dose-dependent antihyperalgesic and anti-allodynic effects. Dose-response studies of combinations of Tra and Gbp in combination showed the DRC was leftward-shifted compared to the DRCs for each compound alone. One combination demonstrated both antihyperalgesic and anti-allodynic effects greater than those observed after individual administration. The remaining combinations demonstrated an additive effect. The Tra+Gbp combination demonstrated a potentiative effect with smaller doses of Tra. Additionally, it was determined lethal dose 50 (LD50 ) of Tra alone and tramadol + Gbp 10 using mice to 48 h post administration. The DRC (death) were similar for Tra alone and in Tra in combination, despite the improved effectiveness of Tra in the presence of GBP, 10 mg/kg. A combination of these drugs could be effective in neuropathic pain therapy because they can produce potentiative (at a low dose) or additive effects. Drug Dev Res 77 : 217-226, 2016.   © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Poverty | La pauvreté

Directory of Open Access Journals (Sweden)

2012-05-01

Full Text Available Poverty Evolution, 1990–2010 (World Bank income categoriesEvolution de la pauvreté, 1990-2010 (catégories de revenus de la Banque mondialeSource: World Bank, World Bank GNI per Capita Operational Guidelines and Analytical Classifications, http://data.worldbank.org/about/country-classifications/a-short-history.Where the Poor Are, 2007–2008 (million of people living under USD 1.25/day, Purchasing Power Parity*Où sont les pauvres, 2007-2008 (millions de pauvres qui vivent avec moins de 1.25 U...

The Niśvāsamukha, the Introductory book of the Niśvāsatattvasaṃhitā : critical edition, with an introduction and annotated translation appended by Śivadharmasaṅgraha 5–9

NARCIS (Netherlands)

Kafle, Nirajan

2015-01-01

A single 9th-century Nepalese palm-leaf manuscript transmits what appears to be the oldest surviving Śaiva tantra, called the Niśvāsatattvasaṃhitā. The manuscript consists of five separate books: Niśvāsamukha, Mūlasūtra, Nayasūtra, Uttarasūtra and Guhyasūtra. The Niśvāsamukha, which is divided into

Chinmo prevents transformer alternative splicing to maintain male sex identity.

Science.gov (United States)

Grmai, Lydia; Hudry, Bruno; Miguel-Aliaga, Irene; Bach, Erika A

2018-02-01

Reproduction in sexually dimorphic animals relies on successful gamete production, executed by the germline and aided by somatic support cells. Somatic sex identity in Drosophila is instructed by sex-specific isoforms of the DMRT1 ortholog Doublesex (Dsx). Female-specific expression of Sex-lethal (Sxl) causes alternative splicing of transformer (tra) to the female isoform traF. In turn, TraF alternatively splices dsx to the female isoform dsxF. Loss of the transcriptional repressor Chinmo in male somatic stem cells (CySCs) of the testis causes them to "feminize", resembling female somatic stem cells in the ovary. This somatic sex transformation causes a collapse of germline differentiation and male infertility. We demonstrate this feminization occurs by transcriptional and post-transcriptional regulation of traF. We find that chinmo-deficient CySCs upregulate tra mRNA as well as transcripts encoding tra-splice factors Virilizer (Vir) and Female lethal (2)d (Fl(2)d). traF splicing in chinmo-deficient CySCs leads to the production of DsxF at the expense of the male isoform DsxM, and both TraF and DsxF are required for CySC sex transformation. Surprisingly, CySC feminization upon loss of chinmo does not require Sxl but does require Vir and Fl(2)d. Consistent with this, we show that both Vir and Fl(2)d are required for tra alternative splicing in the female somatic gonad. Our work reveals the need for transcriptional regulation of tra in adult male stem cells and highlights a previously unobserved Sxl-independent mechanism of traF production in vivo. In sum, transcriptional control of the sex determination hierarchy by Chinmo is critical for sex maintenance in sexually dimorphic tissues and is vital in the preservation of fertility.

Chinmo prevents transformer alternative splicing to maintain male sex identity.

Directory of Open Access Journals (Sweden)

Lydia Grmai

2018-02-01

Full Text Available Reproduction in sexually dimorphic animals relies on successful gamete production, executed by the germline and aided by somatic support cells. Somatic sex identity in Drosophila is instructed by sex-specific isoforms of the DMRT1 ortholog Doublesex (Dsx. Female-specific expression of Sex-lethal (Sxl causes alternative splicing of transformer (tra to the female isoform traF. In turn, TraF alternatively splices dsx to the female isoform dsxF. Loss of the transcriptional repressor Chinmo in male somatic stem cells (CySCs of the testis causes them to "feminize", resembling female somatic stem cells in the ovary. This somatic sex transformation causes a collapse of germline differentiation and male infertility. We demonstrate this feminization occurs by transcriptional and post-transcriptional regulation of traF. We find that chinmo-deficient CySCs upregulate tra mRNA as well as transcripts encoding tra-splice factors Virilizer (Vir and Female lethal (2d (Fl(2d. traF splicing in chinmo-deficient CySCs leads to the production of DsxF at the expense of the male isoform DsxM, and both TraF and DsxF are required for CySC sex transformation. Surprisingly, CySC feminization upon loss of chinmo does not require Sxl but does require Vir and Fl(2d. Consistent with this, we show that both Vir and Fl(2d are required for tra alternative splicing in the female somatic gonad. Our work reveals the need for transcriptional regulation of tra in adult male stem cells and highlights a previously unobserved Sxl-independent mechanism of traF production in vivo. In sum, transcriptional control of the sex determination hierarchy by Chinmo is critical for sex maintenance in sexually dimorphic tissues and is vital in the preservation of fertility.

Capacidade reprodutiva e preferência da traça-das-crucíferas para diferentes brassicáceas Reproductive capacity and preference of the diamondback moth feeding on different brassicacea

Directory of Open Access Journals (Sweden)

Sergio A De Bortoli

2011-06-01

Full Text Available O objetivo desta pesquisa foi comparar diferentes cultivares de brassicáceas em relação à capacidade reprodutiva e preferência para alimentação e oviposição da traça-das-crucíferas. Os experimentos foram realizados utilizando-se as cultivares de repolho Midori, Chato-de-Quintal, híbridos da Top Seed® - Agristar (TPC 308, TPC 681 e TPC 668, couve-flor Bola de Neve, couve brócolis Ramoso Piracicaba Precoce e couve Manteiga da Geórgia, sendo esta última utilizada como padrão de suscetibilidade. Por meio dos dados biológicos de P. xylostella foram estimados os parâmetros necessários para a construção de tabela de vida de fertilidade, para comparação das cultivares testadas em relação à capacidade reprodutiva da praga. Em gaiolas de criação da traça-das-crucíferas foram colocados quatro quartos de folha, dois a dois, que justapostos formavam um círculo de 8 cm de diâmetro, confrontando-se os materiais dois a dois. As partes foram dispostas equidistantemente, para realização do teste de dupla chance de escolha (preferência para alimentação e oviposição e de múltipla chance de escolha, confrontando todos os substratos (preferência para alimentação. As cultivares que proporcionaram melhor desenvolvimento e reprodução para a traça-das-crucíferas foram couve Manteiga da Geórgia e couve brócolis. Para preferência alimentar constatou-se alta suscetibilidade em couve Manteiga e TPC 681 e para preferência de oviposição alta preferência para couve-flor Bola de Neve. Com isso, sugere-se a divisão das cultivares estudadas em quatro classes distintas: repolho Midori como moderadamente resistente (MR; couve-flor Bola de Neve e repolho Chato-de-Quintal como suscetíveis (S; couve brócolis, TPC308, TPC681 e TPC668 como moderadamente suscetíveis (MS; e couve Manteiga como altamente suscetível (AS.We compared different cultivars of crucifer in relation to reproductive capacity and preference for feeding and

Traço e estado de ansiedade de nutrizes com indicadores de hipogalactia e nutrizes com galactia normal Trazo y estado de ansiedad de mujeres lactantes con indicadores de hipogalactia y mujeres lactantes con galactia normal Trace and anxiety of nursing mothers with insufficient and normal breast feeding indicators

OpenAIRE

Ilva Marico Mizumoto Aragaki; Isília Aparecida Silva; Jair Lício Ferreira dos Santos

2006-01-01

Este estudo objetivou identificar e comparar o traço e estado de ansiedade, no 10º dia pós-parto e estado de ansiedade no 30º dia puerperal, das nutrizes primíparas e multíparas que apresentaram indicadores de hipogalactia e nutrizes com galactia normal; verificar possíveis relações entre o estado de ansiedade das nutrizes nesses dois momentos com a presença dos indicadores de hipogalactia. É um estudo exploratório/descritivo, cujos dados foram obtidos com 168 nutrizes e seus filhos, por meio...

Paradoxical effects of all-trans-retinoic acid on lupus-like disease in the MRL/lpr mouse model.

Directory of Open Access Journals (Sweden)

Xiaofeng Liao

Full Text Available Roles of all-trans-retinoic acid (tRA, a metabolite of vitamin A (VA, in both tolerogenic and immunogenic responses are documented. However, how tRA affects the development of systemic autoimmunity is poorly understood. Here we demonstrate that tRA have paradoxical effects on the development of autoimmune lupus in the MRL/lpr mouse model. We administered, orally, tRA or VA mixed with 10% of tRA (referred to as VARA to female mice starting from 6 weeks of age. At this age, the mice do not exhibit overt clinical signs of lupus. However, the immunogenic environment preceding disease onset has been established as evidenced by an increase of total IgM/IgG in the plasma and expansion of lymphocytes and dendritic cells in secondary lymphoid organs. After 8 weeks of tRA, but not VARA treatment, significantly higher pathological scores in the skin, brain and lung were observed. These were accompanied by a marked increase in B-cell responses that included autoantibody production and enhanced expression of plasma cell-promoting cytokines. Paradoxically, the number of lymphocytes in the mesenteric lymph node decreased with tRA that led to significantly reduced lymphadenopathy. In addition, tRA differentially affected renal pathology, increasing leukocyte infiltration of renal tubulointerstitium while restoring the size of glomeruli in the kidney cortex. In contrast, minimal induction of inflammation with tRA in the absence of an immunogenic environment in the control mice was observed. Altogether, our results suggest that under a predisposed immunogenic environment in autoimmune lupus, tRA may decrease inflammation in some organs while generating more severe disease in others.

Relationships between climatic factors and the growth of kenaf (Hibiscus cannabinus L.); Relazioni tra fattori climatici e accrescimento del kenaf (Hibiscus cannabinus L.)

Energy Technology Data Exchange (ETDEWEB)

Rossini, F.; Cereti, C. F.; D' Antuono, L. F.

1993-07-01

Four varieties of kenaf were cultivated at Viterbo, Central Italy, in 1990-91, both in rainfed and in irrigated conditions. Total biomass was related to intercepted PAR. The lower biomass production of the rainfed crop was determined both by the lower interception of radiation (Lower LAI) and by the lower light use efficiency. Light use efficiency increased after flowerig. An underestimation of the intercepted radiation, due to the fact that only leaf interception was considered, could partially account for this fact. Under optimum water supply, the intercepted radiation was the main determinant of crop growth, whereas in water stress situation light use efficiency increased when water deficit decreased [Italian] Quattro varieta' di kenaf sono state coltivate a Viterbo in regime asciutto ed irriguo nel biennio 1990-91. La biomassa prodotta e' stata posta in relazione con la radiazione fotosinteticamente attiva (PAR) intercettata. La minore produzione delle tesi asciutte e' stata determinata sia dalla minore quantita' di energia intercettata (bassi valori di LAI), che dalla piu' bassa efficienza di uso della radiazione. L'efficienza di uso della radiazione e' aumentata notevolmente dopo la fioritura. Tra le ragioni di questo aumento si puo' ipotizzare una sottostima della radiazione intercettata, non essendo stata considerata la quota intercettata dalla parte apicale del fusto. In condizioni idriche ottimali la radiazione intercettata e' risultata la principale variabile che regola l'accumulo di biomassa mentre, in situazioni di stress idrico, l'efficienza d'uso della radiazione e' aumentata al diminuire del deficit idrico.

Industria cinematografica e turismo nell’immaginario collettivo: Los Angeles tra mito e creatività / Film industry and tourism in collective imagination: Los Angeles between myth and creativity

Directory of Open Access Journals (Sweden)

Franca Miani

2016-05-01

Full Text Available Obiettivo del contributo è quello di proporre alcuni spunti di riflessione sul caso della città di celluloide più nota al mondo: Los Angeles. Più in particolare s’intende analizzare la stretta relazione che intercorre tra l’attrattività turistica della metropoli e l’industria cinematografica.  Come ben noto, Los Angeles continua da quasi un secolo a suggestionare l’immaginario collettivo in quanto mecca del cinema e patria di Hollywood, l’industria che ha creato il sogno americano. Tuttavia LA, oggi, è anche una delle prime dieci città mondiali. Rappresenta l’esempio di come l’industria creativa (e il cinema è creatività per definizione sia riuscita a realizzare un sistema economico e d’innovazione tecnologica che funziona come polo di attrazione sia per tutti coloro che intendono sviluppare nuove attività, non possibili in altre parti del mondo, sia per visitatori e turisti attirati da un insieme di fattori emozionali legati alla notorietà dei luoghi del sistema cinematografico e dello spettacolo. Sulla base dell’analisi della letteratura e facendo seguito a esperienze di studio sul campo, il contributo vuole evidenziare la stretta connessione costruita nel corso di più di un secolo tra Hollywood, il luogo, e Hollywood, l’industria, per dimostrare come il luogo di produzione rappresenti una componente unica del prodotto finale, un’autenticazione di qualità soggettive e simboliche in grado di amplificare il valore economico intrinseco e di provocare un’attrazione crescente di attività e persone verso l’area metropolitana di Los Angeles.   This paper discusses Los Angeles as the best-known celluloid city in the world, and focuses particularly on the close relationship between its attractiveness for tourists and the film industry. For almost a century Los Angeles has exerted influence over the collective imagination as the mecca of cinema and home of Hollywood, the industry that created the American dream

Essai d’une méthodologie d’analyse des données d’Internet sur un ordinateur

OpenAIRE

Géraldine Foin

2017-01-01

Dans l’étude de l’environnement numérique dans lequel les individus vivent et évoluent, des problèmes méthodologiques peuvent se poser pour les chercheurs en sciences humaines et sociales. Cet article s’interroge sur la compatibilité des outils classiques en sciences sociales pour l’étude des pratiques numériques sur un écran, celui de l’ordinateur. En effet, l’usage classique d’entretiens, de questionnaires ou d’observations ne suffit plus pour recueillir avec précision les données relatives...

L’Europe et les sans-papiers

OpenAIRE

Simonnot, Nathalie; Intrand, Caroline

2013-01-01

En Europe, les sans-papiers vivent des conditions socio-économiques particulièrement défavorables. Les systèmes de santé des pays européens sont peu performants pour le suivi des personnes sans papiers. Ils sont en outre souvent victimes de refus de soins. Pire, l’accès aux soins est dans certains pays progressivement instrumentalisé au profit du contrôle de l’immigration. Ces politiques grossissent les rangs des populations qui n’accèdent pas aux soins et doivent avoir recours à Médecins du ...

Archeologia tra ricerca tutela e valorizzazione / Archaeology between research, protection and enhancement

Directory of Open Access Journals (Sweden)

Daniele Manacorda

2010-10-01

Full Text Available I beni archeologici sono anche una risorsa economica, ma tale definizione è insufficiente se posta in contrapposizione con il valore immateriale della cultura in sé, in mancanza del quale tutto perde valore, perché esso incide profondamente sulla qualità della vita.Ogni sito archeologico nasconde in sé le potenzialità di una condivisione di culture e prospettive e il rischio di nuovi steccati in nome di un’identità rivendicata con l’occhio rivolto al passato. Guardando con gli occhiali dello storico nella profondità del tempo ci vediamo immersi in un intreccio, dove l’identità non è più un dato statico da disvelare, ma una condizione dinamica, il frutto di un processo di esperienze condivise. L’archeologia è infatti uno strumento formidabile che contrasta l’oblio, rimotivando continuamente le finalità della conoscenza critica del passato, per ricostruire l’origine delle differenze tra le culture e afferrare la complessità del presente.L’archeologo deve assumersi la responsabilità di stabilire una nuova gerarchia delle informazioni. Non esistono scorciatoie quando in ballo è la conservazione della memoria storica del nostro Paese, ma la sua salvaguardia è parte di un progetto complessivo di attenzione alla qualità del vivere, rispetto alla quale l’archeologia può dimostrare di saper conciliare questa salvaguardia con gli interessi più generali della collettività. Prima di valorizzare occorre pensare se ne valga davvero la pena. Il ruolo progettuale degli archeologi dovrebbe fondarsi sulla capacità di interpretare ciò che resta del passato, di restituirgli un senso. Per questo la valorizzazione è una funzione sociale vitale, che identifica le capacità di una nazione di testimoniare la propria eredità culturale e di farla vivere manifestandosi a tutti i livelli pubblici, associativi, privati nei quali si articola la società civile. The economical value of the archaeological resources is insufficient when

I Romani in montagna: tra immaginario e razionalità / The Romans in mountain: between imaginary and rationality

Directory of Open Access Journals (Sweden)

Michel Tarpin

2015-12-01

Full Text Available Si sa che l’immagine delle Alpi nell’Antichità presenta una contraddizione tra una tradizione letteraria impegnata a dare della montagna l’immagine più terribile possibile, e le energie spese dai Romani per arrivare in fretta fino alla catena e impadronirsi degli sbocchi alpini e delle miniere. Un‘altra tradizione fa delle Alpi il baluardo creato, quasi per volontà della Provvidenza, per proteggere l’Italia dai barbari esterni. Infine, le fonti ricorrono spesso, in maniera del tutto naturale, alla parola “Italia” per parlare della Transpadana, anche quando l’Italia “ufficiale” si fermava 200 km a sud del Po. Siccome una parte di questi discorsi può essere seguita fino a Catone il Vecchio, si deve sospettare che egli fosse riuscito a convincere i Romani che l’Italia era tutta la penisola secoli prima che l’Italia amministrativa si estendesse fino alle Alpi da parte dei triumviri, nel 42 a.C. Ciò non era un gesto generoso ma una loro misura prudenziale e si può quindi ammettere che l’identificazione dell’Italia con tutta la penisola fosse un vecchio progetto, maggiormente concretizzato da Cesare. This paper aims to interpret the apparent contradiction between many literary texts, which describe the Alps as a very uncomfortable and dangerous place, and the fact that the Roman strategy was very directed to the Alpine commercial roads and mines. It is well known that a tradition well diffused intended the Alpine range as a great wall, created by the Providence to protect Italy from foreign potential invaders. Another group of texts use the name “Italy” to describe the Po valley, even when official “Italy” was only south and centre Italy. We can trace most of theses discourses almost to Cato the Elder and suspect that he had made the Romans admit that Italy was all the Peninsula long before administrative Italy was expanded to the Alps by the triumvirs in 42 BC. As this statement was not a generous

Aditivos e sua influência no comportamento de secagem e resistência à tração de concretos refratários Additives and their influence in the refractory castables drying and traction strength behavior

Directory of Open Access Journals (Sweden)

I. R. Oliveira

2007-12-01

Full Text Available A evolução tecnológica de concretos refratários tem tornado mais difícil a etapa de secagem devido a redução da sua permeabilidade e conseqüente aumento da dificuldade para que o vapor de água migre do interior do corpo para a superfície. A hidratação do cimento de aluminato de cálcio também causa decréscimo da permeabilidade dos concretos. Tal processo é significativamente afetado pela presença de aditivos utilizados para a dispersão do concreto. Neste contexto, este trabalho teve como objetivo relacionar o tipo de aditivo utilizado no processamento de concretos refratários com seu comportamento de secagem e resistência à tração. Foi verificado que os aditivos não atuam somente na dispersão das partículas da matriz e ligante, mas o efeito da sua atuação pode influenciar no tipo de hidrato formado. O aditivo CS se mostrou um eficiente dispersante promovendo a redução no consumo de água. Isso acarretou na formação preferencial dos hidratos C3AH6 disponibilizando mais alumina para a formação de AH3. Essa fase apresenta alta capacidade de preencher vazios interparticulas contribuindo para aumentar a resistência à tração do material. Por outro lado, o aditivo AC desfavoreceu a formação desses tipos de hidratos uma vez que atua como retardador da hidratação do cimento por meio do consumo de íons cálcio. Também a presença de um maior teor de água nos concretos preparados com este aditivo pode explicar o aumento da porosidade e decréscimo da resistência à tração do concreto.The growing technology applied in the refractory castables production has become more difficult the drying process due the reduction of their permeability and the consequent increasing difficult of vapor migration from the inner region of the body to the surface. The hydration of calcium aluminate cement is also responsible for the castables permeability reduction. This process is significatively affected by the presence of

Efeito da desmineralização das superfícies de contato na resistência à tração de enxertos ósseos autógenos em tíbia de coelhos. Analise mecânica e à microscopia eletrônica de varredura

OpenAIRE

Marcus Gustavo Silva Rodrigues

2009-01-01

Vinte e nove coelhos machos (Oryctolagus cuniculus) tiveram fragmentos ósseos corticais de 8mm de diâmetro removidos com trefina da metáfise proximal tibial que foram transplantados para uma área adjacente após a realização de um dos seguintes tratamentos: G-EDTA (desmineralização com EDTA pH neutro a 24% na forma de gel por 3 minutos das superfícies ósseas de contato); G-EDTA-P (o mesmo tratamento de G-EDTA e perfuração do leito receptor); G-P (perfuração do leito receptor) e G-C (nenhum tra...

Tremor cells in the human thalamus: differences among neurological disorders.

Science.gov (United States)

Brodkey, Jason A; Tasker, Ronald R; Hamani, Clement; McAndrews, Mary Pat; Dostrovsky, Jonathan O; Lozano, Andres M

2004-07-01

Thalamic neurons firing at frequencies synchronous with tremor are thought to play a critical role in the generation and maintenance of tremor. The authors studied the incidence and locations of neurons with tremor-related activity (TRA) in the thalamus of patients with varied pathological conditions-including Parkinson disease (PD), essential tremor (ET), multiple sclerosis (MS), and cerebellar disorders--to determine whether known differences in the effectiveness of thalamic stereotactic procedures for these tremors could be correlated to differences in the incidence or locations of TRA cells. Seventy-five operations were performed in 61 patients during which 686 TRA cells were recorded from 440 microelectrode trajectories in the thalamus. The locations of the TRA cells in relation to electrophysiologically defined thalamic nuclei and the commissural coordinates were compared among patient groups. The authors found that TRA cells are present in patients with each of these disorders and that these cells populate several nuclei in the ventral lateral tier of the thalamus. There were no large differences in the locations of TRA cells among the different diagnostic classes, although there was a difference in the incidence of TRA cells in patients with PD, who had greater than 3.8 times more cells per thalamic trajectory than patients with ET and approximately five times more cells than patients with MS or cerebellar disorders. There was an increased incidence of TRA in the thalamus of patients with PD. The location of thalamic TRA cells in patients with basal ganglia and other tremor disorders was similar.

The role of the transformer gene in sex determination and reproduction in the tephritid fruit fly, Bactrocera dorsalis (Hendel).

Science.gov (United States)

Peng, Wei; Zheng, Wenping; Handler, Alfred M; Zhang, Hongyu

2015-12-01

Transformer (tra) is a switch gene in the somatic sex-determination hierarchy that regulates sexual dimorphism based on RNA splicing in many insects. In tephritids, a Y-linked male determining gene (M) controls sex in the sex-determination pathway. Here, homologues of Drosophila tra and transformer-2 (tra-2) genes were isolated and characterized in Bactrocera dorsalis (Hendel), one of the most destructive agricultural insect pests in many Asian countries. Two male-specific and one female-specific isoforms of B. dorsalis transformer (Bdtra) were identified. The presence of multiple TRA/TRA-2 binding sites in Bdtra suggests that the TRA/TRA-2 proteins are splicing regulators promoting and maintaining, epigenetically, female sex determination by a tra positive feedback loop in XX individuals during development. The expression patterns of female-specific Bdtra transcripts during early embryogenesis shows that a peak appears at 15 h after egg laying. Using dsRNA to knock-down Bdtra expression in the embryo and adult stages, we showed that sexual formation is determined early in the embryo stage and that parental RNAi does not lead to the production of all male progeny as in Tribolium castaneum. RNAi results from adult abdominal dsRNA injections show that Bdtra has a positive influence on female yolk protein gene (Bdyp1) expression and fecundity.

Maternal provision of transformer-2 is required for female development and embryo viability in the wasp Nasonia vitripennis

NARCIS (Netherlands)

Geuverink, Elzemiek; Rensink, Anna H.; Rondeel, Inge; Beukeboom, Leo W.; van de Zande, Louis; Verhulst, Eveline C.

2017-01-01

In insect sex determination a primary signal starts the genetic sex determination cascade that, in most insect orders, is subsequently transduced down the cascade by a transformer (tra) ortholog. Only a female-specifically spliced tra mRNA yields a functional TRA-protein that forms a complex with

In corpo due anime: La chiave a stella tra finzione, testimonianza e antropologia

Directory of Open Access Journals (Sweden)

Emanuele Caon

2016-11-01

Full Text Available La chiave a stella viene, appena pubblicato, investito da un dibattito molto vivace dovuto alla carica polemica che sembrava assumere il testo rispetto al tema del lavoro. Anche la critica letteraria si concentra su questo aspetto, oltre che sulle qualità linguistiche dell’opera. Mantenendo come punto fermo che la scelta del tema in Levi è centrale quanto la sua elaborazione artistica, si tenterà di dimostrare le qualità anzitutto letterarie del romanzo e solo alla fine si valuterà il suo motivo dominante. L’analisi inizia dalle strutture narrative, ovvero sulla capacità di Levi di saldare insieme i vari racconti nella forma romanzo, per passare poi alla rielaborazione della funzione testimoniale a scopi prettamente finzionali; argomento valido a erodere l’immagine stereotipata di Levi come il testimone del Lager per sbilanciarla maggiormente verso quella dello scrittore. Infine, sempre tenendo presente l’intera opera leviana, si affronta il tema del lavoro all’interno del romanzo, spesso accusato di risentire troppo dell’ideologia autoriale. L’ipotesi di ricerca è che Levi compia un percorso di scavo antropologico servendosi degli strumenti dell’invenzione letteraria e dell’elaborazione stilistica. Sono la distanza tra autore e personaggio e l’uso della figuralità letteraria a consentire a La chiave a stella di contraddire, almeno in parte, il controllo del proprio autore. Il romanzo si apre, dunque, alla polisemia e svela le sue capacità di durata nel tempo e di prefigurazione rispetto alla nuova configurazione post-fordista. The publication of La chiave a stella (1978 stirred an immediate and animated debate due to its polemic tones with regard to the theme of work. Indeed, beside the linguistic concerns, literary critics also focused on such theme. By starting from the assumption that Levi’s thematic choice is as fundamental as its artistic re-elaboration, the present contribution aims to emphasize primarily

Maternal provision of transformer-2 is required for female development and embryo viability in the wasp Nasonia vitripennis

NARCIS (Netherlands)

Geuverink, Elzemiek; Rensink, Anna H.; Rondeel, Inge; Beukeboom, Leo W.; Zande, van de Louis; Verhulst, Eveline C.

2017-01-01

In insect sex determination a primary signal starts the genetic sex determination cascade that, in most insect orders, is subsequently transduced down the cascade by a transformer (tra) ortholog. Only a female-specifically spliced tra mRNA yields a functional TRA-protein that forms a complex with

Validity of a traffic air pollutant dispersion model to assess exposure to fine particles.

Science.gov (United States)

Kostrzewa, Aude; Reungoat, Patrice; Raherison, Chantal

2009-08-01

Fine particles (PM(2.5)) are an important component of air pollution. Epidemiological studies have shown health effects due to ambient air particles, particularly allergies in children. Since the main difficulty is to determine exposure to such pollution, traffic air pollutant (TAP) dispersions models have been developed to improve the estimation of individual exposure levels. One such model, the ExTra index, has been validated for nitrogen oxide concentrations but not for other pollutants. The purpose of this study was to assess the validity of the ExTra index to assess PM(2.5) exposure. We compared PM(2.5) concentrations calculated by the ExTra index to reference measures (passive samplers situated under the covered part of the playground), in 15 schools in Bordeaux, in 2000. First, we collected the input data required by the ExTra index: background and local pollution depending on traffic, meteorology and topography. Second, the ExTra index was calculated for each school. Statistical analysis consisted of a graphic description; then, we calculated an intraclass correlation coefficient. Concentrations calculated with the ExTra index and the reference method were similar. The ExTra index underestimated exposure by 2.2 microg m(-3) on average compared to the reference method. The intraclass correlation coefficient was 0.85 and its 95% confidence interval was [0.62; 0.95]. The results suggest that the ExTra index provides an assessment of PM(2.5) exposure similar to that of the reference method. Although caution is required in interpreting these results owing to the small number of sites, the ExTra index could be a useful epidemiological tool for reconstructing individual exposure, an important challenge in epidemiology.

Targeted radiotherapy potentiates the cytotoxicity of a novel anti-human DR5 monoclonal antibody and the adenovirus encoding soluble TRAIL in prostate cancer

International Nuclear Information System (INIS)

Arafat, W.; Arafat, W.; Zhou, T.; Naoum, G.E.; Buchsbaum, D.J.

