WorldWideScience

Sample records for vid miljoehistoriskt moete

  1. Mildeu de la Vid

    Directory of Open Access Journals (Sweden)

    Daníes L. Carlos Alberto

    1941-02-01

    Full Text Available Esta es una de las enfermedades de la vid que más importancia tienen desde hace cincuenta años. En tanto que la filoxera, el Oidium y la Pudrición Negra, han dejado de inspirar serias inquietudes entre los agricultores, el Mildeu, continúa siendo el principal peligro en las regiones vitícolas. El ataque de 1915, en Francia, redujo la cosecha de 40 a 50 millones de hectolitros, que es la producción promedia, a 17 millones. Los híbridos de resistencia parcial, han sufrido pérdidas notables, lo cual les ha hecho perder el prestigio que tenían como fuertes productores. Los órganos de reproducción del parásito que causa el Mildeu de la vid, emiten unos filamentos que penetran por los estomas de los órganos; se desarrollan en el interior de los órganos verdes, donde alteran sus tejidos; envían, luego, al exterior, fructificaciones que aparecen bajo la forma de una borra blanca; estas fructificaciones, llevan semillas que se dispersan como granos y germinan en el agua para continuar la evolución. La acción del parásito sobre los tejidos, da a los órganos de la vid caracteres que permiten conocer fácilmente la enfermedad, al examen microscópico. El Mildeu sólo ataca los órganos jóvenes, aún verdes; los sarmientos lignificados y los órganos de más edad, lo mismo que las partes subterráneas, no son atacados. Los distintos estados del desarrollo del parásito han recibido diversos nombres en viticultura: la penetración de los filamentos al órgano, lleva el nombre de: "diseminación"; viene, luego, la llamada "incubación", en la cual el desarrollo de los filamentos, en el interior de los tejidos, no provoca manifestaciones exteriores visibles. La primera manifestación exterior de la enfermedad, es llamada: "aparición" o, más frecuentemente: "invasión". Este último término es más usado, aunque, etimológicamente, es impropio. Los viticultores, no pueden señalar la invasión del Mildeu, sino cuando éste hace su

  2. Baltika Moetänav = Baltika Fashion Street

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Veerenni 24 asuvast Baltika Moetänava sisearhitektuursest lahendusest. Autorid: Maire Milder, Ott Kangur, Ülo-Tarmo Stöör, Maris Kerge, Kaur-Lembit Stöör, Pärtel Eelma, Pekka Porkanen, Lauri Eltermaa

  3. Wat iedere journalist moet weten van marktonderzoek : Doorvragen bij wie

    NARCIS (Netherlands)

    de Leeuw, Edith

    Een gouden regel in de journalis-tiek vormen de vijf W’s (en een H). Een goede onderzoeksjournalist zal altijd vragen: wie, waarom, wat, waar, wanneer en hoe. Het zijn prima basisvragen, maar wanneer een journalist een item voorbereidt en daarbij gebruik maakt van marktonderzoek, moet er nog even

  4. Wat moet je doen om goed te slapen in 26 tips. Wat je niet moet doen om goed te slapen in 26 tips

    NARCIS (Netherlands)

    Hofman, W.

    2014-01-01

    De boekjes 'Wat je moet doen om goed te slapen' en 'Wat je niet moet doen om goed te slapen' zijn twee aparte boekjes die je op een eenvoudige en praktische manier op weg helpen om natuurlijk (nog) beter te slapen. De boekjes zijn geschreven door dr. Winni Hofman en voor iedereen begrijpelijk. Elk

  5. Women, "Star Trek," and the early development of fannish vidding

    Directory of Open Access Journals (Sweden)

    Francesca Coppa

    2008-09-01

    Full Text Available This paper argues that the practices and aesthetics of vidding were structured by the relationship of Star Trek's female fans to that particular televisual text. Star Trek fandom was the crucible within which vidding developed because Star Trek's narrative impelled female fans to take on two positions often framed as contradictory in mainstream culture: the desiring body, and the controlling voice of technology. To make a vid, to edit footage to subtext-revealing music, is to unite these positions: to put technology at the service of desire. Although the conflict between desire and control was particularly thematized in Star Trek, most famously through the divided character of Spock, the practices of vidding are now applied to other visual texts. This essay examines the early history of vidding and demonstrates, through the close reading of particular vids made for Star Trek and Quantum Leap, how vidding heals the wounds created by the displacement and fragmentation of women on television.

  6. Multiple ovulation and embryo transfer (MOET in camels: An overview

    Directory of Open Access Journals (Sweden)

    Binoy S. Vettical

    2016-04-01

    Full Text Available Unlike in other domestic animal species like cattle, reproductive biotechnologies like Artificial Insemination (AI and Embryo Transfer (ET are not well developed and thus are not being used as routine breeding procedures in camels. One of the important objectives of this manuscript is to focus on analyzing the present status of Multiple Ovulation and Embryo Transfer (MOET in camels and its future perspectives. Camels are induced ovulators, thus require hormonal treatment to induce ovulation and control the follicular cycles, which is the main reason why protocols used in other domestic animal species cannot be directly used in this species. The review suggests that the best method for super stimulation of ovaries in camels is use of a combination of Equine Chorionic Gonadotropin (eCG and Follicle Stimulating Hormone (FSH at any stage after elimination of dominant follicle if any or at the early stage of the follicular wave and ovulation of the developed multiple follicles can be achieved by mating donors. The review highlights that a better pregnancy rate is achieved with recipients who ovulate 24 h after the donor.

  7. Techniek moet rijtaak ondersteunen : interview met Fred Wegman, directeur SWOV, over verkeersveiligheid.

    NARCIS (Netherlands)

    Ohm, R.

    2010-01-01

    Het gaat nog steeds goed, maar het kan altijd beter. Helaas is de problematiek ingewikkelder geworden en zijn er geen snelle oplossingen met veel effect meer voorhanden. Daarom moet het karakter van de aanpak van verkeersonveiligheid veranderen. (Author/publisher)

  8. Soigner des jeux vidéo / soigner par les jeux vidéo

    OpenAIRE

    Gaon, Thomas; Stora, Michel

    2012-01-01

    La problématique de l’addiction aux jeux vidéo pose la question de leurs effets performatifs. La notion d’addiction, ici fortement critiquée, se révèle être avant tout un enjeu doctrinal pour la psychologie clinique. Cette généalogie détaillée du concept remet en cause la notion même d’addiction et privilégie un usage excessif d’un genre particulier de jeux, les jeux de rôle massivement multi-joueurs. Ces deux regards croisés sur les jeux vidéo révèlent ainsi la dimension transitionnelle de c...

  9. Rescate de embriones para la obtencion de vitroplantas de vid

    National Research Council Canada - National Science Library

    Hernandez Rendon, Cesar Augusto; Salazar Marin, Yesica; Restrepo Betancur, Luis Fernando

    2013-01-01

    Este trabajo es la primera fase de un macroproyecto sobre la optimizacion de un protocolo para la obtencion de metabolitos secundarios de interes comercial mediante la utilizacion de suspensiones celulares de Vid (Vitis vinifera L...

  10. Streaming Scholarship: Using Fan Vids to Teach "Harry Potter"

    Science.gov (United States)

    Winters, Sarah Fiona

    2013-01-01

    This article argues that Harry Potter fan vids can be used in the classroom as works of secondary criticism about J. K. Rowling's primary text. It makes two claims: the first is that vids can be read as criticism of a particular text (in this case Harry Potter) alongside other critical essays on that text; the second is that the practice of…

  11. Transpiración nocturna en vid

    OpenAIRE

    Montoro, A.; López Urrea, R.; F Mañas; Martínez, L; Sánchez, J. M.

    2016-01-01

    Se presentan las medidas de transpiración media cada quince minutos, de la vid (Vitis vinifera cv. Tempranillo), en tres periodos fenológicos del cultivo: cerrado de racimo, envero y maduración. El estudio se realizó en dos plantas de 16 años de edad, a un marco de plantación de 3 m x 1,5 m, regadas mediante goteo y plantadas en un lisímetro de pesada continua monolítico de 9 m2 de superficie. Con la finalidad de poder medir la transpiración, la superficie del lisímetro fue cub...

  12. Hälsorisker vid saneringsarbete i bostadshus

    OpenAIRE

    Ehrstedt, Kim

    2015-01-01

    Det här arbetet innehåller främst information om hälsorisker vid saneringsarbete samt hur det går att förhindra hälsoriskerna i samband med arbetet. Sjukdomar och symptom relaterade till saneringsarbete är fortfarande vanligt i Finland. Hus byggda från 1920 – talet till det sena 80 – talet har ofta material eller ämnen som kan klassas som en hälsorisk. Mögel, en följd av fuktskada, stöter man ofta på i såväl nya som gamla byggnader, det är därför på sin plats att säga att det ofta finns för h...

  13. Règle d'installation vidéosurveillance

    CERN Document Server

    2011-01-01

    Ce référentiel définit les exigences techniques minimales applicables aux systèmes de vidéosurveillance, avec des caméras implantées à l’intérieur ou l’extérieur. Il donne des recommandations pour concevoir, installer et maintenir des systèmes de vidéosurveillance dans des applications de sécurité. Pour une vidéosurveillance efficace, on pourra appliquer la méthodologie proposée : comment réaliser l’analyse de risque ? Quel rôle attribuer au système de vidéosurveillance ? quel système mettre en place, avec quelles fonctions et quelles caractéristiques techniques ? comment réaliser l’installation ? comment assurer la maintenance du système ? Cette nouvelle édition a notamment pour objectifs de : compléter les rôles de la vidéosurveillance (gestion d'activité) ; clarifier la définition des objectifs de prise de vue ; inclure l'utilisation d'une cible normalisée pour la réception de l'installation ; mettre à disposition un outil d'aide pour les petits systèmes ;...

  14. Simulation study on the efficiencies of MOET nucleus breeding schemes applying marker assisted selection in dairy cattle.

    Science.gov (United States)

    Luo, WeiZhen; Wang, YaChun; Zhang, Yuan

    2009-03-01

    Advantages of breeding schemes using genetic marker information and/or multiple ovulation and embryo transfer (MOET) technology over the traditional approach were extensively evaluated through simulation. Milk yield was the trait of interest and QTL was the genetic marker utilized. Eight dairy cattle breeding scenarios were considered, i.e., traditional progeny testing breeding scheme (denoted as STANPT), GASPT scheme including a pre-selection of young bulls entering progeny testing based on their own QTL information, MOETPT scheme using MOET technology to generate young bulls and a selection of young bulls limited within the full-sib family, GAMOPT scheme adopting both QTL pre-selection and MOET technology, COMBPT scheme using a mixed linear model which considered QTL genotype instead of the BLUP model in GAMOPT, and three non-progeny testing schemes, i.e. the MOET, GAMO and COMB schemes, corresponding to MOETPT, GAMOPT and COMBPT with progeny testing being part of the system. Animals were selected based on their breeding value which was estimated under an animal model framework. Sequential selection over 17 years was performed in the simulations and 30 replicates were designed for each scenario. The influences of using QTL information and MOET technology on favorable QTL allele frequency, true breeding values, polygenetic breeding values and the accumulated genetic superiority were extensively evaluated, for five different populations including active sires, lactating cows, bull dams, bull sires, and young bulls. The results showed that the combined schemes significantly outperformed other approaches wherein accumulated true breeding value progressed. The difference between schemes exclusively using QTL information or MOET technology was not significant. The STANPT scheme was the least efficient among the 8 schemes. The schemes using MOET technology had a higher polygenetic response than others in the 17th year. The increases of frequency of the favorable QTL

  15. FlexVid: Fleksible arbejdsformer i videregående uddannelser

    DEFF Research Database (Denmark)

    2012-01-01

    Præsentation af forsknings- og udviklingsprojektet FlexVid med hovedvægt på modeller for blended learning i de fire deltagende uddannelser.......Præsentation af forsknings- og udviklingsprojektet FlexVid med hovedvægt på modeller for blended learning i de fire deltagende uddannelser....

  16. La vid y el vino en el arte español

    OpenAIRE

    Rincón García, Wifredo

    2007-01-01

    [ES] El arte español, a 10 largo de los siglos, se ha ocupado con asiduidad de la cultura de la vid y del vino, y asi encontramos que desde época romana hasta nuestros días, en numerosas obras de arte hallarnos referencias al cultivo de la vid, a las leyendas de su nacimiento, al proceso de elaboración del vino y su consumo, en cuadros tan magistrales corno los borrachos de Velázquez. La presencia de la vid y el vino en numerosos temas mitológicos y religiosos del Antiguo y ...

  17. Kompetensdiamanten : En kvalitativ studie om kompetensers olika betydelse vid rekrytering

    OpenAIRE

    Pettersson, Martin; Priba, Michael

    2012-01-01

    Följande undersökning behandlar ämnet rekrytering med inriktning på kompetensens betydelse vid tillsättning av en tjänst. Vidare redogörs för hur rekryteringsföretag i en mellanstor svensk stad väljer ut individer ur en grupp av arbetssökande och på vilka premisser urvalen sker. Det vill säga om en arbetssökande väljs ut att bli tillsatt för en tjänst på grund av vederbörandes arbetserfarenhet, kunskap och utbildning, eller om det är tack vare dennes personliga egenskaper. Studien ämnar under...

  18. Vidding and the perversity of critical pleasure: Sex, violence, and voyeurism in "Closer" and "On the Prowl"

    Directory of Open Access Journals (Sweden)

    Sarah Fiona Winters

    2012-03-01

    Full Text Available Analysis of two fan vids ("Closer" by Killa and T. Jonesy, and "On the Prowl" by Sisabet and Sweetestdrain in the context of theories of vidding reveals that vids have a unique ability to combine analytic detachment and pleasurable investment. I analyze these two vids through Roland Barthes's provocative suggestion that reading criticism demands from the reader a perverse voyeurism of the critic's pleasure in the text to argue that they are examples of the ways in which many vids function as pleasurable criticism that invites viewers of such vids to enter voyeuristically into that pleasure. Both vids use tropes of sexual violence to characterize not only the mass media they respond to, but also the nature of fandom and of transformative fan readings. "On the Prowl" criticizes and celebrates the fan through constructing different audiences for a series of self-portraits; "Closer" does the same thing by constructing Spock as a portrait of the fan. The narratives of sadism and rape constructed by the vids both disturb and seduce the viewer, thus forming perverse texts that that problematize pleasure while simultaneously reinscribing it.

  19. The two-source illusion: How vidding practices changed Jonathan McIntosh's political remix videos [symposium

    Directory of Open Access Journals (Sweden)

    Martin Leduc

    2012-03-01

    Full Text Available In an interview with Henry Jenkins, Jonathan McIntosh named fannish vidding as a key influence on two of his more recent video remixes. I took a more detailed look at precisely how these two videos intertwine vidding practices with those of political remix video (PRV, and to what effect.

  20. The coat morphogenetic protein SpoVID is necessary for spore encasement in Bacillus subtilis

    Science.gov (United States)

    Wang, Katherine H.; Isidro, Anabela L.; Domingues, Lia; Eskandarian, Haig A.; McKenney, Peter T.; Drew, Kevin; Grabowski, Paul; Chua, Ming-Hsiu; Barry, Samantha N.; Guan, Michelle; Bonneau, Richard; Henriques, Adriano O.; Eichenberger, Patrick

    2009-01-01

    SUMMARY Endospores formed by Bacillus subtilis are encased in a tough protein shell known as the coat, which consists of at least 70 different proteins. We investigated the process of spore coat morphogenesis using a library of 40 coat proteins fused to GFP and demonstrate that two successive steps can be distinguished in coat assembly. The first step, initial localization of proteins to the spore surface, is dependent on the coat morphogenetic proteins SpoIVA and SpoVM. The second step, spore encasement, requires a third protein, SpoVID. We show that in spoVID mutant cells, most coat proteins assembled into a cap at one side of the developing spore but failed to migrate around and encase it. We also found that SpoIVA directly interacts with SpoVID. A domain analysis revealed that the N-terminus of SpoVID is required for encasement and is a structural homolog of a virion protein, whereas the C-terminus is necessary for the interaction with SpoIVA. Thus, SpoVM, SpoIVA and SpoVID are recruited to the spore surface in a concerted manner and form a tripartite machine that drives coat formation and spore encasement. PMID:19775244

  1. Managing Obstetric Emergencies and Trauma (MOET structured skills training in Armenia, utilising models and reality based scenarios

    Directory of Open Access Journals (Sweden)

    Israelyan Musheg

    2002-05-01

    Full Text Available Abstract Background Mortality rates in Western Europe have fallen significantly over the last 50 years. Maternal mortality now averages 10 maternal deaths per 100,000 live births but in some of the Newly Independent States of the former Soviet Union, the ratio is nearly 4 times higher. The availability of skilled attendants to prevent, detect and manage major obstetric complications may be the single most important factor in preventing maternal deaths. A modern, multidisciplinary, scenario and model based training programme has been established in the UK (Managing Obstetric Emergencies and Trauma (MOET and allows specialist obstetricians to learn or revise the undertaking of procedures using models, and to have their skills tested in scenarios. Methods Given the success of the MOET course in the UK, the organisers were keen to evaluate it in another setting (Armenia. Pre-course knowledge and practice questionnaires were administered. In an exploratory analysis, post-course results were compared to pre-course answers obtained by the same interviewer. Results All candidates showed an improvement in post-course scores. The range was far narrower afterwards (167–188 than before (85–129.5. In the individual score analysis only two scenarios showed a non-significant change (cord prolapse and breech delivery. Conclusion This paper demonstrates the reliability of the model based scenarios, with a highly significant improvement in obstetric emergency management. However, clinical audit will be required to measure the full impact of training by longer term follow up. Audit of delays, specific obstetric complications, referrals and near misses may all be amenable to review.

  2. VID22 is required for transcriptional activation of the PSD2 gene in the yeast Saccharomyces cerevisiae.

    Science.gov (United States)

    Miyata, Non; Miyoshi, Takuya; Yamaguchi, Takanori; Nakazono, Toshimitsu; Tani, Motohiro; Kuge, Osamu

    2015-12-15

    Phosphatidylethanolamine (PE) in the yeast Saccharomyces cerevisiae is synthesized through decarboxylation of phosphatidylserine (PS), catalysed by PS decarboxylase 1 (Psd1p) and 2 (Psd2p) and the cytidine 5'-diphosphate (CDP)-ethanolamine (CDP-Etn) pathway. PSD1 null (psd1Δ) and PSD2 null (psd2Δ) mutants are viable in a synthetic minimal medium, but a psd1Δ psd2Δ double mutant exhibits Etn auxotrophy, which is incorporated into PE through the CDP-Etn pathway. We have previously shown that psd1Δ is synthetic lethal with deletion of VID22 (vid22Δ) [Kuroda et al. (2011) Mol. Microbiol. 80: , 248-265]. In the present study, we found that vid22Δ mutant exhibits Etn auxotrophy under PSD1-depressed conditions. Deletion of VID22 in wild-type and PSD1-depressed cells caused partial defects in PE formation through decarboxylation of PS. The enzyme activity of PS decarboxylase in an extract of vid22Δ cells was ∼70% of that in wild-type cells and similar to that in psd2Δ cells and the PS decarboxylase activity remaining in the PSD1-depressed cells became almost negligible with deletion of VID22. Thus, the vid22Δ mutation was suggested to cause a defect in the Psd2p activity. Furthermore, vid22Δ cells were shown to be defective in expression of the PSD2 gene tagged with 6×HA, the defect being ameliorated by replacement of the native promoter of the PSD2 gene with a CYC1 promoter. In addition, an α-galactosidase reporter assay revealed that the activity of the promoter of the PSD2 gene in vid22Δ cells was ∼5% of that in wild-type cells. These results showed that VID22 is required for transcriptional activation of the PSD2 gene. © 2015 Authors; published by Portland Press Limited.

  3. Verksamhetsmodell för klinisk specialistsjukskötare inom samjour vid Vasa centralsjukhus : - en kvalitativ studie

    OpenAIRE

    Svahn, Helena

    2013-01-01

    Syftet med studien var att utveckla en verksamhetsmodell för klinisk specialistsjukskötare inom samjour vid Vasa centralsjukhus. Frågeställningen för studien var: Hur skall verksamhetsmodellen utformas för en klinisk specialistsjukskötare? Vilka ansvarsområden kan en klinisk specialistsjukskötare inneha vid samjouren? Vilka arbetsuppgifter kan en klinisk specialistsjukskötare ha inom samjouren vid Vasa centralsjukhus? Metoden som användes var aktionsforskning med kvalitativ ansats. Datainsaml...

  4. L’institutionnalisation de la violence des jeux vidéo à l’Assemblée nationale

    OpenAIRE

    Mauco, Olivier

    2012-01-01

    La violence des jeux vidéo est au cœur des débats parlementaires sur la réglementation. à travers l’étude des questions au gouvernement, cet article se propose de retracer la genèse de ce cadrage dominant. Au-delà du moment institutionnel, l’usage du jeu vidéo à des fins du jeu politique prend progressivement le pas sur une hypothétique politique du jeu vidéo. Videogames violence is the core subject of parliamentary debates on regulation. Through the study of the questions to government, t...

  5. VID-R and SCAN: Tools and Methods for the Automated Analysis of Visual Records.

    Science.gov (United States)

    Ekman, Paul; And Others

    The VID-R (Visual Information Display and Retrieval) system that enables computer-aided analysis of visual records is composed of a film-to-television chain, two videotape recorders with complete remote control of functions, a video-disc recorder, three high-resolution television monitors, a teletype, a PDP-8, a video and audio interface, three…

  6. Download… Une courte histoire de la dématérialisation des jeux vidéo

    Directory of Open Access Journals (Sweden)

    Alexis Blanchet

    2012-08-01

    Full Text Available Dans les années 2000, la dématérialisation des logiciels de jeux s’est très largement développée en bouleversant les circuits de distribution de l’industrie vidéoludique et en modifiant en profondeur les habitudes de consommation et d’achat des joueurs de jeux vidéo. Accompagnant un mouvement général de distribution numérique des biens culturels (fichiers musicaux, vidéo à la demande, livre numérique…, la dématérialisation des jeux vidéo nous interroge sur la restructuration du secteur vidéoludique, les nouveaux modes de consommation et les potentialités en termes de créativité et d’innovation du côté des studios de développement.In the 2000s, dematerialization of video game softwares fundamentally changes consumer habits and games industry’s distribution channels. As an expression of cultural industries digitalization (music, video on demand, digital book ..., dematerialization gives us the opportunity to analyze how the game industry is restructuring, producing new consumption patterns and creating new production spaces of creativity and innovation for game developers.

  7. Selección de nuevas variedades de vid resistentes a enfermedades fúngicas, generadas mediante cruzamientos con Monastrell

    OpenAIRE

    García de Rosa, Beatriz; Fuentes Enríguez, Jose Antonio; Egea Gilabert, Catalina; Martinez Cutillas, Adrián; Ruiz García, Leonor

    2014-01-01

    La viticultura y la vinicultura han sido tradicionales desde la antigüedad en Murcia (España), siendo la vid un cultivo de gran importancia económica en esta zona. Sin embargo, las enfermedades causadas por hongos afectan gravemente al rendimiento, el coste y la calidad de la producción de la vid. Estas enfermedades se controlan en la actualidad mediante tratamientos con fungicidas, repetidos durante cada temporada de cultivo. La obtención de nuevas variedades resistentes de al...