2015-01-01

TRAIL (tumor necrosis factor-related apoptosis-inducing ligand) induces a death signal following binding to death receptors (DR4, DR5). We have developed a novel anti-human DR-5 monoclonal antibody (TRA-8) and adenoviral encoding TRAIL (Ad/TRAIL). Herein, we are testing the combined effect of radiotherapy and TRA-8 or Ad TRAIL in prostate cancer cells. Human prostate cancer cell lines LnCap, PC-3 and DU145 were used in this study. Cells were treated either with TRA-8 alone or Ad/TRAIL, radiation alone, or a combination of each at different doses and intervals. Cell survival using the MTS assay and colony forming assay were used to determine radiosensitization. Immunohistochemistry was used to detect bax and bcl-2. Real-time PCR was performed on mRNA of treated prostate cancer cell lines. Finally, a murine model of subcutaneous prostate cancer was used to evaluate the in vivo effect. Cell survival assays detected by MTS assay showed that prostate cell lines treated with a combination of radiation and TRA-8 showed significantly lower survival than cells treated with either radiation or TRA-8 alone. Colony forming assay and cell proliferation assays showed increased killing after combination treatment with TRA-8 or Ad/TRAIL and radiation, than either single agent alone. Mechanistic studies showed that the killing effect was due to induction of apoptosis mostly by increased expression of bax in TRA-8 or Ad/TRAIL treated cells. Additionally, RT-PCR showed an increased copy number of bax in most cells treated with TRA-8 and radiation. It is concluded that radiation and TRA-8 or Ad/ TRAIL produced a synergistic effect in refractory prostrate cancer.

Movement amplitude on the Functional Re-adaptive Exercise Device: deep spinal muscle activity and movement control.

Science.gov (United States)

Winnard, A; Debuse, D; Wilkinson, M; Samson, L; Weber, T; Caplan, Nick

2017-08-01

Lumbar multifidus (LM) and transversus abdominis (TrA) show altered motor control, and LM is atrophied, in people with low-back pain (LBP). The Functional Re-adaptive Exercise Device (FRED) involves cyclical lower-limb movement against minimal resistance in an upright posture. It has been shown to recruit LM and TrA automatically, and may have potential as an intervention for non-specific LBP. However, no studies have yet investigated the effects of changes in FRED movement amplitude on the activity of these muscles. This study aimed to assess the effects of different FRED movement amplitudes on LM and TrA muscle thickness and movement variability, to inform an evidence-based exercise prescription. Lumbar multifidus and TrA thickness of eight healthy male volunteers were examined using ultrasound imaging during FRED exercise, normalised to rest at four different movement amplitudes. Movement variability was also measured. Magnitude-based inferences were used to compare each amplitude. Exercise at all amplitudes recruited LM and TrA more than rest, with thickness increases of approximately 5 and 1 mm, respectively. Larger amplitudes also caused increased TrA thickness, LM and TrA muscle thickness variability and movement variability. The data suggests that all amplitudes are useful for recruiting LM and TrA. A progressive training protocol should start in the smallest amplitude, increasing the setting once participants can maintain a consistent movement speed, to continue to challenge the motor control system.

Avaliação de um Solo em Termos de Resistência à Compressão Simples, Resistência à Tração por Compressão Diametral e Módulo de Resiliência, Considerando Resultados de Diferentes Tipos de Compactação

Directory of Open Access Journals (Sweden)

Albaniza Maria da Silva

2016-09-01

Full Text Available No Brasil, o ensaio laboratorial de compactação Proctor é normatizado pela Associação Brasileira de Normas Técnicas (NBR 7182/1986 e pelo Departamento Nacional de Infraestrutura e Transportes (DNIT – ME 164/2013 e DNIT – ME 162/1994. As normas apresentam diferentes alternativas para executar a compactação Proctor, no entanto, verifica-se que o comportamento mecânico de um solo compactado é função do índice de vazios, do grau de saturação e principalmente da estrutura do solo que é diretamente influenciada pelo processo de compactação adotado. Este trabalho teve como objetivo comparar quatro processos distintos de compactação (mecânica com reúso, manual com reúso, manual sem reúso e manual sem reúso com umedecimento da amostra 24 horas antes da compactação, utilizando a energia intermediária, com a pretensão de avaliar os seus efeitos nas propriedades de resistência à compressão, resistência à tração e resiliência de um solo. A fase experimental foi dividida em três (3 etapas: ensaios de caracterização do solo, ensaios de compactação Proctor e ensaios mecânicos (Resistência à Compressão Simples - RCS, Resistência à Tração por Compressão Diametral - RT e Módulo de Resiliência - MR. Por meio dessa pesquisa, constatou-se que o tipo de compactação utilizado exerceu uma influência significativa nos resultados, pois de um modo geral os valores de RT , RCS e MR obtidos na compactação manual sem reúso 24h foram superiores as demais compactações.

AcEST: DK950225 [AcEST

Lifescience Database Archive (English)

Full Text Available ... 256 5e-67 tr|A1Y9I8|A1Y9I8_TOBAC Chloroplast post-illumination chlorophyll... 254 3e-66 tr|A9PFG9|A9PFG9...a m... 245 2e-63 tr|A1Y9I7|A1Y9I7_MAIZE Chloroplast post-illumination chlorophyll...YANVD 255 Query: 549 DGSCPYISDESSD 587 DGSCP +S + Sbjct: 256 DGSCPLELSDSDE 268 >tr|A1Y9I8|A1Y9I8_TOBAC Chloroplast post-illuminat

Response of mucous cells of the gills of traíra (Hoplias malabaricus and jeju (Hoplerythrinus unitaeniatus (Teleostei: Erythrinidae to hypo- and hyper-osmotic ion stress

Directory of Open Access Journals (Sweden)

Sandro Estevan Moron

Full Text Available The mucous cells (MC of traíra, Hoplias malabaricus, and jeju, Hoplerythrinus unitaeniatus, two ecologically distinct erythrinid species, were analyzed in fish exposed to deionized (DW and high ion concentration (NaCl and Ca2+ water (HIW during 15 days to evaluate the MC responses to ion challenge. MCs are localized in the leading and trailing edge and, interlamellar region of the gill filament epithelium but, in H. unitaeniatus, they are also found in the breathing or lamellar epithelium. MC density is lower in H. malabaricus, the exclusively water-breathing fish, than in H. unitaeniatus, a facultative air-breathing fish. The transference to DW or HIW did not change the MC density and surface area, excepting in H. malabaricus, in the first day of exposure to DW. A single MC containing three types of glycoproteins (neutral, acidic and sulphated was identified in the gill epithelium of both, H. malabaricus and H. unitaeniatus. The amount (based on the intensity of histochemistry reaction of these glycoproteins differed between the species and were altered after exposure to DW and HIW showing little adjustments in the amount of mucosubstances in the MC of H. malabaricus and reduction of acidic and sulphated glycoproteins in H. unitaeniatus. The decreasing of these glycoproteins in H. unitaeniatus reduced the mucus protection against desiccation of gill tissue when change the ion concentration in water.

The influence of imipramine and trazodone on platelet [3H]serotonin uptake in depressed patients: changes following treatment

International Nuclear Information System (INIS)

Katasonow, A.B.; Brusow, O.S.; Beljaew, B.S.; Slobina, G.P.; Faktor, M.I.; Larionowa, T.B.; Trunte, K.; Lidemann, R.R.

1989-01-01

The inhibitory potencies of imipramine (IC 50 values for IMI) and trazodone (IC 50 values for TRA) on platelet [ 3 H]serotonin uptake were measured in depressed patients. The IC 50 values for IMI in patients was shown to be higher (P 50 values for TRA in patients were lower (P 3 H]imipramine binding sites. Drug treatment led to the normalization of the IC 50 values for IMI and to the partial increase of the IC 50 values for TRA. There was a negative correlation of IC 50 values for TRA and severity of depressive symptoms evaluated by the Hamilton Depression Rating Scale. The results support the hypothesis that the mechanisms of the regulation of [ 3 H]serotonin uptake sensitivity to IMI and TRA in patients are different. (author)

Funzioni esecutive in interazione con dispositivi di narrazione multilineare per una formazione generativa evidence based

Directory of Open Access Journals (Sweden)

Luisa Salmaso

2015-12-01

Full Text Available La promozione degli apprendimenti in partecipazione e cooperazione con gli altri, la pianificazione da concretizzare attraverso azioni organizzate, il far scaturire dal problem setting narrativo un processo dinamico, prospettico e costruttivo, in cui l’alunno viene sostenuto dal formatore e dalla struttura narrativa che guida, sono in grado di sollecitare la scoperta di percorsi possibili, sostenendo il carico cognitivo implicato in processi complessi, quali le funzioni neuropsicologiche di tipo esecutivo (Hughes, 2011; Zoccolotti, 2010. Il modello qui presentato può permettere l’attivazione di processi di apprendimento multiplo, infatti, pur inquadrato nel paradigma socio-culturale costruzionista, implica anche strategie afferenti a modelli istruzionali, cognitivi e metacognitivi dell’apprendimento, offrendo una palestra articolata per uno sviluppo di abilità cognitive e sociali, in una prospettiva formativa generativa evidence based.

Alternative Constructions of Treason in the Angevin Political World: Traïson in the History of William Marshal

Directory of Open Access Journals (Sweden)

Stephen D. WHITE

2007-05-01

Full Text Available After some nobles and other fighting men surrendered Rochester castle to King John in 1215, John wanted to hang the nobles but refrained from doing so on the advice of one of his military captains. Would hanging the nobles for making war on the king have been lawful? This question about the law of treason has provoked inconclusive debate among historians who have sought to determine whether, in this period, making war against the English king was legally classified as lèse-majesté (crimen laesae majestatis, proditio or infidelitas. This article, however, asks whether the nobles whom John wanted to hang were guilty of traïson, as this vernacular term was used in the History of William Marshal (c. 1230. On this basis, the paper concludes that in all probability, the nobles who held Rochester against the king would not have been condemned as traitors, at least by their aristocratic peers.Cuando en 1215 ciertos nobles y otros combatientes se rindieron y entregaron el castillo de Rochester al rey Juan éste quiso colgarles, pero el consejo de uno de sus nobles le hizo absternerse. ¿Habría sido legítimo condenar a la horca a los que habían guerreado contra el rey? Cuestiones relativas al derecho de traición al intentar determinar si la guerra contra el rey de Inglaterra fue considerada en la época un crimen laesae majestatis, proditio, o infidelitas, según la definición que dan a estos términos las fuentes latinas, han suscitado debates interminables entre los historiadores. Este artículo, por el contrario, se pregunta si los nobles que el rey Juan deseaba colgar eran o no culpables de traición, en el sentido vernáculo del término que es usado en L’histoire de Guillaume le Maréchal (hacia 1230. Sobre esta base, la conclusión del artículo es que los nobles que ocuparon el castillo de Rochester, casi con total seguridad, no habrían sido condenados como traidores, al menos por sus pares.

Validating a simple discharge planning tool following hospital admission for an isolated lower limb fracture.

Science.gov (United States)

Kimmel, Lara A; Holland, Anne E; Simpson, Pam M; Edwards, Elton R; Gabbe, Belinda J

2014-07-01

Early, accurate prediction of discharge destination from the acute hospital assists individual patients and the wider hospital system. The Trauma Rehabilitation and Prediction Tool (TRaPT), developed using registry data, determines probability of inpatient rehabilitation discharge for patients with isolated lower limb fractures. The aims of this study were: (1) to prospectively validatate the TRaPT, (2) to assess whether its performance could be improved by adding additional demographic data, and (3) to simplify it for use as a bedside tool. This was a cohort, measurement-focused study. Patients with isolated lower limb fractures (N=114) who were admitted to a major trauma center in Melbourne, Australia, were included. The participants' TRaPT scores were calculated from admission data. Performance of the TRaPT score alone, and in combination with frailty, weight-bearing status, and home supports, was assessed using measures of discrimination and calibration. A simplified TRaPT was developed by rounding the coefficients of variables in the original model and grouping age into 8 categories. Simplified TRaPT performance measures, including specificity, sensitivity, and positive and negative predictive values, were evaluated. Prospective validation of the TRaPT showed excellent discrimination (C-statistic=0.90 [95% confidence interval=0.82, 0.97]), a sensitivity of 80%, and specificity of 94%. All participants able to weight bear were discharged directly home. Simplified TRaPT scores had a sensitivity of 80% and a specificity of 88%. Generalizability may be limited given the compensation system that exists in Australia, but the methods used will assist in designing a similar tool in any population. The TRaPT accurately predicted discharge destination for 80% of patients and may form a useful aid for discharge decision making, with the simplified version facilitating its use as a bedside tool. © 2014 American Physical Therapy Association.

Chlorination of tramadol: Reaction kinetics, mechanism and genotoxicity evaluation.

Science.gov (United States)

Cheng, Hanyang; Song, Dean; Chang, Yangyang; Liu, Huijuan; Qu, Jiuhui

2015-12-01

Tramadol (TRA) is one of the most detected analgesics in environmental matrices, and it is of high significance to study the reactivity of TRA during chlorination considering its potential toxicity to the environment. The chlorine/TRA reaction is first order with respect to the TRA concentration, and a combination of first-order and second-order with respect to chlorine concentration. The pH dependence of the observed rate constants (kobs) showed that the TRA oxidation reactivity increased with increasing pH. kobs can be quantitatively described by considering all active species including Cl2, Cl2O and HOCl, and the individual rate constants of HOCl/TRA(0), HOCl/TRAH(+), Cl2/TRA and Cl2O/TRA reactions were calculated to be (2.61±0.29)×10(3)M(-1)s(-1), 14.73±4.17M(-1)s(-1), (3.93±0.34)×10(5)M(-1)s(-1) and (5.66±1.83)×10(6)M(-1)s(-1), respectively. Eleven degradation products were detected with UPLC-Q-TOF-MS, and the corresponding structures of eight products found under various pH conditions were proposed. The amine group was proposed to be the initial attack site under alkaline pH conditions, where reaction of the deprotonated amine group with HOCl is favorable. Under acidic and neutral pH conditions, however, two possible reaction pathways were proposed. One is an electrophilic substitution on the aromatic ring, and another is an electrophilic substitution on the nitrogen, leading to an N-chlorinated intermediate, which can be further oxidized. Finally, the SOS/umu test showed that the genotoxicity of TRA chlorination products increased with increasing dosage of chlorine, which was mostly attributed to the formation of some chlorine substitution products. Copyright © 2015 Elsevier Ltd. All rights reserved.

Mostre e musei nei cinegiornali dell’Archivio Luce tra le due guerre / Exhibitions and museums in the newsreels of the Institute Luce Archive between the WWI and the WWII

Directory of Open Access Journals (Sweden)

Tommaso Casini

2016-12-01

Full Text Available Il patrimonio cinematografi co dell’Istituto Nazionale Luce raccoglie alcune centinaia di ore di fi lmati che riguardano la storia delle mostre e dei musei del ‘900 in Italia e non solo. Sin dalla sua nascita, nel 1925, il LUCE (L’Unione Cinematografi ca Educativa inviò i suoi operatori a documentare musei, gallerie e mostre, specialmente in occasione di visite ufficiali dei sovrani e di esponenti del regime fascista. Cinegiornali e documentari didattici sono visibili on-line sul sito dell’Archivio, e parzialmente anche sul canale dedicato di YouTube. Il contributo traccia una prima ricognizione di un vasto panorama di materiali documentari e informativi, dando conto dell’uso del mezzo fi lmico per documentare le esposizioni temporanee e i musei. L’importanza del materiale del LUCE, che a partire dal 1931 diventa anche sonoro, offre uno spaccato ancora poco conosciuto di questa forma di documentazione in relazione al coevo dibattito sui musei, tra propaganda e uso pedagogico dell’immagine. Vengono esaminate modalità e strategie di presentazione visive e testuali distinguendo tra gli i musei di archeologia, arte antica, arte moderna e contemporanea, considerando alcuni casi specifi ci di esposizioni temporanee come la Biennale di Venezia e la Quadriennale di Roma. La conclusione è dedicata ad una rifl essione sui viaggi di Adolf Hitler in Italia in rapporto al patrimonio artistico e architettonico. The film heritage of the National Institute Luce collects several hundred hours of footage covering the history of the exhibitions and museums of the ‘900 in Italy and beyond. Since its inception in 1925, the LUCE (The Union Educational Film sent his workers to document museums, galleries and exhibitions, especially on the occasion of offi cial visits of kings and members of the fascist regime. Newsreels and educational documentaries and that for some years on-line are also visible on the Archive audiovisual database, and partly also

AcEST: DK963417 [AcEST

Lifescience Database Archive (English)

Full Text Available c, transcri... 33 5.4 tr|A0Y2K3|A0Y2K3_9GAMM ATP-dependent helicase HepA OS=Alteromona... 33 9.3 >tr|A6QD08|... + +++T +T ++++ NLH Sbjct: 388 PWEIRRHPRDRGQDMSLKKAVSRIEPEYIRRALSVTGGNRTKAAQLLDISLRNLH 442 >tr|A0Y2K3|A0Y2K3

AcEST: BP920186 [AcEST

Lifescience Database Archive (English)

Full Text Available in OS=Neosa... 33 7.6 tr|A6GTT6|A6GTT6_9BURK DNA polymerase I OS=Limnobacter sp. MED10... 33 9.9 >tr|A5FM58|...NLSL-----LTLVNAPADNTRFLIRHYHKDSSWEWAFSGN 346 >tr|A6GTT6|A6GTT6_9BURK DNA polymerase I OS=Limnobacter sp. MED

Forêt paysanne et paysage : les agriculteurs et le visible

OpenAIRE

Sauget , N.; Depuy , M.

1996-01-01

International audience; Aspects formels et aspects culturels sont les principales composantes de la perception esthétique et les fondements de l'évaluation esthétique du paysage. Le regard porté de l'extérieur diffère d'une expérience du paysage. Les agriculteurs, qui vivent cette expérience, sont aussi créateurs des paysages ruraux, à travers notamment leurs pratiques de gestion des formations boisées de leur exploitation. S'il est donc justifié, pour évaluer la qualité paysagère de la forêt...

Données récentes sur le comportement du grand cachalot (Physeter macrocephalus)

OpenAIRE

Goddard, Nicolas

2015-01-01

Le grand cachalot (Physeter macrocephalus) présente de nombreux comportements caractéristiques. Ces cétacés vivent les ¾ du temps en profondeur et peu de comportements sont directement visibles depuis la surface. Cette thèse bibliographique dresse un bilan sur ce qui est connu du comportement de cette espèce depuis les années 2000. Après avoir présenté les comportements généraux, les différents mouvements des cachalots sont analysés. Les différentes vocalisations, qui sont uniques aux cachalo...

L'attachement émotionnel à une marque : application aux équipes sportives professionnelles de hockey

OpenAIRE

Zaaboub, Emna

2017-01-01

Le produit sport est envisagé comme l'un des rares produits qui procurent de la passion et de l'enthousiasme chez les individus. Les amateurs d'une équipe sportive vivent des réactions émotionnelles pour leurs équipes favorites, plus fortes dans l'industrie du sport comparativement à d'autres industries. Cette étude s'intéresse particulièrement à l'attachement émotionnel d'un individu à une équipe sportive. Il s'agit d'examiner les antécédents et conséquences de l'attachement émotionnel qu'un...

Performance Assessment in a Heat Exchanger Tube with Opposite/Parallel Wing Twisted Tapes

Directory of Open Access Journals (Sweden)

S. Eiamsa-ard

2015-02-01

Full Text Available The thermohydraulic performance in a tube containing a modified twisted tape with alternate-axes and wing arrangements is reported. This work aims to investigate the effects of wing arrangements (opposite (O and parallel (P wings at different wing shapes (triangle (Tri, rectangular (Rec, and trapezoidal (Tra wings and on the thermohydraulic performance characteristics. The obtained results show that wing twisted tapes with all wing shape arrangements (O-Tri/O-Rec/O-Tra/P-Tri/P-Rec/P-Tra give superior thermohydraulic performance and heat transfer rate to the typical twisted tape. In addition, the tapes with opposite wing arrangement of O-Tra, O-Rec, and O-Tri give superior thermohydraulic performances to those with parallel wing arrangement of P-Tra, P-Rec, and P-Tri around 2.7%, 3.5%, and 3.2%, respectively.

Traços de personalidade e habilidades sociais em universitários Personality traits and social skills in college students

Directory of Open Access Journals (Sweden)

Daniel Bartholomeu

2008-06-01

Full Text Available O presente estudo teve como objetivo analisar as relações entre habilidades sociais e traços de personalidade englobados por socialização, no modelo dos Cinco Grandes Fatores. O Inventário de Habilidades Sociais (IHS foi utilizado para a mensuração de habilidades sociais, e para avaliação do nível de socialização foi escolhida a Escala Fatorial de Socialização (EFS. A amostra foi composta por 126 estudantes universitários com média de idade de 21 anos (DP=3,37, e 53,5% eram homens. Os resultados da IHS e EFS foram comparados para os sexos, encontrando-se diferenças estatisticamente significativas para seis das dez medidas realizadas no estudo. Foram encontradas correlações significativas entre amabilidade, auto-afirmação e o total do IHS. Pró-sociabilidade correlacionou-se com auto-afirmação e autocontrole. Confiança nas pessoas apresentou correlações significativas com enfrentamento, auto-afirmação e autocontrole. Os resultados indicam que, efetivamente, a personalidade pode influenciar diferentes aspectos da habilidade social.This study analyzed the relationship between social skills and personality traits, particularly agreeableness trait, based on Big Five model. To assess the social skills, the Social Skills Inventory (Inventário de Habilidades Sociais - IHS and the Agreeableness Scale (Escala Fatorial de Socialização - EFS measured agreeableness. The participants were 126 college students with mean age of 21 years old (SD=3,37, 53,5% men composed the sample. The sex comparison of the IHS and EFS measures pointed significant differences in six of ten measures. It was ascertain significant correlations between cordiality, coping and assertion and the total score of IHS. Pro-sociability was associated with coping and assertion and self-control. Trust in people was significantly correlated with coping and assertion, expressing positive affection and aggressiveness self-control. This result suggests personality

Tra sogno e realtà: Michail Bulgakov tra letteratura e cinema

Directory of Open Access Journals (Sweden)

Sara Tongiani

2011-05-01

Full Text Available The great masterpiece of Michail Bulgakov, Master i Margarita, represents an hypertext by which writers, literary critics and directors are still inspired. This paper focuses on the interconnection of languages and media characterizing the shift from the Bulgakov’s troubled page to the big-screen. In particular, the Wajda’s film (Pilatus und andere, 1972 and the Bortko’s tv-series (Master i Margarita, 2005 appear deeply different for both the character of hypertext of the reference novel and the historical and political context that the two authors point out. Wajda complies with the Bulgakov’s point: both of them tell about the trial suffered by Jeshua through the Pilate’s experience. The interpretation of the Polish director is enriched by the frequent references to cultural, social and political conflicts of the last century Europe. On the other hand, Bortko follows the Bulgakov’s novel page after page. The tv-series by Bortko becomes a kind of choral work in which the viewer can choose between the characters and different points of view. Thus, Wajda interprets the Bulgakov work, while Bortko translates the words of the novel in artificial television images.

Probability distribution of atmospheric pollutants: comparison among four methods for the determination of the log-normal distribution parameters; La distribuzione di probabilita` degli inquinanti atmosferici: confronto tra quattro metodi per la determinazione dei parametri della distribuzione log-normale

Energy Technology Data Exchange (ETDEWEB)

Bellasio, R [Enviroware s.r.l., Agrate Brianza, Milan (Italy). Centro Direzionale Colleoni; Lanzani, G; Ripamonti, M; Valore, M [Amministrazione Provinciale, Como (Italy)

1998-04-01

This work illustrates the possibility to interpolate the measured concentrations of CO, NO, NO{sub 2}, O{sub 3}, SO{sub 2} during one year (1995) at the 13 stations of the air quality monitoring station network of the Provinces of Como and Lecco (Italy) by means of a log-normal distribution. Particular attention was given in choosing the method for the determination of the log-normal distribution parameters among four possible methods: I natural, II percentiles, III moments, IV maximum likelihood. In order to evaluate the goodness of fit a ranking procedure was carried out over the values of four indices: absolute deviation, weighted absolute deviation, Kolmogorov-Smirnov index and Cramer-von Mises-Smirnov index. The capability of the log-normal distribution to fit the measured data is then discussed as a function of the pollutant and of the monitoring station. Finally an example of application is given: the effect of an emission reduction strategy in Lombardy Region (the so called `bollino blu`) is evaluated using a log-normal distribution. [Italiano] In questo lavoro si discute la possibilita` di interpolare le concentrazioni misurate di CO, NO, NO{sub 2}, O{sub 3}, SO{sub 2} durante un anno solare (il 1995) nelle 13 stazioni della Rete di Rilevamento della qualita` dell`aria delle Provincie di Como e di Lecco mediante una funzione log-normale. In particolare si discute quale metodo e` meglio usare per l`individuazione dei 2 parametri caratteristici della log-normale, tra 4 teoreticamente possibili: I naturale, II dei percentili, III dei momenti, IV della massima verosimiglianza. Per valutare i risultati ottenuti si usano: la deviazione assoluta, la deviazione pesata, il parametro di Kolmogorov-Smirnov e quello di Cramer-von Mises-Smirnov effettuando un ranking tra i metodi in funzione degli inquinanti e della stazione di misura. Ancora in funzione degli inquinanti e delle diverse stazioni di misura si discute poi la capacita` della funzione log-normale di

Influence of grape genotype, ripening season, seed trace size, and culture date on in ovule embryo development and plant formation Influência do genótipo, época de maturação, tamanho da semente-traço e época da cultura sobre o desenvolvimento do embrião no óvulo e a formação da planta de videira

Directory of Open Access Journals (Sweden)

Celso V. Pommer

1995-01-01

Full Text Available Eighteen seedless grape genotypes differing in ripening season (early, mid and late and in seed trace size (small, medium and large were harvested at 6, 10, 14, 18 and 22 weeks past bloom (wpb. Using embryo rescue techniques it was studied if embryo do abort as the fruit matures and what percent embryos remain viable at later stages. The size of seed trace was also investigated to determine its influence on embryo viability during maturation. It was found that genotype have great influence on embryo culture traits. Late maturing genotypes showed fewer rescued embryos, germinated embryos and transplantable plants than early and mid season ones. The best culture time for grape embryo rescue is 6 and 10 wpb. At these dates, the largest number of embryos, germinated embryos and transplantable plants were obtained. Genotypes with the largest ratio for seed trace weight/seed trace length (i.e., largest density showed the greatest tendency to have the largest number of ovules with embryos, more germinated embryos and more transplantable plants. The study also showed that it is possible to recover plants from mature fruit harvested late, although at a much reduced rate.Dezoito genótipos de uvas (Vitis vinifera L. apirenas, sem sementes diferindo na época de maturação (precoce, média e tardia c no tamanho da semente-traço (pequena, média e grande, foram colhidos a 6, 10, 14, 18 e 22 semanas após o florescimento. Usando técnicas de resgate de embrião, foi estudado se o embrião aborta à medida que o fruto amadurece e quais percentagens de embriões permanecem viáveis em estádios mais avançados. O tamanho da semente-traço também foi investigado para determinar sua influência na viabilidade do embrião durante a maturação. Verificou-se que o genótipo tem grande influência nas características relacionadas com a cultura de embrião. Genótipos de maturação tardia mostraram menos embriões resgatados e germinados e menos pl

Ethnic socialization, perceived discrimination, and psychological adjustment among transracially adopted and nonadopted ethnic minority adults.

Science.gov (United States)

Arnold, Tara; Braje, Sopagna Eap; Kawahara, Debra; Shuman, Tara

2016-01-01

Little is known on how transracial adoptees (TRA) navigate issues of race and ethnicity. Using Shared Fate Theory as a framework, this study was interested in the moderating role of adoption status among a group of ethnic minority adults in explaining the relationship between ethnic socialization, perceived discrimination, and mental health outcomes. Nonadopted (NA; n = 83) and TRA (n = 87) ethnic minorities responded to measures on ethnic socialization, perceived discrimination, and psychological outcomes administered online. TRA and NA ethnic minorities reported similar levels of ethnic socialization, perceived discrimination, and psychological outcomes (depression and self-esteem). Perceived discrimination was significantly associated with depression for both TRA and NA ethnic minorities. Ordinal Least Squares (OLS) regressions that were run for a moderated moderational analysis suggest that the protective role of ethnic socialization depended on adoption status. Among the different forms of ethnic socialization, cultural socialization and preparation for bias significantly buffered against the effects of perceived discrimination, but the effects were more pronounced for TRA than for NA ethnic minorities. Because NA and TRA ethnic minorities were similarly affected by discrimination, it suggests that being a TRA does not confer any additional risk when experiencing discrimination. Additionally, the study found that ethnic socialization may continue to serve a protective role against the effects of discrimination into adulthood for TRA, but less so for NA ethnic minorities. These results have policy implications regarding the role of parental ethnicity in adoption decisions as well as the importance of educating adopted parents about ethnic socialization for ethnic minority children. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

Desenvolvimento de metodologia para previsão do fenômeno de vibrações decorrentes da interferência entre eixos de um trator com tração dianteira auxiliar (TDA Development of methodology to predict power hop of the axle interference of a front wheel assist tractor (FWA

Directory of Open Access Journals (Sweden)

José Fernando Schlosser

2001-12-01

Full Text Available Foi desenvolvido um ensaio de campo com o objetivo de avaliar as condições da ocorrência do fenômeno do "galope" do trator, que consiste em vibrações de baixa freqüência e grande amplitude. Este fenômeno físico é muito comum nos tratores de tração integral, principalmente nos que possuem pneus de diferentes diâmetros no eixo dianteiro e traseiro. Para provocar o "galope", determinaram-se diferentes condições de distribuição de peso, pressão interna dos pneus e da magnitude da carga na barra de tração. Ao final dos ensaios, determinaram-se as condições de ocorrência do fenômeno por meio de uma metodologia bastante simples em função dos raios dos pneus. O método utilizado para a determinação das condições de ocorrência do galope foi plenamente satisfatório, pois pôde prever com bastante precisão as condições em que iria ocorrer o fenômeno.A field experiment was carried out to evaluate the conditions for the appeareance of the power hope phenomenon. It consists in low frequency vibrations and great amplitude. This physical phenomenon is very common in FWA tractors, mainly with unequal tires diameter in front and rear axle. To promote power hope, different weight distribution conditions, different tire pressure and different drawbar force were used. Power hope occurence conditions were determined using simple methodology, which uses tire radio in the calculations.