  8. Respuesta agronómica de diferentes cultivares tintos de vid en zona templada

    OpenAIRE

    Baeza Trujillo, Pilar; Sánchez Lirio, M.; Verdugo, J.; Tejerina Sanz, M.; López Pavón, Cristina; Martín Cuadrado, L.; Iglesias, L.; Díaz Riquelme, M.T.; Pérez Ayuso, E.; Hernández, E.; Pérez Cidoncha, Cristina; González, C

    2011-01-01

    Se presenta la respuesta varietal de 6 cultivares tintos de vid, con riego deficitario controlado, en zona cálida: Barbera, Graciano, Mencía, Pinot noir, Petit verdot y Tempranillo. Teniendo en cuenta que en zona cálida hay que escoger cultivares de ciclo largo, recolección tardía, capaces de madurar manteniendo alta la acidez real y total, se concluye que los más idóneos para su cultivo en zona cálida son Barbera, por su alta acidez y Petit verdot y Graciano por su larga maduración y acidez ...

  9. Verkligt värde vid första redovisningstillfället?

    DEFF Research Database (Denmark)

    Thinggaard, Frank; Nilsson, Sven-Arne

    2007-01-01

    I en första artikel av två diskuterar Frank Thinggaard och Sven-Arne Nilsson en rapport från IASB som föreslår verkligt värde istället för anskaffningsvärde vid första redovisningstillfället. Där rapporten står för nytänkande undersöker de om denär i linje med en rapport om förbättrad föreställni...

  10. Le feedback vidéo en EPS: les processus en jeu

    OpenAIRE

    Fonseca, Bruno; Guinand, Alain; Baumberger, Bernard

    2012-01-01

    Quels sont les processus engendrés par les feedbacks vidéos qui améliorent l’apprentissage ? La question centrale de recherche de ce travail nous a amenés à aborder l’apprentissage sous un angle d’analyse reliant les feedbacks et les processus cognitifs. Après avoir posé, dans un premier temps, les concepts de cette approche (stades de traitement de l’information et connaissances), nous avons développé les différents feedbacks et plus précisément les rétroactions visuelles. Pour tent...

  11. El vino y la vid en la construcción social: un caso boyacense

    OpenAIRE

    Fabio Aldemar Gómez Sierra

    2005-01-01

    Las actividades agrícolas productivas que identifican las culturas campesinas, están inscritas en una compleja diversidad simbólica, consolidada en elementos religiosos, políticos, económicos, tecnológicos y ambientales. Históricamente, el cultivo de la vid y el consumo del vino se han enriquecido de tradiciones religiosas, distinción de clases, necesidades psicológicas de beber alcohol y experimentar placer, desenlaces políticos, estrategias económicas, negocios atractivos y climas favorable...

  12. Enhancement of malate-production and increase in sensitivity to dimethyl succinate by mutation of the VID24 gene in Saccharomyces cerevisiae.

    Science.gov (United States)

    Negoro, Hiroaki; Kotaka, Atsushi; Matsumura, Kengo; Tsutsumi, Hiroko; Hata, Yoji

    2016-06-01

    Malate in sake (a Japanese alcoholic beverage) is an important component for taste that is produced by yeasts during alcoholic fermentation. To date, many researchers have developed methods for breeding high-malate-producing yeasts; however, genes responsible for the high-acidity phenotype are not known. We determined the mutated gene involved in high malate production in yeast, isolated as a sensitive mutant to dimethyl succinate. In the comparative whole genome analysis between high-malate-producing strain and its parent strain, one of the non-synonymous substitutions was identified in the VID24 gene. The mutation of VID24 resulted in enhancement of malate-productivity and sensitivity to dimethyl succinate. The mutation appeared to lead to a deficiency in Vid24p function. Furthermore, disruption of cytoplasmic malate dehydrogenase (Mdh2p) gene in the VID24 mutant inhibited the high-malate-producing phenotype. Vid24p is known as a component of the multisubunit ubiquitin ligase and participates in the degradation of gluconeogenic enzymes such as Mdh2p. We suggest that the enhancement of malate-productivity results from an accumulation of Mdh2p due to the loss of Vid24p function. These findings propose a novel mechanism for the regulation of organic acid production in yeast cells by the component of ubiquitin ligase, Vid24p. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  13. The influence of hurricanes upon the quiet depositional conditions in the Lower Emsian La Vid shales of Colle (NW Spain)

    NARCIS (Netherlands)

    Stel, Jan H.

    1976-01-01

    The author supposes that the fossil content of thin carbonate units in the Upper La Vid shales (Lower Devonian) of Colle was influenced by heavy storms like hurricanes. Apart from microplankton (Cramer, 1964) no fossils are found in the shales. Together with the very well developed fissility of the

  14. résultats de 8 années de pratique de vidéochirurgie dans le service ...

    African Journals Online (AJOL)

    Son expansion est freinée par l'absence de formation pratique des personnels malgré des infrastructures désormais équipées. Mots clés : vidéochirurgie, laparoscopie, Thoracoscopie, endo-urologie, Gabon. Videoscopic surgery is a minimally invasive surgical approach, increasingly practiced in several specialties in ...

  15. The greening of existing buildings. The position of heat distribution in several policy areas; Bestaande bouw moet nog sterker vergroenen. Positie van warmtenetten op diverse beleidsterreinen nog zwak

    Energy Technology Data Exchange (ETDEWEB)

    De Jong, K.

    2012-04-15

    The Netherlands will have to take some major steps to realize its sustainability ambitions in eight years' time. With this challenge in mind, the Dutch Stichting Warmtenetwerk organized a symposium on green heat for existing buildings in press centre Nieuwspoort, The Hague on 25 January. The deployment of heat distribution is bringing the targets much closer. [Dutch] Nederland moet nog flinke stappen maken om over acht jaar de voorgenomen duurzaamheidsambities te kunnen halen. Met deze uitdaging in gedachten, werd op 25 januari door de Stichting Warmtenetwerk in perscentrum Nieuwspoort, Den Haag een symposium georganiseerd over groene warmte voor de bestaande bouw. De inzet van warmtenetten brengt de doelen een flink stuk dichterbij.

  16. Die wese, doel en belangrikheid van liggaamlike opvoeding in 'n moderne kulturele samelewing en die prinsipiële grondbeginsels waarop dit moet berus*

    Directory of Open Access Journals (Sweden)

    I. R. van der Merwe

    1963-03-01

    Full Text Available Om dat die begrip Liggaamlike Opvoeding in die alledaagsc taalgebruik ligtclik assosieer word o.a. m et sulke begrippe soos sport, liggaamsoefeninge, in Engels m et physical culture; in Duits m et kórpcrerziehung; in Grieks met gym nastiek en andcr moontlike m isleidende begrippe in aanverw ante tale, en om dat in die alledaagse spreek- taal daar wanopvattings ook kan bestaan i.v.m. so ’n begrip soos kultuur, wil ons dan ten einde m isverstand uit die weg te ruim , vir eers kortliks nagaan w at presies onder die begrippe K ultuur en Liggaamlike Opvoeding verstaan moet word voordat ’n poging aangewend w ord om bogenoemde onderwerp te ondersoek.

  17. Focus on welfare in design. Designing buildings for occupants increases productivity; Focus bij ontwerp moet op welzijn liggen. Gebouwen voor gebruikers ontwerpen verhoogt productiviteit

    Energy Technology Data Exchange (ETDEWEB)

    Nierman, G.J. [Royal Haskoning Buildings, Arnhem (Netherlands)

    2012-03-15

    When creating buildings, more focus should be put on the impact of a building on the end user: how will the various users experience the building and how will they behave? The consequences for absence due to illness, productivity, and the number of patients or students directly influence the effectiveness of the organization. This can be incorporated qualitatively and quantitatively in the design process. [Dutch] Er moet bij het creeren van gebouwen meer focus komen op de impact van een gebouw op de eindgebruiker: hoe de diverse gebruikers het gebouw ervaren en hoe ze zich zullen gaan gedragen. De gevolgen in ziekteverzuim, productiviteit, aantallen patienten of leerlingen beinvloeden direct de effectiviteit van de organisatie. In het ontwerpproces kan dit op een kwalitatieve en kwantitatieve wijze worden meegenomen.

  18. Arachis pintoi como alternativa sostenible en el manejo integrado de malezas en vid

    Directory of Open Access Journals (Sweden)

    Bareño Rojas Patricia

    1999-12-01

    Full Text Available

    En Roldanillo (Valle del Cauca, se realizaron varios experimentos con el objeto de evaluar el establecimiento, la efectividad y los beneficios del Arachis pintoi Krapovickas y Gregory al ser usado como cobertura noble en el cultivo de la vid. Se encontró que, tanto la germinación, como  la emergencia, se aumentan en un 20% cuando las semillas se remojan por 12 horas en un medio de agua y acido giberelico. A los 240 días después de la siembra de la cobertura, las malezas gramíneas, ciperáceas y de hoja ancha disminuyeron significativamente, tanto su densidad, como su biomasa, a tal punto que la cobertura alcanzo el 100%. EI rendimiento y la calidad de la uva se beneficiaron con la cobertura. El rendimiento se aumento en casi una tonelada por hectárea. En esta investigación, se comprobó la bondad del A. pintoi como practica integrada de manejo de malezas en el cultivo de la vid dentro de un sistema de agricultura sostenible para un ambiente mas limpio.

     

    Palabras claves: Arachis pintoi, maní forrajero perenne, cobertura, sostenible, malezas, vid.

  19. Penser l’intégration du jeu vidéo en classe de langue

    OpenAIRE

    Schmoll, Laurence

    2017-01-01

    Le jeu vidéo fait son entrée dans les classes de langue en raison de son potentiel motivationnel. Il représente, de plus, un intérêt certain en regard de la perspective actionnelle prônée par le CECRL. L’intégrer aux enseignements relève cependant de la gageure car l’idée du jeu peut parfois être conçue comme incompatible avec la notion de travail en milieu d’apprentissage. Dans cet article, nous montrons le lien entre jeu et perspective actionnelle puis nous exposons différentes modalités du...

  20. Mise au point d’une « Application de Vidéosurveillance »

    OpenAIRE

    BELABBAS, Abdelilah; LASLA, Abderrahim

    2015-01-01

    La télésurveillance est la surveillance à distance d'un lieu, public ou privé, de machines ou d'individus. Elle est employée dans de nombreuses situations, généralement pour des raisons de sécurité. La vidéosurveillance consiste à placer des caméras de surveillance dans un lieu public ou privé pour visualiser et/ou enregistrer en un endroit centralisé tous les flux de personnes au sein d'un lieu ouvert au public pour surveiller les allées et venues, prévenir les vols, agressions, fraudes et g...

  1. La mémoire en jeu vidéo dans Level five (1996

    Directory of Open Access Journals (Sweden)

    Thibaut Garcia

    2009-10-01

    Full Text Available Abstract (E: The theory of digital arts today is almost always articulated around the dichotomy
    real/virtual. The universe of video games is generally perceived as a parallel reality, the time of play as
    time that can be reversed. In Level five, Chris Marker uses computer techniques highlighting their
    dimension of memory rather than their “virtuality”: preserving the complete memory of the past, the
    video game about the battle of Okinawa returns the player to his own ineffaceable memory and to the
    inescapable character of what, in reality, “is played” once and for all. The computer memory becomes
    the double of the human memory.
    Abstract (F: Aujourd’hui, la théorie des arts numériques s’articule presque toujours autour de la
    dichotomie réel/virtuel. L’univers des jeux vidéo est généralement perçu comme une réalité parallèle,
    le temps du jeu comme un temps réversible. Dans Level five, Chris Marker utilise les techniques
    informatiques en mettant en avant leur dimension « mémorielle » plutôt que « virtuelle » : conservant
    toute la mémoire du passé, le jeu vidéo sur la bataille d’Okinawa renvoie le joueur à sa propre
    mémoire ineffaçable et au caractère inéluctable de ce qui, dans la réalité, est « joué » une fois pour
    toutes. La mémoire informatique devient le double de la mémoire humaine.

  2. Variaciones interanuales de la precipitación de verano y el rendimiento del cultivo de la vid en Mendoza

    Directory of Open Access Journals (Sweden)

    Eduardo Andrés Agosta

    2010-12-01

    Full Text Available La producción de vid es la fuente económica agroindustrial principal en Cuyo (28°S-36°S / 65°W-70°W, siendo la región de más elevado desarrollo vitivinícola del país. Uno de los factores climáticos de mayor impacto en la producción de vid es la destrucción del cultivo por granizo, como resultado de la convección severa desarrollada en época estival. La violencia con que se desarrollan las tormentas estivales de granizo genera un impacto importante en el rendimiento de los viñedos afectados, logrando la disminución parcial o total de parcelas enteras. Durante el período 1979-2008, la precipitación de verano presenta fluctuaciones de la escala 7-8 años al igual que la producción total de vid y ambas se encuentran inversamente correlacionadas intradecádicamente. Asimismo, veranos húmedos (secos pueden presentar mayor (menor probabilidad de ocurrencia de daños por granizo en la temporada actual que se pueden asociar a menor (mayor producción de vid en la temporada del año siguiente debido a cambios en la disponibilidad de yemas fértiles. También una fracción de la variación de la producción de vid en el verano actual puede estar asociada a cambios en la precipitación de ese verano por daño directo (intensidad de la precipitación o indirecto (anegamiento relativamente prolongado ya que la desfoliación y asfixia radicular parecen afectar el rendimiento de las plantas. La clara dependencia climática de cultivo muestra que la producción total anual de vid está modulada por las variaciones de la precipitación en escalas decádicas, la cual está vinculada a factores de escala global del sistema climático. Se derivan potenciales resultados para el pronóstico de la producción de vid bajo futuros escenarios de cambio climático para la región.The grape production is the main economic source in the agro-industry of Cuyo (28°S-36°S / 65°W- 70°W, becoming the most developed region for wine production in Argentina

  3. La Vidéo Participative : essai de cadrage du concept

    Directory of Open Access Journals (Sweden)

    Loïc Colin

    2009-06-01

    Full Text Available Dans la boite à outils des « développeurs », la vidéo (regagne en crédibilité pour appuyer l’ensemble des processus communicationnels au sein des projets. Son utilisation participative se développe, en accord avec les méthodes et principes admis dans les paradigmes dominants du domaine de la coopération. Le concept de « Vidéo Participative » est néanmoins manié avec peu de précision. Cet article cherche à en donner les origines, ainsi qu’une définition, avant de proposer une typologie d’approches et les principaux critères permettant de les caractériser.Participatory Video: framing of the conceptAmong the tools available to projects managers and designers, the video has regained a certain credibility regarding the support that it may bring to the various communicational processes required to carry out a successful project. In this context, video is now increasingly used in a participative way in accordance with the recent evolution of the methods, principles and theoretical frameworks of the North-South cooperation field. Nevertheless, the concept of “participatory video” is still handled with little accuracy. Thereby, this article aims at defining it precisely, explaining its origins and proposing a typology of the various models, criteria and approaches that can be used to characterize it properly.La « Vídeo Participativa »: esbozo de definición del conceptoEntre los instrumentos que implican una técnica, el vídeo vuelve a ganar credibilidad en la medida en que reafirma los procesos de comunicación en el seno de los proyectos. Su utilización participativa se desarrolla en acuerdo con los métodos y principios admitidos por los paradigmas dominantes del ámbito de la comunicación. El concepto de « Vídeo Participativa » debe ser sin embargo utilizado de manera precisa. Se trata en este artículo de explicar sus orígenes y también de formular una definición ya que son dos requisitos

  4. Guerres et jeux vidéo : représentations et enjeux de mémoire de la Seconde Guerre mondiale

    OpenAIRE

    Facchini, Thomas

    2016-01-01

    L’Histoire, et particulièrement la Seconde Guerre mondiale, est propice à de nombreuses mises en scène vidéoludiques. Cet article se décompose en deux grands axes. Le premier porte sur l’évolution des représentations vidéoludiques de la Seconde Guerre mondiale au cours des années 2000 et les diverses esthétiques (temporelles, visuelles et sonores) du combat qui transparaissent dans ces jeux. Le second axe questionne la polémique suscitée en Russie par le jeu vidéo Company of Heroes 2, sorti e...

  5. A VidEo-Based Intelligent Recognition and Decision System for the Phacoemulsification Cataract Surgery

    Directory of Open Access Journals (Sweden)

    Shu Tian

    2015-01-01

    Full Text Available The phacoemulsification surgery is one of the most advanced surgeries to treat cataract. However, the conventional surgeries are always with low automatic level of operation and over reliance on the ability of surgeons. Alternatively, one imaginative scene is to use video processing and pattern recognition technologies to automatically detect the cataract grade and intelligently control the release of the ultrasonic energy while operating. Unlike cataract grading in the diagnosis system with static images, complicated background, unexpected noise, and varied information are always introduced in dynamic videos of the surgery. Here we develop a VidEo-Based Intelligent Recognitionand Decision (VEBIRD system, which breaks new ground by providing a generic framework for automatically tracking the operation process and classifying the cataract grade in microscope videos of the phacoemulsification cataract surgery. VEBIRD comprises a robust eye (iris detector with randomized Hough transform to precisely locate the eye in the noise background, an effective probe tracker with Tracking-Learning-Detection to thereafter track the operation probe in the dynamic process, and an intelligent decider with discriminative learning to finally recognize the cataract grade in the complicated video. Experiments with a variety of real microscope videos of phacoemulsification verify VEBIRD’s effectiveness.

  6. Mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet

    Directory of Open Access Journals (Sweden)

    Sven B Eriksson

    2013-01-01

    Full Text Available Det pedagogiska ledarskapet inom högre utbildning fokuseras allt mer. Det understryks genom att flera lärosäten föreskriver såväl att pedagogiska ledare ska finnas på olika nivåer, som vilka övergripande uppgifter dessa ska ha. Denna artikel är ett resultat av en fallstudie av hur de tillägnade kunskaperna och färdigheterna från kursen Pedagogiskt ledarskap, en kurs för målgruppen studierektorer/pedagogiskt ansvariga eller motsvarande arrangerad av Universitetspedagogiskt centrum, har bidragit till deltagarnas professionalisering av det pedagogiska ledarskapet ett år efter kursens slut. Fallstudien genomfördes genom gruppintervjuer. Respondenterna uttryckte att de fått ett stärkt självförtroende i rollen som pedagogiska ledare samt att kursen bidrog till en professionalisering av rollen som pedagogiska ledare genom att stärka identiteten, att skapa en början till en handlingsetik bestående av delvis delade värderingar kring det pedagogiska ansvaret samt ge utbildning och träning i färdigheter som har sin grund i teoretisk kunskap. Kursen Pedagogiskt ledarskap ger därmed ett stöd i en process mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet.

  7. El vino y la vid en la construcción social: un caso boyacense

    Directory of Open Access Journals (Sweden)

    Fabio Aldemar Gómez Sierra

    2005-10-01

    Full Text Available Las actividades agrícolas productivas que identifican las culturas campesinas, están inscritas en una compleja diversidad simbólica, consolidada en elementos religiosos, políticos, económicos, tecnológicos y ambientales. Históricamente, el cultivo de la vid y el consumo del vino se han enriquecido de tradiciones religiosas, distinción de clases, necesidades psicológicas de beber alcohol y experimentar placer, desenlaces políticos, estrategias económicas, negocios atractivos y climas favorables. La emergente viticultura del Valle del Sol en Boyacá, no es ajena a dicha complejidad. Los campesinos que la incorporan, poseen un patrimonio social expresado en religiosidad, sensibilidad al comercio y cambios tecnológicos; Además, son capitalistas rurales, consumidores de cerveza y estrategas de la economía doméstica. Este artículo muestra indicadores para la comprensión de una producción cultural centrada en la viticultura.

  8. US moet nog ver vorder

    DEFF Research Database (Denmark)

    Bergenholtz, Henning

    2006-01-01

    af de virkelige problemer ikke ses. Det drejer sig også om valg af sprog (afrikaans, engelsk eller xhosa) på alle møder, i alle referater og meddelelser, men i særlig grad også i valg af sprog på alle oplysende skilte og plakater. I sidste tilfælde foreslås brug af alle tre officielle sprog, ved valg...... af unvervisningssprog bør man fortsætte den linje, der allerede er valgt, dvs. en stor del af undervisningen på afrikaans, en mindre på engelsk, men på længere sigt også i nogen grad på xhosa. I øvrigt kunne rektor og herunder også universitetets tast group for udarbejdelse af en ny sprogpolitik med...

  9. Kwaliteitsverantwoordelijke moet ook zelf veranderen

    NARCIS (Netherlands)

    PhD. Everard van Kemenade

    2014-01-01

    Kwaliteitsverantwoordelijken hebben steeds meer te maken met het begeleiden van veranderingen. Steeds meer zijn zij change agents. Dat vraagt om andere vaardigheden, schrijft Everard van Kemenade, dan in de tijd van controle en beheersing of van voortdurend verbeteren. Het belangrijkst zijn de

  10. Impact clinique chez les patients explorés par vidéocapsule PILLCAM SB®: suivi à 1 an des patients inclus consécutivement dans 2 centres français en 2003

    National Research Council Canada - National Science Library

    El Alaoui, M; D’halluin, P N; Boustière, C; Bretagne, J F; Heresbach, D

    2006-01-01

    ... et thérapeutique immédiat et à long terme de la VCE.Exploration of the small intestine by vidéocapsule endoscopy (EVC) is becoming general practice and its diagnostic yield is well established...

  11. La médiatisation des problématiques de la violence et de l'addiction aux jeux vidéo

    OpenAIRE

    Mauco, Olivier

    2012-01-01

    Les problématiques de la violence et de l’addiction des jeux vidéo sont des thématiques récurrentes dans les médias généralistes. En étudiant la genèse du traitement médiatique de ces notions, dans une approche comparative et internationale, cet article suggère que la récurrence de ces thèmes est liée à la question de la sélection des experts du jeu vidéo. Leurs modes de sélections endogènes afin de répondre aux impératifs d’explication, produit une surreprésentation des professionnels de la p...

  12. Regulation of Hxt3 and Hxt7 turnover converges on the Vid30 complex and requires inactivation of the Ras/cAMP/PKA pathway in Saccharomyces cerevisiae.

    Directory of Open Access Journals (Sweden)

    Chris Snowdon

    Full Text Available Eukaryotic cells adjust their intracellular protein complement as a mechanism to adapt to changing environmental signals. In Saccharomyces cerevisiae the hexose transporters Hxt3 and Hxt7 are expressed and function on the plasma membrane in high and low glucose abundance, respectively. By contrast, Hxt3 is endocytosed and degraded in the vacuole when cells are starved of glucose and Hxt7 in response to rapamycin treatment or when nitrogen is limiting. Yeast uses several signaling pathways, including the TORC1 and Ras/cAMP/Protein Kinase A (PKA pathways, to adapt to nutrient changes in the environment. The multi-protein Vid30 complex (Vid30c, an E3 ubiquitin ligase required for the degradation of FBPase, assists in this adaptation process in a mechanism that is poorly understood. Here we show the endocytosis and the subsequent degradation of both Hxt3 and Hxt7, in response to different nutrient signals, is dependent on components of the Vid30c. Additionally, we define the signaling events required for the turnover of Hxt3 and Hxt7 by showing that Hxt3 turnover requires Ras2 and PKA inactivation, whereas Hxt7 turnover requires TORC1 and Ras2 inactivation. Further investigation led us to identify Rim15, a kinase that is inhibited by both the TORC1 and Ras/cAMP/PKA pathways, as a key downstream effector in signaling both turnover events. Finally, we show that the turnover of both Hxt3 and Hxt7 is dependent on the essential E3 ubiquitin ligase, Rsp5, indicating that the role of the Vid30c might be indirect of Hxt ubiquitylation.

  13. Dzimuma lomu interpretācija mūzikas videoklipos jauniešu vidū

    OpenAIRE

    Frišenfelde, Magda

    2014-01-01

    Maģistra darba ”Dzimuma lomu interpretācija mūzikas videoklipos jauniešu vidū” mērķis noskaidrot dominējošās zināšanas, kas atspoguļo jauniešu interpretāciju par dzimuma lomām, lai novērtētu videoklipu iespaidu uz jauniešiem kā mērķa grupu. Darbā ir izmantots sociālais konstrukcionisms, kas tiek saistīts ar mediju, populārās kultūras teorijām. Sniegta arī iepriekš veikto pētījumu analīze par populārākajām dzimumu lomām mūzikas videoklipos. Empīrisko datu ieguvei izmantotas daļēji struktur...

  14. Les utilités du jeu vidéo sérieux : finalités, discours et mises en corrélation

    Directory of Open Access Journals (Sweden)

    Etienne Armand Amato

    2011-05-01

    Full Text Available Les jeux vidéo sérieux offrent aujourd’hui une grande diversité de catégories et d’usages. Ils prétendent changer notre rapport au monde comme au jeu. Pour surmonter les paradoxes provenant de l’opposition entre activité ludique et activité sérieuse, il est préférable d’étudier ces nouveaux produits en termes d’utilité. La méthode de la recherche présentée ici a consisté à prendre en considération le point de vue et les intérêts particuliers de ceux qui les produisent – les émetteurs –, et de ceux qui les pratiquent – les récepteurs. Le résultat obtenu est que leurs finalités respectives sont surtout convergentes et complémentaires dans le cas de la formation et du soin, alors qu’elles divergent et changent de nature dans le domaine de la communication journalistique, politique et surtout publicitaire. Il se trouve que cette réalité est masquée par le discours des promoteurs des jeux sérieux qui tiennent des propos très globalisants. Pour dépasser la rhétorique des acteurs d’un secteur en pleine expansion, une nouvelle définition du jeu vidéo sérieux est finalement proposée. Elle se fonde sur l’instrumentalisation du jeu vidéo et conclut sur l’idée que tous les jeux sérieux cherchent à mettre en corrélation effective le jeu et la réalité.

  15. Apprendre ensemble en classe via des jeux vidéo populaires : le modèle du LAN pédagogique

    Directory of Open Access Journals (Sweden)

    Samuelle Ducrocq-Henry

    2011-05-01

    Full Text Available La thèse intitulée « Les tribus ludiques» expose le modèle du LAN pédagogique (LP découlant d’une étude des compétitions de jeu vidéo en réseau local (LAN parties. Incarnant un rite de passage quasi tribal chez les 12-25 ans, les LAN semblent favoriser socialisation et apprentissage. Un LP permet aux enseignants d’initier des expériences réseautiques similaires et formatrices en classe, tenues simultanément dans les mondes réels et virtuels, en détournant le scénario de jeux vidéo multijoueurs populaires, pour en faire des simulateurs propices à l’enseignement de disciplines diverses. Sa procédure simple et abordable révèle le potentiel du Serious Gaming en éducation.

  16. Fosfaat moet de kringloop weer in

    NARCIS (Netherlands)

    Smit, A.L.

    2011-01-01

    Niet alleen olie raakt op, ook zoet water, fosfaat en landbouwgrond zijn niet grenzeloos beschikbaar. Met een uitdijende wereldbevolking groeien echter de aanspraken op grondstoffen en andere natuurlijke hulpbronnen. In die concurrentiestrijd zijn duurzame oplossingen nodig als besparing, denken in

  17. Moetähestik / Anne Metsis

    Index Scriptorium Estoniae

    Metsis, Anne, 1958-

    2016-01-01

    Moeterminite tähendusi: A- 2015. a. veebruarinumbris, B- märtsinumbris, C- aprillinumbris, D-mainumbris, E ja F juuninumbris, G juulinumbris, H - augustinumbris, I & J - septembrinumbris, K - oktoobrinumbris, L - novembrinumbris, M - detsembrinumbris; N - 2016. a. jaanuarinumbris, O - veebruarinumbris, P - märtsinumbris, R- aprillinumbris, S-mainumbris, T - juuninumbris, U - juulinumbris, V - augustinumbris, Õ, Ä, Ö, Ü - septembrinumbris

  18. Moet teologiese opleiding kerklik-konfessioneel wees?

    African Journals Online (AJOL)

    By name is die bydrae van die godsdiens tot'die verstaan van die groter werklikheid ingesien en toegegee. Werner Heisenberg (1969:119) sê byvoorbeeld die volgende van die kousaliteits- wette waarmee die natuurwetenskappe onder teologiese verklarings van die werk likheid amok gemaak het: 58. HTS50/lá2(l994) ...

  19. Cybersecurity: Nederland moet inzetten op internationale cybersamenwerking

    NARCIS (Netherlands)

    Bouwman, F.; Marácz, L.

    2012-01-01

    Het digitale domein is, naast land, de lucht, de zee en de ruimte, inmiddels het vijfde domein voor militair optreden geworden omdat dit domein en de toepassing van digitale middelen als wapen overal ter wereld sterk in ontwikkeling zijn. Allerlei vormen van digitale oorlogsvoering zijn een reëel

  20. Étude de facteurs liés à l’attention d’apprenants universitaires en contexte de vidéocommunication

    OpenAIRE

    Patrick Giroux

    2009-01-01

    [Français] La recherche présentée adopte le point de vue des apprenants et place l’apprentissage en vidéocommunication (VC) au niveau universitaire au centre des préoccupations. Les objectifs poursuivis sont de favoriser la compréhension de ce contexte et de proposer quelques recommandations basées sur l’expérience. Une étude descriptive corrélationnelle a été menée dans 11 cours donnés en VC dans 3 universités afin d’étudier les facteurs associés aux difficultés attentionnelles des apprenant...

  1. Stresa optimizēšanas iespējas 12-13 gadus veciem pusaudžiem skolas vidē

    OpenAIRE

    Vēvere, Ieva

    2007-01-01

    Bakalaura darbā „Stresa optimizēšanas iespējas 12-13 gadus veciem pusaudžiem skolas vidē” tiek aplūkota stresa problēma skolā, noskaidroti galvenie pusaudžu stresori skolā, ka arī analizēta skolēnu stresa un sekmju līmeņa saistība. Darba autore: Ieva Vēvere Darba vadītāja: Dr.biol., Mag.paed. doc. Inta Kraukle Darba apjoms: darbs sastāv no 48 lpp, 10 tabulām, 5 grafiskajiem attēliem un 9 pielikumiem. Darba pirmajās trīs nodaļās analizēta literatūra par stresu, tā būtību un ietekm...

  2. Les jeux vidéo compétitifs au prisme des jeux sportifs : du sport au sport électronique

    OpenAIRE

    BESOMBES, Nicolas

    2016-01-01

    La comparaison entre jeux vidéo compétitifs et jeux sportifs fait régulièrement débat, et ce notamment auprès des acteurs de la communauté du sport électronique. À l’aide de concepts empruntés à la sociologie du sport, l’article propose de questionner la définition du sport électronique au regard de quatre critères objectifs et opérationnels régulièrement utilisés pour définir le jeu sportif : la pertinence motrice de l’activité, l’organisation de compétitions, le système règlementaire et le ...

  3. Los carábidos como componentes clave de la agrobiodiversidad : Su rol en la sustentabilidad de los agroecosistemas de vid de la zona de Berisso, provincia de Buenos Aires

    OpenAIRE

    Paleologos, María Fernanda

    2012-01-01

    El objetivo de esta tesis fue analizar las variaciones de la coleopterofauna en general y de carábidos en particular, asociadas a la heterogeneidad ambiental en sistemas de producción de vid y su importancia para el manejo de los agroecosistemas sustentables. Como objetivos particulares, dentro de cada una de las zonas, se propuso: 1) Identificar las familias de Coleoptera, 2) Calcular su abundancia (densidad- actividad), riqueza y diversidad de familias, y abundancia relativa de gr...

  4. Élaboration et validation de l’échelle de la perception et du sentiment d’auto-efficacité en vidéocommunication (ÉPAV .

    Directory of Open Access Journals (Sweden)

    Patrick Giroux

    2008-01-01

    Full Text Available L’article présente le processus d’élaboration et de validation de l’échelle de la perception et du sentiment d’auto-efficacité des apprenants vis-à-vis de la vidéocommunication (ÉPAV. Basée sur la théorie sociocognitive de Bandura (1977, 1982, 1997/2007, cette échelle permet d’évaluer deux dimensions: la perception générale de la vidéocommunication et celle que l’individu a de son propre niveau de compétence dans ce contexte. Les résultats soutiennent la structure bidimensionnelle ainsi que la cohérence interne de l’ÉPAV. Des corrélations avec des mesures de la motivation et de l’expérience en vidéocommunication ainsi qu’avec des mesures de l’attention en appuient la validité.

  5. Historia del cultivo de la vid y el vino; su expresión en la Biblia [The history of wine and the growing of grapes; as expressed in the Bible

    Directory of Open Access Journals (Sweden)

    José María Melero Martínez

    2012-06-01

    Full Text Available Resumen:Para entender el valor de la vid y del vino en la Biblia es necesario conocer antes su cultivo; para ello, el presente artículo pretende, primero, adentrar al lector en la historia del vino y de la situación actual de la vid, así como su morfología y fenología para, posteriormente, centrarse en el significado de la vid y el vino en las Sagradas Escrituras.La importancia de la vid es extraordinaria, no solamente porque las uvas constituyan uno de los frutos más apreciados, sino porque el mayor valor de las uvas es la elaboración del vino. Además, la vid y el vino están ampliamente citados en las Sagradas Escrituras. A través de sus numerosas menciones, se puede contemplar la importancia que tenía la vid y el vino, ambos imprescindibles para aquellos pueblos. La vid es un importante símbolo cristiano, especialmente en cuanto produce el vino que es la imagen de la alegría, la fiesta, el derroche y también del conocimiento. La palabra traducida “vino” en las Escrituras no siempre se refiere a la misma cosa. Hay diferentes palabras hebreas y griegas y, varias de ellas, se refieren a diferentes cosas. Mediante la realización de este artículo, se pretende dar a conocer al lector estos vocablos en la Biblia.  Abstract:To understand the value of the grapevines and wine in the Bible it is necessary to know its culture first; this article aims to get the reader involved in the history of wine and the current status of grapevines, as well as their morphology and phenology, to focus the attention on the meaning of the grapevines and wine in the Holy Scriptures later.The importance of grapevines is extraordinary; not only because grapes are one of the most popular kinds of fruit, but because the highest value of grapes is wine making. Furthermore, he vine and wine are widely quoted in the Holy Scriptures. Through it’s numerous references, you can notice the importance attached to the vine and wine, both essential for those

  6. Description et usages d’un nouveau dispositif de vidéo-cours : l’encre numérique

    Directory of Open Access Journals (Sweden)

    Marc Trestini

    2011-06-01

    Full Text Available Cet article présente un nouveau design de vidéo-cours pour l’enseignement universitaire : « l’encre numérique ». Il rend compte de son impact sur l’apprentissage et décrit le profil cognitif des étudiants pour qui ce dispositif semble produire les meilleurs résultats. Le dispositif étudié est constitué d’un Tablet PC associé à un cahier de textes en ligne. Le Tablet PC permet de vidéoprojeter ce que l’enseignant avait coutume d’écrire auparavant au tableau et le cahier de textes de restituer, en ligne, l’ensemble des traces du cours (visuelles, sonores, textuelles. L’étude du dispositif s’appuie sur les résultats des étudiants aux examens, la fréquence de consultation des ressources, ainsi que sur la manière dont elles sont consultées. Cette étude met en évidence certaines caractéristiques et affordances du dispositif qui semblent avoir un effet bénéfique sur les apprentissages et ce, en fonction du profil cognitif de l’étudiant.This paper presents a new design of video courses for university teaching. It is called "digital ink". It shows its impact on student learning and describes the cognitive profile of students for which this device seems to produce the best results. The device which is studied consists of a Tablet PC combined with a work agenda on line. The Tablet PC enables one to project what the teacher traditionally wrote on the board. That is to say; explanatory notes, equations and hand-written diagrams. The teacher has a writing tool (digital light pen which allows cursive script (handwriting on a computer. All written records produced by the teacher during the course, accompanied by verbal comments are recorded. The study of this device is based on student performance on exams, how often they consulted the videos as well as the manner of consulting them. This study shows the impact of this new device on student learning according to their cognitive profile.

  7. Le sens de l’écart : la narration déconstruite dans les vidéos de Willie Doherty

    Directory of Open Access Journals (Sweden)

    Valérie Morisson

    2011-08-01

    Full Text Available Dans les œuvres vidéographiques de l’artiste nord-irlandais Willie Doherty, les éléments narratifs entretiennent une relation complexe avec les images filmiques. Témoin de la guerre civile, récepteur méfiant des images du conflit, Doherty n’a de cesse de rappeler que la mémoire individuelle du traumatisme est erratique et le statut de victime problématique. La déconstruction du récit, l’instabilité de la focalisation, ainsi que l’écart, voire l’incompatibilité, entre l’image et le texte qui l’accompagne aboutissent à une réflexion sur les dissensions historiques. La voix off devient alors un facteur d’incertitude.In his video works, all tightly focused on the Northern-Irish conflict, Willie Doherty probes the perpetrator-victim dyad and denounces the truncated visual representation of the conflict by deconstructing the relation between image and sound. The texts uttered by the voice-over raise political issues relevant to post-conflict Ireland, whether it be victimhood, national trauma or the construction of collective memory. Multiple open-ended interwoven narratives accompany images without closing their interpretation.

  8. … en perser och resten flygvärdinnor… : En kvalitativ studie av tågmästarnas upplevelser av företagskultur och yrkesroll i omorganiseringen 2003/2004 vid SJ AB, Stockholm

    OpenAIRE

    Ackelman Thunholm, Josefina; Sobat, Virginia

    2009-01-01

    Denna studie behandlar tågmästarnas upplevelser av företagskultur och yrkesroll i omorganiseringen 2003/2004, vid SJ AB Stockholm. Det empiriska materialet bygger på kvalitativa forskningsintervjuer med sju tågmästare, som arbetade ombord på x2000 under omorganiseringen.I analys av empirin har vi kunnat se indikatorer på att företagskulturen påverkar tågmästarnas upplevelser av omorganisering. Utifrån deras syn på den aktuella omorganiseringen, tolkar vi det som att förändringar som inte över...

  9. INFLUIENŢA TRATĂRII TERMICE ÎN AZOT SAU ÎN VID ASUPRA PROPRIETĂŢILOR STRATURILOR DE GaN CRESCUTE PE Si(111 PRIN METODA HVPE

    Directory of Open Access Journals (Sweden)

    Vasile BOTNARIUC

    2015-12-01

    Full Text Available A fost studiată influenţa tratării termice la temperaturi ridicate în azot sau în vid asupra proprietăţilor stra­turilor de GaN depuse pe siliciu prin metoda reacţiilor chimice de transport în sistemul (H2-NH3-HCl-Ga-Al, (HVPE. În spec­trele de fotoluminescenţă (FL, la 300 K, ale straturilor netratate se evidenţiază două fâşii de recombinare radiantă, cu maximele la 370 şi 555 nm. La tratarea în azot intensitatea fâşiei 370 nm creşte, iar la tratarea în vid – descreşte. Inten­sitatea benzii galbene (555 nm, la tratare în ambele medii, scade neesenţial. Se demonstrează că parametrii electrici ai straturilor pot fi, de asemenea, modificaţi prin metoda tratării termice în azot sau în vid, precum şi prin durata de tratare. The influence of high temperature annealing in nitrogen or vacuum on properties of GaN layers deposited on Si(111 by HVPE mehodThe influence of high temperature annealing in nitrogen and vacuum of GaN layers deposited by chemical reactions transport (HVPE in (H2-NH3-HCl-Ga-Al system on their properties was studied. In the photo­luminescence (PL spectra at 300 K of the untreated layers two recombination radiation bands with the plats at 370 nm and 555 nm were revealed. At the layers heat treatment the intensity of the radiation band at 370 nm increases when at the intensity of the yellow band (555 nm decreases not significantly at the treatment in the both ambiances. It was shown that the electrical parameters could as well be controlled by using heat treatment in nitrogen and vacuum and this depends on the annealing duration. 

  10. Relación entre las características físico-químicas del suelo y las densidades de población de nematodos fitoparásitos en vid

    OpenAIRE

    González Royo, Elena

    2007-01-01

    Los objetivos del trabajo fueron i) comparar la eficiencia de extracción de nematodos del suelo de los métodos: tamizado diferencial-centrifugación flotación, bandejas de Baermann y Flegg modificado; y ii) determinar la relación entre las características físico-químicas del suelo y la densidad de población de nematodos fitoparásitos en vid. La eficiencia de extracción de los nematodos del género Xiphinema mediante el método TD-CF fue superior al de las BB y no difirió del métod...

  11. Embriogénesis somática en la vid : control de la maduración de los embriones somáticos y generación de nueva variabilidad in vitro

    OpenAIRE

    Acanda Artiga, Yosvanis

    2015-01-01

    En esta tesis se establece un protocolo eficiente de regeneración de plantas mediante embriogénesis somática a partir de filamentos de estambres de vid (cv. Mencía) empleando TDZ y 2,4-D como inductores de la respuesta embriogénica. Se estudió el efecto del tamaño de inóculo en la maduración y la germinación precoz de los embriones somáticos, y se encontró que es posible controlar ambos a partir de la manipulación del tamaño de los inóculo en el medio de maduración. El análisis de los niveles...

  12. Hvis Blended Learning er svaret, hvad er så spørgsmålet - et læringsperspektiv på FlexVid i regi af UCN

    DEFF Research Database (Denmark)

    Dau, Susanne

    2012-01-01

    in the process prepared as blended learning. The importance of clarity in training organization unfolded and explained with existing knowledge in the field. The article also puts perspective on progression during training and development of students' knowledge development skills. It points to other forms......This chapter intends to develop some questions to the base of education and learning activities in FlexVid to expand reflection basis. The article focuses on the framework and basic assumptions that may affect the training organization and thereby the didactic opportunities and challenges...... of articulation of adult pedagogick using the concepts of andragogic, paragogogic and herutagogic, as these terms appear "in line" with the learning intentions behind flexible education....

  13. Ensembleundervisning på lika villkor : En studie om fyra ensemblepedagogers syn på genuspedagogiska förhållningssätt och handlingar vid ensembleundervisning på gymnasiet

    OpenAIRE

    Hurtig, Ella

    2013-01-01

    Syftet med föreliggande studie är att undersöka relationen mellan styrdokumen­tens föreskrifter gällande jämställdhet och lärares hantering av detta i ensemble­undervisning inom jazz och populärmusik på gymnasiet. Jag har valt att analysera ensemblepedagogernas förhållningssätt och handlingar vid ensembleundervisning utifrån ett genusperspektiv. Denna studie tar avstamp i synen på genus som en social konstruktion, där genusmönster genereras i möten mellan människor, genom ständig upprepning a...

  14. La producción vinícola en el mundo fenicio-púnico: apuntes sobre cultivo de la vid y consumo del vino a través de las fuentes arqueológicas y literarias

    OpenAIRE

    Prados Martínez, Fernando

    2011-01-01

    En este artículo se pretende realizar un estado de la cuestión sobre el conocimiento del cultivo de la vid en el mundo de Cartago y sobre la producción y exportación de vino a través de las fuentes arqueológicas y literarias. Para ello, nos apoyaremos en las referencias extraídas de diversos textos clásicos púnico-romanos (Magón, Virgilio o Columela) y en datos obtenidos a partir de la realización de excavaciones arqueológicas tanto en Cartago como en su entorno próximo. Además, para compleme...

  15. Relationship between Root Growth of 'Thompson Seedless' Grapevines and Soil Temperature Relación entre el Crecimiento Radical de Vid 'Thompson Seedless' y la Temperatura del Suelo

    Directory of Open Access Journals (Sweden)

    Rodrigo Callejas R

    2009-12-01

    Full Text Available With the purpose of characterizing the growth of the root system of table grapes (Vitis vinifera L. cv. Thompson Seedless and its relationship with soil temperature, research was carried out during the 2004-2005 growing season in vineyards in the Copiapó and Huasco Valleys. Four plants were chosen and rhizotrons were used to measure the growth of the root system. Measurements were performed once a week from September 2004 to September 2005, estimating the intensity of root growth and its annual distribution in the ranges of 0 to 40, 40 to 80 and 80 to 120 cm of soil depth. Temperature sensors were installed in four plants at 25, 50, 75 and 100 cm of soil depth, and the temperature was registered every 1 h. The thermal diffusivity of the soil was calculated based on the annual mean temperature and annual thermal amplitude values. Root growth occurred throughout the year, presenting lower intensity in July (winter. Root systems presented different patterns in the distribution of growth intensity in the three soil depths, with variations in the order of five times in maximum annual growth intensity among sites. High thermal diffusivity in soils favored root growth.Con el objetivo de caracterizar el crecimiento del sistema radical de la vid (Vitis vinifera L. cv. Thompson Seedless y su relación con la temperatura del suelo, durante la temporada 2004-2005 se llevó a cabo un estudio en parronales ubicados en los valles de Copiapó y Huasco. Se instalaron cuatro cámaras de observación de raíces o rizotrones en plantas homogéneas, en plena producción, pie franco, sanas, y ubicadas en diferentes localidades de la región. Las mediciones del crecimiento de las raíces se efectuaron semanalmente, desde septiembre de 2004 hasta completar 1 año, estimándose la intensidad de crecimiento radical anual y su distribución en los rangos de 0 a 40, 40 a 80 y 80 a 120 cm de profundidad. Adicionalmente, se instalaron sensores de temperatura a 25, 50, 75 y

  16. Tillbyggnad vid Nationalmuseum : Parametrisk studie

    OpenAIRE

    Ericson, Noa

    2013-01-01

    Tillbyggnad Nationalmuseum Kontext och form Jag ville förhålla mig fritt i utformningen av en tillbyggnad till Nationalmuseum. Muséet är pampigt och behöver kontraster snarare än likhet. Platsen utmärker sig dels i att den är nästan plan och att den är kraftigt skuggad av NM och Lydmar hotell under framförallt vintermånaderna. Tomten har även stora träd som stäcker sig över NM och ger platsen uttryck. Så jag ville arbeta vidare parametriskt med dessa platsbundna element.  Det första steget va...