Efeito da profundidade de trabalho das hastes sulcadoras de uma semeadora-adubadora na patinagem, na força de tração e no consumo de combustível de um trator agrícola Effects of work operation depth of shanks in a seeder-fertilizer on slip, traction force and fuel consumption of a tractor

Directory of Open Access Journals (Sweden)

Marcos Antonio Zambillo Palma

2010-10-01

Full Text Available A consolidação do sistema de semeadura direta trás grandes benefícios ao meio ambiente e, também, é notável a redução dos custos de produção devido a desnecessidade das operações como aração, subsolagem, escarificação e gradagem. Porém, nesse sistema se têm muitos problemas relacionados a compactação das camadas superficiais em função do tráfego de máquinas e a consorciação lavoura-pecuária. A solução encontrada pelos agricultores tem sido a substituição, na semeadora-adubadora, do sulcador disco duplo pela haste sulcadora que atua em profundidades superiores. O presente estudo teve como objetivo avaliar diferentes profundidades de trabalho da haste sulcadora, analisando o consumo de combustível, força de tração, índice de patinagem, potência na barra de tração, consumo específico de combustível e capacidade de campo teórica de um trator agrícola tracionando uma semeadora-adubadora em solo compactado pela integração lavoura-pecuária. Os tratamentos foram 100, 150, 200 e 250 mm de profundidade de trabalho da haste sulcadora, sendo os ensaios desenvolvidos no Departamento de Engenharia da Universidade Federal de Lavras, utilizando delineamento experimental de blocos, casualisados, composto por quatro tratamentos e três repetições. Dessa forma, conclui-se que o aumento da profundidade de trabalho da haste sulcadora em semeadoras-adubadoras de semeadura direta de milho em solos compactados ocorre o aumento no consumo de combustível, no índice de patinagem e no esforço de tração dos tratores agrícolas. Porém, quando a ponteira da haste sulcadora trabalhou posicionada 50 mm abaixo da camada mais compactada se teve reduções nos parâmetros força de tração e índice de patinagem, aumentando a capacidade de campo teórica.The direct sowing system brings many benefits to the environment and also reduction in production costs, since operations such as plowing, subsoiling, chiseling and harrowing

Changes in muscle thickness after exercise and biofeedback in people with low back pain.

Science.gov (United States)

Partner, Shandi L; Sutherlin, Mark Alan; Acocello, Shellie; Saliba, Susan A; Magrum, Eric M; Hart, Joe M

2014-11-01

Individuals with low back pain (LBP) have reduced function of the transversus abdominis (TrA) and lumbar multifidus (LM) muscles. Biofeedback during exercise may increase the ability to contract the TrA and LM muscles compared with exercise alone. To compare TrA preferential activation ratio (PAR) and the percent change in LM-muscle thickness in patients with LBP history before and after exercise with or without biofeedback. Controlled laboratory study. University research laboratory. 20 LBP individuals, 10 exercise alone and 10 exercise with biofeedback. Patients were allotted to tabletop exercises in isolation or tabletop exercises with visual, auditory, and tactile biofeedback. TrA PAR and percent change in LM-muscle thickness. There were no differences between groups at baseline (all P > .05). Nonparametric statistics showed decreased resting muscle thickness for total lateral abdominal-wall muscles (P = .007) but not TrA (P = .410) or LM (P = .173). Percent TrA thickness increased from table to standing positions before (P = .006) and after exercise (P = .009). TrA PAR increased after exercise (pre 0.01 ± 0.02, post 0.03 ± 0.04, P = .033) for all patients and for exercise with biofeedback (pre 0.02 ± 0.01, post 0.03 ± 0.01, P = .037) but not for exercise alone (pre 0.01 ± 0.02, post 0.02 ± 0.05, P = .241). No group differences were observed for TrA PAR before (exercise 0.01 ± 0.02, exercise with biofeedback 0.02 ± 0.01, P = .290) or after exercise (exercise 0.02 ± 0.05, exercise with biofeedback 0.03 ± 0.01, P = .174). There were no group differences in LM percent change before exercise (P = .999) or after exercise (P = .597). In addition, no changes were observed in LM percent change as a result of exercise among all participants (P = .391) or for each group (exercise P = .508, exercise with biofeedback P = .575). TrA PAR increased after a single session of exercises, whereas no thickness changes occurred in LM.

Anquilose intencional dos caninos decíduos como reforço de ancoragem para a tração reversa da maxila: estudo cefalométrico prospectivo Intentional ankylosis of the deciduous canines to enhance maxillary protraction: a prospective cephalometric analysis

Directory of Open Access Journals (Sweden)

Omar Gabriel da Silva Filho

2006-12-01

Full Text Available OBJETIVO: o presente trabalho de pesquisa analisou os efeitos da tração reversa da maxila associada à anquilose intencional dos caninos decíduos superiores, mediante o emprego da cefalometria. METODOLOGIA: o protocolo de tratamento incluiu: 1 anquilose intencional dos caninos decíduos superiores; 2 expansão rápida da maxila e 3 tração reversa da maxila, imediatamente após o término da fase ativa da expansão. A amostra foi composta de 18 crianças nos estágios de dentadura decídua e dentadura mista, com idade média inicial de 7 anos e 1 mês. O intervalo médio de tratamento com a tração reversa da maxila foi de 1 ano e 1 mês. As telerradiografias laterais foram obtidas na documentação inicial e após a correção da Classe III. RESULTADOS E CONCLUSÕES: os resultados demonstram que os ângulos representativos da convexidade facial, NAP e ANB, aumentaram de 0º para 6,6º e 3,5º, respectivamente. Isso significa dizer que a face transformou-se de reta ou côncava, peculiar na Classe III, para uma face convexa, característica de normalidade no estágio avaliado. Essa melhora na convexidade facial é atribuída ao avanço da maxila, registrado tanto na região alveolar (ângulo SNA e as distâncias Co-A e NPerp-A como na região basal (ângulo SN.ENA. A maxila deslocou-se para frente, enquanto a redução do ângulo SNB de 80,56º para 79,61º demonstrou um retroposicionamento mandibular. Além da mudança no sentido sagital, houve rotação da mandíbula no sentido horário, com aumento dos ângulos SN.GoGn e SN.Gn. Somado aos efeitos ortopédicos, houve inclinação vestibular dos incisivos superiores.AIM: the current article analyses the effects of maxillary protraction associated to the intentional ankylosis of the deciduous canines on the basis of cephalometric measurements. METHODS: the treatment protocol included: 1 intentional ankylosis of the upper deciduous canines; 2 rapid palatal expansion and 3 maxillary

Breaking Bad: Intertextuality, Intermediality and Crossmediality, and the Taste of Unpredictability

Directory of Open Access Journals (Sweden)

Nicola M. Dusi

2016-07-01

Full Text Available Breaking Bad è una serie per molti aspetti indecidibile nel genere, che presenta un’intertestualità aperta e cangiante, tra serialità televisiva e cinema d’autore (ad esempio tra western e poliziesco, e si apre all’innovazione intermediale, data non solo dall’ibridazione dei generi e della fiction seriale con il cinema, ma dai modi metadiscorsivi (o 'metacinematografici' e da soluzioni che lavorano sui bordi dei media e sulla loro porosità grazie alle nuove tecnologie digitali. Passando attraverso esempi di modi traduttivi e reinterpretativi, intertestuali e intermediali, transmediali e crossmediali, cercherò di analizzare alcuni meccanismi di funzionamento degli attuali ecosistemi mediali seriali in Breaking Bad. Ad esempio nelle citazioni dirette e indirette, nelle aperture intertestuali e intermediali, ma anche nei teaser e nei recaps, nei webisode e nelle proliferazioni crossmediali delle pratiche dei remixer, distinguendo tra ripetizione e innovazione, tra modi centripeti e centrifughi dello storytelling e, per i remix, tra modi della selezione e modi della collezione.

Dual combination therapy targeting DR5 and EMMPRIN in pancreatic adenocarcinoma.

Science.gov (United States)

Kim, Hyunki; Zhai, Guihua; Samuel, Sharon L; Rigell, Christopher J; Umphrey, Heidi R; Rana, Samir; Stockard, Cecil R; Fineberg, Naomi S; Zinn, Kurt R

2012-02-01

The goal of the study was to assess the efficacy of combined extracellular matrix metalloprotease inducer (EMMPRIN)- and death receptor 5 (DR5)-targeted therapy for pancreatic adenocarcinoma in orthotopic mouse models with multimodal imaging. Cytotoxicity of anti-EMMPRIN antibody and anti-DR5 antibody (TRA-8) in MIA PaCa-2 and PANC-1 cell lines was measured by ATPlite assay in vitro. The distributions of Cy5.5-labeled TRA-8 and Cy3-labeled anti-EMMPRIN antibody in the 2 cell lines were analyzed by fluorescence imaging in vitro. Groups 1 to 12 of severe combined immunodeficient mice bearing orthotopic MIA PaCa-2 (groups 1-8) or PANC-1 (groups 9-12) tumors were used for in vivo studies. Dynamic contrast-enhanced-MRI was applied in group 1 (untreated) or group 2 (anti-EMMPRIN antibody). The tumor uptake of Tc-99m-labeled TRA-8 was measured in group 3 (untreated) and group 4 (anti-EMMPRIN antibody). Positron emission tomography/computed tomography imaging with (18)F-FDG was applied in groups 5 to 12. Groups 5 to 8 (or groups 9 to 12) were untreated or treated with anti-EMMPRIN antibody, TRA-8, and combination, respectively. TRA-8 showed high killing efficacy for both MIA PaCa-2 and PANC-1 cells in vitro, but additional anti-EMMPRIN treatment did not improve the cytotoxicity. Cy5.5-TRA-8 formed cellular caps in both the cell lines, whereas the maximum signal intensity was correlated with TRA-8 cytotoxicity. Anti-EMMPRIN therapy significantly enhanced the tumor delivery of the MR contrast agent, but not Tc-99m-TRA-8. Tumor growth was significantly suppressed by the combination therapy, and the additive effect of the combination was shown in both MIA PaCa-2 and PANC-1 tumor models.

Responses of sri lankan traditional rice to photoperiod at early vegetative stage

International Nuclear Information System (INIS)

Rathnathunga, U.U.E.; Geekiyanage, S.

2017-01-01

Rice is a photoperiod sensitive plant for flowering initiation. Effect of photoperiod can be important in vegetative growth and yield determination in rice. The objective of the research was to determine the effect of photoperiod on the vegetative responses of Sri Lankan traditional rice germplasm (SLTRG). Forty five traditional rice accessions (TRA), 5 improved rice varieties (IR), Sri Lankan wild rice (Oryza nivara and Oryza rufipogan) and Oryza japonica accessions 6782 and 6752 were grown in short day (SD), day neutral (DN) and long day (LD) conditions. Days to reach the fifth leaf stage (DFL), plant height (PH) and tiller number (TN) at the fifth leaf stage were recorded. Twenty three genotypes including 21 TRA, Oryza japonica 6752 and Oryza nivara did not respond to photoperiod having non-significant values for DFL, PH and TN among photoperiods. The DFL was affected in 25 genotypes; among them both DFL and PH were affected in 7 genotypes. DFL was significantly increased during LD in 4 TRA while DFL was significantly reduced in all 5 IR and 5 TRA. DFL was significantly increased in Oryza japonica 6782 and 5 TRA under SD. In 4 TRA, DFL was reduced under SD. The TN was affected in Oryza japonica 6782 only under SD with increased DFL. The DFL was significantly increased under DN in Oryza rufipogan, 5 TRA and 2 IR. Both SD and LD photoperiods differently affected the interaction between DFL and PH in TRA while only LD affected that of IR. DN had an effect on the interaction between DFL and PH only in wild rice Oryza rufipogon. Variation of vegetative growth response to photoperiod may depict the wide genetic basis of SLTRG. (author)

La “grande bellezza” del paesaggio italiano nel cinema contemporaneo: tra falsificazione e finanziamento locale / The “great beauty” of Italian landscape in contemporary movies: between falsification and local funding

Directory of Open Access Journals (Sweden)

Eleonora Mastropietro

2016-05-01

Full Text Available I film hanno rappresentato l’evoluzione del paesaggio italiano per gran parte del novecento. Negli ultimi due decenni i film italiani hanno però smesso di esplorare le trasformazioni del territorio. La debolezza dell’industria cinematografica spiega in parte l’assenza del contemporaneo dagli schermi. Inoltre il diffuso ricorso al supporto economico degli enti pubblici, che spesso vedono i film come strumenti di promozione turistica, sembra influenzare le modalità di rappresentazione del paesaggio. Il contributo presenta una ricerca condotta sui film di maggior successo tra il 1990 e il 2014 alla ricerca dell’immagine del paesaggio italiano in essi prevalente e evidenzia alcune cause alla base di questa rappresentazione omogenea. Films have portrayed the evolution of the Italian urban landscape in the last 100 years. Nevertheless, contemporary movies partially ignore the recent transformations and represent instead a stereotyped image of Italian landscapes. The structure of the local movie industry could provide a first explanation of this phenomenon. Moreover, the financial support of productions provided by local government influences the choice of including or excluding elements of the landscape in the movies screen. The paper explores the new representations of landscape in Italian movies, in order to show which features of the changing contemporary Italian landscapes are visible and which are hidden.

O legado da rememoração: traços e vestígios memoriais nas américas The legacy of rememoration: traces and memory vestiges in the americas

Directory of Open Access Journals (Sweden)

Sandra Regina Goulart Almeida

2013-06-01

Full Text Available À luz da temática dos rastros e da memória como herança familiar, percurso individual e legado histórico, o trabalho discute romances de escritoras contemporâneas das Américas, a partir da articulação do conceito de "rememoração" de Toni Morrison e das teorizações sobre a noção de traço e o rastro, segundo Freud, Ricouer, Benjamin, Derrida e Spivak.A la luz del tema de los rastros y de la memoria como herencia familiar, recorrido individual y legado histórico, el trabajo analiza novelas de escritoras contemporáneas de las Américas, a partir de la articulación del concepto de "rememoración" de Toni Morrison y de las teorizaciones sobre las nociones de trazo y rastro de Freud, Ricouer, Benjamin, Derrida y Spivak.Based on the theme of traces and memory as family heritage, individual trajectory, and historical legacy, this work analyzes novels by contemporary women writers from the Americas with a view to articulating the concept of rememoration by Toni Morrison and the theorizations about the notion of trace by Freud, Ricouer, Benjamin, Derrida and Spivak.

Transversus abdominis is part of a global not local muscle synergy during arm movement.

Science.gov (United States)

Morris, S L; Lay, B; Allison, G T

2013-10-01

The trunk muscle transversus abdominis (TrA) is thought to be controlled independently of the global trunk muscles. Methodological issues in the 1990s research such as unilateral electromyography and a limited range of arm movements justify a re-examination of this theory. The hypothesis tested is that TrA bilateral co-contraction is a typical muscle synergy during arm movement. The activity of 6 pairs of trunk and lower limb muscles was recorded using bilateral electromyography during anticipatory postural adjustments (APAs) associated with the arm movements. The integrated APA electromyographical signals were analyzed for muscle synergy using Principle Component Analysis. TrA does not typically bilaterally co-contract during arm movements (1 out of 6 participants did). APA muscle activity of all muscles during asymmetrical arm movements typically reflected a direction specific diagonal pattern incorporating a twisting motion to transfer energy from the ground up. This finding is not consistent with the hypothesis that TrA plays a unique role providing bilateral, feedforward, multidirectional stiffening of the spine. This has significant implications to the theories underlying the role of TrA in back pain and in the training of isolated bilateral co-contraction of TrA in the prophylaxis of back pain. Crown Copyright © 2013. Published by Elsevier B.V. All rights reserved.

Effects of Addition of Systemic Tramadol or Adjunct Tramadol to Lidocaine Used for Intravenous Regional Anesthesia in Patients Undergoing Hand Surgery

Directory of Open Access Journals (Sweden)

Abdulkadir Yektaş

2016-01-01

Full Text Available Intravenous regional anesthesia (IVRA is used in outpatient hand surgery as an easily applicable and cost-effective technique with clinical advantages. The present study aimed to investigate the effects of addition of systemic tramadol or adjunct tramadol to lidocaine for IVRA in patients undergoing hand surgery. American Society of Anesthesiologists (ASA I-II patients (n=60 who underwent hand surgery were included. For this purpose, only lidocaine (LDC, lidocaine+adjunct tramadol (LDC+TRA group, or lidocaine+systemic tramadol (LDC+SysTRA group was administered to the patients for IVRA and the groups were compared in terms of onset and recovery time of sensory and motor blocks, quality of anesthesia, and the degree of intraoperative and postoperative pain. The onset time of sensorial block was significantly shorter in the LDC+TRA group than that in the LDC+SysTRA group. The motor block recovery time was significantly shorter in the LDC+SysTRA group than that in the LDC+TRA and LDC groups. Administration of tramadol as an adjunct showed some clinical benefits by providing a shorter onset time of sensory and motor block, decreasing pain and analgesic requirement, and improving intraoperative conditions during IVRA. It was determined that systemic tramadol administration had no superiority.

Feedforward responses of transversus abdominis are directionally specific and act asymmetrically: implications for core stability theories.

Science.gov (United States)

Allison, Garry T; Morris, Sue L; Lay, Brendan

2008-05-01

Experimental laboratory study supplemented with a repeated case study. To examine bilateral muscle activity of the deep abdominals in response to rapid arm raising, specifically to examine the laterality and directional specificity of feedforward responses of the transversus abdominis (TrA). Based on the feedforward responses of trunk muscles during rapid arm movements, authors have concluded that the deep trunk muscles have different control mechanisms compared to the more superficial muscles. It has been proposed that deep trunk muscles such as TrA contribute substantially to the stability of the lumbar spine and that this is achieved through simultaneous bilateral feedforward activation. These inferences are based on unilateral fine-wire electromyographic (EMG) data and there are limited investigations of bilateral responses of the TrA during unilateral arm raising. Bilateral fine-wire and surface EMG data from the anterior deltoid, TrA, obliquus internus (OI), obliquus externus, biceps femoris, erector spinae, and rectus abdominis during repeated arm raises were recorded at 2 kHz. EMG signal linear envelopes were synchronized to the onset of the anterior deltoid. A feedforward window was defined as the period up to 50 ms after the onset of the anterior deltoid, and paired onsets for bilateral muscles were plotted for both left and right arm movements. Trunk muscles from the group data demonstrated differences between sides (laterality), which were systematically altered when alternate arms were raised (directional specificity). This was clearly evident for the TrA but less obvious for the erector spinae. The ipsilateral biceps femoris and obliquus externus, and contralateral OI and TrA, were activated earlier than the alternate side for both right and left arm movements. This was a consistent pattern over a 7-year period for the case study. Data for the rectus abdominis derived from the case study demonstrated little laterality or directionally specific

AcEST: DK963038 [AcEST

Lifescience Database Archive (English)

Full Text Available tr_hit_id A5WW09 Definition tr|A5WW09|A5WW09_DANRE Novel protein similar to autism susceptibility candidate ... Novel protein similar to autism susceptib... 42 0.028 tr|A9H6U3|A9H6U3_GLUDA Put...Putative uncharacterized protein OS=Planc... 33 9.9 >tr|A5WW09|A5WW09_DANRE Novel protein similar to autism

AcEST: BP912927 [AcEST

Lifescience Database Archive (English)

Full Text Available t : TrEMBL tr_hit_id A6GRE8 Definition tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limnobacter...bacter... 33 9.4 >tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limnobacter ........done Score E Sequences producing significant alignments: (bits) Value tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limno

Estabilidade dimensional e resistência à tração perpendicular de painéis fabricados com partículas termorretificadas oriundas de embalagens de Pinus sp.

Directory of Open Access Journals (Sweden)

Benedito Rocha Vital

2014-10-01

Full Text Available O objetivo deste trabalho foi avaliar o efeito do tratamento térmico em algumas propriedades de painéis de partículas, produzidos com resíduos de embalagens de Pinus sp. Foi utilizado o adesivo à base de ureia-formaldeído, na quantidade de 8%. O experimento foi desenvolvido em um fatorial 4 x 3 x 3, sendo quatro proporções de partículas (25, 50, 75 e 100%, termorretificadas, três temperaturas de tratamento térmico (180, 200 e 220 ºC e três repetições, totalizando 36 painéis. Foram produzidos mais três painéis com partículas sem tratamento térmico (testemunhas, totalizando 39 painéis. A absorção de água, inchamento em espessura e resistência à tração perpendicular foram determinadas de acordo com a Norma ABNT/NBR 14810-3 (2002. Os resultados desses testes foram comparados com os valores estabelecidos nas Normas ABNT/NBR 14810-3 (2002 e DIN 68 761 (1 (1961. A estabilidade dimensional dos painéis aumentou com a adição de partículas termorretificadas, enquanto as propriedades mecânicas foram reduzidas. O efeito da adição de partículas termorretificadas nas propriedades dos painéis é maior à medida que se utilizam maiores temperaturas de tratamento térmico.

Barn swallows nesting near radioactive leaching ponds in southeastern Idaho

International Nuclear Information System (INIS)

Millard, J.B.; Whicker, F.W.; Markham, O.D.

1978-01-01

Seasonally occurring populations of barn swallows nest near the Test Reactor Area (TRA) radioactive leaching ponds on the Idaho National Engineering Laboratory (INEL) Site. These birds utilize leaching pond arthropods and are therefore capable of accumulating radioactive materials and exporting them from the INEL Site during migration. The breeding biology is discussed for these swallows and a control group located 100 km away. Total nestling mortality for the controls and a 1977 TRA population was found to be statistically identical. Over 20 fission and activation products have been detected in immature and adult TRA birds. Mean concentrations of detectable radionuclides were used to calculate internal dose rates, and results showed that Na-24 contributed about 72% of the total average of 21.9 mrad/d for adult birds. Concentration factors were also calculated for predominant radionuclides in swallows relative to filtered pond water. Data from LiF dosimeters in swallow nests constructed with contaminated mud indicated average dose rates were 84 mrad/d for eggs and 220 mrad/d for nestlings. Growth curves were constructed for the immature TRA birds and controls. The first clutch of TRA swallows was found to have a significantly lower mean growth rate constant than the first clutch of controls. The statistical difference in growth rate between the control and TRA first clutch populations may have resulted from differences in climate, nesting site habitat, or available food sources, and cannot be solely attributed to radiation exposure as a causative factor. Growth rate parameters for TRA birds were within the range of values reported in the literature

Pourquoi les étudiants de régions rurales montrent des aspirations scolaires plus faibles que ceux provenant de régions urbaines? Une explication basée sur une perspective motivationnelle et relationnelle

OpenAIRE

Litalien, David

2008-01-01

Tableau d’honneur de la Faculté des études supérieures et postdoctorales, 2007-2008. Plusieurs études démontrent que les étudiants des régions éloignées ont moins d’aspirations scolaires que ceux des villes (Arnold et al., 2005). Nous tentons de compléter l’étude des déterminants des aspirations à l’aide de la théorie de l’autodétermination (Deci & Ryan, 1985). Notre modèle motivationnel propose que comparativement aux étudiants urbains, ceux des régions vivent plus de problèmes sur le...

Estudo preliminar do controle biológico da traça-do-tomateiro com o parasitóide Trichogramma pretiosum em ambientes protegidos A preliminar survey on the biological control of South American tomato pinworm with the parasitoid Trichogramma pretiosum in greenhouse models

Directory of Open Access Journals (Sweden)

Maria Alice de Medeiros

2009-03-01

Full Text Available O cultivo de tomate em ambiente protegido é economicamente vantajoso para os produtores. No entanto, o ambiente interno da casa de vegetação, quente e seco, favorece o crescimento populacional da traça-do-tomateiro Tuta absoluta (Meyrick dificultando seu controle, geralmente realizado com inseticidas químicos. O controle biológico da traça-do-tomateiro utilizando o parasitóide Trichogramma pretiosum Riley é indicado como método alternativo aos inseticidas e foi avaliado em ambiente protegido. O experimento foi conduzido com plantas de tomateiro tutoradas, cv. Larissa, em três modelos de casas de vegetação (arco, capela e convectivo, com 288 plantas em uma área de 160 m² em cada modelo. Todos os tratamentos foram associados com uma aplicação semanal do inseticida biológico Bacillus thuringiensis e liberações semanais do parasitóide: 1 casa de vegetação com teto convectivo: 200 cm² de ovos parasitados em liberação única, ou seja, apenas uma vez por semana; 2 teto em arco: 200 cm² de ovos parasitados liberados duas vezes por semana, ou seja, 100 cm² a cada liberação; 3 capela: 400 cm² de ovos parasitados liberados duas vezes por semana, ou seja, 200 cm² a cada liberação. A população da traça-do-tomateiro foi amostrada semanalmente, coletando-se 50 folíolos de tomateiro ao acaso, em cada casa de vegetação. Em laboratório, os ovos foram contados, individualizados e mantidos em câmara climatizada para se determinar o número de larvas emergidas e o número de ovos parasitados. A produtividade e o dano causado pela traça foram avaliados em 50 frutos colhidos ao acaso em cada tratamento. A eficiência técnica e econômica do sistema de produção foi analisada em cada modelo de casa de vegetação. Os principais resultados foram: a as diferentes condições de temperatura e umidade proporcionadas pelas casas de vegetação têm influência sobre o desempenho do parasitóide; b o uso exclusivo do controle biol

L’economia napoletana e il commercio internazionale tra ‘800 e ‘900: I Magazzini Generali e il Deposito Franco = The Neapolitan economy and international trade between 800 and 900: The Magazzini Generali and the Free Warehouse

Directory of Open Access Journals (Sweden)

Serena Potito

2013-12-01

Full Text Available I Magazzini Generali, creati su modello dei docks inglesi e dei magazzini francesi -e regolamentati da una legge del 1871- si diffusero nelle maggiori città italiane, con alterna fortuna: comune era lo scopo di provvedere alla custodia delle merci, rilasciando speciali titoli di commercio, e di agevolare l’incontro tra produttore e acquirente, riducendo i tempi di negoziazione. Essi sono, dunque, da annoverare fra gli strumenti commerciali con cui si intendeva intensificare e favorire i traffici di merci nel periodo in cui il commercio internazionale su larga scala andava riducendo le barriere tra paesi, accompagnato dallo sviluppo e ammodernamento delle infrastrutture. Nell’ambito del dibattito sul tentativo italiano di ritagliarsi un ruolo durante la prima globalizzazione -con la crescita della liberalizzazione del commercio internazionale e, nello stesso tempo, lo sviluppo del protezionismo moderno- la presente ricerca mette a fuoco l’esperienza della costituzione dei Magazzini Generali di Napoli, per alcuni decenni i più importanti d’Italia. La Società Meridionale dei Magazzini Generali ne assunse la gestione nel 1874 e -attraverso lo studio di testimonianze dell’epoca, degli Atti del Consiglio Comunale e della Camera di Commercio, di dati di bilancio presenti nell’Archivio di Stato di Napoli- questo saggio ne ripercorre l’iter costitutivo e le vicende dei primi anni. Oltre a offrire un quadro della situazione politica ed economica del Mezzogiorno d’Italia, ed in particolare di Napoli, nella congiuntura economica tra fine ‘800 e inizio ‘900, emergono spunti interessanti relativi all’ammodernamento delle infrastrutture portuali cittadine, e alla questione della creazione di un punto franco (uno degli ipotetici cardini dello sviluppo industriale della città: in un quadro di occasioni mancate ed ostacoli legati alle caratteristiche del processo storico, dal confronto con economie di differenti realtà europee

L’economia napoletana e il commercio internazionale tra ‘800 e ‘900: I Magazzini Generali e il Deposito Franco = The neapolitan economy and international trade between 800 and 900: The Magazzini Generali and the Free Warehouse

Directory of Open Access Journals (Sweden)

Serena Potito

2014-07-01

Full Text Available Resumo I Magazzini Generali, creati su modello dei docks inglesi e dei magazzini francesi e regolamentati da una legge del 1871 si diffusero nelle maggiori città italiane, con alterna fortuna: comune era lo scopo di provvedere alla custodia delle merci, rilasciando speciali titoli di commercio, e di agevolare l’incontro tra produttore e acquirente, riducendo i tempi di negoziazione. Essi sono, dunque, da annoverare fra gli strumenti commerciali con cui si intendeva intensificare e favorire i traffici di merci nel periodo in cui il commercio internazionale su larga scala andava riducendo le barriere tra paesi, accompagnato dallo sviluppo e ammodernamento delle infrastrutture. Nell’ambito del dibattito sul tentativo italiano di ritagliarsi un ruolo durante la prima globalizzazione con la crescita della liberalizzazione del commercio internazionale e, nello stesso tempo, lo sviluppo del protezionismo moderno la presente ricerca mette a fuoco l’esperienza della costituzione dei Magazzini Generali di Napoli, per alcuni decenni i più importanti d’Italia. La Società Meridionale dei Magazzini Generali ne assunse la gestione nel 1874 e attraverso lo studio di testimonianze dell’epoca, degli Atti del Consiglio Comunale e della Camera di Commercio, di dati di bilancio presenti nell’Archivio di Stato di Napoli questo saggio ne ripercorre l’iter costitutivo e le vicende dei primi anni. Oltre a offrire un quadro della situazione politica ed economica del Mezzogiorno d’Italia, ed in particolare di Napoli, nella congiuntura economica tra fine ‘800 e inizio ‘900, emergono spunti interessanti relativi all’ammodernamento delle infrastrutture portuali cittadine, e alla questione della creazione di un punto franco (uno degli ipotetici cardini dello sviluppo industriale della città: in un quadro di occasioni mancate ed ostacoli legati alle caratteristiche del processo storico, dal confronto con economie di differenti realtà europee

Correlazione tra potere fonoisolante e rumorosità da pioggia pesante in coperture con finitura metallica - Correlation between airborne sound insulation and heavy rain noise on coverings with metallic finishing

Directory of Open Access Journals (Sweden)

Roberto Baruffa

2017-02-01

Full Text Available Due camere riverberanti sovrapposte, con la possibilità di disporre i campioni di coperture inclinati, come nelle condizioni reali di posa, consentono di effettuare, in successione, prove di potere fonoisolante e di livello di intensità sonora di rumore di pioggia pesante. È quindi possibile individuare gli effetti sulle due grandezze acustiche delle differenti tipologie di coibentazione interna oppure del materiale antirombo impiegato. A causa della difficoltà di reperire in letteratura tecnica i dati del livello globale di intensità sonora di rumore di pioggia ponderato A, LIA, si è determinata una correlazione tra LIA e l’indice di valutazione del potere fonoisolante RW e la massa per unità di area dei campioni m. ------ Two overlying reverberation rooms, with the possibility to place the roof's sample tilted, as in the real installation conditions, allow to carry out in succession, the tests of sound insulation and of sound intensity level of heavy rain noise. So is possible to identify the effects on the two acoustics quantities of the different internal insulation or of the dumping materials used. Due to the difficulty of finding in technical literature the values of the weighted A overall sound intensity level of rain noise LIA, a correlation between LIA and the single number rating of sound insulation RW and the mass per unit area of samples m was determined.