  17. Economia funerària a la segona edat del ferro de les illes Balears. L’ús diacrític del sacrifici de bòvids en el santuari i les necròpolis de l’àrea de Son Real (Mallorca

    Directory of Open Access Journals (Sweden)

    Jordi Hernández-Gasch

    2011-10-01

    Full Text Available L’aparició d’un objecte excepcional fet d’os de bòvid anomenat tap en emplaçaments rituals de la segona edat del ferro va permetre fa uns anys postular una hipòtesi anomenada d’”economia funerària”. Les dades procedents d’assentaments suggereixen que la cabana ramadera va canviar en la seva composició, disminuint la quantitat de bòvids en favor dels ovicàprids. El perfil de sacrifici també va canviar orientant l’ús d’aquests animals domèstics cap a l’obtenció de productes secundaris i la força de treball. Les recents troballes de la necròpolis de Son Real i del Santuari de la Punta des Patró a Mallorca apunten vers un ritual de comensalitat, on presumiblement els sectors més rics de la societat haurien consumit carn de bòvid en els rituals funeraris o l’haurien emprada com a ofrena, en contraposició als grups menys rics que només haurien tingut accés a la carn de suid o ovicàprid.

  18. Onderscheid moet er zijn : pleziervaren in Nederland, een cultuurgeschiedenis

    NARCIS (Netherlands)

    Beulakker, Eerde Hendrik Geert Taeke Maria

    2012-01-01

    Two questions set the course for my research into the Dutch pleasure boating. 1. How could an elite pastime like water sport develop into mass recreation? 2. How do the economical, cultural and nautical elite with their historical claim to "good taste", manage to make themselves distinguishable

  19. De komende diabetesvloedgolf: Nederland moet zijn voorsprong goed benutten

    NARCIS (Netherlands)

    ter Riet, Gerben

    2009-01-01

    Some authors claimed that if current trends prevail, 1.32 million people will have been diagnosed with diabetes mellitus in the Netherlands by 2025. In this commentary, the author sheds doubt on some of the underlying assumptions. First, the author argues that advanced age in itself cannot be an

  20. Moet teologiese opleiding kerklik-konfessioneel wees? | Deist | HTS ...

    African Journals Online (AJOL)

    Should theological education be ecclesiastical and confessional? This article seeks to evaluate the involvement of the church in theological education at universities, and proceeeds from a cosmological rather than a pragmatic perspective. From a cosmological perspective, no university can claim to study universalia while ...

  1. Die inkortingsneller moet en die woordeboek | Prinsloo | Lexikos

    African Journals Online (AJOL)

    Die AfrikaanSe hulpwerkwoord mod kan binne sekere kontekste as inkortingsneller ten opsigte van 'n saamgestelde hoofwerkwoord 'optree, waardeur laasgenoemde ingekort word sander dat die semantiese inhoud van die sin verander ('n voorwaarde, trouens, van alle inkorting). Die omstandighede waaronder dit ...

  2. Heel Nederland moet bloeden voor deelbelang TNT-postbezorgers

    NARCIS (Netherlands)

    Baarsma, B.

    2011-01-01

    Het kabinet wil dat voor aanstaande vrijdag vaste arbeidscontracten in de postbezorging zijn geregeld. Daarmee helpt het kabinet de concurrenten van TNT om zeep, stelt Barbara Baarsma. Het beleid is enorm kortzichtig, want zonder concurrentie wordt de TNT weer monopolist, maar dan een private. Daar

  3. Slow Food moet niet anti-technologisch worden

    NARCIS (Netherlands)

    Boekel, van M.A.J.S.

    2011-01-01

    Veel gemaksvoedsel in de supermarkt staat op gespannen voet met de beginselen van 'lekker, puur en eerlijk'. Maar, zegt hoogleraar voedseltechnologie Tiny van Boekel, dat neemt niet weg dat de voedselindustrie een revolutionaire bijdrage heeft geleverd aan de beschikbaarheid van voldoende,

  4. Remiksēšanas kultūra virtuālajā vidē: mēmu lietošanas un veidošanas vietņu analīze

    OpenAIRE

    Vilsone, Paula

    2013-01-01

    Bakalaura darba “Remiksēšanas kultūra virtuālajā vidē: mēmu lietošanas un veidošanas vietņu analīze” mērķis ir izpētīt interneta mēmu lietotāju un veidotāju mēmu patērēšanas paradumus. Darbam izvirzīts pētnieciskais jautājums, vai latviešu mēmu lietotājiem un veidotājiem ir interneta vietne, kura lokālā līmenī spējīga konkurēt ar populārām pasaules mēroga mēmu lietošanas un veidošanas vietnēm? Kā arī apakšjautājumi – ja ir, tad kas to padara konkurētspējīgu; ja nav, tad kāpēc un vai tāda viet...

  5. Bostadsförsäljning före ordinarie visning : Hur påverkas slutpriset vid försäljning före ordinarie visning?

    OpenAIRE

    Zettergren, Herman; Broms, Martin

    2017-01-01

    Studien gick ut på att undersöka hur slutpriset på en bostadsrättslägenhet av storleken en- och tvårummare i Stockholms innerstad påverkas av försäljning före ordinarie visning. Vidare ville vi ta del av hur köpare, säljare och fastighetsmäklare tänker vid försäljning före öppen visning.  För att få svar på våra frågeställningar, så utfördes såväl en kvantitativ undersökning, samt en kvalitativ. Den kvantitativa undersökningen utfördes genom att vi jämförde slutpriser på bostadsrättslägenhete...

  6. Producción de ácido indol-3-acético por Pseudomonas veronii R4 y formación de raíces en hojas de vid “Thompson seedless” in vitro

    Directory of Open Access Journals (Sweden)

    María F. Peñafiel-Jaramillo

    2016-06-01

    Full Text Available Rizobacterias con actividad antagonista son empleadas a problemas patológicos y promueven el desarrollo de tejido radicular de especies vegetales El objetivo del estudio fue evaluar la capacidad en síntesis de ácido indol-3-acetico (AIA y la formación de raíces en hojas de vid “Thompson Seedless”, por el empleo de Pseudomonas veronii R4 in vitro. La bacteria, fue incubada en medio mínimo M9 y se verificó la producción de AIA a 24, 48 y 72 h de muestreo, los sobrenadantes fueron analizandos por HPLC. Peciolos de hojas de “Thompson Seedless” fueron sumergidos por 5 min, en el tampón PBS con P. veronii R4 a (1.5 x 109 células mL-1, y evaluados a los 32 días post-inoculación. Los tratamientos fueron sujetos al análisis de varianza por DCA. Los sobrenadantes muestreados a 72 h, del cultivo de líquido con P. veronii R4, se obtuvo los mayores niveles de AIA entre 0.0231 a 0.0245 mM, al emplear 5 a 10 mM del precursor L-triptofano, del sobrenadante obtenido de P. fluorescens CHA0 la producción de AIA con 0.0174 mM a 10 mM de L-triptofano. Se obtuvo la regeneración del sistema radicular en los peciolos de hojas de “Thompson Seedless”, con un promedio de 14 raíces/planta bajo la aplicación de P. veronii R4. Estos resultados preliminares realzan la importancia de la cepa nativa P. veronii R4, que se estaría proyectando para futuras investigaciones de su empleo en condición de invernadero al desarrollo del sistema radicular en “Thompson Seedless”.

  7. Producción de ácido indol-3-acético por Pseudomonas veronii R4 y formación de raíces en hojas de vid “Thompson seedless” in vitro

    Directory of Open Access Journals (Sweden)

    Maria Peñafiel Jaramillo

    2016-07-01

    Full Text Available Rizobacterias con actividad antagonista son empleadas a problemas patológicos y promueven el desarrollo de tejido radicular de especies vegetales El objetivo del estudio fue evaluar la capacidad en síntesis de ácido indol-3-acetico (AIA y la formación de raíces en hojas de vid “Thompson Seedless”, por el empleo de Pseudomonas veronii R4 in vitro. La bacteria, fue incubada en medio mínimo M9 y se verificó la producción de AIA a 24, 48 y 72 h de muestreo, los sobrenadantes fueron analizandos por HPLC. Peciolos de hojas de “Thompson Seedless” fueron sumergidos por 5 min, en el tampón PBS con P. veronii R4 a (1.5 x 109 células mL-1, y evaluados a los 32 días post-inoculación. Los tratamientos fueron sujetos al análisis de varianza por DCA. Los sobrenadantes muestreados a 72 h, del cultivo de líquido con P. veronii R4, se obtuvo los mayores niveles de AIA entre 0.0231 a 0.0245 mM, al emplear 5 a 10 mM del precursor L-triptofano, del sobrenadante obtenido de P. fluorescens CHA0 la producción de AIA con 0.0174 mM a 10 mM de L-triptofano. Se obtuvo la regeneración del sistema radicular en los peciolos de hojas de “Thompson Seedless”, con un promedio de 14 raíces/planta bajo la aplicación de P. veronii R4. Estos resultados preliminares realzan la importancia de la cepa nativa P. veronii R4, que se estaría proyectando para futuras investigaciones de su empleo en condición de invernadero al desarrollo del sistema radicular en “Thompson Seedless”.

  8. Etat de santé des habitats et peuplements de poissons des îles et récifs de l’Astrolabe, Pétrie et Walpole, Parc Naturel de la Mer de Corail. Evaluation initiale par stations vidéo rotatives STAVIRO

    OpenAIRE

    Schohn, Thomas; Bockel, Thomas; Carpentier, Liliane; Pelletier, Dominique

    2017-01-01

    - Le projet AMBIO a conduit des évaluations des peuplements de poissons et habitats associés aux récifs coralliens sur l’ensemble  des lagons de Nouvelle-Calédonie, en s’appuyant sur la technique de vidéo rotative STAVIRO. - Cette campagne a été réalisée en 2014 sur les iles et récifs éloignés d’Astrolabe, Pétrie et Walpole, situés dans le périmètre du Parc Naturel de la Mer de Corail. Le plan d'échantillonnage couvre toute la zone avec une stratification en fonction des structures récifa...

  9. Device at valves. Anordning vid ventiler

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, M.; Hedlund, P.O.

    1990-07-02

    The invention is intended to be utilized in pipes and at valves where there are risks for accumulation of oxyhydrogen gas. In or at the pipe/valve is located a body of recombining material such as platinum or other platinum metals or its alloys in order to recombine oxyhydrogen gas. (L.F.).

  10. Potassium and Phosphorus in Muscat Rosada Grape Yield in Elqui Valley Soil Fósforo y Potasio en la Producción de Vid Moscatel Rosada, en Suelo del Valle de Elqui

    Directory of Open Access Journals (Sweden)

    Carlos Sierra B

    2008-09-01

    Full Text Available The effects of P and K on grapevines (Vitis vinifera L. var. Muscat Rosada were evaluated four years, considering the same levels of N. The experiment was conducted at the Vicuña Experimental Station (30° S; 70°44´ W of the Instituto de Investigaciones Agropecuarias (INIA. The soil is alluvial antropic miscellaneous (Entisols. Three fertilization treatments were established: 1 N 160 + P2O5 200 + K2O 300; 2 N 160 + P2O5 0 + K2O 300; and 3 N 160 + P2O5 200 + K2O 0. At the beginning of the experiment, grape vines received all the phosphate fertilizers, 200 kg ha-1 of P2O5 as triple superphosphate in Treatments 1 and 3. Nitrogen was applied as urea for four years. The applications were initiated when the vine buds measured 20 cm. The K was applied to the soils of Treatments 1 and 2, at a dosage of 200 kg ha-1 K2O, using potassium sulphate. Between berry set and 30 d before harvest, 100 kg ha-1 K2O were applied as potassium sulphate by fertigation. Significant effects of the P fertilization were observed by the second year, with increased cluster numbers per plant. K also increased grape fruit yield by the third year. This response was obtained with less than 5 mg kg-1 of P available in the soil and less than 145 mg kg-1 of exchangeable K in the soil. The initially low content of available K and P suggests a high probability of response to the application of both elements.En el Campo Experimental del Instituto de Investigaciones Agropecuarias (INIA, ubicado en la localidad de Vicuña (30° S; 70°44´ O, se evaluó durante cuatro años el efecto de la aplicación de P y K, considerando un mismo nivel de aplicación de N en vid (Vitis vinifera L. var. Moscatel Rosada. El suelo corresponde al tipo misceláneo antrópico coluvial (Entisols. Se establecieron tres tratamientos de fertilización: 1 N 160 + P2O5 200 + K2O 300; 2 N 160 + P2O5 0 + K2O 300; y 3 N 160 + P2O5 200 + K(20 0. El parrón recibió toda la fertilización fosfatada aplicada al

  11. Cut to the Chase: Editing Time and Space through Closed-Circuit Television Surveillance La fin des courses poursuites pour les policiers britanniques ? Le rôle de la vidéosurveillance dans le changement des représentations spatio-temporelles dans les courses poursuites

    Directory of Open Access Journals (Sweden)

    Daniel Neyland

    2011-10-01

    Full Text Available The UK is said to have the largest number of CCTV cameras of any European nation. These cameras have been involved in a variety of changes in UK police practices. Such changes range from new evidential practices in court cases, through access to new materials, to new questions posed regarding invasions of privacy. One unexplored area of police practices, which this paper will argue have undergone significant changes since the introduction of CCTV cameras, is police accountability. This paper will draw on recent controversies in the UK regarding police car chases to investigate the ways in which CCTV cameras have led to new and complex questions of police accountability.Le Royaume-Uni est souvent présenté comme le pays ayant le plus grand nombre de caméras en Europe. Ces caméras ont joué un rôle dans bien des changements intervenus au sein des pratiques de la police britannique, depuis la production de nouveaux types de preuves devant les tribunaux, en passant par l’accès à de nouveaux matériaux et à de nouvelles informations, jusqu’à la mise en lumière de nouvelles questions touchant aux violations de la vie privée. Un des aspects peu explorés parmi ces nouvelles pratiques policières concerne la question de la responsabilité et le fait, pour la police, de rendre des comptes. Cet article porte précisément sur les changements significatifs provoqués par l’introduction de caméras de vidéosurveillance dans la façon d’accomplir les activités policières. À partir du cas de controverses récentes au Royaume-Uni autour de courses poursuites dans lesquelles sont engagés des véhicules de police, il s’intéressera aux façons dont la présence et l’usage de caméras de vidéosurveillance ont amené des questions à la fois nouvelles et complexes, concernant la justification des actions de police.

  12. Optimización de los medios de propagación y enraizamiento in vitro de las variedades “criollas” de vid para elaborar pisco Optimization of media for in vitro propagation and rooting of creole grapevine varieties utilized for pisco making

    Directory of Open Access Journals (Sweden)

    Eugenio González

    2012-02-01

    Full Text Available Los protocolos y medios disponibles para la propagación y enraizamiento in vitro de la vid no han sido ajustados todavía a las variedades “criollas” con las que se elabora el pisco. En este trabajo se exploró el uso de medios para la propagación de las variedades Quebranta, Negra Criolla, Albilla, Italia y Torontel, así como para el enraizamiento de las variedades Quebranta, Albilla y Torontel, a partir de los medios estándares reportados en la literatura científica. Para ello, se pusieron a prueba 11 variantes del medio estándar de propagación de vid (medio Murashige y Skoog 1X, 3% de sucrosa, 1 mg/L de benzilaminopurina y 0,8% de agar en las que se combinaron reducciones en la fuerza del medio con reducciones en la concentración de hormona. Para el enraizamiento posterior, se probaron el ácido naftalen acético y el ácido indol acético a 5 concentraciones distintas por cada hormona. Los resultados mostraron que el mejor medio para la propagación de las variedades Quebranta, Albilla e Italia es el estándar; las variedades Negra Criolla y Torontel tuvieron mejor desempeño con una reducción de la concentración de benzilaminopurina a 0,25 y 0,5 mg/L, respectivamente. El mejor enraizamiento en la variedad Quebranta ocurrió con 80 μg/L de ácido naftalen acético y 2 mg/L de ácido indol acético; las variedades Albilla y Torontel tuvieron una mejor respuesta al ácido indol acético a concentraciones de 2 y 1 mg/L, respectivamente.The protocols and culture media available for in vitro propagation and rooting of grapevine have not yet been adjusted to the creole varieties used for pisco making. In this paper we explored the use of culture media for the propagation of varieties Quebranta, Negra Criolla, Albilla, Italia and Torontel and for rooting varieties of Quebranta, Albilla and Torontel based on known standard culture media.To address this issue, 11 media derived from the standard propagation medium for grapevine (1X

  13. The Effect of Brand Image on Consumer Behaviour: Case Study of Louiss Vuitton-Moet Hennessy

    OpenAIRE

    TEKİN, Gökhan; YILTAY, Sercan; AYAZ, Esra

    2016-01-01

    Consumers are influenced by many psychological, social and personal factors that influence their perception of a brand. Brand is a powerful tool to attract more consumers to buy particular products and, has become important in the luxury market. A very important factor that influences consumer’s perceptions of a brand is strong brand image. The main purpose of this article is to study and analyze the role of brand image on consumer behaviour. This study examines how brand image affects consu...

  14. 'As ek dáárdie nektar wil eet, dan moet ek steke verdra ...

    African Journals Online (AJOL)

    Even as the article exposes common homophobic stereotypes, it emerges that the lesbian characters' experiences are complex and multi-faceted. The exposure to stereotypes results in a profound sense of alienation, which the characters attempt to overcome by undertaking journeys. As they struggle to deal with pain and ...

  15. Moetööstuse uus hitt - eesti kalanahk / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2007-01-01

    Firma "Skinnova" avab Pärnus parkimistöökoja, kus kalanahkadest hakatakse valmistama väärisnahka moe- ja jalatsitööstusele. Kommenteerib Marina Kaas. Mervi Lill räägib kalanaha kasutamisest käekottide, vööde ja kingade valmistamisel

  16. Hendrik-Jan de tuinman moet eruit! : mobbing, een zaak van het hele bedrijf?

    NARCIS (Netherlands)

    Kooijman, H.; Nossent, S.; Hark, T. ter

    2005-01-01

    Wat begint als een geintje met een persoon ontaardt in pesten, intimideren of 'mobbing' door een groep collega's. Hoe voorkom je dat het zover komt? In dit artikel geven deskundigen hier, naar aanleiding van een rollenspel, hun mening over. Als belangrijkste tips komen naar voren: snel ingrijpen,

  17. dankbaar gebruik moet maak. SU ZuiDEMA, Ons ^ye&ecf, T. Wever ...

    African Journals Online (AJOL)

    Test

    Die skrywer behandel nie, soos baie ander gedoen het, die gebed in die algemeen nie, maar die gebed soos dit 'n kenmerkende trek van die Reformatorische Christen behoort te wees. Besonder goed is dit dat hy die gebed, en ook ons gebed, nie van die res van die geloofslewe isoleer nie, maar telkens wys op die relasie.

  18. Eestlased teevad igavast Laumast moetööstuse tipptegijat / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2005-01-01

    Eesti investeerimisfirma Alta Capital omandas 2004. aasta kevadel enamuse Läti kanga- ja pesutootja AS-i Lauma aktsiatest. Ettevõtte arengust ja tulevikuplaanidest. Lisa: Pesumood muutub erootilisemaks. Diagrammid: Lauma

  19. 'n Lied moet klink om gehoor te word ... : Faktore wat die resepsie ...

    African Journals Online (AJOL)

    17 Apr 2013 ... belemmer of kan iemand negatief teenoor 'n lied reageer. Dit beteken dus dat die 'objektiewe' kriteria wat deur kommissies gestel word, sowel as die lied self, relatiewe waarde het – relatief tot wie dit sing en relatief tot die konteks waarbinne gesing word. Page 1 of 8. Scan this QR code with your smart ...

  20. Preventie van congenitale syfilis ; een inventariserend onderzoek naar de vraag of de screening moet worden voortgezet

    NARCIS (Netherlands)

    Gruteke P; Postma MJ; Jager JC; Loeber JG; van de Laar MJW; Conyn-van Spaendonck MAE

    1991-01-01

    This study summarizes clinical, laboratory and epidemiological aspects of syphilis and congenital syphilis. An outline is given of an economic evaluation of the programme for the prevention of congenital syphilis. figures available in the Netherlands were used in a previousluy published model for

  1. Die paradigmaskuif wat 'n tradisionele AGS pastor moet ondergaan vir effektiewe gemeentemobilisasie.

    OpenAIRE

    2008-01-01

    The purpose of this study is to suggest a paradigm shift that will enable the traditional pastor to effectively mobilize his congregation. An in depth look at the early history of the pastor of the Carletonville-AFM congregation and his idea of the ministry was undertaken. Due to certain frustrations he experienced trying to do everything himself, the Body of Christ model was proposed for the congregation whereby every member of the congregation has a function in fulfulling the Great Commisio...

  2. Moet glyfosfaat van de straat? : onkruidbeheer 2.0... hoe nu verder?

    NARCIS (Netherlands)

    Dijk, van C.J.

    2012-01-01

    Al enige tijd houdt de motie Grashoff, die de regering oproept ‘een verbod in te stellen voor gebruik van gewasbeschermingsmiddelen met glyfosaat voor niet-commerciële doeleinden’, de gemoederen bezig. In de discussie die daarop is ontstaan in aanloop naar het Nationaal Actieplan worden vergaande

  3. Wat elke leraar moet weten: De wetenschap van het leren in handboeken in de lerarenopleiding

    NARCIS (Netherlands)

    Surma, Tim; Vanhoyweghen, Kristel

    2018-01-01

    This presentation was held for the pedagogical assistance department in Flanders. It highlights the importance of a basic understanding of foundational principles in cognitive science for future teachers.

  4. 'As ek dáárdie nektar wil eet, dan moet ek steke verdra': Stereo ...

    African Journals Online (AJOL)

    Trouens sy is so verlief op die aanvallige jong man, Phaon, dat sy selfmoord pleeg wanneer hy haar verwerp ... dings teenoor gay mans en lesbiërs, vind Simon (63) ook dat lesbiërs dikwels beskou word as vroue wat nog net nie die ..... D. Atkins, D. Looking Queer: Body Image and Identity in Lesbian,. Bisexual, Gay, and ...

  5. Materials in flue gas condensation plants; Materialval vid roekgaskondensering

    Energy Technology Data Exchange (ETDEWEB)

    Goldschmidt, Barbara; Nordling Magnus

    2003-02-01

    This project is the first part of a larger project. In the part reported here, materials for flue gas condensers have been investigated by contact with plant owners and suppliers and by a literature review of reported failures. If it is decided to continue with another part of the project, a number of materials will be long term tested on site. The project is complementary to an earlier project, which investigated the operating experiences from flue gas condensers in biomass fired cogeneration plants. In the project materials (steel and polymeric) suitable for long term testing in existing plants are discussed. It is proposed that testing in the second part of the project is made with material coupons in one plant fired with only biomass and one plant where biomass is co fired with other fuels. In the biomass fired plant a number of steel materials should be tested. In the co fired plant, with its harsher operating conditions, the same steel materials plus a number of polymeric materials should be tested. Materials suitable for testing are summarised in the report.

  6. Flue gas condensation cleaning technology; Reningsteknik vid roekgaskondensering

    Energy Technology Data Exchange (ETDEWEB)

    Westermark, M. [Vattenfall Utveckling AB, Stockholm (Sweden)

    1996-08-01

    Flue gas condensation has become established as an economical and environmentally attractive method for heat recovery and flue gas cleaning. Effective capture is wanted for dust and flue gas components. This also leads to more advanced treatment of the condensate. Important aspects for present plants are removal of heavy metals, sulfur oxides and ammonia. Future areas are condensation in biofuel driers, small-scale oil- and natural gas boilers and boilers using Salix. High concentrations of heavy metals are reported in refuse boilers, where sulphide precipitation and filtration are used to minimize outlet concentrations in the condensate. For simple dust cleaning (multicyclones) filtration of condensate is normally demanded. The pH value should be increased (to {approx} 7,5-9) for precipitation of heavy metals; zinc and cadmium being the most relevant from environmental point of view. Salix contains considerably higher amounts of cadmium, and may need sulphide precipitation. Addition of sodium hydroxide to the condensate film gives 90-95% absorption of sulfur dioxide. The pH value 6-6,5 is optimal for good removal of sulfur compounds and ammonias, and minimizes carbon dioxide absorption. For avoiding corrosion on concrete pipes the outlet condensate has to be neutralized. Ammonia is formed during combustion of fuels containing nitrogen and can be found in flue gases from e.g. biofuels. For SNCR extra ammonia is added. The main part ({approx} 60-95%) of the ammonia in flue gas is absorbed as ammonia ions in the condensate. Normal ammonium concentration in condensate is about 30-50 g/m{sup 3} without SNCR and 50-150 g/m{sup 3} with SNCR. Removal of ammonia from condensates can become necessary and methods are under development for stripping of ammonia with air or steam. 27 refs, 5 figs, 3 tabs, 14 appendices

  7. Weed control in energy forest production. Ograesbekaempning vid energiskogsodling

    Energy Technology Data Exchange (ETDEWEB)

    Danfors, B.

    1985-01-01

    The aim of the work was to collect, analyse and present experiences from mechanical and chemical weed control. The drainage status of the soil have to be good if mechanical control shall be used. Chemical weed control with soil-active herbicides requires less herbicide on mineral soils than on organic soils. Weed control must be started the year before planting the cuttings. The energy forestry plantation should be planted with the greatest possible precision to enable weed control between the rows. If weed control is neglected the energy forestry plantation will be unsuccessful. In all such plantations an intensive supervision of the weeds is required for the 2 first years. When the plantation has become established, the weed will have difficulties in competing with the energy plants. Seed-propagated weeds can be controlled if the entire area is sprayed with a soil-active herbicide immediately after the planting of the cuttings. Soils with different organic contents require different doses of herbicide. At present, research is being concentrated on preparing recommendations on doses for different soils. If the spraying with soil-active herbicides is unsuccessful there must be alternative forms of weed control. Weed control in growing stands protect the plants. After harvest the competitive conditions change radically for the weeds. There may now be justification in applying an early spraying before new shoots have developed. Granulated soil-active herbicides may be an alternative. Under favourable conditions the energy plantations is capable of growing faster than the weeds without the help of herbicides or mechanical weed control. Recommendations for the use of herbicides have been prepared for different situations. (BoK).

  8. Occupational health hazards in power production and transmission. Haelsorisker i arbete vid elproduktion och eldistribution; 11. Haelsotillstaandet vid treaarsuppfoeljningen

    Energy Technology Data Exchange (ETDEWEB)

    Toernqvist, S.; Hoegstroem, R.M.; Gamberale, F.; Knave, B.

    1992-01-01

    In a prospective study of health hazards in work with production and distribution of electricity a young cohort of 529 electrical workers has been health examined after three years of work in the electric power industry. Prevalence of symptoms and discomfort and results from clinical tests have been compared to base line data previously collected by means of different questionnaires and clinical tests at the time of employment. The follow-up period reported here is three years, i.e. the second health examination in this prospective study. A tendency towards increased neurastenic symptoms and musculoskeletal complains was noted over the three years, mostly in the age group 30-39 years. The musculoskeletal complains were considered work related in a higher degree than all other complains. Data from the clinical tests were within the normal variation. As a whole this young cohort was healthy. In future analyses the individual comparisons over time and comparisosn with other occupational groups will be of interest to be able to judge occupational hazards in relation to health of electrical workers in the electrical power industry. Reports on different aspects of health in relation to specific exposures at work will be available in future analyses. (25 refs., 12 tabs., 6 figs.).

  9. Moet die Afrikaanse Kerke skuld bely oor apartheid?: Wat leer ons uit die Duitsers se worsteling met skuld?

    Directory of Open Access Journals (Sweden)

    I. W.C van Wyk

    1997-01-01

    Full Text Available Should Afrikaans churches confess guilt for its share in apartheid? What do we learn from the German discussion? This article asks the question whether the Afrikaans-speaking churches should confess guilt publicly for their support of the apartheid-state. A short summary is given to different opinions in South Africa. The main focus of the article is on the German discussion. From this discussion we learn that people, some in a more horrible way than others, do make themselves guilty in history. For believers it is a matter of course to confess their guilt in a church service. Guilty people, unfortunately, always try to justify themselves and to point to the guilt of others. Some people are always more guilty than others, but people become guilty collectively. To prevent evil, the church has the responsibility of preaching the doctrine of original guilt. This would also enable believers to handle guilt from the perspective of the doctrine of justification.

  10. PPO Glastuinbouw en LEI helpen biologische ketenprojecten op weg: "vernieuwing moet wel uit de biologische hoek komen"

    NARCIS (Netherlands)

    Staalduinen, van Jan; Poot, E.H.; Wertheim-Heck, S.C.O.

    2006-01-01

    Het biologische marktsegment is vanwege de hogere kostprijs van het geteelde product een natuurlijke kraamkamer voor productinnovatie. De zoektocht naar tastbaar onderscheid en aansprekende verkoopconcepten vereist multidisciplinaire samenwerking van teelt- en marktonderzoek. LEI en PPO Glastuinbouw

  11. Cesarean Section: Recovering After Surgery

    Medline Plus

    Full Text Available ... It's been added to your dashboard . '; $("#video-display").html(data); $("title").append(_vidTitle + " | March of Dimes"); $("#main.container > em").append(_vidTitle); $("#vidTitle").html(_vidTitle); $("#vidDesc").html(_vidDesc); $("#vidDuration").html(convert_time(_ ...

  12. Exercise during Pregnancy

    Medline Plus

    Full Text Available ... It's been added to your dashboard . '; $("#video-display").html(data); $("title").append(_vidTitle + " | March of Dimes"); $("#main.container > em").append(_vidTitle); $("#vidTitle").html(_vidTitle); $("#vidDesc").html(_vidDesc); $("#vidDuration").html(convert_time(_ ...

  13. Gestational Hypertension and Preeclampsia

    Medline Plus

    Full Text Available ... It's been added to your dashboard . '; $("#video-display").html(data); $("title").append(_vidTitle + " | March of Dimes"); $("#main.container > em").append(_vidTitle); $("#vidTitle").html(_vidTitle); $("#vidDesc").html(_vidDesc); $("#vidDuration").html(convert_time(_ ...

  14. At Least 39 Weeks

    Medline Plus

    Full Text Available ... It's been added to your dashboard . '; $("#video-display").html(data); $("title").append(_vidTitle + " | March of Dimes"); $("#main.container > em").append(_vidTitle); $("#vidTitle").html(_vidTitle); $("#vidDesc").html(_vidDesc); $("#vidDuration").html(convert_time(_ ...

  15. Cesarean Section: The Operation

    Medline Plus

    Full Text Available ... It's been added to your dashboard . '; $("#video-display").html(data); $("title").append(_vidTitle + " | March of Dimes"); $("#main.container > em").append(_vidTitle); $("#vidTitle").html(_vidTitle); $("#vidDesc").html(_vidDesc); $("#vidDuration").html(convert_time(_ ...

  16. Exercise during Pregnancy

    Medline Plus

    Full Text Available ... id"]; relatedVidsDefer(_videoId).done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order ...

  17. At Least 39 Weeks

    Medline Plus

    Full Text Available ... id"]; relatedVidsDefer(_videoId).done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order ...

  18. Cesarean Section: The Operation

    Medline Plus

    Full Text Available ... id"]; relatedVidsDefer(_videoId).done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order ...

  19. Cesarean Section: Recovering After Surgery

    Medline Plus

    Full Text Available ... id"]; relatedVidsDefer(_videoId).done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order ...

  20. Gestational Hypertension and Preeclampsia

    Medline Plus

    Full Text Available ... id"]; relatedVidsDefer(_videoId).done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order ...

  1. Tyst kunskap och produktdatasystem vid medicinteknisk tillverkning : Pilotstudie av system för produktdatahantering och kartläggning av den tysta kunskapen vid Nationellt respirationscetrum, NRC

    OpenAIRE

    Hedlund, Niclas

    2009-01-01

    This thesis looks at two sides of the same coin: how to support the production and future development at a specialist medical technology department at Danderyd Hospital. The two sides are; a pilot study of a product management system (PDM) and an interview based study on the characteristics of the silent knowledge of the technicians. The department (National respiratory centre, NRC) is facing retirement of several key employees. The technical study shows that the success of an implementation ...

  2. ‘Je moet onder aan de ladder beginnen’: distinctie en hiërarchie binnen de klassieke en hedendaagse muziek

    NARCIS (Netherlands)

    Vermeulen, L.; van den Haak, M.

    2012-01-01

    In this paper we explore the distinctive and hierarchical dynamics of a typical field of avant-garde art: contemporary classical music. Researchers on cultural taste and distinction often ignore this genre due to its small following, whereas literature on avant-garde does not focus on consumers. By

  3. Découpage automatique de la vidéo en plans | Maredj | Revue d ...

    African Journals Online (AJOL)

    Automatic out of video into Plans Temporal segmentation is a necessary first step to indexing digital video for browsing and retrieval. A number of different video temporal segmentation algorithms have been published in the literature. This paper describes an original approach for temporal segmentation algorithm of video ...

  4. Qualité d’expérience et adaptation de services vidéo

    OpenAIRE

    Diallo, Mamadou Tourad

    2015-01-01

    With the network heterogeneity and increasing demand of multimedia services, Quality of Experience (QoE) becomes a crucial determinant of the success or failure of these services. In this thesis, we first propose to analyze the impact of quality metrics on user engagement, in order to understand the effects of video metrics (video startup time, average bitrate, buffering ratio) and content popularity on user engagement. Our results show that video buffering and content popularity are critical...

  5. Lokal forskningspolitik. Institutionell dynamik och organisatorisk omvandling vid Lunds universitet 1980-2005

    OpenAIRE

    Melander, Fredrik

    2006-01-01

    In the wake of an emerging knowledge society, universities around the world have come under severe institutional pressure from changing national research policies, financing organizations´ new strategies and turbulent research dynamics. This study examines how Lund University in Sweden manages these institutional pressures. The study explores how the university leadership ? rector and the governing board ? have (1) articulated the normative foundations of the university, (2) experimented with...

  6. Vidéo magazine no 1 de l'actualité du CERN : octobre 2002

    CERN Multimedia

    Audivideo Service; Photolab

    2002-01-01

    Nouvelles de : ATHENA : des milliers d'anti-atomes froids produits au CERN. (CERN Bulletin 39/2002) CMS ECAL : en construction, le détecteur de CMS utilise des cristaux pour capter les particules après la collision. MICROCOSM : inauguration d'une maquette LHC grandeur réelle. (CERN Bulletin 42/2002) Fete de la Science : 14-20 octobre 2002 dans le Pays de Gex. (CERN Bulletin 42/2002) Diaporama : évènements qui se sont déroulés en septembre-octobre 2002.

  7. District Heating at Power Failures - Final Report; Fjaerrvaerme vid Elavbrott - Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Lauenburg, Patrick; Johansson, Per-Olof

    2008-11-15

    Our society is vulnerable to prolonged power cuts. In cold weather interrupted heating is one of the most serious threats. District heating is available at most locations in Sweden and if heat can be transferred to the connected buildings at a power failure, it is of great importance for securing energy supply. In this work it was found that there are good opportunities for upholding heat supply at a power failure through self-circulation in connected radiator system, which has previously been overlooked. Self Circulation occurs when there is a sufficiently large temperature difference between forward and return line in the radiator system. The control and circulation in radiator systems will fail, but if the district heating water can continue to pass through the heat exchangers of the radiator systems self-circulation can occur. A prerequisite for self-circulation in the individual buildings to work is therefore to district heating network can operate at a power failure. District heating supply must have back to maintain the production and distribution of district heating, which is not always the case. Our studies show that there is every reason to this. Moreover there are customers that have their own reserve aggregates, such as hospitals, which are dependent on the district heating network function. In an extensive power failure, it may be desirable to establish a smaller grid, separate from backbone, using local electricity generation. The establishment of such a network requires there is local production which can start to loose voltage networks and has necessary control equipment for the frequency approach. In Malmoe, it is now possible to establish a such a network with the help of local production units. A prerequisite is that there are consumption of heating. It is not unusual for power plants (which produce both electricity and heat) is dependent on the pipe system for cooling the production of electricity. One can from the results also argue that every district should have cogeneration for a security of supply. The results show that the vast majority of buildings can be self-circulation in a power failure equivalent to 40-80 percent of the warming effect. Hot water systems covered primarily not of this, even if some hot water production can be possible. Self-circulation works better the higher the ambient temperature is. However, most buildings, possibly after some modifications, have at least 50 percent of the warming impact at a very low ambient temperature, which means that you normally do for several days before a possible evacuation becomes necessary. The studies have enabled a number of recommendations have been compiled. The recommendations are designed to increase opportunities for self-circulation of different systems and is addressed to all parties concerned, i.e. from authorities and district heating companies to manufacturers, building owners, operators and residents, and includes both preparatory steps and these actions can be taken when a power failure has been occurred. Finally, we note that there should be a value in the form of the presented results are a selling point for the district and the societal costs of example, reserve units and possible evacuations can be reduced

  8. Effektiviseringspotential inom industrisektorn : Energibesparing vid frekvensstyrning av centrifugalpumpar – en fallstudie

    OpenAIRE

    Blomström, Hanna

    2013-01-01

    The project was performed at Siemens Industry Drive Technologies with the objective to provide actual values for the energy savings potential within Siemens scope of practice. In Sweden the electrical drives stand for about 30 % of the total electricity consumption and about 60 % of the electricity consumption within the industry. During the pre-study phase electrical drives with pump applications were identified as large energy users. Because of this a case study at one of Siemens customers,...

  9. Korrosion vid svetsfogning med hjälp av transient smältfasteknik

    OpenAIRE

    FAT MAN, CHI

    2015-01-01

    In many areas of engineering industries there are necessary to bond steel, where traditional bonding processes such as welding and brazing are neither efficient enough nor possible. Alternative technique is transient liquid phase bonding (TLPB). In this study, carbon steel (IRAM 1010/1040) have been welded using transient liquid phase bonding method with Fe-B amorphous as filling material. The joints were performed by induction heating with argon flux, set pressure and different temperature a...

  10. Environmental impact by toxic compounds from waste treatment; Miljoepaaverkan fraan toxiska aemnen vid hantering av avfall

    Energy Technology Data Exchange (ETDEWEB)

    Loefblad, Gun; Bisaillon, Mattias; Sundberg, Johan (Profu AB (Sweden))

    2010-07-01

    The study deals with emissions of toxic compounds from waste treatment to the environment with the aim of improving the state of knowledge and to find a way of describing the environmental impact from these substances. Toxicity is one of a number of environmental aspects necessary to address in the planning of waste treatment and in the daily waste treatment routines in order to fulfill the environmental objective A Non-Toxic Environment and other environmental requirements. The study includes waste to incineration, composting and anaerobic digestion. A comparison between methods were made for biological household waste. According to our study, the compounds of importance for waste treatment are metals and persistent organic compounds. These tend to bioaccumulate and enrich in food chains. The substances are important for the environmental objective A Non-Toxic Environment. In a first step the compounds chosen in this study may be suggested for describing toxicity from waste treatment: As, Cd, Cu, Hg, Pb, dioxin, PCB, the phthalate DEHP and the brominated flame retardant HBCDD. Other substances may be added to the list in a next step from up-dated and quality-assured characterisation factors or from other requirements or preferences. There is a limited knowledge on toxic compounds in waste flows and in different environmental compartments. More data are available for metals than for organic substances. There is also a limited knowledge on the fate of the compounds during the waste treatment processes. Most information is found for incineration. During composting and anaerobic digestion the metals will mainly be emitted to the environment by use of the compost and the anaerobic digestion residue. Organic substances will to some extent be degraded during the processes. However, there are gaps of knowledge to fill for the further work on estimating toxic emissions. There is mainly a need for more extensive data on toxic compounds in waste and their variations. A test was made to use a weighted index for toxicity - such as used for climate impact, acidification, etc. in system analyses for waste treatment. The result was not useful due to the limited availability of characterisation factors for the chosen substances. In stead, the toxic impact was assessed by other comparisons, from a local and a national perspective. No acute effects on human health and on the environment are expected to occur from waste processes or from the use of compost and anaerobic digestion residue. The conclusion is that emissions of toxic substances from waste treatment will contribute to the present fugitive levels of pollutants in the environment. The toxic impact is proposed to be quantified as the total emission of metals and persistent organic pollutants, without consideration to the way emissions are made; to air, water and soil. Emissions, even though they are small, contribute to present levels of pollution with the risk of further elevated concentrations and further dispersion in nutrient chains. In all environ metal work it is essential to reduce emissions of toxic persistent compounds. Many activities in society contribute to the total levels. Waste treatment is an unavoidable activity in the society. By massive actions to limit the use and to con tol the emissions of toxic compounds, a cleaner waste is expected to be the result. In addition, measures such as more effective source separation and separation of hazardous waste will make a more optimised treatment of different types of waste possible

  11. Ash problem at wood fired fluidized bed plants; Askproblem vid skogsbraensleeldning i fluidbaedd

    Energy Technology Data Exchange (ETDEWEB)

    Hansson, Soeren; Nystroem, Olle; Axby, Fredrik [Sycon Energikonsult AB, Malmoe (Sweden); Andersson, Christer; Kling, Aasa [Vattenfall Utveckling AB, Aelvkarleby (Sweden)

    2001-03-01

    Several ash related problems occurs during conversion from fossil fuels to bio fuels. The most frequent and expensive problem is agglomeration of bed material (in fluidized beds) and fouling on superheating surfaces. The last problem leads to corrosion problem and decreased transfer of heat. This project is the first part of a proposed project focussed on fluidized bed combustion (FB), because FB have become the dominating technology for combustion of biofuels. The project includes this first update of what has been done by different research institutes since 1997 and results of questionnaire on operating problems to owners of fluidized bed plants. A couple of pilot studies and different thermodynamical studies of bed agglomeration with biofuel combustion have been done during the latest years. There are no published reports where the results from agglomeration tests in pilot scale are verified in full scale plants. No project was found which deals with the fouling problem in the cyclone in a circulating fluidized bed. The knowledge of the mechanisms of deposits growth on heat surfaces is incomplete and more research has to be done of what can prevent the deposit growth. Experience from full scale plants shows that the deposits on heat surfaces grows during a period and after that it falls of the heating surface. There is little knowledge of which ash and flue gas conditions that affects these conditions for bio fuel. The operational experience with wood fuels in circulating fluidized beds is that the main problem with bed material is in the inlet and outlet of the cyclone. A total desulfonated of the bed occurs only when there has been other disturbances or because of operator mistakes. There are a number of things which seem to influence on the deposit problems: (1) Boilers with long residence time have less problem than boilers with short residence time. (2) Fuel size. No plant owner have continuos analysis of the fuel size, but combustion with problem have a rather big share of saw dust in their fuel mix. (3) A fuel mix containing 20 % peat or more reduces the deposit problem in the cyclone. (4) It is possible to decrease the deposit problem with an increase of the bed material (sand) consumption. The boilers which have had these deposit problems have been modified to prevent the problems. Many of these changes have been done recently and it is because of that difficult to say if it have had any effect on the problem or the improvement depends on a better fuel mix.

  12. Projet Vidéo-voix en Zambie | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cette approche exige toutefois que les citoyens soient bien informés, alors que le pays fait face à une pauvreté croissante, à une augmentation de la charge de morbidité et à une diminution du taux d'alphabétisme. Ce projet ... In ROSSA's latest bulletin issue, find out how Africa was saved from another Ebola outbreak.

  13. Mikrotik virtuālās laboratorijas ReSeLa vidē

    OpenAIRE

    Lapiņa, Ieva

    2016-01-01

    Strauji attīstoties virtualizācijas un mākoņskaitļošanas tehnoloģijām, tās tiek izmantotas ar vien plašākiem mērķiem. Virtualizācijas izmantošana virtuālo sistēmu veidošanā ir tikai viens no tās daudziem pielietojumiem. Darba mērķis ir, datortīklu apguves mācību procesā izmantojamu, virtuālo laboratoriju izveide uz ReSeLa platformas. Darba gaitā ir iepazīta MikroTik izveidotā maršrutētāju operētājsistēma un apgūta laboratoriju veidošanai izmantotā OpenStack sistēma. Darba laikā tika izveidota...