Tra advergame e mappe online: contaminazioni tra Street View e discorso pubblicitario

Directory of Open Access Journals (Sweden)

Gabriele Ferri

2013-03-01

Full Text Available Molti servizi di cartografia online – Google Maps, Bing Maps, Nokia Maps, Yandex Maps e altri ancora – permettono di esplorare alcuni luoghi da un punto di vista quasi in soggettiva, come se l'utente si trovasse effettivamente sul posto.

A comparative test of the theory of reasoned action and the theory of planned behavior in the prediction of condom use intentions in a national sample of English young people.

Science.gov (United States)

Sutton, S; McVey, D; Glanz, A

1999-01-01

Based on the theories of reasoned action (TRA) and planned behavior (TPB), predictors of condom use intentions were investigated in 949 young people (16-24 years of age) from a national survey conducted in England. Contrary to expectations, the TPB did not perform significantly better than the TRA, even among women. Measures of past behavior were the best predictors of intentions and attenuated the effects of attitude and subjective norm. There was only weak evidence for the multiplicative assumption underlying the TRA and TPB. Although the TRA components were not the strongest predictors, the beliefs on which they are based are potentially amenable to change through information-based intervention programs. A number of practical suggestions for developing intervention strategies are offered.

Comparison of forcefields for molecular dynamics simulations of hydrocarbon phase diagrams

Science.gov (United States)

Pisarev, V. V.; Zakharov, S. A.

2018-01-01

Molecular dynamics calculations of vapor-liquid equilibrium of methane-n-butane mixture are performed. Three force-field models are tested: the TraPPE-UA united-atom forcefield, LOPLS-AA all-atom forcefield and a fully flexible version of the TraPPE-EH all-atom forcefield. All those forcefields reproduce well the composition of liquid phase in the mixture as a function of pressure at the 300 K isotherm, while significant discrepancies from experimental data are observed in the saturated vapor compositions with OPLS-AA and TraPPE-UA forcefields. The best agreement with the experimental phase diagram is found with TraPPE-EH forcefield which accurately reproduces compositions of both liquid and vapor phase. This forcefield can be recommended for simulation of two-phase hydrocarbon systems.

AcEST: DK952607 [AcEST

Lifescience Database Archive (English)

Full Text Available 3e-33 tr|A7Y7Y0|A7Y7Y0_SOLLC KDEL-tailed cysteine endopeptidase OS=Sol... 144 6e-33 tr|A1Y2K8|A1Y2K8_9ROSI ...idase OS=Vigna radiata ... 142 2e-32 tr|A1Y2K4|A1Y2K4_9ROSI VXH-A (Fragment) OS=Vasconcellea x heilbo... 142

Raccontare la storia al tempo delle crisi

OpenAIRE

La Valle, Paolo

2015-01-01

La ricerca analizza il tema della relazione tra storia e narrazione nella letteratura degli ultimi quindici anni in tre contesti nazionali: Italia, Spagna e Portogalo. Per indagare un campo così vasto si sono identificate tre direttrici principali connesse tra loro, coincidenti con tre "crisi": la crisi del rapporto tra letteratura e mercato, la crisi del concetto di verità e la crisi dello stato nazione. Attraverso le riflessioni sul postmoderno (Lyotard, Jameson Hutcheon) e l’analisi di...

La legge e la giustizia in TV. The Wire a confronto con CSI e Ally McBeal

OpenAIRE

Gianluigi Rossini

2012-01-01

Scopo di questo intervento è individuare il modo in cui la legge è rappresentata in The Wire, serie poliziesca trasmessa negli Stati Uniti tra il 2002 e il 2008 da HBO. Particolare oggetto di interesse dell'analisi è la tematizzazione del rapporto tra il concetto di 'legge' e quello di 'giustizia', ovverosia tra la 'legge positiva' e la 'legge naturale'. Questa tematizzazione viene, però, inquadrata all'interno del contesto della serialità televisiva statunitense, analizzando in via prelimina...

Resistência a abamectin e cartap em populações de traça-das-crucíferas Susceptibility to cartap and abamectin in Diamondback Moth strains

Directory of Open Access Journals (Sweden)

Marina Castelo Branco

2002-12-01

Full Text Available A suscetibilidade de populações de traça-das-crucíferas a cartap e abamectin provenientes de cinco campos de repolho, com diferentes histórias de uso de inseticidas, foi comparada através de um bioensaio em que se usou a imersão das folhas em caldas de inseticidas. Foram utilizadas seis concentrações para cada produto, mais um tratamento água como controle, com três a sete repetições. Discos de folha de repolho (2 cm de diâmetro retirados de plantas com 35 dias de idade foram imersos nas caldas por 10 segundos. Após secarem por duas horas, os discos foram colocados em placas de Petri e 10 larvas de segundo estádio de traça-das-crucíferas foram colocadas sobre estes. Após isto, as placas foram mantidas em uma câmara com temperatura de 20 ± 1ºC e fotofase de 13 h. A mortalidade larval foi avaliada após 48 h para cartap e 72 h para abamectin. Os resultados dos ensaios foram avaliados usando o método "probit". Os índices de resistência foram calculados dividindo-se a CL50 de cada população pela CL50 da população mais suscetível. A população mais suscetível foi coletada em área sem aplicação destes produtos. O índice de resistência para cartap variou de 2,8 a 7,1, sendo que este último foi observado em uma população coletada em área tratada diversas vezes com o inseticida. Os índices de resistência para abamectin variou de 1,1 a 12,1; porém, a população mais resistente foi coletada em área sem nenhuma aplicação do produto. Uma das causas deste resultado poderia ser a migração de indivíduos resistentes para a área de cultivo.Susceptibility of Diamondback Moth to cartap and abamectin, from five areas with different histories of insecticide spray, was compared using a leaf-dip bioassay. Six concentrations of each insecticide plus water control were evaluated with three to seven replications per concentration. Cabbage leaf disks (2 cm diameter from 35-day old plants were immersed in test solutions

Influence of increment thickness on radiant energy and microhardness of bulk-fill resin composites.

Science.gov (United States)

Karacolak, Gamze; Turkun, L Sebnem; Boyacioglu, Hayal; Ferracane, Jack L

2018-03-30

Determining the energy transferred at the bottom of eleven bulk-fill resin composites, comparing top and bottom microhardness's and evaluating the correlation between microhardness and radiant energy were aimed. Samples were placed over the bottom sensor of a visible light transmission spectrophotometer and polymerized for 20 s. The bottom and top Knoop microhardness were measured. Paired t-test and correlation analysis were used for statistics (p≤0.05). In all groups, the bottom radiant energy decreased significantly with increasing thickness. For groups of Aura 2 mm, X-tra Fil 2 and 4 mm, SDR 2 and 4 mm, X-tra Base 2 mm no significant difference was found between top and bottom microhardness. For the bottom levels of Aura, X-tra Fil, Filtek Bulk-Fill Posterior, SDR, X-tra Base groups no significant difference was found between the microhardness's of 2 and 4 mm thicknesses. For X-tra Fil, Tetric Evo Ceram Bulk-Fill, Filtek Bulk-Fill Flowable and Z100 groups radiant energy affected positively the microhardness.

Political Turmoil and Lack of Rights in Nigerian Literature

Directory of Open Access Journals (Sweden)

Nicola Turi

2012-05-01

Full Text Available La letteratura nigeriana del Novecento è stata fortemente condizionata dagli eventi collettivi che hanno scandito la storia recente del paese – dalla colonizzazione inglese alla guerra del Biafra, fino agli scontri armati tra il governo centrale e le forze del Mosop sul Delta del Niger – e che hanno di volta in volta a che fare con la sostituzione e/o la sospensione dell’ordinamento giuridico vigente, con la controversa applicazione del diritto internazionale, con la repressione legalizzata del dissenso. Coprendo il cinquantennio che va da Things fall apart (1958 di Chinua Achebe (nel quale si racconta l’avvento dei primi missionari inglesi alle testimonianze (narrative e non di Wole Soyinka (1972, Ken Saro-Wiwa (1985 e Chimamanda Ngozi Adichie (2006 intorno alla guerra civile del 1967-1970, il presente studio intende offrire, mettendo tra loro in dialogo i testi citati, le declinazioni esemplari della dialettica tra letteratura e diritto all’interno di un panorama letterario pressoché condannato a figurare la legge come chimera, abuso, scontro tra codici (morali e poi legislativi tra loro incompatibili.

Maternal provision of non-sex-specific transformer messenger RNA in sex determination of the wasp Asobara tabida.

Science.gov (United States)

Geuverink, E; Verhulst, E C; van Leussen, M; van de Zande, L; Beukeboom, L W

2018-02-01

In many insect species maternal provision of sex-specifically spliced messenger RNA (mRNA) of sex determination genes is an essential component of the sex determination mechanism. In haplodiploid Hymenoptera, maternal provision in combination with genomic imprinting has been shown for the parasitoid Nasonia vitripennis, known as maternal effect genomic imprinting sex determination (MEGISD). Here, we characterize the sex determination cascade of Asobara tabida, another hymenopteran parasitoid. We show the presence of the conserved sex determination genes doublesex (dsx), transformer (tra) and transformer-2 (tra2) orthologues in As. tabida. Of these, At-dsx and At-tra are sex-specifically spliced, indicating a conserved function in sex determination. At-tra and At-tra2 mRNA is maternally provided to embryos but, in contrast to most studied insects, As. tabida females transmit a non-sex-specific splice form of At-tra mRNA to the eggs. In this respect, As. tabida sex determination differs from the MEGISD mechanism. How the paternal genome can induce female development in the absence of maternal provision of sex-specifically spliced mRNA remains an open question. Our study reports a hitherto unknown variant of maternal effect sex determination and accentuates the diversity of insect sex determination mechanisms. © 2017 The Authors. Insect Molecular Biology published by John Wiley & Sons Ltd on behalf of Royal Entomological Society.

Parasitismo de traça-das-crucíferas por Oomyzus sokolowskii Parasitism of diamondback moth by Oomyzus sokolowskii

Directory of Open Access Journals (Sweden)

Christian Sherley Araújo da Silva-Torres

2010-07-01

Full Text Available O objetivo deste trabalho foi avaliar a capacidade de parasitismo do parasitoide larval-pupal Oomyzus sokolowskii, submetido a diferentes densidades do hospedeiro traça-das-crucíferas (Plutella xylostella, em laboratório, casa telada e campo. Em laboratório e campo, O. sokolowskii foi exposto às densidades de 2, 4, 8 e 16 lagartas. Em laboratório, empregaram-se recipientes de 300 mL e, em campo, plantas de couve foram confinadas em gaiolas de organza (30x50 cm. Em casa telada, foram utilizadas microparcelas compostas por seis plantas de repolho infestadas com 25, 50, 85 ou 100 lagartas. O número de lagartas parasitadas aumentou de acordo com a densidade do hospedeiro e variou de 1,7 a 10,4, em laboratório, e de 0,61 a 7,0, em campo. Em casa telada, a maior taxa de parasitismo foi observada nas microparcelas com densidades mais elevadas do hospedeiro. O tempo de exposição aos parasitoides proporcionou maior taxa de parasitismo após 72 horas (24 horas, 52,4% e 72 horas, 80,7% independentemente da densidade. Oomyzus sokolowskii responde positivamente ao incremento na densidade de P. xylostella, embora a taxa de parasitismo permaneça constante independentemente da disponibilidade do hospedeiro.The objective of this work was to evaluate the parasitism capacity of the larval-pupal parasitoid Oomyzus sokolowskii submitted to different densities of the host diamondback moth, Plutella xylostella, in the laboratory, greenhouse and field. In the laboratory and in the field, O. sokolowskii was exposed to densities of 2, 4, 8 or 16 larvae. In the laboratory, 300 mL recipient were used, and in the field kale plants were placed in cages (30x50 cm. In the greenhouse, microparcels consisted of six cabbage plants each infested with 25, 50, 85 or 100 larvae. The number of parasitized larvae increased with host density and varied from 1.7 to 10.4 (laboratory and from 0.61 to 7.0 (field. In the greenhouse, parasitism rate was higher in microparcels with

Travoprost 0.004%/timolol 0.5%-fixed combination with and without benzalkonium chloride: a prospective, randomized, doubled-masked comparison of safety and efficacy.

Science.gov (United States)

Kitazawa, Y; Smith, P; Sasaki, N; Kotake, S; Bae, K; Iwamoto, Y

2011-09-01

The purpose of this study is to compare the safety and intraocular pressure (IOP)-lowering efficacy of travoprost/timolol in a benzalkonium chloride (BAK)-free fixed combination preserved with polyquaternium-1 (TRA/TIM BAK-free), with travoprost/timolol-fixed combination preserved with BAK (TRA/TIM), in patients with open-angle glaucoma or ocular hypertension. In this prospective randomized controlled trial, subjects with IOP of at least 22  mm Hg in one or both eyes at 0900  h, and IOP of at least 21  mm Hg in one or both eyes at 1100  h and 1600  h at two eligibility visits were randomly assigned to receive either TRA/TIM BAK-free (n=195) or TRA/TIM (n=193), dosed once daily in the morning (0900  h) for 6 weeks. IOP was assessed at 0900  h, 1100  h, and 1600  h at each scheduled visit (baseline, 2 and 6 weeks after randomization). Mean IOP reduction across all visits and time points was 8.0  mm Hg in the TRA/TIM BAK-free group and 8.4  mm Hg in the TRA/TIM group (P=0.0943). The difference in mean IOP between groups ranged from 0.2 to 0.7  mm Hg across visits and time points, with a mean pooled difference of 0.4  mm Hg (95% CI: -0.1 to 0.8), demonstrating equivalence of the two formulations. The most common drug-related adverse event was hyperemia of the eye (ocular hyperemia and conjunctival hyperemia combined), occurring in 11.8% of the TRA/TIM BAK-free group and 13.0% of the TRA/TIM group. Travoprost/timolol BAK-free demonstrated equivalence to travoprost/timolol preserved with BAK in efficacy. No clinically relevant differences in the safety profiles of travoprost/timolol BAK-free and travoprost/timolol preserved with BAK were identified.

Radionuclide uptake and growth of barn swallows nesting by radioactive leaching ponds

International Nuclear Information System (INIS)

Millard, J.B.; Whicker, F.W.; Markham, O.D.

1990-01-01

Populations of barn swallows (Hirundo rustica) nested seasonally near the Test Reactor Area (TRA) radioactive leaching ponds on the Idaho National Engineering Laboratory. These birds utilized leaching pond arthropods as a food source and contaminated mud for nest construction. Over 20 fission and activation products were detected in immature and adult TRA birds. The radionuclide exhibiting the highest mean concentration in adult birds was 51Cr, with 16.1 Bq g-1. Mean concentrations of detectable radionuclides were used to calculate internal dose rates. Approximately 72% of the total dose rate of 219 microGy d-1 (22 mrad d-1) for adult birds was due to 24Na. Swallow thyroids contained a mean 131I concentration of 3330 Bq g-1. An average dose rate to the thyroid was calculated to be 4300 microGy d-1 or 450 mGy (45 rad) for the entire breeding season. Data from LiF-700 thermoluminescent dosimeters in swallow nests indicated that average dose rates were 840 microGy d-1 for eggs and 2200 Gy d-1 for nestlings, for a total of 54 mGy (5.4 rad) during the nesting period. The breeding biology and growth rate were investigated for TRA swallows and comparison group located 15 km and 100 km away. Total mortality rates for the comparison group vs. 1976 and 1977 TRA populations were not found to be significantly (p greater than 0.9) different. Nonlinear regression was used to fit individual growth curves and estimate parameters using a logistic model. First clutch TRA swallows were found to have a significantly lower mean growth rate compared to either the first clutch comparison group or the second clutch of TRA birds. Mean asymptotic weights achieved by immature TRA birds were also found to be significantly lower than those achieved by comparison group birds. Both growth rate and asymptotic weights for TRA birds were within the normal range reported in the literature

Biofeedback effectiveness to reduce upper limb muscle activity during computer work is muscle specific and time pressure dependent

DEFF Research Database (Denmark)

Vedsted, Pernille; Søgaard, Karen; Blangsted, Anne Katrine

2011-01-01

trapezius (TRA) can reduce bilateral TRA activity but not extensor digitorum communis (EDC) activity; (2) biofeedback from EDC can reduce activity in EDC but not in TRA; (3) biofeedback is more effective in no time constraint than in the time constraint working condition. Eleven healthy women performed......Continuous electromyographic (EMG) activity level is considered a risk factor in developing muscle disorders. EMG biofeedback is known to be useful in reducing EMG activity in working muscles during computer work. The purpose was to test the following hypotheses: (1) unilateral biofeedback from...... computer work during two different working conditions (time constraint/no time constraint) while receiving biofeedback. Biofeedback was given from right TRA or EDC through two modes (visual/auditory) by the use of EMG or mechanomyography as biofeedback source. During control sessions (no biofeedback), EMG...

Adaptação de um pulverizador de tração humana para aplicação localizada de herbicidas Adaptation of a manual spray for herbicide application at specific site

Directory of Open Access Journals (Sweden)

C.A. Viliotti

2009-03-01

Full Text Available Objetivou-se com este trabalho adaptar um pulverizador de tração humana para aplicação localizada de herbicidas. Para o desenvolvimento do circuito eletrônico, foi elaborado um programa computacional em linguagem Assembly, com informações sobre a variação da resistência elétrica no LDR (Resistor Dependente de Luz referente à radiação global incidente e refletida para quatro tipos de superfícies diferentes (plantas dicotiledôneas, plantas monocotiledôneas, palhada de trigo e solo. Concluiu-se que é possível e economicamente viável a utilização do sensor LDR para detecção de plantas daninhas.The objective of this work was to adapt a manual spray for herbicide application at specific site. For the development of the electronic circuit, a computer program in Assembly language was elaborated, with information on the variation of the electric resistance in LDR (Light Dependent Resistance, referring to the incident and reflected global radiation for four types of different surfaces (dicotyledonous plants, monocotyledonous plants, wheat straw and soil. It was concluded that it is possible and economically viable to utilize the LDR sensor to detect weeds.

La nuova fisica delle particelle e i segreti dell'universo un dialogo fra filosofia, scienza e religione

CERN Document Server

Bodei, Remo

2017-01-01

La Scuola della Cattedrale, presieduta da Monsignor Gianantonio Borgonovo, prosegue il suo ciclo di incontri con un evento culturale nel segno della fisica che esplora il mondo delle particelle. Guido Tonelli, fisico e professore ordinario dell’Università di Pisa, tratta degli eventi che hanno portato alla scoperta del bosone di Higgs al Cern di Ginevra dove è stato realizzato Lhc, l’acceleratore di particelle più potente del mondo, con un’analisi di materia e antimateria, energia e universo, per capire come tutto è cominciato e come forse andrà a finire. Dove potrà arrivare l’uomo con queste nuove visioni? Quali cambiamenti e traguardi sono ipotizzabili? Come leggere da un punto di vista religioso e filosofico questi nuovi scenari che la scienza prospetta? L’evento ha visto gli interventi di Monsignor Borgonovo e del filosofo Remo Bodei, professore emerito di Filosofia all’Università di Pisa.

Sottoscrizioni autografe nelle più antiche carte del monastero di S. Liberatore alla Maiella. Contributo alla storia del rapporto tra scrittura e alfabetismo in Abruzzo nel secolo X Autograph subscriptions in the oldest cards of the monastery of S. Liberatore of the Maiella. A contribution to the history of the relationship between writing and literacy in Abruzzo in 10th Century

Directory of Open Access Journals (Sweden)

Mariano Dell'Omo

2005-06-01

Full Text Available

Il saggio che si propone di contribuire alla storia delle relazioni tra scrittura e alfabetismo in Abruzzo nel secolo X, deriva da una sezione (pp. CXLI-CLXX della “Introduzione storica, paleografica e archivistica” al volume pubblicato dall’autore nel 2003. L’immediato contesto geo-monastico è quello di S. Liberatore alla Maiella, la più grande delle dipendenze di Montecassino in Abruzzo, e una delle prepositure più notevoli tra le circa sessanta che appartennero al monastero cassinese nell’Italia centro-meridionale. L’obiettivo più generale è quello di far conoscere l’intero fondo archivistico di S. Liberatore, sia quello di età medievale con il citato volume, sia quello di età moderna con il successivo, apparso nel 2006. Questa specifica serie dell’Archivio cassinese, gravitante intorno a S. Liberatore ma relativa anche ad altri centri monastici minori di area abruzzese, e che occupa oggi le capsule da XCIX a CIV, racchiude complessivamente 801 documenti.

Tra questi se ne annoverano alcuni particolarmente noti agli studiosi – specialmente dopo i lavori di Enrico Carusi (1929, 1932 e Herbert Bloch (1986 –, come il “Memoratorium” dell’abate Bertario († 883 e il “Commemoratorium” – inventario testamentario – del preposito maiellese, poi abate di Montecassino Teobaldo († 1035/1037.

Alcuni hanno riservato interessanti scoperte, come l’attuale caps. XCIX, fasc. I, n. 4, una carta del luglio 936, che racchiude la più antica sottoscrizione autografa (“Ego qui supra Arechisi iudex” di Arechi, giudice della città di Capua, lo stesso che sottoscrisse il celeberrimo placito del 960, prima testimonianza ufficiale di volgare italiano.

Altri costituiscono un nucleo di documenti omogenei (nn. 7, 8, 9, 10, 12, 13 la cui edizione integrale ha offerto finalmente in modo completo la più antica collezione di contratti agrari di Montecassino (dal 950 al 984, specialmente sotto forma di

Sibling Rivalry in Myxococcus xanthus Is Mediated by Kin Recognition and a Polyploid Prophage.

Science.gov (United States)

Dey, Arup; Vassallo, Christopher N; Conklin, Austin C; Pathak, Darshankumar T; Troselj, Vera; Wall, Daniel

2016-01-19

Myxobacteria form complex social communities that elicit multicellular behaviors. One such behavior is kin recognition, in which cells identify siblings via their polymorphic TraA cell surface receptor, to transiently fuse outer membranes and exchange their contents. In addition, outer membrane exchange (OME) regulates behaviors, such as inhibition of wild-type Myxococcus xanthus (DK1622) from swarming. Here we monitored the fate of motile cells and surprisingly found they were killed by nonmotile siblings. The kill phenotype required OME (i.e., was TraA dependent). The genetic basis of killing was traced to ancestral strains used to construct DK1622. Specifically, the kill phenotype mapped to a large "polyploid prophage," Mx alpha. Sensitive strains contained a 200-kb deletion that removed two of three Mx alpha units. To explain these results, we suggest that Mx alpha expresses a toxin-antitoxin cassette that uses the OME machinery of M. xanthus to transfer a toxin that makes the population "addicted" to Mx alpha. Thus, siblings that lost Mx alpha units (no immunity) are killed by cells that harbor the element. To test this, an Mx alpha-harboring laboratory strain was engineered (by traA allele swap) to recognize a closely related species, Myxococcus fulvus. As a result, M. fulvus, which lacks Mx alpha, was killed. These TraA-mediated antagonisms provide an explanation for how kin recognition specificity might have evolved in myxobacteria. That is, recognition specificity is determined by polymorphisms in traA, which we hypothesize were selected for because OME with non-kin leads to lethal outcomes. The transition from single cell to multicellular life is considered a major evolutionary event. Myxobacteria have successfully made this transition. For example, in response to starvation, individual cells aggregate into multicellular fruiting bodies wherein cells differentiate into spores. To build fruits, cells need to recognize their siblings, and in part, this is

Tra retorica ed enciclopedia

Directory of Open Access Journals (Sweden)

Mario Montorzi

2006-01-01

Full Text Available The juridical reflection on origins clearly took place in a context dominated by a culture that was both of theological extraction and rhetorical formation. The »textual« culture of the theologians soon became the practice of interpretation of the jurists, who substituted the Justinian text for the Biblical one in their exegetic attitudes, but who nevertheless – at least initially– maintained intact the essentially rhetorical nature of their interpretative accessus to the textus of the Justinian corpus. It was with that interpretative tendency that the central role reserved for the maxim »nomina sunt consequentia rerum« emerged, which postulated the existence of a system of necessary correspondences between the nomina iuris and empirical reality which the jurist strove to fit into the interpretative structure of his own analytic discourse. Originally, mediaeval man considered the nomina iuris as the immediate and direct consequence of their ontological basis. To his eyes, the names of things were precisely the key to the privileged awareness of reality; knowing single physical entities meant first discovering their names. This also held true for the activity of the jurist, who essentially depended precisely on the nomina iuris of his work of constructing a normative system.Besides, the etymological logic of the mediaeval derivatores, from the Pisan Uggucione to the Genoese Balbi, to Papias vocabulista, had as its characteristic note precisely this essential basis in the field of sensory perception: the process of making names was not simply a formal, linguistic matter but was above all material and concrete. As in the hierarchy of being one thing derived from another, and similarly, consequently – and almost as a mirror image – in the structure of the language one name derived from another.The derivatio was the final fruit of the specific mutation of practical reality, the organisation of which was expressed in each single nomen. And the names were considered real and proper »normative objects«, as they might be called, which functioned as in the world of things and everyday experience.And the premise of that embryo of ideology lay precisely in this: that the jurist and the rhetorician, while »etymologising« and discussing the nomina iuris, seemed rather to be describing the autonomous semantic content of the nomina themselves, while in reality they were manipulating them – and without excessive scruples – and so were passing off as objective and incontrovertible normative prescription what was, in truth, the pure fruit of their conceptual elaborations.