  14. Materials in flue gas condensation plants. Stage 2; Materialval vid roekgaskondensering. Etapp 2

    Energy Technology Data Exchange (ETDEWEB)

    Nordling, Magnus; Bergman, Gunnar; Baeck, Gustaf; Jacobsson, Karin; Pahverk, Helen; Roemhild, Stefanie

    2004-12-01

    The corrosion resistance of some metallic and polymeric materials has been investigated in the flue gas scrubbers/condensers in the power plants at Igelsta using waste wood and Brista using bio fuel in the boilers. The materials were exposed inside the inlet part of the condenser and inside the flue gas duct after the condenser. In Brista, the polymeric materials were also exposed to the hot flue gases inside the duct before the condenser. The temperature of the gases before and after the condenser in Brista was 140 deg C and 50-60 deg C, respectively. In Igelsta, the flue gas temperature after the condenser was 45 deg C. The metallic coupons in the condenser were located in the spray-zone, both in Igelsta and Brista. That was true also for the polymeric material in Brista. In both plants, the wash-solution had a pH of 7-8, a temperature of 30 deg C, and a low content of chloride. The metallic materials investigated were stainless steels of the following grades: 17-12-2.5, 2205, SAF2507 and 254SMO. The major part of the polymeric materials investigated consisted of FRP laminates, which were made with different combinations of resin type of surface veil and type of chopped strand mat (CSM). Laminates with a new type of vinyl ester resin, Atlac E-Nova FW 1045, a new type of a stress-corrosion-resistant glass-fibre called Arcotex, and two types of surface reinforcement of carbon fibre have been compared to laminates of common type. Laminates with a special reinforcement of the type 3-D fabric were also included as well as five polypropylene materials (PP) with varying degree of stabilisation, two glass-flake materials applied on carbon steel and a butyl rubber. The corrosion resistance of the materials was evaluated after seven a months exposure at the different positions in the plants. The stainless steel materials were evaluated with respect to uniform corrosion, pitting and crevice attack. The corrosion resistance of the polymeric materials was evaluated with different methods and techniques which varied depending on the type of material. The FRP and the glass-flake materials were evaluated using visual inspection, microscopic investigation of polished and dye-stained cross sections, determination of mass loss and thickness changes. The laminates were also subjected to mechanical testing. The PP materials were evaluated by so-called OIT determinations (Oxidation Induction Time) and the rubber material by determination of changes in elongation at break. The results showed that for all steel materials the uniform corrosion was very low in all positions. The corrosion rate was between 0.2 and 0.4 {mu}m/year, which suggests that they would perform well from a uniform corrosion resistance point of view. The only clear difference among the steels was that the weld of SAF2507 showed a higher frequency of pits than that in the weld of the other steels. It however ought to be pointed out that the metallic materials that were exposed in the inlet of the condenser, were not exposed in the probably most aggressive region, the so called wet-dry zone. If so, a difference regarding the degree of corrosion attack on the different materials might would have been the case. The results related to polymeric materials showed among other things that the new glass-fibre type, Arcotex, is not suitable to be used for laminates in the environments studied, because of a too low osmosis resistance which gave rise to damage in the form of microdelaminations and blistering. The new resin Atlac E-Nova FW 1045 showed a markedly less corrosion resistance to hot flue gases compared to the conventional ones based on Atlac 590 and Derakane 470. Compared to surface veil reinforcement made of glass and carbon fibre, the use of a woven fabric of carbon fibre in the surface layer seemed to generally improve the resistance of the laminate to the studied environments with respect to the retention of the mechanical properties. The glass-flake materials showed good corrosion resistance in all positions. The PP-materials showed good resistance to corrosion, but the stabiliser was consumed to varying extents depending on partly the temperature of exposure, partly on unknown factors. The butyl rubber showed good corrosion resistance, but also signs of ageing. When comparing metallic and polymeric materials, it can be concluded that all steels have performed well, but most polymeric materials have shown certain damage of varying degree and importance. The long-term corrosion resistance of the polymeric materials is, compared to metals, more complex to evaluate and assess. In particular, that is true when data is available only for one single exposure time. To predict how different forms of attack develop in time, corrosion analyses at different exposure times are required. [abstract truncated

  15. La vidéo, un instrument de paix au Liban | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En outre, elle nuit aux rares sources d'eau potable que se disputent déjà les bergers et les fruiticulteurs. La perturbation du ... Pour eux, les lentilles étaient des objets neutres et, en dehors des rencontres face-à-face, ils n'avaient pas à faire montre de la même politesse que celle qui est de mise dans les réunions du majlis.

  16. Etude du codage distribué pour de nouveaux concepts en compression vidéo

    OpenAIRE

    Lajnef, Khaled

    2006-01-01

    In this thesis, we focus on the design of distributed coding set-ups using punctured turbo codes.; Le codage de sources distribuées (CSD) concerne le cas de signaux fortement corrélés que l'on code séparément et décode conjointement. Ce genre de technique a été récemment étudié comme solution potentielle pour la compression de données dans des applications exigeant des encodeurs simples. D'un point de vue théorique, le CSD s'appuie sur le théorème de Slepian-Wolf établi en 1973. Dans cette th...

  17. Standardiserad lösningsprototyp vid implementation av Microsoft Dynamics CRM

    OpenAIRE

    Westman, Mathias; Larsson, Sara

    2015-01-01

    I arbetet att tillfredsställa kunders behov och stärka relationerna mellan köpare och säljare så använder sig företag av affärsfilosofin Customer Relationship Management (CRM). Stora CRM satsningar görs inom företag och flera olika CRM leverantörer ger stöd åt verksamheterna i form av CRM-system. CRM-systemen levererar ofta funktionalitet för kundtjänsthantering, försäljning och marknadsföring men många företag använder endast försäljningsmodulen i CRM-systemet.   Kentor jobbar idag med suppo...

  18. Analyste de l'infrastructure technologique (réseau, vidéo et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'analyste réseau/ télécommunications apporte aux Services d'infrastructure les compétences nécessaires et une compréhension approfondie de l'architecture de l'infrastructure, notamment des éléments liés au réseau et aux télécommunications, qui lui permettent de recommander, concevoir, documenter et réaliser des ...

  19. Automatisation of moisture content measurement in biofuel deliveries; Automatiserad fukthaltsmaetning vid braenslemottagning

    Energy Technology Data Exchange (ETDEWEB)

    Aulin, Robert; Hessling, Krister; Karlsson, Mikael; Tryzell, Robert (Bestwood AB, Sundbyberg (Sweden))

    2008-06-15

    Measurement of moisture content in biofuel is normally made through manual sampling near the surface of truck deliveries or in the bulk of fuel deliveries that is distributed on e.g. a storage area. Moisture content is usually performed trough gravimetric determination at lab using oven drying for 24 hours. Precision is approximately a standard deviation of 2 %-units. However, there are several reasons to replace this method by an automatic procedure that measures moisture content in the bulk of the cargo. Except for obtaining more representative samples in the bulk, are speed and the measurement cost important characteristics. The purpose of this project was to develop a well-functioning prototype of a system that is automatic in the sense that manual sampling and sample preparation is replaced by a Near Infra Red (NIR) based system. The intended users of such a system would be both buyers of biofuel and suppliers who would benefit from better knowledge of the quality of the product that they are about to deliver. This project was initiated in the late autumn of 2006. A complete hardware set-up including a NIR spectrophotometer, light probe and a crane was installed in June 2007 in Eskilstuna, Sweden, and shown to members of the reference group at Vaermeforsk. The reliability of reference data obtained through gravimetric measurement was unfortunately not as good as expected on beforehand. This problem was due to the difficulty of obtaining representative samples near the surface of the truck cargo. It delayed the validation phase of this project significantly. An evaluation of the NIR based system reveals a good accuracy and precision that is far better than that of the traditional method for delivery control. A major reason for the superior precision is that the sampling error is reduced. Further, the NIR based system delivers real-time moisture data with a speed that is difficult to reach at lab because of restrictions in manual labour and limitations in equipment capacity. This project has therefore fulfilled all goals that were initially set up. (author)

  20. Caracterización de variedades de vid (Vitis vinifera L) de la provincia de Huesca

    OpenAIRE

    Casanova Gascón, José; Ortiz Marcide, Jesús María

    2009-01-01

    El objetivo de este estudio es conocer y caracterizar la riqueza varietal que tiene la provincia en parcelas de cultivo plantadas antes de 1960. Para ello se han seleccionado 14 parcelas procedentes de 12 localidades y las accesiones del Banco de Germoplasma de Movera (Zaragoza) procedentes de Huesca. La caracterización varietal se ha realizado con 3 métodos. La ampelografía se realiza estudiando 51 caracteres cualitativos estudiados durante 4 épocas del año realizándose el seguimiento duran...

  1. Styrelseledamots skyldigheter gentemot aktieägarna vid M&A-transaktioner i Delaware

    OpenAIRE

    Lundqvist, Rickard

    2017-01-01

    The Court of Chancery in Delaware is, in regard to adjudicating corporate governance issues, the most preeminent court in the United States. The Court is one of equity, and has century-long tradition of dealing with litigation arising out of disputes concerning the internal affairs of corporations. Therefore, it should come as no surprise that sixty-four percent of Fortune 500 companies are incorporated in Delaware. What might be surprising is the frequency of shareholder litigation involving...

  2. Mindfulness based stress reduction (MBSR) vid bröstcancer : - en litteraturöversikt

    OpenAIRE

    Olsson, Elin; Bertling, Frida

    2017-01-01

    Bakgrund: Mindfulness är ett nytt koncept inom omvårdnad. Mindfulness-based stress reduction (MBSR) är ett program som utvecklats från mindfulness inom vården. MBSR har studerats i samband med olika sjukdomar däribland cancer. Bröstcancer är den vanligaste maligna cancern hos kvinnor världen över och att få en cancerdiagnos medför både fysiska och psykiska svårigheter. Syfte: Att beskriva effekter av MBSR på personer med bröstcancer. Metod: Litteraturöversikt baserad på RCT-studier (randomise...

  3. Corrosion risks with polyethylene pipes in district cooling systems; Korrosionsrisker vid anvaendning av polyetenroer i fjaerrkylesystem

    Energy Technology Data Exchange (ETDEWEB)

    Vinka, Tor-Gunnar; Almquist, Joergen; Gubner, Rolf [Swedish Corrosion Inst., Stockholm (Sweden)

    2005-06-01

    Field exposures of carbon steel and stainless steel test cylinders have been made in the district cooling system at Affaersverken Energi AB, Karlskrona, Sweden, as well as determinations of the amount of dissolved oxygen in the district cooling water. In the district cooling system tubes of polyethylene, carbon steel and stainless steel SS 2343 according to Swedish standard SS 14 23 43 are used. Karlskrona's drinking water, without deaeration, is used in the district cooling system. The polyethylene tubes with pressure number PN 10 are placed underground. The content of dissolved oxygen was very low in Karlskrona both before and after a period of 19 days with elevated oxygen content. During these 19 days the content of dissolved oxygen in the system increased without any apparent cause. The highest recorded oxygen content was 3.4 mg O{sub 2}/l. There are no obvious explanations for the increase of oxygen in the system. However, transport of oxygen into the system through the polyethylene tubes can be excluded as the source of the entering oxygen. The corrosion rate that was determined for freely exposed carbon steel in the district heating water in Karlskrona was low, 5 {mu}m/year. The corrosion attack was of a uniform nature (general corrosion) and there were no local corrosion attacks on the carbon steel cylinders. On connecting the carbon steel with stainless steel SS 23 43 with an area ratio of 1:1 the corrosion rate of the carbon steel increased by 2-3 times as compared to free exposure without electrical connection. On the stainless steel SS 2343 there was no corrosion damage either on the freely exposed stainless steel or on stainless steel that was connected to carbon steel. There were no signs of pitting corrosion or crevice corrosion on the stainless steel cylinders. The main corrosion risk for carbon steel at an elevated content of dissolved oxygen is bimetallic corrosion (galvanic corrosion) between carbon steel and copper and copper alloys, or between carbon steel and stainless steel. Calculations show that the amount of oxygen gas that is transported through the walls of polyethylene tubes in air is very small. This amount of oxygen causes a slow corrosion on carbon steel. For polyethylene tubes in soil the oxygen transport through the tubes will be considerably lower than for tubes in air. Recommendations state that the area of carbon steel should be at least 10 % of the area of the polythene tubes if the polyethylene tubes are placed outdoors or indoors in air and not in soil. The reason is that the carbon steel tubes should use up the oxygen that is transported through the tubes. The most important reason for reducing the oxygen content in the system is the risk of bimetallic corrosion on the carbon steel. Another purpose for recommending a certain minimum area of carbon steel in the system is that any oxygen from unforeseen air intakes, from system starts and major additions of makeup water to the system with un-degassed water should be consumed, without causing significant corrosion on the carbon steel. For district cooling systems with polyethylene tubes placed in soil it is recommended that the area of carbon steel should be at least 5 % of the polyethylene tube area, to take care of unintentional intakes of air and system starts and major toppings with un-degassed water. It is recommended that the risks of accidental intakes of oxygen into the district cooling system should be considered. With the present use of soil-placed polyethylene tubes in district cooling systems the risks connected with accidental oxygen intakes are judged to be greater than the risk of oxygen diffusion through the polyethylene tubes. Furthermore, it is recommended that the risks of bimetallic corrosion should be taken in account at the design of district heating systems. The current use of soil-placed polyethylene tubes in district cooling systems with large quantities of carbon steel in the system is not considered to cause any risk of corrosion. The amount of oxygen that is transported through the polyethylene tubes is very small.

  4. Bed agglomeration in biomass fueled CFB-boilers; Sintring av baeddmaterial vid biobraensleeldning i CFB

    Energy Technology Data Exchange (ETDEWEB)

    Zintl, F. [TPS Termiska Processer AB, Nykoeping (Sweden)

    1997-02-01

    In fluidized-bed boilers fired with solid fuels operational problems caused by spontaneous defluidization are sometimes observed. This bed agglomeration can be caused by sintering phenomena where fuel components and/or bed material may be involved. In serious cases the problems can lead to expensive operation breaks. The objective in this project was to show whether this type of operational problems can be minimized by choice of other than conventional bed materials. The study was carried out as model experiments in a larger laboratory scale. In a fluidized bed fired with propane a number of both well known and more unusual bed materials were tried out. The choice of bed materials included some common sands (silver and quartz sand) and, as possible alternatives, olivine sand, zirconium sand, calcined dolomite and the synthetic materials sintered magnesite (MgO) and mullite (alumina silicate). The model experiments were started at about 700 deg C and the temperature then raised until an irreversible bed agglomeration was observed, or to a maximum of 1100 deg C. The most promising results were obtained with calcined dolomite, being an active bed material. With this material no irreversible agglomerations were observed at all. The expensive synthetic materials sintered magnesite and mullite and the zirconium sand turned out as the next best. Olivine sand, on the other hand, showed a clear sensitivity to physical agglomeration and some sensitivity also towards sintering. The common sand types based on silicon oxide clearly showed the worst results. 12 refs, 5 figs, 1 tab 12 refs, 5 figs, 1 tab

  5. Environmental impact at primary production of biofuels; Miljoeeffekter vid primaerproduktion av biobraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Bergstedt, Johan; Westerberg, Lars; Tonderski, Karin (Linkoepings Univ, Linkoeping (Sweden). Dept. of Physics, Chemistry and Biology, Div. of Ecology)

    2009-02-15

    Sweden has a policy objective that the forest and agricultural production of renewable energy must increase. Several of the traditionally cultivated annual crops can be used to biofuels, such as wheat, oilseed rape and sugar beet, but other crops are also interesting. Apart from an increase in Salix cultivation we discuss the cultivation of plants we have not cultivated, such as hemp, poplar and aspen, and intensive cultivation of spruce. Reed canary grass and grassland with several species are other candidates. The old reproductive systems environment are well known but what the new ones mean for the environment is poorly known. In this report, the state of knowledge regarding environmental impacts of primary bio-fuel production in Sweden is compiled. Based on the assumption that the reference crop is a plowed field the crops that can be grown on agricultural land are discussed. For the forest soil analyzed GROT (Tree-branches and -tops), root harvesting and intensive farmed spruce. The environmental impacts treated are carbon sinks in soil, compaction (with accompanying erosion problems), nutrient leaching, pesticides, landscape diversity, and biodiversity. One conclusion of the study is that it generally that there are many positive environmental effects of converting agricultural land to perennial crops for bioenergy, at least to some degree. On the other hand, increased collection of primary bio-energy from forests has mainly negative environmental impacts. The size of the effects are strongly linked to how much and where to grow and harvest, so a study of scale problems should be urgently implemented. This applies to both nutrient leaching and on the biological and landscape diversity. Use of ecosystem- and geographic models can be effective tools to generate different scenarios. The greatest potential of all crops, however, appears to be for aquatic systems with harvest of blue-green algae and bacteria, which probably would have mainly positive effects on the eutrophied lakes from which they were harvested. No such studies exist, however. Studies of techno-economic character are need in this area

  6. Upplevelsen av kejsarsnitt : -en enkätundersökning vid Akademiska Sjukhuset

    OpenAIRE

    Lindvall, Sara

    2013-01-01

    ABSTRACTAbout 17% of all deliveries in Akademiska Sjukhuset end with caesarean section. The purpose of the survey was to study parental pairs experience to undergo a caesarean section and experience of information about surgery. The aim was also to see if there were differences between those undergoing a planned or an emergency caesarean section, as well as differences between the birthing women and their partners. 100 couples participated in the study and answered a questionnaire 1-3 days af...

  7. L’interface cerveau-ordinateur: futur des jeux vidéo?

    NARCIS (Netherlands)

    Nijholt, Anton

    2017-01-01

    Brain-computer interfacing: the future of video games? Communication activity in the brain goes with changes in electrical activity (voltage differences) and oxygen flow. These changes can be measured and located: that makes it possible to translate them to appropriate commands to devices, robots or

  8. Računalniški vid za pametno knjižnico

    OpenAIRE

    Trček, Matej

    2016-01-01

    S prostoročnimi vmesniki lahko tehnologijo na udoben način vključimo v vsakdanje dejavnosti. Diplomsko delo opisuje izdelavo aplikacije za prepoznavanje knjižnih platnic z barvno-globinsko kamero za rabo v pametni knjižnici. Aplikacija v globinski sliki zazna ravnino, v njej najde štirikotnik in ga naravna v ravnino kamere. V naslednjem koraku s tehnikami računalniškega vida primerja najdeno sliko s pripravljeno podatkovno bazo posnetkov knjižnih platnic in najde najboljše ujemanje. Globinska...

  9. Zhivopisnõje vidõ i igrõ v "drugih" / Julia Totskaja

    Index Scriptorium Estoniae

    Totskaja, Julia

    2008-01-01

    Polina Ashihmina maalinäitus "Maalilised Eesti vaated" Narva Muuseumi kunstigaleriis. Tallinna ja Narva kunstnike ning poola kunstniku Lidia Berta Barej ühisnäitus "Mäng" Narva Muuseumi kunstigaleriis. Näitusel on eksponeeritud maalid, installatsioonid ja fotod

  10. Hereditär hjärnblödning. Demens vid cystatin C amyloidos

    DEFF Research Database (Denmark)

    Blöndal, H; Guomundsson, G; Benedikz, Eirikur

    1990-01-01

    Nineteen cases of hereditary cystatin C amyloidosis with cerebral haemorrhage are described. The first haemorrhage occurred between the ages of 20 and 41 years and the period of survival varied from 10 days to 23 years after the first insult. Progressive dementia was a striking clinical symptom...... in 17 of the patients and in two cases dementia was the first sign. At the last examination severe dementia and pronounced pathological EEG were established in the majority of the patients. Infiltration of amyloid substance positive for anti-cystatin C was found in the proximity of the blood vessels...... the name Hereditary Cystatin C Amyloidosis (HCCA)....

  11. Sjuksköterskors upplevelser och copingstrategier vid palliativ hemsjukvård

    OpenAIRE

    Eriksson Glad, Kristin; Kunz, Rebecca

    2013-01-01

    Aim: The aim of the current study was to investigate nurses’ experiences of caring for palliative patients in palliative home care, and to examine the coping strategies they use. Method: The study was empirical descriptive with qualitative approach. The data was collected by nine semi-structured interviews and analyzed by using manifest content analysis. Result: By analysing data three categories: Positive experiences of palliative home care, Stressful experiences of palliative home care and ...

  12. Cesarean Section: Recovering After Surgery

    Medline Plus

    Full Text Available ... done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order that they were added ... Global programs Research Need help? Frequently ...

  13. Exercise during Pregnancy

    Medline Plus

    Full Text Available ... done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order that they were added ... Global programs Research Need help? Frequently ...

  14. At Least 39 Weeks

    Medline Plus

    Full Text Available ... done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order that they were added ... Global programs Research Need help? Frequently ...

  15. Cesarean Section: The Operation

    Medline Plus

    Full Text Available ... done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order that they were added ... Global programs Research Need help? Frequently ...

  16. Gestational Hypertension and Preeclampsia

    Medline Plus

    Full Text Available ... done(relatedVidsDetailsDefer, [mostPlayedVidsDefer().done(mostPlayedVidsDetailsDefer)]); // chain the done() function which executes in sequential order that they were added ... Global programs Research Need help? Frequently ...

  17. Practical consequences of the Water Framework Directive implementation for combustion plants. New water cleaning technologies and methods for improvement of effluent discharges; Praktiska konsekvenser foer foerbraenningsanlaeggningar vid infoerandet av Vattendirektivet. Nya reningstekniker och foerbaettringsaatgaerder vid utslaepp till vatten

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Hansson, Christina [Carl Bro Energikonsult AB, Malmoe (Sweden)

    2004-11-01

    As a consequence of the growing impact on water resources the Water Framework Directive was legislated in 2000. The directive should ensure that a 'good water status' and entail a coordinated legislation striving for a long-term protection of all water resources. Stakeholders should be able to participate in the preparations of river basin management plans and programs of measures. District based water authorities will administrate the implementation and are mandated to decide upon regional environmental quality standards and promulgate fees for water use and discharges. The Directive contains a list of 33 prioritized substances that should be reduced or phased out. Discharges from combustion plants contain twelve, polyaromatic hydrocarbons (PAH) and heavy metals. PAH and heavy metals impacts growth and vital functions as respiration and photosynthesis of water living organisms and induces cancer in humans. NOEC-values (NO Effect Concentration) state manageable substance concentrations for an organism. Flue gas condensate contains concentrations of some of the substances which impact exceeds the critical state level. Extended sewage treatment could thus be needed. Sludge, wash and soot water contains elevated levels of heavy metals. This water is normally treated by municipal sewage treatment. Further treatment at plant site could be relevant. Presence of PAH and heavy metals in leach water depends on the precipitation. Additional flowing-independent water treatment could be relevant. It is very uncertain how plant owners will be affected. Licenses could be reviewed and standards could be raised for sensitive recipients; new limits for prioritized substances and standards for other types of discharges and water fees could be added. Respites could be given if costs exceed the benefits. Location, ecotoxicological risk assessments and precautionary measures could become more relevant in an EIA. Pricing of water could take place by using a system of emissions trading. Plant owners could make an impact by participating in development of environmental quality standards plans and programs by representation in public consultations and cooperative groups. Methods for improvement to meet the new standards are presented in the categories fuel, combustion, flue gas- and flue gas condensate treatment. The prioritized substances shouldn't be introduced or generated in the system to avoid costly investments of advanced technologies. Heavy metals are reduced by the choice of fuel and complete combustion generates less PAH. Both of the substances could be reduced by the separation of particles. An example of an appropriateness assessment according to a model considering the overall plant conditions including technological, economic and organizational aspects is demonstrated. For a 'standard plant' the best choice of fuel would be wood chips combined with stable combustion. Given the prerequisites of the model, the most appropriate flue gas treatment were a bag filter without chemical dosing and the most appropriate flue gas condensate-, slug-, wash-, and soot water treatment would be sand- or lamella filter with pH-adjustment, together with leach water treatment by sedimentation and sand filter. If another type of plant would be considered, other methods would be more optimal Hence, the model should be used in a 'plant specific' manner and then be a useful tool in negotiations with authorities if/when measures will be taken to reach the standards of the Water Framework Directive.

  18. Vilka faktorer inverkar vid valet av transportföretag? : En fallstudie om företagskunders resonemang och prioriteringar vid köp av transporttjänster och val av transportföretag.

    OpenAIRE

    Lundström, Linda; Kjellman, Anna-Karin

    2005-01-01

    During the last couple of years the focus for many businesses have moved from just being price oriented to include such factors as quality, flexibility, service, delivery precision and environmentally friendliness. The shift in viewpoint arises from the increasingly competition on the market and the hard economic atmosphere. It has become more important to differentiate the company and its products to be able to increase market share. The purpose with this master’s thesis was to get a better ...

  19. Financial Control and Safety. An investigation on how financial and safety aspects are integrated in the decision making at the Swedish nuclear power plants; Ekonomistyrning och saekerhet. En utredning om hur ekonomi- och saekerhetsaspekter integreras vid beslutsfattandet vid kaernkraftverken

    Energy Technology Data Exchange (ETDEWEB)

    Vaernild, Ola [OV Konsult i Vaesteraas AB, Vaesteraas (Sweden)

    2005-08-01

    The alleged inter-relationship between economy and nuclear safety has been investigated. Through interviews and review of instructions and other documents, information on how management at Swedish nuclear power plants integrates financial control and safety management has been compiled. Owners of nuclear power plants have well founded expectations on that the plants are profitable and that the operations are rationalized in order to reduce costs. This could allegedly threaten the nuclear safety. However, it is not to be expected that there are any obvious relationships between expenditures and safety. The quality of the safety management has to be judged in terms of how well safety requirements are met irrespective of the associated costs. The owners have imposed clear financial objectives on the nuclear power plants. At the same time they have also established policies for nuclear safety. The nuclear power plants have systems for operations management, which basically comprise separate parts for operations planning and quality management. Financial control and safety management are included in the operations planning and quality management respectively. The quality management impose restrictions to be adhered to in the operations planning. This means that from a formal point of view, the safety management is superior to the operations planning. There are examples of simple as well as advanced approaches to financial management at the nuclear power plants. In all cases the methods used are reasonably well adapted to the needs. Typical for all plants is the focus on long-term aspects. Investments are for example analysed in a plant life-time perspective. With regard to safety, profitability calculations are not required to the same extent for safety related investments as for other investments. A number of factors, which tend to warrant that safety aspects are given the appropriate attention in the decision making, have been identified. Examples of such factors are the involvement of cross functional teams and external parties in the decision process, detailed and unambiguous instructions in the quality system and follow-up by organizational entities, which are independent of the line organization. In 2003 concerns related to the prioritization of financial control at the expense of safety were expressed at one nuclear power plant and management took action on this. There now appears to be a unanimous opinion at all Swedish nuclear power plants that safety really has a higher priority than financial control and that this is well reflected in company policies and in the systems for operations management. Above reference has only been made to the formal operations management. A common remark has been that the adherence to the quality system depends on the safety culture. In order to safeguard that the safety culture remains unaffected by any changes related the norms and values concerning economy, the safety culture should to a large extent be based on safety related institutional activities. Authority review of the financial control at the nuclear power plants should focus on that the quality system really is superior to the operations management. In addition, when reviewing the safety culture, the existence of stabilizing institutional safety related activities should be checked.

  20. Occupational health hazards in power production and transmission. 11. Physical conditions at the three-year follow-up; Haelsorisker i arbete vid elproduktion och eldistribution. 11. Haelsotillstaandet vid treaarsuppfoeljningen

    Energy Technology Data Exchange (ETDEWEB)

    Toernqvist, S.; Hoegstroem, R.M.; Gamberale, F.; Knave, B.

    1992-12-31

    In a prospective study of health hazards in work with production and distribution of electricity a young cohort of 529 electrical workers has been health examined after three years of work in the electric power industry. Prevalence of symptoms and discomfort and results from clinical tests have been compared to base line data previously collected by means of different questionnaires and clinical tests at the time of employment. The follow-up period reported here is three years, i.e. the second health examination in this prospective study. A tendency towards increased neurastenic symptoms and musculoskeletal complains was noted over the three years, mostly in the age group 30-39 years. The musculoskeletal complains were considered work related in a higher degree than all other complains. Data from the clinical tests were within the normal variation. As a whole this young cohort was healthy. In future analyses the individual comparisons over time and comparisosn with other occupational groups will be of interest to be able to judge occupational hazards in relation to health of electrical workers in the electrical power industry. Reports on different aspects of health in relation to specific exposures at work will be available in future analyses. (25 refs., 12 tabs., 6 figs.).

  1. vid119_0601d -- Line coverage of sediment types from video collected from the Delta submersible vehicle.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Delta submersible vehicle, outfitted with video equipment (and other devices), was deployed from the R/V Auriga during September 2001 to monitor seafloor...

  2. La vidéo et les soulèvements populaires en Égypte | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Orient, quand j'ai vu les changements, en particulier les changements politiques, tout cela m'a beaucoup intéressée, m'a passionnée même. Et c'est ma passion pour ces mouvements qui m'a poussée à vouloir en savoir plus.

  3. Calibrations and evaluation of the control program at the National Laboratory during 1995; Kalibrerings- och normalieverksamheten vid riksmaetplatsen under 1995

    Energy Technology Data Exchange (ETDEWEB)

    Grindborg, J.E.; Gullberg, O.; Kylloenen, J.E.; Samuelson, G.

    1996-07-01

    The Dosimetry Laboratory at the Swedish Radiation Protection Institute (SSI) is a National Laboratory for the dosimetric quantities kerma, absorbed dose and dose equivalent. The activity is based on established routines for how calibrations should be made and a control and a calibration program for the used standards. This report gives a brief summary of the calibrations performed during 1995 and a more detailed description and analysis of the control program during this year. To summarize all the controls and calibrations of standards made during the year makes it easier to draw conclusions about the long term stability and possible malfunctions. Therefore, this summary makes an important part of the quality assurance program at the National Laboratory. 10 figs, 24 tabs.

  4. Fouling and slagging problems at recovered wood fuel combustion; Orsaker till askrelaterade driftproblem vid eldning av returtraeflis

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Christer; Hoegberg, Jan [Vattenfall Utveckling AB, Stockholm (Sweden)

    2001-03-01

    CHP-plants that use a large portion of sorted wood waste fuel can face ash-related problems. By analysing the circumstances about these problems, the goal is to find causes for the problems and measures that can be taken. This knowledge can then be utilised in plants where it is desired to increase the portion of sorted wood waste fuel. For the measurements, a deposit probe is a good tool to use since the result is independent of many boiler-specific factors. Compared with forest residues, sorted wood waste causes a more problematic ash. The risk of troublesome fouling and corrosion seems to increase with increased admixture of sorted wood waste fuel. Plugging of the grate is associated with melts that are formed from metallic contamination in the fuel. These melts obstruct the air holes. The melts that have been seen during the project have had a content of aluminium, brass and zinc. In order to solve these problems, the construction and cooling of the grate and quality assurance of the fuel are important aspects. One problem that was found in all of the studied boilers (grates as well as fluidized beds) is growth of fouling on surfaces for heat transfer. Measurements with deposit probe show that the initial growth rate on superheaters are approximately 3 - 5 times higher when sorted wood waste is used than if forest residues is used. Even if this growth rate can not be extrapolated to a complete operating season, the relative difference between the fuels remains. The extent of the problem depends on the dimensioning of the boiler. The fouling tends to have a light outer layer that can be disadvantageous for the absorption of heat radiation. Haendeloe P11 needs for example to be stopped for cleaning with an interval of 2 - 3 months because of lost heat absorption in the furnace and the convection path. The most obvious ash related problem that was found in Haendeloe P11 when 100 % sorted wood waste fuel was used was corrosion on the walls of the lower parts of the furnace. The corrosion has forced an exchange of large parts of the panel walls. More or less severe corrosion on the superheaters is reported from all of the boilers that were studied in the project. Since most of them use sorted wood waste mixed with some other fuel, it is difficult to make conclusions about the specific role of the sorted wood waste fuel for this corrosion. Long-term measurements with a deposit probe in Haendeloe P11 shows that the deposit growth rate varies with a factor five from day to day, although the load is relatively constant. In addition to the typical components in wood fuel ash such as calcium, potassium and sulphur, also zinc, lead, and in some cases titanium are concentrated in the deposits. Zinc is common in the deposits from the grate furnaces and the CFB within the concentration interval 5 - 20 % (also higher contents occur). The zinc content was lower in the deposits from the CFB. Lead and titanium was found to a higher extent in the fluidized bed boilers.

  5. Why and how to make a REACH registration of combustion ash; Moejligheter vid REACH-registrering av energiaskor

    Energy Technology Data Exchange (ETDEWEB)

    Loevgren, Linnea; Wik, Ola

    2009-10-15

    The new chemical regulation, REACH (1997/2006/EC), Registration, Evaluation, Authorization and restriction of Chemicals, took effect the 1st of June 2007. The background to this report was the introduction of REACH and the difficulties to understand the implications for ash. The most important consequence of REACH is that all chemical substances that are manufactured, handled and used above one tonne per annum per legal entity shall be registered according to this regulation. The registration includes specifying the chemical, physical, toxicity and ecotoxicity properties of the substance and risk assessing the identified areas of use. The report describes the use of ash in connection to the waste legislation and its planned end-of-waste-criteria, the chemical legislation and the Construction Products Directive. The target audience of this report is companies producing ashes and having a use or seeing a use for its ash. The report describes how to make a REACH registration of ash independent if a company did or did not pre-register ash during 2008. It describes how to change from one ash registration into another if the pre-registration was done for one type of ash but the company changes opinion during the sameness check, i.e. changing SIEF (Appendix A). Taking part in REACH registration projects during 2009-2010 can be advantageous since knowledge and financing are shared. Ash can be REACH registered also in the future but it is important to know that the registration have to be done prior the production and marketing starts. If ash is consider to be a waste the handling is covered by the community and national waste legislation. In Sweden ashes are by and large being regarded as waste, and recycling is risk assessed and permits are given case by case. End-of-waste criteria for different waste material are being elaborated within the EU. Such criteria will among other details cover chemical safety. When a material fulfils the end-of-waste criteria such material will have the possibility to leave the waste legislation and be covered by the chemical legislation in becoming a product or an article. It is not know in detail how far the chemical legislation will reach for material having end-of-waste criteria. Currently, end-of-waste criteria have not yet been initiated for ashes. The Swedish Environmental Protection Agency (Naturvaardsverket) is currently elaborating end-of-waste criteria for the use of material in construction works. Recovering waste is according to REACH identical with manufacturing. A chemical substance, preparation/mixture or article manufactured from waste, i.e. via a recovering operation will have to follow chemical legislation. The enterprise responsible for the recovering operation is the legal entity responsible to follow REACH for the manufactured material. One example of recovering ash into a chemical substance is the manufacturing of cement when ash is the raw material. It is the responsibility of the cement plant to have its substance or product REACH-registered before manufactured and provided to a third party. The waste legislation, instead of the chemical legislation, applies when the waste recovering operation does not results in manufacturing of a substance, preparation or article provided to a third party and the waste has a use at the end of its life cycle. This is identified as late recovery. The waste legislation applies during the life cycle of the waste in such cases. Examples in Sweden are ashes used in landfill sealing and covering layers and in roads or soil stabilization. Use of ashes in constructions is covered by the Constructions Product Directive (2008/98/EC), CPD, irrespective if it is identified as a waste or a chemical product. The CPD harmonizes only testing and CE-marking of construction products. Chemical safety requirements originate from national legislation which in many cases is based on chemical regulation. Standardized testing methods to measure emitted hazardous substances from construction products were initiated in 2006 on the EU level. The proposed method s are similar to leaching methods used today in characterization of waste properties for landfill. The report describes pros and cons with REACH registration of ashes. It is believed that uses of ashes will more easily be available if the ashes are registered according to REACH. The reason is that a REACH registration generates extensive information about properties and emissions during uses and that safety instructions will be available to guarantee that emissions will not be higher than what man and nature can sustain. The fee for a joint submission of a REACH registration is 23,250 Euro per legal entity if the company put more than 1,000 tonnes of the dry substance on the market per year.

  6. SCR in biofuel combustion - stage 3. Regeneration at full-scale; SCR vid biobraensleeldning - etapp 3. Regenerering i full skala

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Christer; Kling, Aasa; Odenbrand, Ingemar; Khodayari, Raziyeh

    2002-04-01

    This is the third and last part of a project that started in 1996. The overall goal of the project was to increase the possibilities to use SCR at bio fuel combustion under reasonable technical and economical conditions. This part of the project has focused on full-scale applications of the reactivation methods that were developed during phase 1 and 2. There are quite large differences in deactivation rate between different types of catalysts. A high active Biocomb catalyst deactivates more slowly then a catalyst that contains less vanadium and is less active. A high active catalyst also catalysts the oxidation from SO{sub 2} to SO{sub 3}. Practical consequences of this for low sulphur fuels should be investigated. Two new reactivation methods, sulphation and sulphation in combination with water wash, give an activity increase of 80 and 90% relative activity respectively for the evaluated catalyst (Biocomb Type B). The water washed and sulphated samples deactivate with approximately the same deactivation rate as not regenerated samples regardless of flue gas exposure temperatures. The samples that were regenerated with sulphation deactivates less fast than not regenerated samples when they are exposed to flue gas temperatures lower then 340 deg C. At higher temperatures they deactivates relatively fast. The plate-type catalyst has been regenerated with water wash in combination with sulphation as well as water and sulphuric acid wash up to a relative activity of 80%. The deactivation has been faster for the water washed and sulphated samples compared to the water and sulphuric acid washed samples (which deactivates with the same rate as fresh samples). At full-scale sulphation tests at the Brista Kraft plant, the catalytic activity was raised with 23% by sulphation with 260 ppm SO{sub 2} during 25 hours (dosage of 3 tons of elementary sulphur with the fuel). The sulphation led to a reduction on the NO{sub x}, emissions by half. The catalyst, which works in a flue gas temperature between 360-390 deg C, lost its activity relatively fast. After 2000 hours of exposure the NO{sub x}, reduction was in the same level as before the sulphation. This result agrees with results from test bench tests at the same temperature. Four full-scale regenerations by washing with water and sulphuric acid have been performed in the ldbaecken plant on the plate catalyst that was installed in 1994. These washings have shown that it is possible, on repeated occasions, to regenerate the catalyst to a relative activity of 70-80%.

  7. Bag filters at biofuelled plants, reliability and economy of operation; Slangfilter vid bioeldade anlaeggningar, tillfoerlitlighet och driftsekonomi

    Energy Technology Data Exchange (ETDEWEB)

    Lindau, Leif [SYCON Energikonsult, Malmoe (Sweden)

    2002-04-01

    The background to this work is the increased requirements on dust emission control for smaller (2-50 MW) biofuel plants in Sweden, where established technology consisting of multi cyclones cannot meet the emission demands, and where the specific cost of the large scale established technology (electrostatic precipitators) quickly increases with decreased plant size. Operational experience of bag filters on Swedish biofuel plants down to a size of 2 MW has been collected. The operational experience is remarkably uniform and positive and availability is high. Bag life, being the most important operational cost factor, is between two and eleven years. Most frequent material used is aramide, but also PPS is employed and the experience of both materials is good. The cost relation between bag filter (including an upstream skimmer) and electrostatic precipitator has been studied based on supplier quotations. Bag filter always has the lowest first cost. At one year bag life, the total cost of a bag filter is less than that for an electrostatic precipitator for plants smaller than 15 MW, and at more than one year's bag life, the bag filter has the lowest total cost for plants up to 50 MW. For plants smaller than 5-10 MW, the difference in total cost is very high. With some simple means for quality assurance of new bags, premature failure rate can be reduced. Following up cleaning interval and/or emission during operation time, gives information about the development of bag condition and necessary bag change can be foreseen. Since bag filters are more prone to damage by fire than electrostatic precipitators, the process of damage due to entrained sparks has been analysed based on practical observations and a thermal calculation. This consideration shows that this damage mode can be eliminated by an upstream skimmer having moderate but reliable performance. The result is well in coherence with the practical operational experience found that with an adequate skimmer upstream, the failure becomes much less probable.

  8. Field testing of ethanolamine, an alternative volatile alkalising agent; Faeltprovning av etanolamin vid Idbaeckens Kraftvaermeverk i Nykoeping

    Energy Technology Data Exchange (ETDEWEB)

    Tavast, J. [Alstom Power Sweden AB, Finspong (Sweden)

    2002-02-01

    The use of alternative volatile organic alkalising agents is increasing. These compounds are usually stronger bases than ammonia and most are also less volatile. This results in a higher pH-value in the first condensate, reducing the risk for erosion corrosion. The disadvantages are a higher cost as well as thermal decomposition in the boiler drum and in the superheater. The most common decomposition products are carbon dioxide and organic acids like formic and acetic acid. These decomposition products are acidic and may be corrosive as such. They also increase the cation conductivity making it difficult or impossible to use monitoring of cation conductivity to supervise steam purity. Thermal stability is therefore a desired property of an organic alkalising agent, in addition to a high base strength and a relatively low volatility. Ethanolamine (ETA) is a potential alternative volatile alkalising agent. ETA has shown promising alkalising properties in earlier tests performed. ETA did also show a better thermal stability than other candidates included in the tests. The results indicated that it should be possible to use a mixture of ammonia and ETA as an alkalising agent to reduce the risk for erosion corrosion without too much disturbance caused by the increase of the cation conductivity of the steam. The reason for the interest for the combination of ammonia and ETA is that such a combination should be well suited to alkalise the whole steam and condensate system. ETA should be enriched in the region of the first condensate while ammonia should be enriched in the latter part of the system. ETA has also been successfully used to reduce erosion corrosion as well as transport of iron oxides in PWR plants in the US. A field test as a complement to the earlier autoclave tests is a logical step towards establishing the use of a mixture of ETA and ammonia also in conventional fossil plants where erosion corrosion has been a problem. Such a field test has been performed at Idbaecken in Nykoeping. The primary object of this field test has been to establish the effect on the cation conductivity of the steam. Another object has been to try to draw general conclusions from the current field test as well as from the earlier autoclave tests. Alkalisation of the steam, condensate and feed water systems together with the effect on the transport of corrosion products with the feed water were other items of interest. The results of the field test in combination with the results of the earlier autoclave tests show that the increase of the cation conductivity of the steam increases with the following factors: increasing dosage; increasing temperature in boiler drum and superheater; increasing retention time in boiler drum and superheater; increasing recirculation with condensate (decreasing makeup). The field test has resulted in a model, which can be used to estimate the increase of the cation conductivity of the steam vs. dosed amount of ETA, temperature and retention time. This model can be improved as information from more plants becomes available. Dosing of 1 ppm of ETA should result in an increase of steam cation conductivity in the range of 0.1 {mu}S/cm at a boiler pressure of 80 bars, in plants similar to Idbaecken. The same increase would not be expected below 120 bars in a plant with low recirculation of ETA with the condensate. Lower pressures would not be expected to result in a significant increase of the cation conductivity. Monitoring of cation conductivity may be replaced with continuous monitoring of sodium in plants where thermal decomposition of organic compounds like ETA results in a disturbing increase of the cation conductivity. Monitoring of sodium will give an estimate of the content of aggressive compounds like sodium chloride, sodium sulphate and sodium hydroxide, but not of compounds like ammonium chloride and ammonium sulphate. The results of the field test did not give a clear indication of the influence ETA on the pH of the steam, condensate or feed water. There are several reasons for this, like the relatively low amount of ETA and the fact that the difference in base strength between ETA and ammonia is relatively low at room temperature. The influence of ETA on the pH is more significant in the first condensate than in the total condensate. It has, however, not been possible to extract samples for analysis from that part of the turbine. Dosing of ETA together with ammonia is more costly than dosing of ammonia only. The additional cost should not, however, be significant. Dosing of 1 ppm of ammonia in Idbaecken costs approximately 5000 kr/year (about 500 USD/year) calculated on 6000 hours on full load. The corresponding cost for dosing of 0.5 ppm ETA and 0.5 ppm ammonia is approximately 9000 SEK/year. In conclusion, alkalisation with a mixture of ETA and ammonia is recommended for plants where dosing of ammonia fails to give a sufficient protection towards erosion corrosion. (truncated)

  9. Co teď můžeme vidět na staveništi tokamaku ITER?

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    Listopad (2017) ISSN 2464-7888 Institutional support: RVO:61389021 Keywords : fusion * ITER site * Assembly Hall,Radio Frequency Building * Tritium Building * Tokamak Building * Diagnostic Building * Magnet Power Conversion Building * 400 kV Switchyard * Cryoplant * Coils Winding Facility Subject RIV: BL - Plasma and Gas Discharge Physics https://www.3pol.cz/cz/rubriky/jaderna-fyzika-a-energetika/2084-co-ted-muzeme-videt-na-stavenisti-tokamaku-iter

  10. Emissions from residential combustion of different solid fuels. Roekgasemissioner vid anvaendning av olika fasta braenslen i smaaskaliga system

    Energy Technology Data Exchange (ETDEWEB)

    Rudling, L.

    1983-01-01

    The emission from different types of solid fuels during combustion in residential furnaces and stoves has been investigated. The following fules were investigated: wood pellets, peat-bark pellets, wood chips, wood logs,wood-briquets, peat briquets, lignite briquets, fuel oil. Three different 20-25 kW boilers were used and one stove and one fire place. The flue gases were analysed for carbon dioxide, carbon monoxide, nitrogen oxides, hydrocarbons, particulates, tar and fluoranthen.

  11. Flygbilder och fotogrammetriprogramvaran PI-3000 som alternativ vid 3D-modellering för volymberäkning

    OpenAIRE

    Billinger, Christian; Backeborn, Johan

    2008-01-01

    Projektet har med uppdrag av WSP utförts i syfte att testa och utvärdera ett nytt tillvägagångssätt för volymbestämning av vanligtvis terrestert inmätta objekt. Det nya konceptet innebär att med hjälp av fotogrammetriprogramvaran PI-3000 och, på lämpligt sätt, insamlat digitalt flygbildsmaterial utföra volymbestämningar på objekt av intresse. Detta i syfte att ersätta den normalt terrestert utförda metoden för att göra framförallt tids- och kostnadsbesparingar. I syftet ingick även att jämför...

  12. La « gender panic » à l’école primaire : sexe, mensonges et vidéo

    OpenAIRE

    Collet, Isabelle

    2015-01-01

    En France, en janvier 2014, dans la mouvance de la Manif’ pour tous, une campagne de désinformation a été lancée afin de convaincre les parents d’élèves qu’une « théorie-du-genre » était en train de s’infiltrer dans les écoles. Cette théorie était accusée de nier à la fois l’anatomie, l’identité et le libre arbitre des enfants. En plaçant la lutte sur le terrain scolaire, les détracteurs ont réussi une alliance stratégique entre deux populations croyantes qui n’ont pas l’habitude de militer e...

  13. Klimata pārmaiņu komunikācija interneta vidē Latvijā

    OpenAIRE

    Dragiļeva, Maija

    2014-01-01

    Maģistra darbā tika analizēta un raksturota Latvijas interneta ziņu portālos publicētā informācija par klimata pārmaiņām. Interneta vide spēlē aizvien lielāku lomu kā galvenais informācijas avots ar pieaugošo lomu sabiedrības rīcību ietekmēšanā. Kā viens no svarīgākiem klimata pārmaiņu komunikācijas aspektiem tika izvirzīta pārbaudītas, kvalitatīvas informācijas pasniegšana, kas veltītu vairāk uzmanības lokāli aktuālai informācijai, klimata pārmaiņu sociālā taisnīguma aspektam un konkrēto rīc...