Extratos aquosos de Trichilia pallida e a traça-do-tomateiro Aqueous extracts of Trichilia pallida and the tomato pinworm

Directory of Open Access Journals (Sweden)

Ariane Paes de Barros Werckmeister Thomazini

2000-03-01

Full Text Available Avaliou-se o efeito de extratos aquosos de folhas e de ramos da planta inseticida Trichilia pallida sobre o desenvolvimento e oviposição da traça-do-tomateiro, Tuta absoluta. Acompanhou-se o desenvolvimento do inseto em folhas de tomateiro (Lycopersicon esculentum, cv. Santa Clara previamente submersas nos extratos nas concentrações de 0,1; 1,0 e 5,0%. Também foi avaliado o efeito dos extratos de folhas a 1,0 e 5,0%, pulverizados sobre ovos do inseto, e a não-preferência para oviposição, com chance de escolha, em folhas de tomateiro com e sem esse extrato a 5%. Verificou-se que os extratos de folhas e de ramos prejudicam o desenvolvimento do inseto afetando principalmente a fase larval, aumentando a duração e reduzindo a viabilidade deste período. O extrato de folhas apresenta maior atividade que o de ramos, reduzindo a viabilidade larval a valores próximos a 20%, já na concentração de 1%. O extrato de folhas a 5% não apresenta efeito ovicida mas, o substrato tratado pode tornar-se menos preferido para oviposição.The effect of aqueous extracts of Trichilia pallida leaves and twigs on the development and oviposition of Tuta absoluta was evaluated. Larvae of T. absoluta were fed with tomato leaves (Lycopersicon esculentum, cv. Santa Clara previously treated with extracts at concentrations of 0.1; 1.0 and 5.0%. The effects of the leaf extracts at 1.0 and 5.0% were evaluated on eggs of this pest. Free-choice non-preference tests for oviposition were also conducted with treated and non-treated tomato leaves with the extract at concentration of 5.0%. Leaf and twig extracts affect the insect development mainly at the larval stage, increasing the length and reducing viability of this stage. The activity of the leaf extract is greater than that of the twig extract with the reduction of larval viability to approximately 20% at concentration of 1.0%. No ovicidal activity was detected with T. pallida leaf extract at 5.0%, however, the

Desempenho de três teorias de simulação do comportamento de um trator agrícola em tração Evaluation of three theories for predicting the performance of agricultural tractors

Directory of Open Access Journals (Sweden)

José F. Schlosser

2004-12-01

Full Text Available A simulação matemática é uma ferramenta importante na diminuição de custos de produção e viabilização de novos projetos de máquinas agrícolas. Este trabalho trata da comparação entre três teorias de simulação, as chamadas teorias de predição de tração clássicas, desenvolvidas por Wismer, Brixius e Gee-Clough, na simulação do desempenho de um trator agrícola de rodas. Para efetuar uma comparação entre as três teorias e apurar as condições mais apropriadas de uso das mesmas, realizou-se um experimento de campo com um trator de tração simples (4x2, com o controle de um número apreciável de variáveis relevantes, para criar condições de comparação com uma simulação posterior. No trabalho de campo, foram utilizados tratamentos que envolviam a condição do solo, preparado ou consolidado; pneus do tipo diagonal, e a deflexão desse pneu, maior e menor. Utilizando os parâmetros medidos a campo, realizou-se a comparação com os dados simulados para a variável patinamento. A teoria Cn mostrou que possui uma faixa de utilização mais restrita do que as teorias Bn e MN, sendo o índice de cone a variável que determina essas condições de uso.The simulation of machines behavior by mathematical modeling is nowadays an important tool for reducing production costs and making new projects feasible. The present study comprises a comparison among three theories for predicting the traction performance of a tractor, developed by Wismer, Brixius and Gee-Clough. In order to compare the three theories and find out the most appropriate conditions for using them, a field experiment in which all relevant variables were controlled for further simulation was conducted by using a 2WD tractor (4x2. Using the parameter obtained in field, a comparison was carried out with the results from the different simulation models. In this field study was used treatments that involved soil conditions, with grass and conventional tillage

Current practice of transradial approach for coronary procedures: A survey by the Italian Society of Interventional Cardiology (SICI-GISE) and the Italian Radial Club

International Nuclear Information System (INIS)

Rigattieri, Stefano; Valsecchi, Orazio; Sciahbasi, Alessandro; Tomassini, Francesco; Limbruno, Ugo; Marchese, Alfredo; La Manna, Alessio; Mauro, Ciro; Varbella, Ferdinando; Berti, Segio; Tarantino, Fabio F.; Musumeci, Giuseppe

2017-01-01

Background: Transradial approach (TRA) for percutaneous coronary procedures is associated with improved patient outcome and is being increasingly adopted worldwide. We surveyed Italian interventional cardiologists in order to take a snapshot of the current practice of TRA. Methods: A web-based questionnaire was emailed to all members of the Italian Society of Interventional Cardiology. Results: The survey was taken by 508 respondents. Cardiogenic shock and chronic total occlusions represented the principal limitations to TRA. Right TRA was the default approach for 81% of respondents. Both diagnostic and interventional procedures were routinely performed through 6 Fr sheaths (83% and 93%, respectively); dedicated TRA curves were used in 11% of diagnostic and in about 3% of interventional procedures. Almost 70% of the operators did not assess dual hand circulation. In case of crossover, the contralateral radial artery was the preferred site (57%). Radial artery hemostasis was mostly achieved by pneumatic bracelet (64%) and patency of the radial artery during hemostasis was ensured in 60% of cases. Pre-discharge patency of the radial artery was routinely assessed by almost 60% of respondents. For diagnostic procedures, adequate heparin anticoagulation (5000 IU) was only given by 45% of operators. Most respondents believed that TRA is associated with greater radiation exposure for both the patient (82%) and the operator (98%) as compared to transfemoral approach. Conclusions: This survey provides contemporary data about the adoption of TRA in Italy and gives interesting insights about several technical and clinical issues related to the practice of this vascular approach for coronary procedures. - Highlights: • Transradial approach for coronary procedures is becoming increasingly popular. • We conducted a survey on the contemporary practice of transradial approach in Italy. • We appraised several clinical and technical issues related to transradial approach.

Current practice of transradial approach for coronary procedures: A survey by the Italian Society of Interventional Cardiology (SICI-GISE) and the Italian Radial Club

Energy Technology Data Exchange (ETDEWEB)

Rigattieri, Stefano, E-mail: stefanorigattieri@yahoo.it [Interventional Cardiology Unit, Sandro Pertini Hospital, Roma (Italy); Valsecchi, Orazio [Cardiovascular Department, Papa Giovanni XXIII Hospital, Bergamo (Italy); Sciahbasi, Alessandro [Interventional Cardiology Unit, Sandro Pertini Hospital, Roma (Italy); Tomassini, Francesco [Cardiology Department, Ospedale degli Infermi, Rivoli (Italy); Limbruno, Ugo [Cardiology Unit, Azienda USL Toscana Sudest, Grosseto (Italy); Marchese, Alfredo [Interventional Cardiology Unit, Anthea Hospital, GVM Care & Research, Bari (Italy); La Manna, Alessio [Cardiovascular Department, Ferrarotto Hospital, University of Catania (Italy); Mauro, Ciro [Cardiovascular Department, Cardarelli Hospital, Napoli (Italy); Varbella, Ferdinando [Cardiology Department, Ospedale degli Infermi, Rivoli (Italy); Berti, Segio [Department of Cardiology, Fondazione Toscana “Gabriele Monasterio”, Ospedale del Cuore, Massa (Italy); Tarantino, Fabio F. [Cardiology Unit, Ospedale G.B. Morgagni-L. Pierantoni, Forlì (Italy); Musumeci, Giuseppe [Cardiovascular Department, Papa Giovanni XXIII Hospital, Bergamo (Italy)

2017-04-15

Background: Transradial approach (TRA) for percutaneous coronary procedures is associated with improved patient outcome and is being increasingly adopted worldwide. We surveyed Italian interventional cardiologists in order to take a snapshot of the current practice of TRA. Methods: A web-based questionnaire was emailed to all members of the Italian Society of Interventional Cardiology. Results: The survey was taken by 508 respondents. Cardiogenic shock and chronic total occlusions represented the principal limitations to TRA. Right TRA was the default approach for 81% of respondents. Both diagnostic and interventional procedures were routinely performed through 6 Fr sheaths (83% and 93%, respectively); dedicated TRA curves were used in 11% of diagnostic and in about 3% of interventional procedures. Almost 70% of the operators did not assess dual hand circulation. In case of crossover, the contralateral radial artery was the preferred site (57%). Radial artery hemostasis was mostly achieved by pneumatic bracelet (64%) and patency of the radial artery during hemostasis was ensured in 60% of cases. Pre-discharge patency of the radial artery was routinely assessed by almost 60% of respondents. For diagnostic procedures, adequate heparin anticoagulation (5000 IU) was only given by 45% of operators. Most respondents believed that TRA is associated with greater radiation exposure for both the patient (82%) and the operator (98%) as compared to transfemoral approach. Conclusions: This survey provides contemporary data about the adoption of TRA in Italy and gives interesting insights about several technical and clinical issues related to the practice of this vascular approach for coronary procedures. - Highlights: • Transradial approach for coronary procedures is becoming increasingly popular. • We conducted a survey on the contemporary practice of transradial approach in Italy. • We appraised several clinical and technical issues related to transradial approach.

Applying theory-driven approaches to understanding and modifying clinicians' behavior: what do we know?

Science.gov (United States)

Perkins, Matthew B; Jensen, Peter S; Jaccard, James; Gollwitzer, Peter; Oettingen, Gabriele; Pappadopulos, Elizabeth; Hoagwood, Kimberly E

2007-03-01

Despite major recent research advances, large gaps exist between accepted mental health knowledge and clinicians' real-world practices. Although hundreds of studies have successfully utilized basic behavioral science theories to understand, predict, and change patients' health behaviors, the extent to which these theories-most notably the theory of reasoned action (TRA) and its extension, the theory of planned behavior (TPB)-have been applied to understand and change clinician behavior is unclear. This article reviews the application of theory-driven approaches to understanding and changing clinician behaviors. MEDLINE and PsycINFO databases were searched, along with bibliographies, textbooks on health behavior or public health, and references from experts, to find article titles that describe theory-driven approaches (TRA or TPB) to understanding and modifying health professionals' behavior. A total of 19 articles that detailed 20 studies described the use of TRA or TPB and clinicians' behavior. Eight articles describe the use of TRA or TPB with physicians, four relate to nurses, three relate to pharmacists, and two relate to health workers. Only two articles applied TRA or TPB to mental health clinicians. The body of work shows that different constructs of TRA or TPB predict intentions and behavior among different groups of clinicians and for different behaviors and guidelines. The number of studies on this topic is extremely limited, but they offer a rationale and a direction for future research as well as a theoretical basis for increasing the specificity and efficiency of clinician-targeted interventions.

Relação entre a força dos músculos rotadores do ombro e a capacidade de ativação do músculo transverso abdominal em atletas de handebol

Directory of Open Access Journals (Sweden)

Caruline Rodrigues Alvarenga

2014-09-01

Full Text Available Relacionou-se a força isométrica dos rotadores do ombro e a capacidade de ativação do músculo transverso abdominal (TrA entre 15 atletas de handebol e 15 universitários (22 ± 1,64 anos, distribuídos entre GA e GC. Todos foram submetidos às avaliações da capacidade de ativação do TrA por meio da unidade de biofeedback de pressão e da capacidade de ativação dos mm rotadores internos (RI e externos (RE do ombro pelo break test por meio do Esfigmomanômetro Modificado. Resultados mostraram significativa a correlação entre a força de RE e o TrA no GA (r = 0,68; p = 0,005. Houve diferenças significativas entre GA e GC para ativação do TrA, RI e RE (p < 0,05. Conclui-se que a prática de handebol melhora a ativação do TrA propor cionalmente à magnitude da ativação dos RE.

Ultrasound evaluation of muscle thickness changes in the external oblique, internal oblique, and transversus abdominis muscles considering the influence of posture and muscle contraction.

Science.gov (United States)

Sugaya, Tomoaki; Abe, Yota; Sakamoto, Masaaki

2014-09-01

[Purpose] The aim of this study was to investigate muscle thickness changes in the external oblique (EO), internal oblique (IO), and transversus abdominis (TrA) muscles between the neutral position and trunk rotation, under a state of rest without voluntary contractions, and isometric contractions to both sides with resistance of 50% of the maximum trunk rotation strength. [Subjects] The subjects of this study were 21 healthy young men. [Methods] Muscle thickness changes in the EO, IO, and TrA in each position and state were evaluated by ultrasound. The range of motion at maximum trunk rotation and the maximum strength of trunk rotation were measured using a hand-held dynamometer. [Results] In the neutral position and at 50% trunk rotation to the right side, the thicknesses of the IO and TrA significantly increased with resistance. In both states, the thicknesses of the IO and TrA significantly increased at 50% trunk rotation to the right side. [Conclusion] The muscular contractions of the IO and TrA were stronger during ipsilateral rotation than in the neutral position and with resistance than at rest. Moreover, the muscular contraction was strongest in the resistive state during ipsilateral rotation.

AcEST: DK956225 [AcEST

Lifescience Database Archive (English)

Full Text Available 103 4e-21 tr|A7P8S5|A7P8S5_VITVI Chromosome chr3 scaffold_8, whole genome ... 102 8e-21 tr|A1Y2K8|A1Y2K8_9RO...6 VTHVKNQGACG 156 >tr|A1Y2K8|A1Y2K8_9ROSI VXH-C (Fragment) OS=Vasconcellea x heilbornii PE=2 SV=1 Length = 2...YSGEFRYRDVADLP----ESVDWRKKGA 145 Query: 468 VTPVKDQGMCG 500 VT VK+QG CG Sbjct: 14

Análise de desempenho do contrapiso autonivelante em relação ao sistema tradicional

OpenAIRE

Natalia Cerqueira de Souza

2013-01-01

Este trabalho pretende analisar o desempenho do contrapiso autonivelante, uma argamassa desenvolvida com uso de aditivos para ser bombeada e servir de base para execução de pisos e compará-lo com o processo tradicional de argamassa tipo farofa. O trabalho foi dividido em duas etapas: a primeira analisa três traços do contrapiso autonivelante para entender suas características, sendo um o traço normal recomendado pelo desenvolvedor do produto, o outro um traço com aumento na quantidade de água...

AcEST: DK946050 [AcEST

Lifescience Database Archive (English)

Full Text Available iscus mechowi... 59 2e-07 tr|A6XJN0|A6XJN0_9ROSI Ribosomal protein L32 OS=Hibiscus ...ibosomal protein L32 OS=Cuscuta reflexa ... 57 6e-07 tr|A6XJM9|A6XJM9_9ROSI Ribosomal protein L32 OS=Hibiscus...e-07 tr|B0YPS0|B0YPS0_ANEMR Ribosomal protein L32 OS=Aneura mirabilis... 59 2e-07 tr|A6XJN1|A6XJN1_9ROSI Ribosomal protein L32 OS=Hib

AcEST: BP916627 [AcEST

Lifescience Database Archive (English)

Full Text Available _id A6GSQ9 Definition tr|A6GSQ9|A6GSQ9_9BURK Acyltransferase OS=Limnobacter sp. MED105 Align length 104 Scor...nments: (bits) Value tr|A6GSQ9|A6GSQ9_9BURK Acyltransferase OS=Limnobacter sp. MED105... 37 0.40 tr|Q63KQ5|Q...33 9.9 >tr|A6GSQ9|A6GSQ9_9BURK Acyltransferase OS=Limnobacter sp. MED105 GN=LMED105_16018 PE=4 SV=1 Length =

Il samizdat a Leningrado negli anni Settanta: struttura e dinamiche di una ‘seconda’ realtà culturale

Directory of Open Access Journals (Sweden)

Marco Sabbatini

2015-07-01

Full Text Available Il presente lavoro prende in considerazione la generazione di autori e artisti di Leningrado che hanno iniziato la loro attività nel corso degli anni Settata, nel contesto della stampa clandestina nel sottosuolo. Lo studio descrive gli eventi, i gruppi non ufficiali, i principali periodici del samizdat e le attività informali poste in essere da molti giovani scrittori, tra cui Viktor Krivulin e Boris Ivanov, due tra le personalità più rappresentative della cultura sovietica alternativa a Leningrado nel periodo tra il 1975 e il 1981.

Transmission du capital scolaire et séparation des parents

OpenAIRE

Henri-Panabière, Gaële

2011-01-01

Proportion d’élèves en difficultés selon le niveau de diplôme du père dans la sous-population des parents vivant ensemble, dans celle des parents séparés et dans l’ensemble de la population Parents vivant ensemble Parents séparés Dans l’ensemble de la population Non bacheliers 28,8 32 29,5 Bacheliers et plus 12,6 34,8 14,8 Ensemble 24,2 33,3 23 Lecture : 28,8% des élèves dont le père n’est pas bachelier, et dont les deux parents vivent ensemble, rencontrent des difficultés scolaires. Proport...

Basura Electrónica

OpenAIRE

Mollah, Madeleine; Ramírez, Daniela; Robinson, Yosimar

2014-01-01

El desarrollo de la tecnología en la actualidad no solo ha traído avance en muchos aspectos de las ciencias, sino también por su constante cambio, ha traído un incremento acelerado de sus desechos.

Avaliação ultraestrutural do colágeno do ligamento colateral medial associado ao ligamento oblíquo da articulação do cotovelo de cão SRD após ensaio de tração - DOI: 10.4025/actascibiolsci.v27i2.1324 Collagen ultra-structural evaluation of the mongrel dog’s medial collateral ligament associated with the oblique ligament after strain - DOI: 10.4025/actascibiolsci.v27i2.1324

Directory of Open Access Journals (Sweden)

Juliana Regina Rossi

2005-03-01

Full Text Available O presente trabalho objetivou observar a disposição das fibras colágenas do ligamento colateral medial da articulação do cotovelo do cão, quando associado ao ligamento oblíquo submetido a ensaio de tração. Para tanto, foram utilizadas 18 articulações, divididas em três grupos, em que um grupo teve o ligamento colateral medial coletado e não tracionado, outro teve o ligamento colateral medial testado isoladamente e o outro grupo teve ambos os ligamentos (colateral medial e oblíquo testados associadamente. O ligamento colateral medial, verificado por meio de microscopia eletrônica de varredura, apresentou um padrão ondulado e reticular das fibras colágenas quando não submetidos ao ensaio de tração, o qual não foi destruído totalmente quando associado ao ligamento oblíquo, após o ensaio. Quando analisado isoladamente, o ligamento colateral medial após ensaio de tração perde totalmente o padrão reticular, demonstrando o desgaste das fibras por resistir à tensão. O ligamento oblíquo, portanto, contribui para a integridade da arquitetura das fibras colágenas do ligamento colateral medialUltrastructural evaluation of the collagen of the mongrel dog medial collateral ligament associated to the oblique ligament after strain. The present work aimed to observe the disposition of the collagen fibres of the medial collateral ligament of the elbow joint of the dog, when associated to the oblique ligament. Thus, 18 articulations were used, divided in three groups. A group had the medial collateral ligament collected and not stretched, other group had the collateral medial ligament stretched separately and the other group had both ligaments (medial collateral and oblique stretched associately. The medial collateral ligament examined by scanning electron microscopy presented a wavy and reticular pattern of the collagen fibres when not submitted to strain, which was not totally destroyed when it was associated to the oblique

Dinamiche di scambio tra cinema e letteratura: i sottotitoli di Colette per Jeunes filles en uniforme

Directory of Open Access Journals (Sweden)

Paola Palma

2012-07-01

Full Text Available Nel 1932 Colette realizza i sottotitoli francesi del film tedesco Mädchen in Uniform (T. fr. : Jeunes filles en uniforme, 1931, diretto da Leontine Sagan e tratto da un testo teatrale di Christa Winsloe. La scrittrice viene interpellata dal distributore francese della pellicola, ma accetta il lavoro solo dopo avere visto il film, che analizza attentamente e giudica estremamente riuscito. Si ha la conferma dell’interesse della scrittrice per il mondo delle immagini in movimento, oltre allo stimolante intrecciarsi di alcuni elementi del plot, dei personaggi e dell’ambientazione del film con quelli dei volumi colettiani delle Claudine, con i quali Mädchen in Uniform condividerà anche una significativa e duratura diffusione e popolarità.Il contatto tra la letteratura e il cinema non si esaurisce quindi nella traduzione di un testo per il cinema da parte di una scrittrice, ma prosegue in più direzioni. Vi è anche l’aspetto pubblicitario (e meramente economico, di cui beneficiano e sono consapevoli entrambe le parti: lo stesso “personaggio” Colette si sovrappone all’immagine che si intende dare di Jeunes filles en uniforme. Il film, inoltre, è uno dei titoli fondamentali negli studi sulla storia del cinema gay e lesbico. In questo ambito, questa collaborazione è significativa in termini di ricezione di una pellicola a sfondo lesbico perché l’accostamento del nome di Colette ha senz’altro contribuito all’accoglienza del film in Francia.En 1932, Colette rédige les sous-titres français du film allemand Mädchen in Uniform (Jeunes filles en uniforme, 1931, adapté par l’Autrichienne Léontine Sagan d’une pièce de Christa Winsloe. L'écrivain est sollicitée par le distributeur français, mais elle n'accepte le travail qu'après avoir vu le film, qu'elle analyse attentivement et juge très réussi. On peut y voir la confirmation de son intérêt pour l'univers des images animées. Mais en outre, on relève de nombreux et

Recovering probabilities for nucleotide trimming processes for T cell receptor TRA and TRG V-J junctions analyzed with IMGT tools

Directory of Open Access Journals (Sweden)

Lefranc Marie-Paule

2008-10-01

Full Text Available Abstract Background Nucleotides are trimmed from the ends of variable (V, diversity (D and joining (J genes during immunoglobulin (IG and T cell receptor (TR rearrangements in B cells and T cells of the immune system. This trimming is followed by addition of nucleotides at random, forming the N regions (N for nucleotides of the V-J and V-D-J junctions. These processes are crucial for creating diversity in the immune response since the number of trimmed nucleotides and the number of added nucleotides vary in each B or T cell. IMGT® sequence analysis tools, IMGT/V-QUEST and IMGT/JunctionAnalysis, are able to provide detailed and accurate analysis of the final observed junction nucleotide sequences (tool "output". However, as trimmed nucleotides can potentially be replaced by identical N region nucleotides during the process, the observed "output" represents a biased estimate of the "true trimming process." Results A probabilistic approach based on an analysis of the standardized tool "output" is proposed to infer the probability distribution of the "true trimmming process" and to provide plausible biological hypotheses explaining this process. We collated a benchmark dataset of TR alpha (TRA and TR gamma (TRG V-J rearranged sequences and junctions analysed with IMGT/V-QUEST and IMGT/JunctionAnalysis, the nucleotide sequence analysis tools from IMGT®, the international ImMunoGeneTics information system®, http://imgt.cines.fr. The standardized description of the tool output is based on the IMGT-ONTOLOGY axioms and concepts. We propose a simple first-order model that attempts to transform the observed "output" probability distribution into an estimate closer to the "true trimming process" probability distribution. We use this estimate to test the hypothesis that Poisson processes are involved in trimming. This hypothesis was not rejected at standard confidence levels for three of the four trimming processes: TRAV, TRAJ and TRGV. Conclusion By

Recovering probabilities for nucleotide trimming processes for T cell receptor TRA and TRG V-J junctions analyzed with IMGT tools.

Science.gov (United States)

Bleakley, Kevin; Lefranc, Marie-Paule; Biau, Gérard

2008-10-02

Nucleotides are trimmed from the ends of variable (V), diversity (D) and joining (J) genes during immunoglobulin (IG) and T cell receptor (TR) rearrangements in B cells and T cells of the immune system. This trimming is followed by addition of nucleotides at random, forming the N regions (N for nucleotides) of the V-J and V-D-J junctions. These processes are crucial for creating diversity in the immune response since the number of trimmed nucleotides and the number of added nucleotides vary in each B or T cell. IMGT sequence analysis tools, IMGT/V-QUEST and IMGT/JunctionAnalysis, are able to provide detailed and accurate analysis of the final observed junction nucleotide sequences (tool "output"). However, as trimmed nucleotides can potentially be replaced by identical N region nucleotides during the process, the observed "output" represents a biased estimate of the "true trimming process." A probabilistic approach based on an analysis of the standardized tool "output" is proposed to infer the probability distribution of the "true trimmming process" and to provide plausible biological hypotheses explaining this process. We collated a benchmark dataset of TR alpha (TRA) and TR gamma (TRG) V-J rearranged sequences and junctions analysed with IMGT/V-QUEST and IMGT/JunctionAnalysis, the nucleotide sequence analysis tools from IMGT, the international ImMunoGeneTics information system, http://imgt.cines.fr. The standardized description of the tool output is based on the IMGT-ONTOLOGY axioms and concepts. We propose a simple first-order model that attempts to transform the observed "output" probability distribution into an estimate closer to the "true trimming process" probability distribution. We use this estimate to test the hypothesis that Poisson processes are involved in trimming. This hypothesis was not rejected at standard confidence levels for three of the four trimming processes: TRAV, TRAJ and TRGV. By using trimming of rearranged TR genes as a benchmark, we

PERSONALIDADE E CONSUMO ECOLOGICAMENTE CONSCIENTE

Directory of Open Access Journals (Sweden)

Márcio Augusto Gonçalves

2008-08-01

Full Text Available Adotando-se como moldura teórica o Modelo Meta-teórico de Motivação e Personalidade (MOWEN, 2000, investigou-se a relação entre personalidade e consumo ecologicamente consciente. Por meio de um levantamento com uma amostra de 735 pessoas, obteve-se razoável sustentação empírica para um modelo em que os traços de personalidade explicam percentual considerável da variância do consumo ecologicamente consciente (R2 = 33%, interpretado como traço superficial da personalidade do consumidor. No modelo estimado, construtos relacionados ao cuidado com problemas ambientais são interpretados como traços situacionais, que remetem a traços mais profundos de personalidade. O significado dos resultados é avaliado conforme seu potencial em sustentar intervenções educacionais para promover o comportamento ecologicamente consciente.

Morphometric evaluation of the spermatogenesis in trahira Hoplias malabaricus (Bloch (Characiformes, Erythrinidae Avaliação morfométrica da espermatogênese da traíra Hoplias malabaricus (Bloch (Characiformes, Erythrinidae

Directory of Open Access Journals (Sweden)

Paula M. Bizzott

2007-01-01

Full Text Available The Erythrinidae trahira, Hoplias malabaricus (Bloch, 1794, is widespread throughout South America river basins. We determined Sertoli cell supporting capacity (ratio of primary spermatocytes: Sertoli cells and spermatids: Sertoli cells, meiotic index (ratio of spermatids: primary spermatocytes and the number of spermatogonial mitotic generations of this fish. The fish were captured in the Igarapava reservoir, Grande River, Alto Paraná River basin, Brazil. Testis fragments of three sexually mature trahiras were fixed in 5% buffered glutaraldehyde solution and embedded in glycol methacrylate. Serial sections of 2 and 3 µm in thickness were stained with 0.5% toluidine blue. Histological counts from cysts of primary spermatocytes and spermatids revealed, respectively, 326 ± 99 and 468 ± 73 nuclei of these cells. Sertoli cell supporting capacity was considerably higher for spermatids (113.3 ± 16:1 when compared to primary spermatocytes (71 ± 5:1. Between eight and ten spermatogonial generations were formed to give rise to primary spermatocytes. These values were within the generation range of those already found in freshwater teleosts of external fertilization. Correlation between the number of Sertoli cells and primary spermatocytes per cyst, and Sertoli cells and spermatids per cyst were statistically significant (p A traíra, Hoplias malabaricus (Bloch, 1794, da família Erythrinidae, encontra-se espalhada pelas bacias fluviais da América do Sul. Determinou-se a capacidade de suporte das células de Sertoli (espermatócitos primários: células de Sertoli e espermátides: células de Sertoli, índice meiótico (espermátides: espermatócitos primário e o número de gerações mitóticas de espermatogônias desse peixe. Os indivíduos foram capturados no reservatório de Igarapava, rio Grande, bacia do Alto Paraná, Brasil. Fragmentos dos testículos de três traíras sexualmente maduras foram fixados em glutaraldeído a 5%, e inclu

A new component of the Nasonia sex determining cascade is maternally silenced and regulates transformer expression.

Science.gov (United States)

Verhulst, Eveline C; Lynch, Jeremy A; Bopp, Daniel; Beukeboom, Leo W; van de Zande, Louis

2013-01-01

Although sex determination is a universal process in sexually reproducing organisms, sex determination pathways are among the most highly variable genetic systems found in nature. Nevertheless, general principles can be identified among the diversity, like the central role of transformer (tra) in insects. When a functional TRA protein is produced in early embryogenesis, the female sex determining route is activated, while prevention of TRA production leads to male development. In dipterans, male development is achieved by prevention of female-specific splicing of tra mRNA, either mediated by X-chromosome dose or masculinizing factors. In Hymenoptera, which have haplodiploid sex determination, complementary sex determination and maternal imprinting have been identified to regulate timely TRA production. In the parasitoid Nasonia, zygotic transformer (Nvtra) expression and splicing is regulated by a combination of maternal provision of Nvtra mRNA and silencing of Nvtra expression in unfertilized eggs. It is unclear, however, if this silencing is directly on the tra locus or whether it is mediated through maternal silencing of a trans-acting factor. Here we show that in Nasonia, female sex determination is dependent on zygotic activation of Nvtra expression by an as yet unknown factor. This factor, which we propose to term womanizer (wom), is maternally silenced during oogenesis to ensure male development in unfertilized eggs. This finding implicates the upstream recruitment of a novel gene in the Nasonia sex determining cascade and supports the notion that sex determining cascades can rapidly change by adding new components on top of existing regulators.

A New Component of the Nasonia Sex Determining Cascade Is Maternally Silenced and Regulates Transformer Expression

Science.gov (United States)

Bopp, Daniel; Beukeboom, Leo W.; van de Zande, Louis

2013-01-01

Although sex determination is a universal process in sexually reproducing organisms, sex determination pathways are among the most highly variable genetic systems found in nature. Nevertheless, general principles can be identified among the diversity, like the central role of transformer (tra) in insects. When a functional TRA protein is produced in early embryogenesis, the female sex determining route is activated, while prevention of TRA production leads to male development. In dipterans, male development is achieved by prevention of female-specific splicing of tra mRNA, either mediated by X-chromosome dose or masculinizing factors. In Hymenoptera, which have haplodiploid sex determination, complementary sex determination and maternal imprinting have been identified to regulate timely TRA production. In the parasitoid Nasonia, zygotic transformer (Nvtra) expression and splicing is regulated by a combination of maternal provision of Nvtra mRNA and silencing of Nvtra expression in unfertilized eggs. It is unclear, however, if this silencing is directly on the tra locus or whether it is mediated through maternal silencing of a trans-acting factor. Here we show that in Nasonia, female sex determination is dependent on zygotic activation of Nvtra expression by an as yet unknown factor. This factor, which we propose to term womanizer (wom), is maternally silenced during oogenesis to ensure male development in unfertilized eggs. This finding implicates the upstream recruitment of a novel gene in the Nasonia sex determining cascade and supports the notion that sex determining cascades can rapidly change by adding new components on top of existing regulators. PMID:23717455

A genetic screen in Myxococcus xanthus identifies mutants that uncouple outer membrane exchange from a downstream cellular response.

Science.gov (United States)

Dey, Arup; Wall, Daniel

2014-12-01

Upon physical contact with sibling cells, myxobacteria transiently fuse their outer membranes (OMs) and exchange OM proteins and lipids. From previous work, TraA and TraB were identified to be essential factors for OM exchange (OME) in donor and recipient cells. To define the genetic complexity of OME, we carried out a comprehensive forward genetic screen. The screen was based on the observation that Myxococcus xanthus nonmotile cells, by a Tra-dependent mechanism, block swarm expansion of motile cells when mixed. Thus, mutants defective in OME or a downstream responsive pathway were readily identified as escape flares from mixed inocula seeded on agar. This screen was surprisingly powerful, as we found >50 mutants defective in OME. Importantly, all of the mutations mapped to the traAB operon, suggesting that there may be few, if any, proteins besides TraA and TraB directly required for OME. We also found a second and phenotypically different class of mutants that exhibited wild-type OME but were defective in a responsive pathway. This pathway is postulated to control inner membrane homeostasis by covalently attaching amino acids to phospholipids. The identified proteins are homologous to the Staphylococcus aureus MprF protein, which is involved in membrane adaptation and antibiotic resistance. Interestingly, we also found that a small number of nonmotile cells were sufficient to block the swarming behavior of a large gliding-proficient population. This result suggests that an OME-derived signal could be amplified from a few nonmotile producers to act on many responder cells. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

La telematica per comunicare in modi nuovi ed incontrare mondi lontani.

Directory of Open Access Journals (Sweden)

Barbara Caprara

2008-07-01

Full Text Available Ipotizziamo di costruire un sito Web per facilitare la comunicazione interscolastica: a quali argomenti dare spazio nella home-page e quali introdurre successivamente? Che relazione instaurare tra la didattica tradizionale e le novità telematiche? Come trasmettere agli alunni la continuità tra gli argomenti trattati a lezione e le chat “improvvisate” in laboratorio? Di seguito viene presentata una serie di riflessioni a conclusione di due lavori di ricerca-azione che hanno inteso proporre il Web come estensione degli strumenti tradizionalmente utilizzati dagli insegnanti: dalla sperimentazione in una realtà locale, a un gemellaggio tra scuole di due continenti.

Os mares e o "fondaco": viagens de Florian

Directory of Open Access Journals (Sweden)

Vera Horn

2005-12-01

Full Text Available I due mari di Fliran, emignato di seconda generazione diviso tra la terra dove nato e la terra di sua madre, tra la Germania e la Calabria. Un viaggio che contiene altri viaggi, tra i quali spicca quello di Florian nel suo esere e la ricerca di un´identità. Ill viaggio di Dumas, punto di partenza per un viaggio interstuale e confluenza di un percorso esistenziale, e Ill Fondaco del Fico, transformato in locanda di famiglia e simbolo maggiore di una cultura antica che si rinnova. L´emigrazione como potenzialità umana e letteraria; spazio di pluralità.

Triagem de hemoglobinopatias e avaliação da degeneração oxidativa da hemoglobina em trabalhadores portadores do traço falciforme (HbAS, expostos a riscos ocupacionais Screening of abnormal hemoglobin and the evaluation of oxidative degeneration of hemoglobin among workers with the sickle cell trait (HbAS, exposed to occupational hazards

Directory of Open Access Journals (Sweden)

Isaac L. Silva Filho

2005-09-01

Full Text Available Desde os anos 40, quando foram realizados os primeiros trabalhos de triagem para hemoglobinas anormais na população brasileira, tem sido descrita uma elevada prevalência destas em nosso meio, especialmente a hemoglobina S que, a despeito da heterogeneidade de sua distribuição geográfica, quase sempre é a mais freqüente nas diversas regiões estudadas. Aliado a este fato, estudos recentes têm demonstrado uma maior susceptibilidade desta a oxidação, tornando-a mais sensível ao estresse oxidativo que a hemoglobina normal (HbAA, mesmo em se tratando de portadores heterozigotos (HbAS. Tendo em vista que algumas substâncias químicas são comprovadamente meta-hemoglobinizantes, que alguns fatores ambientais podem influenciar na morbidade da anemia falciforme e também o pouco e controverso conhecimento de que se dispõe a respeito de portadores do traço falciforme, este estudo, além da pesquisa de hemo-globinas anormais, avaliou também a degeneração oxidativa da hemoglobina, através da pesquisa de corpos de Heinz e dosagem de meta-hemoglobina em uma população de trabalhadores portadores do traço falciforme, expostos a riscos ocupacionais. Foram triadas 2.190 amostras sangüíneas entre Outubro de 1999 e Dezembro de 2001. A população estudada foi constituída de trabalhadores de ambos os sexos com idades variando entre 18 e 76 anos. Os resultados evidenciaram 4,7% portadores de hemoglobinas anormais na população analisada, sendo que a hemoglobina S foi a mais freqüente - 3,2% (71. Trabalhadores portadores do traço falciforme apresentaram uma chance 14 vezes maior de possuírem valores aumentados de meta-hemoglobina em relação aos trabalhadores com genótipo AA, porém, esta diferença não foi estatisticamente significativa.Hemoglobinopathies are frequent hereditary diseases in Brazilian population and have been a public health problem. This study reports the screening of abnormal hemoglobin among Fiocruz`s employees, as

Riscos e benefícios da triagem genética: o traço falciforme como modelo de estudo em uma população brasileira

Directory of Open Access Journals (Sweden)

Silva Roberto Benedito de Paiva e

1997-01-01

Full Text Available A triagem populacional de heterozigotos assintomáticos para fins de orientação genética é um procedimento bastante controvertido, por envolver o risco de rotulação, discriminação, estigmatização, perda de auto-estima e invasão de privacidade. Assim sendo, investigou-se no presente trabalho os efeitos da orientação genética fornecida a indivíduos diagnosticados como heterozigotos do gene da hemoglobina S (heterozigotos AS, portadores do traço falciforme durante a triagem de doadores de sangue. Foram convidados por carta 92 doadores AS para receber orientação genética gratuita e individualizada, 66 dos quais (72% aceitaram o convite. Cerca de 50% dos indivíduos trouxeram a parceira e/ou os filhos para investigação laboratorial das hemoglobinopatias, identificando-se assim alguns casais de risco e algumas crianças com anemia hemolítica crônica. Seis meses após o fornecimento da orientação genética, foi possível avaliar por entrevista pessoal ou por carta-questionário 43 doadores AS (65%, constatando-se uma boa assimilação das informações fornecidas. A orientação genética não produziu mudanças significativas na vida da maioria dos indivíduos e os riscos teóricos da orientação genética não aparecem de forma preocupante na casuística examinada. Foram constatados de forma esporádica, no entanto, indícios de estigmatização, rotulação, discriminação, perda da auto-estima e invasão de privacidade.

Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

CERN Document Server

Fracas, Fabio

2017-01-01

Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

A caccia del bosone di Higgs magneti, governi, scienziati e particelle nell'impresa scientifica del secolo

CERN Document Server

Maiani, Luciano

2013-01-01

Nel luglio 2012 veniva confermata sperimentalmente, presso i laboratori del CERN di Ginevra, l'esistenza del "bosone di Higgs", la più piccola di tutte le particelle subatomiche fino ad ora scoperte, teorizzata da Peter Higgs fin dal lontano 1964 e divulgata al mondo come "la particella di Dio". Una scoperta che costituisce un fondamentale passo avanti nella fisica delle particelle e nella conferma del modello standard dell'universo, in direzione di quella Teoria del Tutto, la teoria unificata delle forze, che la fisica insegue da decenni. Per giungere alla prima conferma sperimentale sono stati necessari quasi 50 anni di ricerche teoriche e la costruzione della macchina più grande del mondo, l'LHC, Large Hadron Collider, un anello lungo 27 chilometri situato a 100 metri di profondità nel territorio di Ginevra. Una sfida sul cui successo, all'inizio, pochi avrebbero scommesso e che si accompagna alla storia stessa del CERN, il Consiglio Europeo per la Ricerca Nucleare di cui Luciano Maiani è stato diretto...

Cercare mondi esplorazioni avventurose ai confini dell'universo

CERN Document Server

Tonelli, Guido

2017-01-01

Abitiamo un sottile guscio sferico, di pochi chilometri di spessore, intorno alla superficie della Terra. Anche se esploriamo gli abissi più profondi dell'oceano o scaliamo le vette dell'Himalaya, il nostro regno ha dimensioni ridicole. Per questo, se riflettiamo su quelle dell'universo, ci resta una sensazione di lieve sgomento. Non solo. Il nostro piccolo mondo è anche popolato di chimere, fantasmi e terribili inganni: pensiamo che quello che percepiamo sia reale, invece tutto cambia appena ci allontaniamo dall'angolo tranquillo in cui si svolge la nostra esistenza. Quando cerchiamo di capire i fenomeni che si osservano nel meraviglioso tappeto di galassie che ricopre la volta stellata, o quelli che caratterizzano la materia nei suoi componenti elementari, dobbiamo rinunciare alle certezze che governano la nostra vita e intraprendere un viaggio vertiginoso che lascia senza fiato. Guido Tonelli, fisico al Cern di Ginevra e uno dei padri della scoperta del bosone di Higgs, ci fa compiere questo viaggio irri...

Dalla microfisica alla macrofisica

CERN Document Server

Caldirola, Piero

1974-01-01

La scoperta delle leggi che reggono il micromondo, effettuata dai creatori della fisica quantistica, rappresenta, assieme a quella della relatività, il maggior progresso compiuto dalla fisica nel XX secolo. Fino a poco fa però, malgrado i suoi successi, la meccanica quantistica era ancora mal compresa soprattutto nelle sue conseguenze filosofiche, e fonte di dibattiti senza fine. Spiaceva infatti, come spiace ancora, a molti il dover usare due linguaggi del tutto diversi per descrivere il micro- e il macromondo, per cui la fisica quantistica appariva come un incidente, uno stadio provvisorio nel cammino della scienza. Fu però la stessa ricerca a mettere in evidenza l'esistenza di sistemi macroscopici, quali l'elio liquido, i superconduttori, il laser, descrivibili solamente attraverso le leggi quantistiche. Si comprese allora essere queste un ponte gettato fra il micro- e il macromondo. Il libro vuole illustrare queste leggi in maniera non divulgativa ma concettuale, cioè limitando al minimo l'uso del for...

Measurement of the Z boson transverse momentum and pseudorapidity differential cross sections

CERN Document Server

Magro, Jacopo; Di Marco, Emanuele

2017-01-01

Il Modello Standard della fisica delle particelle ` una teoria che descrive le particelleeelementari e le interazioni a cui sono sottoposte, ed ` una delle teorie pi` importantieudella fisica moderna. Elaborato negli anni ’60, nelle ultime cinque decadi ` statoeoggetto di numerosi test aventi lo scopo di verificarne l’accuratezza e la veridicit`. Iamaggiori risultati ottenuti all’interno di questo modello furono la scoperta dei bosonivettori W e Z nel 1983, da parte degli esperimenti UA1 e UA2, e del bosone di Higgsnel 2012 grazie agli esperimenti ATLAS e CMS. Sebbene descriva con successo molti processi di fisica delle particelle, rimangono escluse alcune evidenze sperimentali.Per cercare una risposta ad alcuni di questi quesiti, LHC, l’acceleratore di particellepi` grande del mondo, continua il suo lavoro, migliorando la conoscenza che abbiaumo del Modello Standard e cercando di superarlo. La misura della sezione d’urtodei processi del Modello Standard va proprio in tale direzione: fornisce im...

Materia strana romanzo scientifico

CERN Document Server

Gómez Cadenas, Juan José

2012-01-01

Nel Laboratorio europeo per la fisica delle particelle, il CERN di Ginevra, sta per vedere la luce uno dei più grandi progressi scientifici di tutti i tempi: la scoperta di un nuovo stato della materia, il cosiddetto "plasma di quark". La direttrice del CERN, Helena Le Guin, teme però che insieme al plasma si stiano formando grumi letali di materia strana, in grado di scatenare una reazione a catena che potrebbe distruggere l'intero pianeta. Mentre Helena cerca disperatamente di far fronte alla crisi, a Ginevra arrivano Irene de Ávila, una giovane e promettente fisica teorica, e il maggiore Héctor Espinosa, un militare americano assegnato alla sede dell'ONU per lavorare a un progetto ultrasegreto legato alla non proliferazione delle armi nucleari: inizia così un'appassionante vicenda in cui convergono rivalità scientifiche, peripezie personali e rischiose operazioni di spionaggio che porteranno i protagonisti fino in Iran.

Sex determination

Indian Academy of Sciences (India)

The sex-determining system differs considerably among organisms. Even among insect species, the genetic system for sex-determination is highly diversified. In Drosophila melanogaster, somatic sexual differentiation is regulated by a well characterized genetic hierarchy X : A > Sxl > tra/tra2 > dsx and fru. This cascade ...

The Interstitial Self: On Literature and Agamben's Potentiality ...

African Journals Online (AJOL)

Partendo da una riflessione letterario-filosofica sulla differenza tra poesia e filosofia, e tra conoscenza e possesso, questo articolo propone una definizione del linguaggio letterario come framezzo. La medianità letteraria, che trova ampio riscontro in gran parte della letteratura moderna e contemporanea, viene qui affrontata ...

The benefits of a critical stance: a reflection on past papers on the theories of reasoned action and planned behaviour.

Science.gov (United States)

Manstead, Antony S R

2011-09-01

In this paper, I reflect on past papers published in the British Journal of Social Psychology (BJSP) that have played a role in the development of the theory of reasoned action (TRA) and the theory of planned behaviour (TPB). I focus on seven papers that fall into five categories: (1) those that critique the TRA/TPB for taking insufficient account of social factors; (2) those that critique the models on the grounds that many social behaviours are 'habitual'; (3) those that critically examine the construct of perceived behavioural control; (4) those that argue for the importance of affective factors, which appear to be overlooked in the TRA/TPB; and (5) those that argue for the importance of studying the role of moderating factors and interaction effects in the TRA/TPB. I conclude that BJSP's traditional focus on criticism and theory development is one that benefits the journal and the field. ©2011 The British Psychological Society.

Aircraft Performance for Open Air Traffic Simulations

NARCIS (Netherlands)

Metz, I.C.; Hoekstra, J.M.; Ellerbroek, J.; Kugler, D.

2016-01-01

The BlueSky Open Air Tra_c Simulator developed by the Control & Simulation section of TU Delft aims at supporting research for analysing Air Tra_c Management concepts by providing an open source simulation platform. The goal of this study was to complement BlueSky with aircraft performance

Raccontare la giustizia

NARCIS (Netherlands)

Jansen, M.; Urban, M.B.

2017-01-01

Dalle varie riflessioni critiche sul rapporto tra letteratura e giustizia e tra narrazione e legge si può dedurre che alla letteratura venga attribuita la facoltà di “fare giustizia” e alla legge il potenziale di produrre delle storie. Anche se le opinioni divergono sull’effettivo valore

AcEST: BP916278 [AcEST

Lifescience Database Archive (English)

Full Text Available DROER GG24967 OS=Drosophila erecta GN=GG24967 P... 33 9.2 tr|A4V047|A4V047_DROME Brother of odd with entrails...SFLGSIPMRKRILPAPTLDLMDPHHHP 673 >tr|A4V047|A4V047_DROME Brother of odd with entrails

Genomic analysis of CD8+ NK/T cell line, ‘SRIK-NKL’, with array-based CGH (aCGH), SKY/FISH and molecular mapping

Science.gov (United States)

Rossi, Michael; LaDuca, Jeff; Cowell, John; Srivastava, Bejai I.S.; Matsui, Sei-ichi

2010-01-01

We performed aCGH, SKY /FISH, molecular mapping and expression analyses on a permanent CD8+ NK/T cell line, ‘SRIK-NKL’ established from a lymphoma (ALL) patient, in attempt to define the fundamental genetic profile of its unique NK phenotypes. aCGH revealed hemizygous deletion of 6p containing genes responsible for hematopoietic functions. The SKY demonstrated that a constitutive reciprocal translocation, rcpt(5;14)(p13.2;q11) is a stable marker. Using somatic hybrids containing der(5) derived from SRIK-NKL, we found that the breakpoint in one homologue of no. 5 is located upstream of IL7R and also that the breakpoint in no. 14 is located within TRA@. The FISH analysis using BAC which contains TRA@ and its flanking region further revealed a ~231 kb deletion within 14q11 in the der(5) but not in the normal homologue of no. 14. The RT-PCR analysis detected mRNA for TRA@ transcripts which were extending across, but not including, the deleted region. IL7R was detected at least at mRNA levels. These findings were consistent with the immunological findings that TRA@ and IL7R are both expressed at mRNA levels and TRA@ at cytoplasmic protein levels in SRIK-NKL cells. In addition to rept(5;14), aCGH identified novel copy number abnormalities suggesting that the unique phenotype of the SRIK-NKL cell line is not solely due to the TRA@ rearrangement. These findings provide supportive evidence for the notion that SRIK-NKL cells may be useful for studying not only the function of NK cells but also genetic deregulations associated with leukemiogenesis. PMID:17640729

The serpent and the Madonna: Senses, practices and soundscapes in a vodou site: Saut d’Eau, Haiti

Directory of Open Access Journals (Sweden)

Francesco Ronzon

2017-12-01

Full Text Available L’articolo analizza la relazione tra sensi, pratiche e paesaggi sonori in relazione a Sodo, sede di un pellegrinaggio vodou su scala nazionale ad Haiti. Partendo dagli studi sui soundscapes (Schafer 1977 come punto di vista teorico per analizzare l’interazione tra suono e persone in un luogo specifico, l’articolo mostra l’interazione tra suoni ambientali, musica registrata e performance dal vivo. In particolare, questa ricerca vuole investigare il micro livello dell’ascolto situato, ovvero i modi con i quali gli attori sociali indirizzano la loro attenzione verso i suoni dell’ambiente in relazione alle loro pratiche sociali, culturali e religiose.

Refraction, scattering, absorption and mode conversion of ECRH waves in RTP

International Nuclear Information System (INIS)

Smits, F.M.A.; Oomens, A.A.M.; Bank, S.L.; Bongers, W.A.; Polman, R.W.; Schueller, F.C.

1993-01-01

A diagnostic, TraP, has been installed which measures the Transmitted Power fraction of one of the two additional Electron Cyclotron Heating sources on the RTP tokamak (R=0.72 m, B 0 ≤2.5 T, a=0.164 m). The ECH power (60 GHz, 180 kW) of this source is launched in O-mode radially from the low field side into RTP. TraP is installed opposite to this launcher at the high field side to measure the transmitted power fraction. With TraP, studies on the refraction, scattering, absorption and mode conversion of the incoming beam have been performed. (orig.)

Ocorrência de doenças oftalmológicas em eqüinos utilizados para tração urbana na cidade de Londrina, PR Occurrence of ophthalmologic diseases in horses used for urban cart hauling in Londrina, PR, Brazil

Directory of Open Access Journals (Sweden)

Peter Reichmann

2008-12-01

Full Text Available Com o objetivo de verificar a ocorrência de doenças oculares em eqüinos utilizados para serviços de tração urbana na cidade de Londrina, PR, foram revistos os registros clínicos de 805 eqüinos atendidos no Hospital Veterinário da Universidade Estadual de Londrina no período entre 1992 e 2007. Nesses registros clínicos foram verificados 25 casos de doenças oftalmológicas (3,1%, compostas por 12 casos (48% de doenças da córnea, seis casos (24% de catarata, seis casos (24% de doenças da conjuntiva (paralelas a outras enfermidades oculares ou não, dois casos (8% de uveíte recorrente eqüina, um caso de carcinoma de células escamosas da terceira pálpebra, um caso de lesão crônica de pálpebra, com necrose e perda do globo ocular, e um caso de Phthisis bulbi (4% cada. A principal causa das enfermidades oftalmológicas diagnosticadas nesses animais foi traumática (36% dos casos. A maioria das doenças diagnosticadas neste estudo, se não tratadas adequadamente, pode resultar em cegueira e, conseqüentemente, pode inutilizar o animal para uso em tração urbana. Isso reforça a necessidade de conscientização dos carroceiros sobre a importância e a profilaxia dessas enfermidades.The clinical records of 805 horses admitted to the Veterinary Hospital of the State University of Londrina between 1992 and 2007 were reviewed in order to establish the occurrence of ophthalmologic diseases in horses used for hauling carts in Londrina, Paraná, Brazil. Among these records, there were 25 ophthalmologic cases (3.1%, composed of 12 cases (48% of corneal diseases, six cases (24% of cataracts, six cases (24% of conjunctival diseases (associated or not to other lesions, two cases (8% of recurrent equine uveitis, one case of squamous cell carcinoma of the third eyelid, one case of chronic necrotic eyelid lesion with loss of the eye globe and one case of phthisis bulbi (4% each. Trauma was the most important etiology for eye diseases diagnosed

Exhibition

CERN Document Server

Staff Association

2018-01-01

En dehors des frontières Maxence Piquet Du 2 au 11 mai 2018 | CERN Meyrin, Bâtiment principal Exposition de peinture d'un artiste autodidacte Maxence Piquet (signature artiste M-P), avec différentes techniques (acrylique, huile, fusain, collage...) et sur différents supports. Un art souvent brut et parfois provoquant, avec des touches expressionnistes et cubistes principale origine de son art. Des œuvres souvent vivent et colorées... Cette exposition est la première en dehors d ses frontières Lorraine et a pour but de faire voyager son art au regard du plus grand nombre . Pour plus d’informations et demandes d’accès : staff.association@cern.ch | Tél: 022 766 37 38

O espírito da Arte Chinesa

Directory of Open Access Journals (Sweden)

Emílio Mazza

1963-12-01

Full Text Available Característica fundamental da' pintura chinesa é a calma harmoniosa. O pintor chinês é um sereno taoista, um homem que, antes de pintar, permaneceu longamente em comunhão com a natureza, contemplando-a do alto das montanhas. Na solidão de seus retiros, longe da mesquinhez citadina, o pintor chinês purifica seu coração, aprende a compreender a íntima essência e a grandiosa unidade dos aspectos naturais e a vitalidade que vibra nas miríades de formas viventes. Êste respiro de ar montanhês, scianlinci, emana de tôda a grande pintura chinesa, refletindo a calma atingida pelo espírito do artista, confundindo-se com a harmonia universal.

Essai d’une méthodologie d’analyse des données d’Internet sur un ordinateur

Directory of Open Access Journals (Sweden)

Géraldine Foin

2017-01-01

Full Text Available Dans l’étude de l’environnement numérique dans lequel les individus vivent et évoluent, des problèmes méthodologiques peuvent se poser pour les chercheurs en sciences humaines et sociales. Cet article s’interroge sur la compatibilité des outils classiques en sciences sociales pour l’étude des pratiques numériques sur un écran, celui de l’ordinateur. En effet, l’usage classique d’entretiens, de questionnaires ou d’observations ne suffit plus pour recueillir avec précision les données relatives à Internet et ses écrans (pratique et consommation. Nous proposons une méthodologie complémentaire aux outils non numériques.

Effects of Taiwan Roselle anthocyanin treatment and single-walled carbon nanotube addition on the performance of dye-sensitized solar cells

International Nuclear Information System (INIS)

Chou, C S; Huang, Y H; Chen, Y S; Tsai, P J; Wu, P; Shu, G G

2014-01-01

This study investigates the relationship between the performance of a dye-sensitized solar cell (DSSC) sensitized by a natural sensitizer of Taiwan Roselle anthocyanin (TRA) and fabrication process conditions of the DSSC. A set of systematic experiments has been carried out at various soaking temperatures, soaking periods, sensitizer concentrations, pH values, and additions of single-walled carbon nanotube (SWCNT). An absorption peak (520 nm) is found for TRA, and it is close to that of the N719 dye (518 nm). At a fixed concentration of TRA and a fixed soaking period, a lower pH of the extract or a lower soaking temperature is found favorable to the formation of pigment cations, which leads to an enhanced power conversion efficiency (η) of DSSC. For instance, by applying 17.53 mg/100ml TRA at 30 for 10 h, as the pH of the extract decreases to 2.00 from 2.33 (the original pH of TRA), the η of DSSC with TiO 2 +SWCNT electrode increases to 0.67% from 0.11% of a traditional DSSC with TiO 2 electrode. This performance improvement can be explained by the combined effect of the pH of sensitizer and the additions of SWCNT, a first investigation in DSSC using the natural sensitizer with SWCNT.

Effects of Taiwan Roselle anthocyanin treatment and single-walled carbon nanotube addition on the performance of dye-sensitized solar cells

Science.gov (United States)

Chou, C. S.; Tsai, P. J.; Wu, P.; Shu, G. G.; Huang, Y. H.; Chen, Y. S.

2014-04-01

This study investigates the relationship between the performance of a dye-sensitized solar cell (DSSC) sensitized by a natural sensitizer of Taiwan Roselle anthocyanin (TRA) and fabrication process conditions of the DSSC. A set of systematic experiments has been carried out at various soaking temperatures, soaking periods, sensitizer concentrations, pH values, and additions of single-walled carbon nanotube (SWCNT). An absorption peak (520 nm) is found for TRA, and it is close to that of the N719 dye (518 nm). At a fixed concentration of TRA and a fixed soaking period, a lower pH of the extract or a lower soaking temperature is found favorable to the formation of pigment cations, which leads to an enhanced power conversion efficiency (η) of DSSC. For instance, by applying 17.53 mg/100ml TRA at 30 for 10 h, as the pH of the extract decreases to 2.00 from 2.33 (the original pH of TRA), the η of DSSC with TiO2+SWCNT electrode increases to 0.67% from 0.11% of a traditional DSSC with TiO2 electrode. This performance improvement can be explained by the combined effect of the pH of sensitizer and the additions of SWCNT, a first investigation in DSSC using the natural sensitizer with SWCNT.

[Study of "The Sūitra of the tranquilization of hemorrhoids" and other relevant material].

Science.gov (United States)

Yamanaka, Yukio; Yamashita, Tsutomu; Akahane, Ritsu; Muroya, Yasutaka

2011-09-01

The present paper focuses primarily on a philological and historical study of the Arśapraśamanisūtra ("The Sütra of the tranquilization of hemorrhoids"). This Sūtra is one of the Buddhist scriptures that are characterized by the magico-religious treatment of various diseases, especially by means of "healing spells" (skt. dhāranī or mantra), as shown by the preliminary survey in our previous paper "The Tradition of healing with magical spells as seen in Buddhist texts", Journal of the Japan Society of Medical History 55/1 (2009), 77-96. The original text of the Arśapraśamanisūtra, most probably written in Sanskrit, is lost whereas its Chinese and Tibetan translations have survived. After an introductory summary, we provide critically edited texts of the Tibetan and Chinese translations accompanied by their Japanese translations with critical notes and annotations. In particular, the Tibetan translation presented here has been critically edited for the first time on the basis of collation of the five editions of the Tibetan Buddhist Canon. In our next paper we will analyze the descriptions of hemorrhoids as found in the Sūtra in comparison with those illustrated in classical Ayurveda literature. And we will also offer further observations about the methods and principles for the treatment and healing of hemorrhoid that are attested in Buddhist scriptures.

The efficacy of a modified Theory of Reasoned Action to explain gambling behavior in college students.

Science.gov (United States)

Thrasher, Robert G; Andrew, Damon P S; Mahony, Daniel F

2011-09-01

Recently, Thrasher et al. (College Student Affairs Journal 27(1): 57-75, 2007) explored the efficacy of the Theory of Reasoned Action (TRA; Ajzen and Fishbein, Attitudes, personality, and behavior, 1980) in explaining gambling behavior of college students. However, their study found the TRA only predicted small amounts of variance in gambling intentions. Heeding their call to enhance the efficacy of the TRA through the addition of explanatory variables to the model, the present study incorporated gambling motivations and locus of control as moderating variables within the TRA to test the potential of a modified TRA in explaining gambling behavior of college students. A total of 345 students at a major metropolitan research university in the Midwest volunteered to participate in the study. A series of hierarchical linear regressions indicated intrinsic motivation to accomplish (p = .002) significantly moderated the relationship between gambling attitudes and gambling intentions. Further, internal locus of control (p < .001), chance locus of control (p < .001), and powerful others locus of control (p < .001) also significantly moderated the relationship between gambling attitudes and gambling intentions. The significant impact of the moderating variables on the relationship between gambling attitudes and intentions suggests intrinsic motivation and locus of control can alter the impact of the relationship between gambling attitudes and gambling intentions.

Annotating pathogenic non-coding variants in genic regions.

Science.gov (United States)

Gelfman, Sahar; Wang, Quanli; McSweeney, K Melodi; Ren, Zhong; La Carpia, Francesca; Halvorsen, Matt; Schoch, Kelly; Ratzon, Fanni; Heinzen, Erin L; Boland, Michael J; Petrovski, Slavé; Goldstein, David B

2017-08-09

Identifying the underlying causes of disease requires accurate interpretation of genetic variants. Current methods ineffectively capture pathogenic non-coding variants in genic regions, resulting in overlooking synonymous and intronic variants when searching for disease risk. Here we present the Transcript-inferred Pathogenicity (TraP) score, which uses sequence context alterations to reliably identify non-coding variation that causes disease. High TraP scores single out extremely rare variants with lower minor allele frequencies than missense variants. TraP accurately distinguishes known pathogenic and benign variants in synonymous (AUC = 0.88) and intronic (AUC = 0.83) public datasets, dismissing benign variants with exceptionally high specificity. TraP analysis of 843 exomes from epilepsy family trios identifies synonymous variants in known epilepsy genes, thus pinpointing risk factors of disease from non-coding sequence data. TraP outperforms leading methods in identifying non-coding variants that are pathogenic and is therefore a valuable tool for use in gene discovery and the interpretation of personal genomes.While non-coding synonymous and intronic variants are often not under strong selective constraint, they can be pathogenic through affecting splicing or transcription. Here, the authors develop a score that uses sequence context alterations to predict pathogenicity of synonymous and non-coding genetic variants, and provide a web server of pre-computed scores.

Beliefs of Pre-Service Teachers toward Competitive Activities and the Effect on Implementation and Planning for Physical Education Classes

Science.gov (United States)

Bernstein, Eve; Herman, Ariela M.; Lysniak, Ulana

2013-01-01

The Theory of Reasoned Action (TRA) is the framework for this study. TRA, or attitude theory, suggests that teachers' affect and cognition or knowledge may influence how an individual interprets an activity (Ajzen, 2005). Attitudes may affect teachers' perceptions and beliefs about PE, and these perceptions and beliefs may affect how teachers…

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

DOA kinase, the Drosophila member of the LAMMER/Clk protein kinase family, phosphorylates SR and SR-like proteins, including TRA, TRA2 and RBP1, which are responsible for the alternative splicing of transcripts encoding the key regulator of sex-specific expression in somatic cells of the fly, DOUBLESEX. Specific Doa ...

Tradition and progress, future and past in the novels of Maria Messina

African Journals Online (AJOL)

Maria Messina scrisse i suoi romanzi tra il 1920 e il 1928, quando il fascismo aveva troncato l'emancipazione femminile e rinforzato le strutture patriarcali. I suoi personaggi femminili rispecchiano i conflitti dell'epoca, divisi tra i richiami contrastanti della tradizione e del progresso, di passato e futuro. Nei primi romanzi le ...

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

pp 49-54 Research Article. Exact Tandem Repeats Analyzer (E-TRA): A new program for DNA sequence mining · Mehmet Karaca Mehmet Bilgen A. Naci Onus Ayse Gul Ince Safinaz Y. Elmasulu · More Details Abstract Fulltext PDF. Exact Tandem Repeats Analyzer 1.0 (E-TRA) combines sequence motif searches with ...

Little Italy, big japan: patterns of continuity and displacement among ...

African Journals Online (AJOL)

L'articolo studia due incontri di eccezione tra la cultura italiana e quella giapponese: l'organica interpretazione di Fosco Maraini, antropologo e orientalista, in visita a più riprese (anche in circostanze drammatiche) nel paese del Sol Levante prima e dopo la seconda guerra mondiale; le impressioni e i giudizi, tra letteratura ...

AcEST: BP919546 [AcEST

Lifescience Database Archive (English)

Full Text Available Definition tr|A3TZ18|A3TZ18_9RHOB ATP-dependent metalloprotease FtsH OS=Oceanicola batsensis HTCC2597 Align ...r... 33 9.2 >tr|A3TZ18|A3TZ18_9RHOB ATP-dependent metalloprotease FtsH OS=Oceanicola batsensis HTCC2597 GN=O

Análise dos traçados de ondas da agregação plaquetária em pacientes com doenças cardiovasculares em uso do ácido acetil salicílico comparados a doadores de sangue Analysis of the waves and aggregation patterns in patients with cardiovascular diseases in using acetylsalicylic acid compared blood donors

Directory of Open Access Journals (Sweden)

Patrícia S. M. Bernardi

2004-12-01

Full Text Available A agregação plaquetária avalia a função das plaquetas através de diferentes vias de ativação plaquetária in vitro, fornecendo traçados de ondas equivalentes à propriedade física dessa agregação. Sabendo-se que a aspirina acetila irrever­sivelmente a enzima cicloxigenase prevenindo a geração de tromboxana A2, potente ativador da agregação plaquetária, esta droga tem sido analisada há mais de trinta anos na clínica médica em pacientes com doenças cardiovasculares como uma potente droga antitrombótica. Foram nossos objetivos obter traçados de ondas correspondentes às fases da agregação plaquetária para nossa padronização utilizando nosso grupo controle de doadores de sangue e compará-las com nosso grupo estudo, frente a diferentes agentes agonistas em diferentes concentrações: ADP 1µM e 3µM; AA, 0,5mM; ADR, 0,05 mg/mL, 0,025 mg/mL e 0,010 mg/mL. Os grupos analisados foram constituídos por 41 cardíacos e 40 doadores de sangue considerados controle. Dos cardíacos, 33 faziam uso regular do AAS na concentração de 200 mg/dia e oito na concentração de 100 mg/dia, sendo todos considerados hipertensos. A padronização da agregometria estava na dependência do encontro de traçados correspondentes a ondas de agregação, sendo esses obtidos em porcentagem no tempo de cinco minutos estandartizados pelo aparelho utilizado. Comparando os resultados entre os pacientes e o grupo controle, foi possível observar que, na presença dos agentes agregantes ADP 1µM e ADP 3 µM, ADR 0,05 mg/mL, 0,025mg/mL e 0,010 mg/mL, os pacientes apresentaram 1ª onda, mas não 2ª onda. Por sua vez, no caso do AA 0,5 mM não houve o encontro de traçados de ondas.Platelet aggregation illustrates the function of the platelets by different ways of in vitro platelet activation providing wave traces equivalent to the physical proprieties of this aggregation. It is well known that aspirin irreversibly blocks the cyclooxygenase enzyme

Bulk-fill resin-based composites: an in vitro assessment of their mechanical performance.

Science.gov (United States)

Ilie, N; Bucuta, S; Draenert, M

2013-01-01

The study aimed to assess the mechanical performance of seven bulk-fill RBCs (Venus Bulk Fill, Heraeus Kulzer; SureFil SDR flow, Dentsply Caulk; x-tra base and x-tra fil, VOCO; Filtek Bulk Fill, 3M ESPE; SonicFill, Kerr; Tetric EvoCeram Bulk Fill, Ivoclar Vivadent) by determining their flexural strength (σ), reliability (Weibull parameter, m), flexural modulus (Eflexural), indentation modulus (YHU), Vickers hardness (HV), and creep (Cr). The significant highest flexural strengths were measured for SonicFill, x-tra base, and x-tra fil, while x-tra base, SureFil SDR flow, and Venus Bulk Fill showed the best reliability. The differences among the materials became more evident in terms of Eflexural and YHU, with x-tra fil achieving the highest values, while Filtek Bulk Fill and Venus Bulk Fill achieved the lowest. The enlarged depth of cure in bulk-fill RBCs seems to have been realized by enhancing the materials' translucency through decreasing the filler amount and increasing the filler size. The manufacturer's recommendation to finish a bulk-fill RBC restoration by adding a capping layer made of regular RBCs is an imperative necessity, since the modulus of elasticity and hardness of certain materials (SureFil SDR flow, Venus Bulk Fill, and Filtek Bulk Fill) were considerably below the mean values measured in regular nanohybrid and microhybrid RBCs. The class of bulk-fill RBCs revealed similar flexural strength values as the class of nanohybrid and microhybrid RBCs, and significantly higher values when compared to flowable RBCs. The modulus of elasticity (Eflexural), the indentation modulus (YHU), and the Vickers hardness (HV) classify the bulk-fill RBCs as between the hybrid RBCs and the flowable RBCs; in terms of creep, bulk-fill and the flowable RBCs perform similarly, both showing a significantly lower creep resistance when compared to the nanohybrid and microhybrid RBCs.

Determinants of Physical Activity in Middle School Children.

Science.gov (United States)

Trost, Stewart G.; Saunders, Ruth; Ward, Dianne S.

2002-01-01

Evaluated the theory of reasoned action (TRA) and theory of planned behavior (TPB) in predicting moderate-to-vigorous physical activity (MVPA) in sixth grade students. Student surveys on physical activity behavior and attitudes and measurement of MVPA indicated that the TRA and TPB accounted for only a small percentage of the variance in MVPA. (SM)

AcEST: BP916010 [AcEST

Lifescience Database Archive (English)

Full Text Available 5QMV0_ORYSJ cDNA clone:J023047L09, full insert sequen... 71 3e-11 tr|A8IXU3|A8IXU3_BRACM Altered response to gravity...bjct: 364 GSSSSRYPTESPENGNIDGKDKSSKKKWFNLNLNRSDK 401 >tr|A8IXU3|A8IXU3_BRACM Altered response to gravity 1 O

Che cos'è la conoscenza? un universo in espansione

CERN Document Server

Franceschini, Guiliano

2017-01-01

Il testo propone un viaggio nell'universo della conoscenza, tra le galassie di conoscenza (religione, scienza, arte), nel cervello (percezione, apprendimento, memoria) e nell'etica (dalla conoscenza all'educazione). Le argomentazioni si espandono attraverso un registro comunicativo intuitivo, tra divulgazione e speculazione, attraverso esempi e riferimenti concreti, rivolgendosi in alcuni casi direttamente al lettore.

AcEST: DK951699 [AcEST

Lifescience Database Archive (English)

Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

Il marketing budget nel settore bancario e assicurativo.

OpenAIRE

Antonella Caru'; Federica Ielasi; Luciano Munari

2012-01-01

Il capitolo descrive i risultati della ricerca relativi alle modalità con cui le istituzioni bancarie e assicurative definiscono il budget e l'allocazione dei costi relativi alle attività di marketing; l'analisi evidenzia alcune differenze tra i comportamenti di assicurazioni e banche e, all'interno di queste ultime, tra diverse categorie di banche.

AcEST: BP913209 [AcEST

Lifescience Database Archive (English)

Full Text Available terized protein OS=Magna... 40 0.10 tr|A3LQY9|A3LQY9_PICST Nonribosomal protein of the nucleolus and... 39 0...AESGKRSA 694 Query: 478 SK 483 SK Sbjct: 695 SK 696 >tr|A3LQY9|A3LQY9_PICST Nonribosomal protein of the nucleolus

Monitoramento da contaminação por elementos traço em ostras comercializadas em Recife, Pernambuco, Brasil Monitoring of trace elements in oysters marketed in Recife, Pernambuco, Brazil

Directory of Open Access Journals (Sweden)

André Dias Cavalcanti

2003-10-01

Full Text Available Amostras de ostras comercializadas em Recife, Pernambuco, Brasil, foram monitoradas em relação ao conteúdo de elementos traço (Hg, Zn, Fe, Cu e Mn durante o período de um ano (março/2001 a fevereiro/2002. Mercúrio foi o principal contaminante encontrado nas ostras e o elemento que apresenta maior risco à saúde pública. Foram encontrados valores de concentração de Hg em ostras de até 551,12µg/kg (peso úmido. Esses valores sugerem que a ingestão de ostras deve ser feita com restrições, principalmente, pela população que vive de sua coleta como forma de subsistência, por crianças, e mulheres grávidas. A avaliação dos níveis de mercúrio em frutos do mar é um importante fator para avaliar o risco de contaminação por mercúrio em pessoas não ocupacionalmente expostas.Samples of oysters marketed in Recife, Pernambuco, Brazil, were monitored for the concentration of trace elements (Hg, Zn, Fe, Cu, and Mn for one year (from March 2001 to February 2002. Mercury was the principal contaminant found in oysters and the element posing the greatest public health risk. Mercury levels in oysters reached 551.12µg/kg (wet weight. These values suggest that oyster consumption should be restricted, especially among communities that gather them as a subsistence activity, as well as by children and pregnant women. Evaluation of mercury concentration in seafood is an important factor for assessing the risk of contamination among individuals who are not occupationally exposed.

A próclise em sentenças infinitivas preposicionadas em PB

Directory of Open Access Journals (Sweden)

Marco Antonio Martins

2016-12-01

Full Text Available http://dx.doi.org/10.5007/1984-8420.2016v17n1p43 Apresentamos, neste artigo, uma análise formal para a colocação de clíticos em sentenças infinitivas preposicionadas no português brasileiro (PB. A análise se baseia no trabalho desenvolvido por Sena Pereira (2015 que aborda a colocação de clíticos nesse contexto na escrita brasileira dos séculos XIX e XX. Nossa proposta é que preposições que ocupam o núcleo de CP motivam mudanças nos valores atribuídos aos traços-phi e aos traços-V fortes nas categorias funcionais COMP, Tempo e Pessoa no PB. Defendemos que em tal configuração a próclise em PB é derivada do movimento do verbo para a categoria funcional Tempo em que há a associação de traços [+V] e traços [+AGR].

Saussure chiama, pascoli risponde. Nuove prospettive sulla ricerca anagrammatica

Directory of Open Access Journals (Sweden)

Giovanni Palmieri

2016-07-01

Full Text Available Dopo un’ampia e aggiornata ricostruzione storico-filologica della corrispondenza tra Saussure e Pascoli, l’articolo suggerisce nuove prospettive sulla ricerca ana-grammatica negando che esista uno iato insanabile tra il Saussure degli anagrammi e quello del Cours. Per dimostrare ciò, l’autore si avvale anche degli scritti saussuriani ritrovati nel 1996. In particolare, Saussure avrebbe ‘scoperto’ il significante (elemento linguistico individuato in contrapposizione alla figure vocale e le serie paradigmatiche proprio a partire dalla sua ricerca sulle associazioni foniche presenti nelle strutture anagrammatiche del linguaggio (poetico. Inoltre, a partire da una riflessione sul principio di similarità fonica, il confronto tra le due ricerche saussuriane consente di limitare il preteso dogma dell’arbitrarietà del segno. Ciò in perfetto accordo con Jakobson. Sviluppando poi un’intuizione di Meillet, viene analizzato il rapporto che esiste tra anagrammi e musica (dodecafonica, nel caso in questione. Chiude l’articolo una lettera immaginaria, ma non troppo, con la quale Pascoli avrebbe potuto rispondere a Saussure sulla questione degli anagrammi presenti nel testo poetico.

«Nothing to laugh»: ironic apocalypses of G. Morselli and M. P. Shiel

Directory of Open Access Journals (Sweden)

Francesco Sielo

2017-01-01

Full Text Available I romanzi Dissipatio H. G. e The Purple Cloud, entrambi tra le prime testimonianze del tema dell’ “ultimo uomo sulla Terra” nelle rispettive letterature, mostrano un ampio uso dell’ironia, contrariamente a quanto diverrà canonico nel genere apocalittico-distopico. Attraverso un confronto tra elementi dei due romanzi che non trovano riscontro in altre opere del genere, il presente contributo intende analizzare la dinamica tra la rappresentazione ironica della contemporaneità come distopia, l’evento catastrofico e la successiva rifondazione della civiltà su basi utopiche. Tra le tematiche comuni alle due opere fondamentale è il rapporto di conservazione e monumentizzazione dei resti del passato che si rovescia parodicamente in un’ansia di distruzione che i protagonisti mostrano verso ogni testimonianza della storia umana e in particolar modo verso gli oggetti della civiltà moderna. La critica ironica verso la contemporaneità si converte quindi nei due autori nella volontà psicologica di riepilogare e poi «parentesizzare», attraverso una narrazione apocalittica, ogni aspetto della cultura contemporanea, per poter in seguito riattivare una progettualità utopica.

Molecular recognition in myxobacterial outer membrane exchange: functional, social and evolutionary implications.

Science.gov (United States)

Wall, Daniel

2014-01-01

Through cooperative interactions, bacteria can build multicellular communities. To ensure that productive interactions occur, bacteria must recognize their neighbours and respond accordingly. Molecular recognition between cells is thus a fundamental behaviour, and in bacteria important discoveries have been made. This MicroReview focuses on a recently described recognition system in myxobacteria that is governed by a polymorphic cell surface receptor called TraA. TraA regulates outer membrane exchange (OME), whereby myxobacterial cells transiently fuse their OMs to efficiently transfer proteins and lipids between cells. Unlike other transport systems, OME is rather indiscriminate in what OM goods are transferred. In contrast, the recognition of partnering cells is discriminatory and only occurs between cells that bear identical or closely related TraA proteins. Therefore TraA functions in kin recognition and, in turn, OME helps regulate social interactions between myxobacteria. Here, I discuss and speculate on the social and evolutionary implications of OME and suggest it helps to guide their transition from free-living cells into coherent and functional populations. © 2013 John Wiley & Sons Ltd.

The message changes belief and the rest is theory: the "1% or less" milk campaign and reasoned action.

Science.gov (United States)

Booth-Butterfield, Steve; Reger, Bill

2004-09-01

Theory-based approaches to public health interventions are useful for designing, implementing, and evaluating research. This paper describes and presents data to support the theoretical force behind the "1% or less" nutrition intervention studies. Using the Theory of Reasoned Action (TRA), high-fat (whole and 2%) milk users were targeted. Supermarket milk sale data were collected, and randomly selected intervention and comparison community residents were surveyed via telephone to assess milk use. TRA constructs were used in the surveys that were conducted immediately before and after a 6-week mass media campaign. Campaign messages were aimed at changing behavioral rather than normative beliefs. We found significant and predicted changes in intervention participants on intention, attitude, and behavioral beliefs, but not subjective norm outcomes. A path model showed support that TRA variables mediated significant changes in self-reported milk use. The analysis further validates the TRAs and supports a template using both the Principle of Compatibility and TRA to aid development and implementation of messages for effective behavior change field interventions.

Per una poetica del plagio: il caso di Kathy Acker

Directory of Open Access Journals (Sweden)

Claudia Cao

2012-10-01

Full Text Available Dopo una breve introduzione intorno alla produzione letteraria di Kathy Acker e dopo una panoramica su alcuni saggi in cui l’autrice si sofferma sulla stretta relazione esistente tra scrittura e potere, e tra scrittura e desiderio, l’articolo esamina il significato assunto dal plagio in una delle sue opere più sperimentali: Great Expectations. Prendendo le mosse da un concetto centrale nella riflessione elaborata da Deleuze e Guattari all’interno del loro L’Anti-Œdipe. Capitalisme et Schizophrénie, come quello di “macchina desiderante”, questo contributo intende illustrare la relazione esistente tra l’atto del plagio e il pensiero schizofrenico elaborato dai due pensatori francesi.

Utility of the theories of reasoned action and planned behavior for predicting physician behavior: a prospective analysis.

Science.gov (United States)

Millstein, S G

1996-09-01

The utility of the theory of reasoned action (TRA) and the theory of planned behavior (TPB) for prospectively predicting physicians' delivery of preventive services was compared. Primary care physicians (N = 765) completed 2 mail surveys at periods 6 months apart. The addition of perceived behavioral control to the TRA model significantly increased the variance accounted for in behavioral intention and subsequent behavior (p behavioral control had direct effects on behavior and interacted with social norms and behavioral intentions. Applications of models such as the TRA or TPB have focused primarily on predicting the behavioral intentions and behaviors of patients. Results suggest that these models have relevance for studying the behavior of health care providers as well.

AcEST: DK953909 [AcEST

Lifescience Database Archive (English)

Full Text Available A3B212_ORYSJ Putative uncharacterized protein OS=Oryza... 49 1e-04 tr|A2Y2K5|A2Y2K5_ORYSI Putative uncharact...+ ++DP I +SKSA + Y + + Sbjct: 76 VEEENDTPSATKSIRDPPVITVSKSATYALYALTY 110 >tr|A2Y2K5|A2Y2K5_ORYSI Putative un

AcEST: DK957741 [AcEST

Lifescience Database Archive (English)

Full Text Available yza sativa subs... 148 3e-34 tr|A2Y2K9|A2Y2K9_ORYSI Putative uncharacterized protein OS=Oryza... 148 3e-34 t...70 SALLKIDVPLMFIGDDASPGL 190 >tr|A2Y2K9|A2Y2K9_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp.

AcEST: DK944912 [AcEST

Lifescience Database Archive (English)

Full Text Available I Ribosomal protein L32 OS=Hibiscus mechowi... 59 2e-07 tr|A6XJN0|A6XJN0_9ROSI Ribosomal protein L32 OS=Hibiscus...S=Cuscuta reflexa ... 57 6e-07 tr|A6XJM9|A6XJM9_9ROSI Ribosomal protein L32 OS=Hibiscus

Surface Circulation in the Iroise Sea (W. Brittany) from High Resolution HF Radar Mapping

Science.gov (United States)

2013-01-01

oceanographic conditions in many coastal regions (e.g. Bassin et al., 2005; Breivik and Sætra, 2001; Haus et al., 2000; Kaplan et al., 2005; Kovacevic et...Oceanol. Acta 22–2, 153–166. Breivik , O., Sætra, O., 2001. Real time assimilation of HF radar currents into a coastal ocean model. J. Mar. Syst. 28

The Cinema of Federico Fellini and 8½ | Cardullo | Italian Studies in ...

African Journals Online (AJOL)

L'articolo ripercorre i grandi temi del cinema di Federico Fellini alla luce della sua biografia: nel nodo tra arte e vita, l'autore vede i segni di un rapido superamento delle strettoie del neorealismo, da cui il regista era partito, e un approdo ai grandi temi di un'immaginazione, qui definita 'neo-romantica', che si muove tra ...

AcEST: DK953938 [AcEST

Lifescience Database Archive (English)

Full Text Available on tr|A3TZ18|A3TZ18_9RHOB ATP-dependent metalloprotease FtsH OS=Oceanicola batsensis HTCC2597 Align length 7...0E06711p OS=Kluyveromyces lactis GN=K... 33 9.8 >tr|A3TZ18|A3TZ18_9RHOB ATP-dependent metalloprotease FtsH OS=Oceanicola bats

AcEST: BP916878 [AcEST

Lifescience Database Archive (English)

Full Text Available 0SQU3_9CARY Maturase K (Fragment) OS=Schiedea obovata... 35 2.9 tr|A0SQU2|A0SQU2_9CARY Maturase K (Fragment) OS=Schiedea nutt...R 98 >tr|A0SQU2|A0SQU2_9CARY Maturase K (Fragment) OS=Schiedea nuttallii GN=matK

AcEST: BP915933 [AcEST

Lifescience Database Archive (English)

Full Text Available 9.1 tr|A4V047|A4V047_DROME Brother of odd with entrails limited, iso... 33 9.1 >tr|B4L9X7|B4L9X7_DROMO GI141...IITQPESGKPPNQPLHSPHEAMPSFLGSIPMRKRILPAPTLDLMDPHHHP 673 >tr|A4V047|A4V047_DROME Brother of odd with entrails

The evolutionary dynamics of major regulators for sexual development among Hymenoptera species

Directory of Open Access Journals (Sweden)

Matthias eBiewer

2015-04-01

Full Text Available All hymenopteran species, such as bees, wasps and ants, are characterized by the common principle of haplodiploid sex determination in which haploid males arise from unfertilized eggs and females from fertilized eggs. The underlying molecular mechanism has been studied in detail in the western honey bee Apis mellifera, in which the gene complementary sex determiner (csd acts as primary signal of the sex determining pathway, initiating female development by csd-heterozygotes. Csd arose from gene duplication of the feminizer (fem gene, a transformer (tra ortholog, and mediates in conjunction with transformer2 (tra2 sex-specific splicing of fem. Comparative molecular analyses identified fem/tra and its downstream target doublesex (dsx as conserved unit within the sex determining pathway of holometabolous insects. In this study, we aim to examine evolutionary differences among these key regulators. Our main hypothesis is that sex determining key regulators in Hymenoptera species show signs of coevolution within single phylogenetic lineages. We take advantage of several newly sequenced genomes of bee species to test this hypothesis using bioinformatic approaches. We found evidences that duplications of fem are restricted to certain bee lineages and notable amino acid differences of tra2 between Apis and non-Apis species propose structural changes in Tra2 protein affecting co-regulatory function on target genes. These findings may help to gain deeper insights into the ancestral mode of hymenopteran sex determination and support the common view of the remarkable evolutionary flexibility in this regulatory pathway.

Molecular characterization and expression profiles of four transformer-2 isoforms in the Chinese mitten crab Eriocheir sinensis

Science.gov (United States)

Luo, Danli; Liu, Yuan; Hui, Min; Song, Chengwen; Liu, Hourong; Cui, Zhaoxia

2017-07-01

The transformer-2 ( tra-2) gene plays a key role in the regulatory hierarchy of sexual differentiation in somatic tissues and in the germline of Drosophila melanogaster. In this study, sequences and expression profiles of tra-2 in the Chinese mitten crab Eriocheir sinensis were characterized. Four tra-2 isoforms, designated as Estra-2a, Estra-2b, Estra-2c, and Estra-2d, were isolated. They all contained an RNA-recognition motif (RRM) and a linker region, which shared high similarity with other reported tra-2s. Sequence analysis revealed that Estra-2a, Estra-2b and Estra-2c are encoded by the same genomic locus and are generated by alternative splicing of the pre-mRNA. Compared with the other three isoforms, Estra-2d lacks the RS2 domain. Quantitative real-time PCR showed that all four isoforms were highly expressed in the fertilized egg, and in the 2-4 cell and blastula stages compared with larval stages ( P≤0.01), suggesting their maternal origin in early embryonic developmental stages. Notably, Estra-2a was highly expressed in male somatic tissues, while Estra-2c was significantly highly expressed in the ovary. These results suggest that Estra-2c is involved in sexual differentiation of the Chinese mitten crab. Our findings provide basic information for further functional studies of the tra-2 gene/protein in this species.

Segmental stabilization and muscular strengthening in chronic low back pain: a comparative study

Directory of Open Access Journals (Sweden)

Fábio Renovato França

2010-01-01

Full Text Available OBJECTIVE: To contrast the efficacy of two exercise programs, segmental stabilization and strengthening of abdominal and trunk muscles, on pain, functional disability, and activation of the transversus abdominis muscle (TrA, in individuals with chronic low back pain. DESIGN: Our sample consisted of 30 individuals, randomly assigned to one of two treatment groups: segmental stabilization, where exercises focused on the TrA and lumbar multifidus muscles, and superficial strengthening, where exercises focused on the rectus abdominis, abdominus obliquus internus, abdominus obliquus externus, and erector spinae. Groups were examined to discovere whether the exercises created contrasts regarding pain (visual analogical scale and McGill pain questionnaire, functional disability (Oswestry disability questionnaire, and TrA muscle activation capacity (Pressure Biofeedback Unit = PBU. The program lasted 6 weeks, and 30-minute sessions occurred twice a week. Analysis of variance was used for inter- and intra-group comparisons. The significance level was established at 5%. RESULTS: As compared to baseline, both treatments were effective in relieving pain and improving disability (p<0.001. Those in the segmental stabilization group had significant gains for all variables when compared to the ST group (p<0.001, including TrA activation, where relative gains were 48.3% and -5.1%, respectively. CONCLUSION: Both techniques lessened pain and reduced disability. Segmental stabilization is superior to superficial strengthening for all variables. Superficial strengthening does not improve TrA activation capacity.

Gombrowicz tra esilio e straduzione

Directory of Open Access Journals (Sweden)

Vera Horn

2006-12-01

Full Text Available L'esilio argentino dello scrittore polacco Witold Gombrowicz raccontato da Laura Pariani nel romanzo La straduzione; il tentativo di tradursi; il tentativo di tradurre il Ferdyduke in spagnolo e conquistare pubblico; critica e traduzione nel mondo argentino; la straduzione come fallimento.

Um estudo correlacional entre habilidades sociais e traços de personalidade A correlational study of social skills to personality traits

Directory of Open Access Journals (Sweden)

José Maurício Haas Bueno

2001-06-01

Full Text Available Este trabalho teve como objetivo o desenvolvimento de um estudo correlacional entre habilidades sociais e traços de personalidade segundo o modelo dos cinco grandes fatores. Foram sujeitos da pesquisa 189 estudantes universitários, de ambos os sexos (41 homens e 148 mulheres, de 18 a 59 anos (média 26,3 anos, primeiro-anistas dos cursos de Letras, História, Psicologia, Pedagogia e Biologia. Foram aplicados o Inventário de Habilidades Sociais, que informa sobre (a enfrentamento com risco, (b auto-afirmação na expressão de afeto positivo, (c conversação e desenvoltura social, (d auto-exposição a desconhecidos e a situações novas e (e auto-controle da agressividade a situações aversivas; e um Inventário de Personalidade que informa sobre os cinco grandes fatores: extroversão, socialização, escrupulosidade, neuroticismo e abertura para novas experiências. Encontrou-se que a variância de enfrentamento com risco pode ser explicada principalmente por extroversão e abertura para novas experiências; auto-afirmação na expressão de afetos positivos, por socialização e equilíbrio emocional; conversação e desenvoltura social, pelo conjunto equilibrado de todas os cinco grandes fatores, exceto escrupulosidade; auto-exposição a desconhecidos e a situações novas, por extroversão e equilíbrio emocional; e auto-controle da agressividade por socialização.The purpose of this study was to investigate de correlation of social skills to personality traits by the big five factors model. The Ss were 189 undergraduates, 41 men and 148 women, from 18 to 59 ys. old (mean 26,3 ys. old, freshmen of the Literature, History, Psychology, Pedagogy, and Biology courses. The instruments were the Social Skills Inventory, which informs about (a confront with risk, (b self-affirmation on the positive affect expression, (c conversation and social easiness, (d self-exposure to strangers and new situations, and (e self-control of aggressiveness in

Effect of carbamide peroxide-based bleaching agents containing fluoride or calcium on tensile strength of human enamel Efeito de agentes clareadores à base de peróxido de carbamida contendo fluoreto e cálcio na resistência à tração do esmalte humano

Directory of Open Access Journals (Sweden)

Marcelo Giannini

2006-04-01

Full Text Available OBJECTIVE: The aim of this study was to evaluate the effects of carbamide peroxide-based bleaching agents (CPG containing fluoride (CF or calcium (CCa on the ultimate tensile strength of enamel (UTS. METHOD: A "cube-like" resin composite structure was built-up on the occlusal surface of twenty-two sound third molars to facilitate specimen preparation for the micro-tensile test. The restored teeth were serially sectioned in buccal-lingual direction in slices with approximate 0.7 mm thickness. Each slice was trimmed with a fine diamond bur to reduce the buccal, internal slope enamel of the cusps to a dumb-bell shape with a cross-sectional area at the "neck" of less than 0.5 mm². The samples were randomly divided into 12 groups (n=11. The control groups were not submitted to the bleaching regimen. Specimens were treated with 10% CPG gel or with 10% CPG formulations containing CF (0.2% and 0.5% or CCa (0.05% and 0.2%. Bleached groups received the application of the 10% CPGs for 6 hours/day at 37º C, during 14 consecutive days and were stored in artificial saliva (AS or 100% relative humidity (RH among each application. After bleaching, specimens were tested with the microtensile method at 0.5 mm/min. Data were analyzed by two-way ANOVA and Tukey test (5%. RESULTS: No significant difference was observed between groups stored in AS or RH. Specimens treated with CF or CCa presented similar UTS as unbleached control groups. CONCLUSION: Either 10% CPG formulations containing CF or CCa can preserve the UTS after bleaching regimen.OBJETIVO: O propósito deste estudo foi avaliar os efeitos de agents clareadores à base de peróxido de carbamida (CPG contendo fluoreto (CF e cálcio (CCa na resistência à tração do esmalte (UTS. MÉTODO: Um bloco de resina composta foi confeccionada na superfície oclusal de vinte e dois terceiros molars hígidos para facilitar a preparação dos espécimes para o teste de micro-tração. Os dentes restaurados foram

AcEST: BP915959 [AcEST

Lifescience Database Archive (English)

Full Text Available RNA synthetase OS=Desulfovibrio v... 60 4e-08 tr|A6GTU1|A6GTU1_9BURK Leucyl-tRNA synthetase OS=Limnobacter s...27 >tr|A6GTU1|A6GTU1_9BURK Leucyl-tRNA synthetase OS=Limnobacter sp. MED105 GN=LMED105_15234 PE=3 SV=1 Lengt

The theory of reasoned action as a model of marijuana use: tests of implicit assumptions and applicability to high-risk young women.

Science.gov (United States)

Morrison, Diane M; Golder, Seana; Keller, Thomas E; Gillmore, Mary Rogers

2002-09-01

The theory of reasoned action (TRA) is used to model decisions about substance use among young mothers who became premaritally pregnant at age 17 or younger. The results of structural equation modeling to test the TRA indicated that most relationships specified by the model were significant and in the predicted direction. Attitude was a stronger predictor of intention than norm, but both were significantly related to intention, and intention was related to actual marijuana use 6 months later. Outcome beliefs were bidimensional, and positive outcome beliefs, but not negative beliefs, were significantly related to attitude. Prior marijuana use was only partially mediated by the TRA variables; it also was directly related to intentions to use marijuana and to subsequent use.

L'arte della vita: biotecnologie e bioetica

Directory of Open Access Journals (Sweden)

Rosangela Maria Barcaro

2014-11-01

Full Text Available La bioarte è un’esperienza artistica che pone in relazione arte, scienza e  biotecnologie esaminando da un nuovo punto di vista i concetti di vita, evoluzione, natura. L’idea rivoluzionaria alla base di tale esperienza è l’uso della materia organica vivente come mezzo espressivo, o medium, trattata con tecniche rese possibili dalle scoperte scientifico-tecnologiche più recenti.La bioarte si propone di avvicinare l’opinione pubblica alle problematiche generate da attività che plasmano il rapporto dell’uomo con le biotecnologie e di esplorare i timori che tali attività suscitano nella società.L’articolo descrive alcune opere realizzate da bioartisti internazionali, con l’intento di fornire un’analisi bioetica e non estetica di un fenomeno culturale che mostra numerose contraddizioni. 

Le Domaine des Co-infections et des Maladies Concomitantes du Réseau Canadien pour les Essais VIH des IRSC : Lignes Directrices Canadiennes pour la Prise en Charge et le Traitement de la Co-Infection par le VIH et l’Hépatite C chez les Adultes

Directory of Open Access Journals (Sweden)

Mark Hull

2014-01-01

Full Text Available HISTORIQUE: De 20 % à 30 % des Canadiens qui vivent avec le VIH sont co-infectés par le virus de l’hépatite C (VHC, lequel est responsable d’une morbidité et d’une mortalité importantes. La prise en charge du VIH et du VHC est plus complexe en raison de l’évolution accélérée de la maladie hépatique, du choix et des critères d’initiation de la thérapie antirétrovirale et du traitement anti-VHC, de la prise en charge de la santé mentale et des toxicomanies, des obstacles socioéconomiques et des interactions entre les nouvelles thérapies antivirales à action directe du VHC et les antirétroviraux

Il dito di Galileo le dieci grandi idee della scienza

CERN Document Server

Atkins, Peter

2004-01-01

Domande e risposte per dieci idee che hanno plasmato il mondo di oggi. Possiamo rintracciare l'origine e il divenire del cosmo? Perché spazio e tempo formano una cosa sola? Che cosa significa l'evoluzione del vivente? Perché il DNA è così importante? Perché il mondo ha bisogno di energia? E com'è che l'aumento dell'entropia scandisce il cambiamento dell'intero universo? Cosa sono gli atomi e cosa c'è di più piccolo di essi? Perché la simmetria della natura e dell'arte cattura il nostro senso della bellezza? Cosa sono quegli elusivi quanti alla base della fisica contemporanea? Siamo sicuri che l'aritmetica non ci inganni? Peter Atkins offre una guida chiara e completa all'impresa scientifica, seguendo la via indicata dal dito di Galileo.

Nursing staff members' intentions to use physical restraints with older people: testing the theory of reasoned action.

Science.gov (United States)

Werner, P; Mendelsson, G

2001-09-01

To examine nursing staff members' attitudes, subjective norms, moral obligations and intentions to use physical restraints, using the Theory of Reasoned Action (TRA). During the last two decades an extensive body of research has examined nurses' attitudes as one of the main factors affecting the decision to use or not to use physical restraints with older persons. However, no studies have examined empirically the antecedents to nurses' intentions to use physical restraints within a theoretically based framework. A correlational design was used with 303 nursing staff members from an 800-bed elder care hospital in central Israel. Participants completed a questionnaire including questions based on the TRA as well as socio-demographic and professional characteristics. Regression analyses found attitudes, subjective norms and moral considerations to be significantly associated to intention to use physical restraints with older people. The TRA explained 48% of the variance in nurses' intentions. The TRA proved to be a useful framework for examining nurses' intentions to use physical restraints. Nurses' attitudes, beliefs and expectations of significant others should be examined before implementing educational programmes regarding the use of physical restraints.

Suitability of semi-automated tumor response assessment of liver metastases using a dedicated software package

International Nuclear Information System (INIS)

Kalkmann, Janine; Ladd, S.C.; Greiff, A. de; Forsting, M.; Stattaus, J.

2010-01-01

Purpose: to evaluate the suitability of semi-automated compared to manual tumor response assessment (TRA) of liver metastases. Materials and methods: in total, 32 patients with colorectal cancer and liver metastases were followed by an average of 2.8 contrast-enhanced CT scans. Two observers (O1, O2) measured the longest diameter (LD) of 269 liver metastases manually and semi-automatically using software installed as thin-client on a PACS workstation (LMS-Liver, MEDIAN Technologies). LD and TRA (''progressive'', ''stable'', ''partial remission'') were performed according to RECIST (Response Evaluation Criteria in Solid Tumors) and analyzed for between-method, interobserver and intraobserver variability. The time needed for evaluation was compared for both methods. Results: all measurements correlated excellently (r ≥ 0.96). Intraobserver (semi-automated), interobserver (manual) and between-method differences (by O1) in LD of 1.4 ± 2.6 mm, 1.9 ± 1.9 mm and 2.1 ± 2.0 mm, respectively, were not significant. Interobserver (semi-automated) and between-method (by O2) differences in LD of 3.0 ± 3.0 mm and 2.6 ± 2.0 mm, respectively, reflected a significant variability (p < 0.01). The interobserver agreement in manual and semi-automated TRA was 91.4%. The intraobserver agreement in semi-automated TRA was 84.5%. Between both methods a TRA agreement of 86.2% was obtained. Semi-automated evaluation (2.7 min) took slightly more time than manual evaluation (2.3 min). Conclusion: semi-automated and manual evaluation of liver metastases yield comparable results in response assessments and require comparable effort. (orig.)

Abdominal muscle activity during a standing long jump.

Science.gov (United States)

Okubo, Yu; Kaneoka, Koji; Shiina, Itsuo; Tatsumura, Masaki; Miyakawa, Shumpei

2013-08-01

Experimental laboratory study. To measure the activation patterns (onset and magnitude) of the abdominal muscles during a standing long jump using wire and surface electromyography. Activation patterns of the abdominal muscles, especially the deep muscles such as the transversus abdominis (TrA), have yet to be examined during full-body movements such as jumping. Thirteen healthy men participated. Wire electrodes were inserted into the TrA with the guidance of ultrasonography, and surface electrodes were attached to the skin overlying the rectus abdominis (RA) and external oblique (EO). Electromyographic signals and video images were recorded while each subject performed a standing long jump. The jump task was divided into 3 phases: preparation, push-off, and float. For each muscle, activation onset relative to the onset of the RA and normalized muscle activation levels (percent maximum voluntary contraction) were analyzed during each phase. Comparisons between muscles and phases were assessed using 2-way analyses of variance. The onset times of the TrA and EO relative to the onset of the RA were -0.13 ? 0.17 seconds and -0.02 ? 0.07 seconds, respectively. Onset of TrA activation was earlier than that of the EO. The activation levels of all 3 muscles were significantly greater during the push-off phase than during the preparation and float phases. Consistent with previously published trunk-perturbation studies in healthy persons, the TrA was activated prior to the RA and EO. Additionally, the highest muscle activation levels were observed during the push-off phase.

Geografia elettorale dell’Emilia Romagna: una cartografia interattiva delle elezioni politiche dal 1976 al 1992

Directory of Open Access Journals (Sweden)

Marianna Pino

2013-05-01

Full Text Available La rappresentazione cartografica del comportamento elettorale dell’Emilia Romagna può essere un utile strumento di analisi delle traiettorie dei partiti nel cruciale passaggio tra la prima e la seconda Repubblica. La mappatura interattiva, infatti, permette di leggere e comparare su scala comunale i risultati dei maggiori partiti che hanno partecipato alle cinque elezioni politiche tenutesi tra il 1976 e il 1992.

AcEST: BP919782 [AcEST

Lifescience Database Archive (English)

Full Text Available Result : TrEMBL tr_hit_id A3U3S0 Definition tr|A3U3S0|A3U3S0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola bats...5 >tr|A3U3S0|A3U3S0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola batsensis HTCC2597 GN=OB2597

Fechamento sequencial da parede abdominal com tração fascial contínua (mediada por tela ou sutura e terapia a vácuo

Directory of Open Access Journals (Sweden)

Fernando Ferreira

Full Text Available Na última década multiplicaram-se as publicações e a utilização da cirurgia de controle de danos, resultando num número crescente de pacientes deixados com o abdome aberto (ou peritoneostomia. Uma das consequências nefastas do abdome aberto são as hérnias ventrais gigantes que resultam da impossibilidade de se fechar o abdome durante a internação hospitalar do paciente. Para minimizar esta sequela têm surgido na literatura diferentes tipos de abordagem. Para abordar este tópico, a reunião de revista "Telemedicina Baseada em Evidência - Cirurgia do Trauma e Emergência" (TBE-CiTE optou por não analisar sistemas comerciais de fechamento abdominal dinâmico, com exceção da terapia de pressão negativa ou vácuo. O grupo fez uma avaliação crítica dirigida de três artigos mais relevantes publicados recentemente sobre fechamento sequencial da parede abdominal (com tela ou sutura mais vácuo. Nesta avaliação foram incluídos dois estudos retrospectivos mais um estudo prospectivo. Baseados na análise crítica desses 3 estudos mais a discussão que contou com a participação de representantes de 6 Universidades e realizada via telemedicina, são feitas as seguintes recomendações: (1 a associação de terapia de pressão negativa com tração fascial constante mediada por tela ou sutura, ajustada periodicamente, parece ser uma ótima estratégia cirúrgica para o tratamento de peritoneostomias. (2 O fechamento abdominal primário dinâmico com sutura e mediada por tela parece ser mais econômico e eficiente do que deixar o paciente com uma hérnia gigante e planejar uma reconstrução complexa tardiamente. Novos estudos com grupos maiores de pacientes separados de acordo com as diferentes apresentações e doenças são necesários para definir qual o melhor método cirúrgico para o tratamento de peritoneostomias.

Cristallini e misurazioni biometriche nella Lepre bianca (Lepus timidus in Provincia di Sondrio

Directory of Open Access Journals (Sweden)

Maria Ferloni

2003-10-01

Full Text Available A partire dalla stagione venatoria 2000 è stato introdotto in Provincia di Sondrio il controllo di tutti i capi di Lepre bianca abbattuti, allo scopo di effettuare valutazioni accurate del sesso, dell'età e delle misurazioni biometriche degli animali. La valutazione dell'età è stata effettuata tramite pesatura del cristallino dell'occhio e tramite palpazione del tubercolo di Stroh. Per una valutazione dell'età è stata utilizzata come riferimento la curva dei pesi di Walhovd (1965. In totale, dal 2000 al 2002, sono stati analizzati 187 esemplari di Lepre bianca (84 maschi e 103 femmine. Dei 154 capi di cui è stata valutata l'età, 54 sono risultati piccoli dell'anno e 100 adulti, di cui 57 di 1 anno e 43 di oltre due anni. Il peso di cristallino rivelatosi discriminante per distinguere tra piccoli e adulti era compreso tra 220 e 240 mg, come rilevato anche da altri autori (Flux, 1970, Walhovd, 1965. È stata inoltre individuata una buona corrispondenza tra la valutazione dell'età tramite peso del cristallino e la palpazione del tubercolo di Stroh, tecnica che ha fornito una valutazione corretta della classe d'età nell'83% degli animali analizzati. Il peso del cristallino dei piccoli ha permesso anche di determinare approssimativamente la distribuzione delle nascite nel corso dell'anno. Le misurazioni biometriche rilevate sono state: lunghezza del corpo, lunghezza della coda, lunghezza dell'orecchio destro, lunghezza del piede posteriore, peso pieno e peso vuoto. I risultati ottenuti sono stati confrontati per le diverse classi di età e di sesso tramite Analisi della Varianza (One-Way ANOVA. Le differenze principali sono emerse tra giovani e adulti, relativamente al peso (sia peso pieno sia peso vuoto e, nel 2001, anche alla lunghezza totale, entrambi maggiori negli adulti. Tra gli adulti sono emerse differenze significative anche nel peso dei due sessi, con le femmine più pesanti dei maschi. Non sono invece state rilevate differenze

Free energy of mixing of acetone and methanol: a computer simulation investigation.

Science.gov (United States)

Idrissi, Abdenacer; Polok, Kamil; Barj, Mohammed; Marekha, Bogdan; Kiselev, Mikhail; Jedlovszky, Pál

2013-12-19

The change of the Helmholtz free energy, internal energy, and entropy accompanying the mixing of acetone and methanol is calculated in the entire composition range by the method of thermodynamic integration using three different potential model combinations of the two compounds. In the first system, both molecules are described by the OPLS, and in the second system, both molecules are described by the original TraPPE force field, whereas in the third system a modified version of the TraPPE potential is used for acetone in combination with the original TraPPE model of methanol. The results reveal that, in contrast with the acetone-water system, all of these three model combinations are able to reproduce the full miscibility of acetone and methanol, although the thermodynamic driving force of this mixing is very small. It is also seen, in accordance with the finding of former structural analyses, that the mixing of the two components is driven by the entropy term corresponding to the ideal mixing, which is large enough to overcompensate the effect of the energy increase and entropy loss due to the interaction of the unlike components in the mixtures. Among the three model combinations, the use of the original TraPPE model of methanol and modified TraPPE model of acetone turns out to be clearly the best in this respect, as it is able to reproduce the experimental free energy, internal energy, and entropy of mixing values within 0.15 kJ/mol, 0.2 kJ/mol, and 1 J/(mol K), respectively, in the entire composition range. The success of this model combination originates from the fact that the use of the modified TraPPE model of acetone instead of the original one in these mixtures improves the reproduction of the entropy of mixing, while it retains the ability of the original model of excellently reproducing the internal energy of mixing.

LA LIBERTÀ E LE IMMAGINI: UNA DRAMMATURGIA A STAZIONI PER IL CONTROLLO DELL’AMORE. LETTURA DI PURGATORIO XVIII-XIX

Directory of Open Access Journals (Sweden)

Ottavio Brigandì

2014-09-01

Full Text Available Il presente lavoro si propone come lettura dei canti XVIII e XIX del Purgatorio, dove il centrale discorso di Virgilio sull’amore come fondamento dell’agire umano trova esemplificazione nella doppia forma dell’incontro con le anime accidiose e del sogno (la celebre «femminabalba». Che sia in dialogo col maestro o nella descrizione dei purganti o per esperienza onirica, la scoperta della forza del desiderio è seguita, rassicurazione e monito insieme, dalla certezza che il libero arbitrio può trattenerci dalle azioni ree, riconducendo il potere appetitivoa quello conoscitivo e dunque trasformando il “moto” d’amore nella feconda stasi della riflessione. Fra gli espedienti che sortiscono l’effetto di porre il lettore sullo stesso piano del Viator, si segnalano l’impianto teatrale del discorso, fitto di stazioni narrative e tematiche, e lo stile ricco di figurazioni, allusivo a un impiego della facoltà immaginativa per un fine poetico che intende mostrarsi utile all’educazione umana e davvero “libero” dal giogo amoroso.

Lo strano caso della mummia di Ankhpakhered: datazione al radiocarbonio di campioni organici

Directory of Open Access Journals (Sweden)

Carla Corvaglia

2013-03-01

Full Text Available ItLa mummia scoperta nel sarcofago ligneo di Ankhpakered, sacerdote del dio Min, è stata studiata presso il CEDAD (Centro di Datazione e Diagnostica dell'Università del Salento, Italia. La TC, eseguita sulla mummia dal team multidisciplinare del Mummy Project di Milano, ha evidenziato caratteristiche insolite, facendo ipotizzare un riutilizzo del sarcofago. Diversi campioni sono stati prelevati per via endoscopica per essere sottoposti ad analisi AMS (Accelerator Mass Spectrometry per la datazione al radiocarbonio, effettuate presso il CEDAD, e ad analisi FTIR (Fourier Transform Infrared.EnThe mummy discovered in the wooden coffin of Ankhpakered, priest of Min god, has been studied at CEDAD (Centre for Dating and Diagnostics at the University of Salento, Italy. The CT analyses, performed by the multidisciplinary team of the Mummy Project of Milan, highlighted unusual features of the mummy, suggesting a re-use of the sarcophagus. Furthermore, specimens were taken via endoscopy for AMS (Accelerator Mass Spectrometry radiocarbon dating and FTIR (Fourier Transform Infrared analyses which have been carried out at CEDAD.

La riscoperta della stereoscopia per la rappresentazione dello spazio architettonico

Directory of Open Access Journals (Sweden)

Simone Garagnani

2011-06-01

Full Text Available Il progressivo sviluppo dei metodi della rappresentazione grafica nel corso della storia è stato possibile in virtù della scoperta di strumenti e tecniche appartenenti al loro tempo: questo continuo progresso delle modalità di “raccontare” l’architettura è tuttora in corso di evoluzione, costituendo il fondamento di ogni strategia informativa e di comunicazione del progetto. Il sempre più pervasivo trattamento digitale dell’informazione, sia essa grafica che testuale, ha condotto ad una progressiva riscoperta di approcci tradizionali nella descrizione dello spazio costruito, declinandoli alle nuove tecnologie informatiche per amplificarne possibilità e valenze. È il caso della stereoscopia, diffuso metodo ottocentesco adottato in fotografia per rendere spaziale la percezione dell’immagine sfruttando la visione binoculare; oggi i modelli tridimensionali e le immagini digitali catturate da apposite fotocamere rendono l’approccio stereoscopico di immediato utilizzo anche per i profani della rappresentazione, semplificando e rendendo trasparenti i concetti di geometria proiettiva alla base del metodo. Questo contributo intende indagare le funzionalità, i vantaggi e le criticità della tecnologia stereoscopica immersiva nella moderna comunicazione del progetto d’architettura.

Teorie del tutto la ricerca della spiegazione ultima

CERN Document Server

Barrow, John D

1992-01-01

«Come, quando e perché l’universo ha avuto origine? Questi interrogativi di carattere fondamentale sono stati fuori moda per secoli: gli scienziati ne diffidavano, teologi e filosofi se ne erano stancati. Poi, d’improvviso, gli scienziati hanno cominciato a porseli con la massima serietà, e i teologi si sono trovati, scavalcati, a dover tenere dietro alle teorizzazioni matematiche della nuova generazione di scienziati... Oggi i fisici credono di essersi imbattuti in una chiave capace di guidarci al segreto matematico che sta al cuore dell’universo: una scoperta che punta verso una “teoria del tutto”, una sorta di quadro onnicomprensivo di tutte le leggi di natura dal quale deve derivare, in modo logicamente ineccepibile, l’inevitabilità di tutto ciò che ci circonda. Una volta in possesso di questa stele di Rosetta cosmica, potremmo leggere il libro della natura in tutta la sua estensione temporale, e intendere ogni cosa che sia stata, che è e che sarà. Di questa possibilità si è sempre fa...

Elettrodinamica classica

Science.gov (United States)

Lechner, Kurt

Nella scoperta della Relatività Ristretta l'Elettrodinamica, rappresentando una teoria relativistica per eccellenza, ha giocato un ruolo fondamentale. Il principio di relativit` a einsteiniana, che afferma che tutte le leggi della fisica devono avere la stessa forma in tutti i sistemi di riferimento inerziali, è emerso con forza da questa teoria ed è andato consolidandosi sempre di più, man mano che le nostre conoscenze del mondo microscopico sono diventate più complete: tutte le interazioni fondamentali rispettano infatti tale principio. Il modo più semplice ed elegante per implementarlo — difatti l'unico di un'utilità concreta — è rappresentato dal paradigma della covarianza a vista nell'ambito del calcolo tensoriale. Questo paradigma è stato applicato con successo a tutte le teorie di carattere fondamentale, come le teorie che descrivono le quattro interazioni fondamentali e le più speculative teorie di superstringa, e mantiene la sua piena efficacia anche in teoria quantistica. La nostra esposizione dell'Elettrodinamica classica si baserà dunque a ragione su questo paradigma.

I pionieri italiaNi della geofisiCa

Directory of Open Access Journals (Sweden)

P. CALOI

1964-06-01

Full Text Available Vengono rapidamente passati in rassenga, seguendo
l'ordine cronologico, gli studiosi di geofisica — intesa in senso lato — clie,
a partire dalla seconda meta del Settecento, ebbero ad interessarsi in Italia
di elettricita atmosferica, magnetismo terrestre, idrografla, oceanografia fisica,
sismologia e vulcanologia, con intenti pionieristici. Sono ricordati i principali
risultati raggiunti da una trentina di ricercatori fra i quali spiccano, per la
vastita del lavoro compiuto e per la novita dei risultati, Leopoldo Nobili e Macedonio
Melloni. Ma, ciascuno nei suo campo, scoperte di rilievo fecero pure
G. B. Beccaria, Luigi Palmieri, Carlo Matteucci, Timoteo Bertelli, Luigi De
Marcbi, Carlo Somigliana, Emilio Oddone, Alfonso Sella e Domenico Pacini.
Alcuni vantano priorita di rilievo: scoperta della doppia oscillazione diurna
del barometro (Chiminello, 1780; unicita sorgiva delle varie radiazioni dello
spettro (M. Melloni; sismografo elettromagnetico a registrazione continua
(Palmieri, 1855; microsismi (Bertelli, 1872; il paleomagnetismo (Oddone e
Sella, 1891; la radiazione cosmica (Pacini, 1910; . ..

Ultrahigh-resolution ultrasound characterization of access site trauma and intimal hyperplasia following use of a 7F sheathless guide versus 6F sheath/guide combination for transradial artery PCI: Results of the PRAGMATIC trial.

Science.gov (United States)

Batchelor, Wayne; Dahya, Vishal; McGee, Dan; Katopodis, John; Dixon, William; Campbell, James; Meredith, Ashley; Knap, Patty; Parkin, Mathew; Noel, Thomas

2018-04-01

There exist limited data on the relative degree of acute injury and late healing of the radial artery after transradial artery (TRA) percutaneous coronary intervention (PCI) with a 7F sheathless guide catheter compared with a 6F sheath/guide combination. We used ultrahigh-resolution (55 MHz) vascular ultrasound to compare intimal-medial thickening (IMT) and early and late radial artery (RA) injury resulting from a sheathless 7F guide catheter versus a 6F sheath/guide combination for TRA-PCI. Forty-one consecutive consenting patients undergoing elective nonemergent TRA-PCI at a single institution from June 2016 to December 2016 were included. Patients were randomized (stratified by sex) to undergo TRA-PCI using a 7F sheathless guide catheter versus a 6F sheath/6F guide combination. Ultrahigh-resolution vascular ultrasound (55MHz) of the RA access site was performed at 24hours and 90days post-TRA-PCI. The primary outcome of the study was a noninferiority comparison of radial artery IMT thickness at 90days. PCI success rates, fluoroscopy times, number of guides used, and crossover rates to a femoral approach were also compared. Baseline characteristics were similar between groups. Radial arterial IMT (mm) was similar between the 7F sheathless and 6F sheath/guide groups at 24hours (0.27 vs 0.29, respectively; P=.43) and at 90days (0.35 vs 0.34, respectively; P=.96). The P value for the noninferiority testing of a 0.07-mm limit was .002. Limited access site intimal tears were relatively common in both groups at 24hours (4 vs 5, P=.53) but often healed by 90days. Radial artery occlusion was infrequent at 90days (2 vs 1, P=.10), and no frank dissections were noted. PCI success rates (100% vs 95%, P=.59), fluoroscopy times (16 vs 12minutes, P=.17), number of guides used (1.1 vs 1.2, P=.48), and femoral crossover rates (0% vs 0%) were similar between the 2 respective groups. A 7F sheathless approach to TRA-PCI results in no more IMT and early or late RA trauma than a

Measurement of the speed of sound in trabecular bone by using a time reversal acoustics focusing system

Energy Technology Data Exchange (ETDEWEB)

Lee, Kang Il [Kangwon National University, Chuncheon (Korea, Republic of); Choi, Bok-Kyoung [Maritime Security Research Center, KIOST, Ansan (Korea, Republic of)

2014-10-15

A new method for measuring the speed of sound (SOS) in trabecular bone by using a time reversal acoustics (TRA) focusing system was proposed and validated with measurements obtained by using the conventional pulse-transmission technique. The SOS measured in 14 bovine femoral trabecular bone samples by using the two methods was highly correlated each other, although the SOS measured by using the TRA focusing system was slightly lower by an average of 2.2 m/s. The SOS measured by using the two methods showed high correlation coefficients of r = 0.92 with the apparent bone density, consistent with the behavior in human trabecular bone in vitro. These results prove the efficacy of the new method based on the principle of TRA to measure the SOS in trabecular bone.