  14. SAB och Dewey vid Uppsala universitetsbibliotek : En attitydundersökning bland bibliotekarier på 6 biblioteksenheter

    OpenAIRE

    Wersäll, Lina

    2012-01-01

    The Library of Uppsala University has decided to change their classification system from the Swedish SAB system to the American Dewey Decimal Classification. One of the main reasons for this decison was that Kungliga biblioteket also has made an exchange between these systems. Due to that, the national bibliography of Sweden classifies Swedish documents according to Dewey Decimal Classification and the SAB system is no longer maintained. A transition to Dewey Decimal Classification will enabl...

  15. PROJEKT HÖGPRESTERANDE BETONG 1991-1997 : Lista över rapporter publicerade vid avd Byggnadsmaterial, LTH

    OpenAIRE

    Fagerlund, Göran

    2014-01-01

    A national Swedish research program HIGH PERFORMANCE CONCRETE was sponsored by the governmental organizations NUTEK and BFR and by a number of private companies within the building sector. The program was performed during the years 1991‐1997. Researchers from four Swedish technical institutes, from the Swedish Cement and Concrete Research Institute and from private companies took part in the program. Our department, Building Materials, took part in research area Materials. Ett natio...

  16. Reduced bed temperature at thermo-chemical conversion of difficult fuels; Saenkt baeddtemperatur vid termokemisk omvandling av svaara braenslen

    Energy Technology Data Exchange (ETDEWEB)

    Niklasson, Fredrik; Haraldsson, Conny; Johansson, Andreas; Claesson, Frida; Baefver, Linda; Ryde, Daniel

    2010-05-15

    This work investigates the prospect of reducing the concentrations of alkali chlorides in the flue gas by lowering the temperature in the bottom zone of a fluidized bed (FB) furnace below the often used 850 deg C. The directive of a retention time of at least two seconds above 850 deg C is fulfilled by the raise of the flue gas temperature that follows the combustion of unburned gases at the point of injection of secondary and tertiary air, above the bottom bed zone. The aim of the present experiments is to determine the dependency between the temperature and the amount of alkali metals leaving the bottom bed for some selected waste and biomass fuels. The results are intended for plant owners as well as boiler manufacturers. The experiments were performed in an FB-reactor, which was externally heated to specific temperatures between 550 and 850 deg C. The reactor is made of a quartz glass tube with an inner diameter of 60 mm and a length of 1.2 m. The fluidized bed rests upon a porous plate of sintered quartz. The bed material used was 180 gram purified sea sand with particle sizes between 0.1 and 0.3 mm. The fluidizing gas was a mixture of nitrogen and air, introduced in the bottom of the reactor by mass flow controllers. At the outlet of the reactor, the flue gas was divided between conventional gas analyzers and an ICP-MS instrument. The gas flow to the ICP-MS instrument was cooled before a slip stream was sucked out via a capillary to a nebulizer from which the sample gas was led to the ICP-MS instrument. The function of the nebulizer is normally to form an aerosol of liquids, but here it was used solely as a pump. In addition, a known flow of krypton was added into the nebulizer to be used as an internal standard. The novel technique to measure the amount of alkali metals on-line from a batch fired FB-reactor has been shown to work in practice and to provide interesting results, which so far is qualitative only. Further development and calibration work is needed to obtain reliable quantitative results. Under pyrolysis (in nitrogen), a strong coupling was found between temperature and measured concentrations of alkali and zinc in the flue gas, especially between 750 and 850 deg C. These findings imply that reactors for gasification (or pyrolysis) of waste and biofuels will benefit from being operated at temperatures below 850 deg C to reduce the alkali content in the product gas. On the other hand, there could be other advantages of operating a gasifier at higher temperatures. The influence of the reactor temperature on the release of alkali metals was found to be less pronounced during combustion as compared to pyrolysis. The reason for this could be that oxygen takes part in the reaction scheme controlling the release of the alkali metals, but it could also be a consequence of locally higher temperatures in the fuel particle while burning. The tests showed that a larger fraction of zinc was released during devolatilisation, compared to the alkali metals of which typically less than 10 % was found to be released during devolatilisation. Some additional tests where HCl was added to the fluidizing gas showed, as expected, that the presence of HCl increases the release of alkali metals from the bottom ash. Agglomeration temperatures were determined for two bed sand samples that had been extracted under operating bed temperatures of 870 and 750 deg C in a commercial waste fired FB-boiler. While sand samples were heated in order to find the agglomeration temperature, considerably more alkali metals were released from the sand sampled at 750 deg C. The agglomeration temperature was somewhat lower for this sand, but it was still considerably higher than normal operating bed temperature of the boiler. The present lab-scale study shows that the release of alkali metals and zinc into the flue gas from waste is reduced, or at least considerably decelerated, by a lowered fuel conversion temperature. However, the atmosphere and bed material of a full scale waste fired power plant cannot be fully reproduced in lab scale. The differences will affect the release of alkali metals. Nevertheless, present study gives an indication that a reduced temperature of the bed may be beneficial. The experiments also showed that reducing atmosphere in the bed preferably should be avoided, at least at a bed temperature of 850 deg C

  17. Choix méthodologiques pour une analyse de conversation en situation de jeux vidéo

    OpenAIRE

    Colón de Carvajal, Isabel

    2012-01-01

    Pour telecharger les actes du colloque dans son ensemble : http://www.modyco.fr/doc_download/717-traitements-de-corpus-outils-et-methodes-actes-du-coldoc-2012; International audience; In the LUDESPACE project, we propose a methodology for analyzing interactions (social, spatial, bodily and linguistic) between players, and between players and the console, in time and space of a video game situation. The study of such interactions is a complex situation to document, requiring audio and video da...

  18. Objektorienterad programmering på teknikprogrammet. : Vad lär sig gymnasieelever av programmering vidC-sharplektioner?

    OpenAIRE

    Barsk, Ulla-Maija

    2013-01-01

    Studien problematiserade gymnasieelevers lärande i perspektivet: Lär sig elever förmågan att programmera eller lär de sig enbart programmeringsspråket? Syftet var att undersöka och analysera hur elever lär sig att programmera och om de lär sig tankesättet för att praktiskt tillämpa sina kunskaper av ett objektorienterat språk. Frågeställningar var: Hur uppfattar elever programmeringen och på vilket sätt lär de sig att programmera,dvs. kan de ta till sig programmeringsspråket för att lösa prob...

  19. vid119_0601c-- Point coverage of sediment types from video collected from the Delta submersible vehicle.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Delta submersible vehicle, outfitted with video equipment (and other devices), was deployed from the R/V Auriga during September 2001 to monitor seafloor...

  20. Réflexions théoriques autour du jeu (vidéo) et de l'apprentissage

    OpenAIRE

    Philippette, Thibault; Journées doctorales en Information et Communication (EDSIC)

    2011-01-01

    Les activités de jeu observées chez les enfants (Freud, Piaget, Winnicot) ont "naturellement" été décrites comme essentielles pour leur développement. Une correspondance pour le moins paradoxale : associer des activités de divertissement au sérieux du développement. Jeu et sérieux font‐ils si bon ménage ? Mais au fait, qu'est‐ce qu'un jeu ? Le jeu de la bobine pour Freud ou encore le jeu symbolique si essentiel à Piaget sont des manières de qualifier des activités de jeu. Mais qu'...

  1. Recommendations for harvesting logging waste for fuel purposes and compensatory fertilization; Rekommendationer vid uttag av skogsbraensle och kompensationsgoedsling

    Energy Technology Data Exchange (ETDEWEB)

    Samuelsson, Hans

    2001-04-01

    This report gives recommendations on harvesting of wood fuels and the following fertilization should be performed in order to avoid unwanted effects on the balance of nutrients in the soil, on biological diversity, on the water quality in surface and ground waters, and that no net harmful substances (e.g. heavy metals) are fed to the soil. The National Board of Forestry have a positive attitude towards harvesting of forest fuels, if the recommendations are followed. Most important recommendations: Compensatory fertilization should be performed, and most of the needles should be left, reasonably well spread. One harvest per rotation period could be made without compensatory fertilization.

  2. Energy and water saving measures at the Arloev sugar mill. Final report; Energi- och vattenbesparande aatgaerder vid Arloevs Sockerbruk. Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Wamsler, M. [AAF-Processdesign AB, Malmoe (Sweden)

    2001-10-01

    The project comprised several, mutually dependent, sub-projects; mapping, investigation of ways to reduce water consumption, membrane tests aiming to find ways to recover sugar, and pinch analysis to evaluate the possibilities for improved process integration. This final report deals with the overall project results. Identified savings opportunities and savings potentials are presented. The presented measures represent an overall optimisation based on the results of all the project parts. Already during the project, measures have been implemented that are calculated to save 65 000 m{sup 3} water annually, corresponding to 10 % of the total water consumption. This saving is in level with the goals for the project. In the table below, these and additional measures are presented with a total savings potential at approximately 200 000 m{sup 3} /year water. The project will then achieve a saving of just below 35 % of present water consumption. Also in the membrane study the results surpassed the expectations. It was found that with nano filtering a sugar concentration of more than 10 %(W) could be reached in the retentate at a flux 50al/m{sup 2}h. The total sugar losses were less than 5 %, i.e. 95 % should be possible to recover. In total, a savings potential of more than 300 tonnes sugar per year is indicated. The Energy savings in the project are calculated to 7,4 GWh/year, of which 0,2 GWh/year by reduced water consumption, 0,6 GWh/year by water recovery, 1,4 GWh/year by membrane technology and 5,2aGWh/year as a result of process integration. This should be compared to the target 2,5 GWh/year. Hence, the results are almost three times the expected. The savings in monetary terms are estimated at just under SEK 5 million per year. The investment is roughly estimated at between SEK 5 and 6 million, of which SEK 4 million for the membrane equipment and SEK 0,5 million for a process water buffer tank. The remaining investment costs cover heat exchangers, control equipment and piping. This means that the total package will have a payback time of approximately one year. The environmental benefits of this project are mainly a result of the reduced energy consumption. This leads to a 1 600 tonne reduction of carbon dioxide emissions annually from reduced natural gas firing. Furthermore, the results indicate possibilities for a profitable reduction of oxygen depleting substances by over 300 tonnes sugar annually. In addition, the reduction of water consumption by 200 000 cubic meters per year results in reduced electricity and chemicals consumption in both water and sewage treatment plants.

  3. Radioactive discharges and environmental monitoring at the Swedish nuclear facilities 2001; Utslaepps- och omgivningskontroll vid de kaerntekniska anlaeggningarna 2001

    Energy Technology Data Exchange (ETDEWEB)

    Sandwall, Johanna

    2002-11-01

    This report contains an evaluation of the discharge and environmental programme for the Swedish nuclear facilities. It also contains the work on quality control performed by SSI. This is done as random sampling of discharge water and environmental samples.

  4. Vísbendingar um gædi lyfjamedferda aldradra vid innlögn á landspítala

    DEFF Research Database (Denmark)

    Sigurdardóttir, Maria Sif; Gudmundsson, Adalsteinn; Gudmundsdóttir, Thorunn K

    2011-01-01

    the quality of medication use in older people at hospital admission. MATERIAL AND METHODS: A retrospective medical record review was performed for patients 70 years and older who had an unplanned admission to the internal medicine and geriatric units at Landspitali University Hospital in 2007. Among...... indicators on admission was 48.4%. Women were more likely to have a quality indicator than men (women 56.2%, men 39.9%). The probability also increased with increasing age and number of drugs. CONCLUSIONS: The quality of drug therapy among older patients at hospital admission appears to be suboptimal. A more...

  5. CARACTERIZACION GENETICA DE LAS VARIEDADES TINTAS DE VID DE VINIFICACION CULTIVADAS TRADICIONALMENTE EN AMERICA: ORIGEN Y DIVERSIDAD INTRAVARIETAL.

    OpenAIRE

    MILLA TAPIA, ALEJANDRA PAOLA

    2002-01-01

    En el presente estudio se ha analizado la identidad y diversidad genética de un conjunto de 90 vides antiguas de vinificación, procedentes de cinco países Americanos, empleando dos herramientas moleculares: microsatelites nucleares y AFLPs. Los resultados 127p.

  6. Seriality and Transmediality in the Fan Multiverse: Flexible and Multiple Narrative Structures in Fan Fiction, Art, and Vids

    NARCIS (Netherlands)

    Kustritz, A.

    2014-01-01

    This article explores new forms of serial structure found in transmedia story worlds, with particular attention to the innovations of amateur transmedia works. Although the term transmedia has most often been associated only with corporate media at the center, taking amateur works as the

  7. Seriality and Transmediality in the Fan Multiverse : Flexible and Multiple Narrative Structures in Fan Fiction, Art, and Vids

    NARCIS (Netherlands)

    Kustritz, A.M.|info:eu-repo/dai/nl/339422211

    2014-01-01

    This article explores new forms of serial structure found in transmedia story worlds, with particular attention to the innovations of amateur transmedia works. Although the term transmedia has most often been associated only with corporate media at the center, taking amateur works as the

  8. Additive for reducing operational problems in waste fired grate boilers; Additiv foer att minska driftproblem vid rostfoerbraenning av avfall

    Energy Technology Data Exchange (ETDEWEB)

    Gyllenhammar, Marianne; Herstad Svaerd, Solvie; Davidsson, Kent; Hermansson, Sven; Liske, Jesper; Larsson, Erik; Jonsson, Torbjoern; Zhao, Dongmei

    2013-09-01

    The combustion of waste implies a risk for deposits and corrosion in different parts of the combustion facility. In recent years, research and tests have been performed in order to find ways to mitigate these problems in waste-fired plants. Most waste-fired plants in Sweden are grates whereas most of the research has been carried out in fluidized bed plants. The purpose of this project is to examine whether co-firing of sewage sludge and waste can reduce deposition and corrosion also in grate-fired boilers as has been shown in fludised beds. The objective is to determine the deposit growth and its composition as well as describing the initial corrosion attack. Representing sulphur-rich waste, elementary sulphur is also added to the waste and thereby compared with sludge as an additive. The target groups for this project are plant owners, researchers, consultants and authorities. Tests were performed in a 15 MWth waste-fired boiler with moving grate at Gaerstadverket, Tekniska Verken (Linkoeping). The boiler produces saturated steam of 17 bars and 207 deg C, and the normal fuel mixture contains of household and industry waste. The results show that co-firing with as heigh as 20 weight-% SLF (25 energy-%) was possible from an operational point of view, but the deposit rate increased especially at the two warmest positions. Generally the deposit rate was highest in the position closest to the boiler and decreased further downstream. During the tests a lot higher amount of SLF than normal was used (recommended mix is 5-10 % of SLF) this to be able to see effects of the different measures. Up to 23 weight-% of the rather moist sewage sludge was possible to fire when co-firing waste and SLF, without addition of oil. By adding sludge the deposit rate decreased but the increase upon adding SLF to ordinary waste was not totally eliminated. In the tests 'Avfall and SLF' the deposits were rich in chlorine. High concentrations of metal chlorides were found in the interface between the steel and the metal oxide. This weakens the adhesion of the oxide to the steel surface and thus increases the corrosion rate. By addition of sewage sludge or sulphur the initial corrosion was decreased on both the low-alloyed steel T22 and the stainless steel 304L; sewage sludge being a little better than sulphur. Qualitatively, the corrosion attack firing SLF was similar to that firing ordinary waste, but the attack was stronger. At material temperatures of 500 deg C and 420 deg C - corresponding to superheaters - alkali chloride corrosion dominated, while at 280 deg C - corresponding to furnace walls - a melt of KCl/ZnCl2 is likely to have accelerated the corrosion. This difference between different material temperatures was especially pronounced in the 'Avfall and the SLF' cases. Higher zinc content in the fuel can therefore increase risk of corrosion. The higher content of iron, lead, copper and zink in the ash from the SLF case corresponds to the content of SLF compared with ordinary waste. Comparing the present tests with similar tests in fludised beds, grate firing resulted in higher deposit rate on the exposed test rings. This can at least partly be attributed to the lack of empty pass in the present grate boiler and to some differences in fuel composition: more chlorine and less sulphur in the waste used in this project. However, the effect of adding sludge was similar but not as strong as in the fluidised bed tests. To summarise, the results show that co-firing SLF with sludge can be advantageous also in a grate-fired boiler. Because of the high heating value of SLF, this combination also makes it possible to add a high fraction of moist sewage sludge.

  9. Miljöbelastning vid förtida utbyte av enstegstätad putsfasad : Orsakad av fuktskador

    OpenAIRE

    Sundström, Olle; Sundström, David

    2012-01-01

    När en konstruktion blir fuktskadad påverkas de ingående materialen på olika sätt och i vissa fall uppstår så kallad mikrobiell tillväxt som kan påverka människans hälsa. Det finns studier om hur människor reagerar på sådan mikrobiell tillväxt, hur materialen påverkas av olika fuktbelastningar och hur mycket pengar det kostar att byta ut denna konstruktion. Vad som inte finns är hur miljön påverkas att i förtid behöva byta ut en fuktskadad konstruktion. Utifrån ovan nämnda har detta examensar...

  10. Emissions of volatile hydrocarbons (VOC) during drying of sawdust; Utslaepp av laettflyktiga kolvaeten vid torkning av biobraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Granstroem, Karin

    2001-08-01

    In the project 'Emissions of volatile hydrocarbons (VOC) during drying of sawdust' the identity, amount and composition of monoterpenes found in the drying medium of a fluidized bed drier drying sawdust from Norwegian spruce and Scotch pine has been determined. The energy efficiency of the drier has also been measured. The aim of this project was to reduce both emissions and energy required for drying, to minimize environmental and health hazards, and make drying more competitive. This would help our primary target group - small scale saw mills - to make use of the sawdust produced as a by- product by making pellets and briquettes. If the VOC remains in the sawdust its energy content will improve and therefore also its value as a fuel. The sawdust was dried to different moisture levels in a spouted bed drier at atmospheric pressure, using either recirculating or not recirculating drying medium with temperatures 140, 170 or 200 deg C. The emissions of VOC were measured using a flame ionization detector (FID) and the nature of the emissions analyzed with a gas chromatograph with mass spectrometric detector (GC-MS). The GC-MS data is reported as emitted substance per oven dry weight (odw). Experiments show that terpenes do not leave the sawdust in great amounts until it is dried to a moisture content (water/total weight) below 10%. When sawdust is dried to a predetermined moisture level, the terpene emissions increase when warmer incoming drying medium is used. The monoterpenes found in greatest amount are a-pinene, b-pinene, 3-carene, limonene and myrcene. y-terpinene was detected in emissions from pine but not from spruce. The relative amounts of different monoterpenes did not vary significantly with post-drying moisture content, but drying medium of higher temperature caused an increase in the relative amount of less volatile monoterpenes. The FID data is reported as concentration of VOC in the drying medium, and as weight VOC per odw. The concentration of VOC increases when the temperature of the gas that enters the drying tower is increased. A mass balance shows that the concentration VOC is proportional to emitted VOC per odw. The concentration VOC is fairly constant at different moisture contents of outgoing sawdust when the drying medium is recirculated, but VOC per odw shows an increase in emissions at lower sawdust moisture contents. The energy efficiency was highest for the tests with high temperature of incoming drying medium. As the sawdust was dried to less moisture content the energy efficiency dropped regardless of the temperature of incoming drying medium. When the drying medium was not recirculated the energy efficiency was poor. An important conclusion is that driers with a spouted bed should use recirculating drying medium, since it is clearly superior to not recirculating drying medium. Another important conclusion is that to minimize emissions from the drier the temperature of incoming drying medium should be kept low and the moisture content of the sawdust above 10%.

  11. Failure modes of safety-related components at fires on nuclear power plants; Saekerhetsrelaterade systemkomponenters felmoder vid brand paa kaernkraftverk

    Energy Technology Data Exchange (ETDEWEB)

    Aaslund, A. [SwedPower AB, Stockholm (Sweden)

    2000-03-01

    Probabilistic assessment methods can be used to identify specific plant vulnerabilities. Application of such methods can also facilitate selection among system design alternatives available for safety enhancements. The quality of assessment results is however strongly dependent on realistic and accurate input data for modelling of system component behaviour and failure modes during conditions to be assessed. Use of conservative input data may not lead to results providing guidance on safety upgrades. Adequate input data for probabilistic assessments seems to be lacking for at least failure modes of some electrical components when exposed to a fire. This report presents an attempt to improve the situation with respect to such input data. In order to take advantage of information in existing documentation of fire incident occurrences some of the lessons learned from the fire at Browns Ferry Nuclear Power Plant on March 22, 1975 are discussed in this report. Also a summary of results from different fire tests of electrical cables presented in a fire risk analysis report is a part of the references. The failure modes used to describe fire-induced damage are 'open circuit' and 'hot short' which seems to be commonly accepted terms within the branch. Definitions of the terms are included in the report. Effects of the failure modes when occurring in some of the channels of the reactor protection system are discussed with respect to the existing design of the reactor protection system at Ringhals 2 nuclear power unit. Experiences from the Browns Ferry fire and results from fire tests of electrical cables indicate that the dominating failure mode for electrical cables is 'open circuit'. An 'open circuit' failure leads to circuit disjunction and loss of continuity. The circuit can no longer transmit its signal or power. When affecting channels of the reactor protection system an 'open circuit' failure can cause extensive inadvertent actions of safety related equipment.

  12. SCR during co-combustion of biofuel and recycled fuels; SCR vid sameldning av biobraenslen och returbraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Kling, Aasa; Myringer, Aase [Vattenfall Utveckling AB, Aelvkarleby (Sweden); Eskilsson, David [SP Swedish National Testing and Research Inst., Boraas (Sweden); Aurell, Johanna; Marklund, Stellan [Umeaa Univ. (Sweden). Environmental Chemistry

    2005-06-01

    An increased cost for wood fuels in combination with higher taxes on fossil fuels have led to an increased interest for less costly recycled fuels. Two examples on recycle fuels are demolition wood and refuse energy waste. These fuels are becoming a larger amount of the heat and electricity production in Sweden, not the least since the prohibition against deposition of combustible waste 2002. One of the environmental problems with combustion of bio based fuels are emissions of nitrogen oxides, NO{sub x}. The commercial flue gas cleaning method that gives the highest reduction in NO{sub x} is SCR, selective catalytic reduction, which can reduce more than 90% of the emissions. The planned raise in NO{sub x}-fee from 40 SEK to 50 SEK per kg/NO{sub x} increases the potential for advanced flue gas cleaning techniques. Today there is unique knowledge about SCR in combination with biofuel in Sweden. During cocombustion of recycle wood and wood fuels there is however, besides the deactivating compounds that dominate during wood combustion, mainly alkali, also other potentially poisonous compounds that can deactivate the catalyst. The goal for the study was to investigate the potential and risk with SCR during cocombustion of wood fuels and recycle wood. The project aimed at describing which components in the fuel/flue gas that leads to an eventual increase in deactivation and compare this with previous studies on wood fuels. The project also aimed at in full scale verify reduction of dioxin over a SCR deNO{sub x} catalyst during combustion of wood fuels and recycle wood. The deactivation of a SCR catalyst increases with an increased amount of recycled wood. During co-combustion of bark and 30 % demolition wood the deactivation increased from 30 % loss of catalytic activity during pure wood fuel combustion to 40 % loss of catalytic activity after 1500 hours of exposure. During combustion of 100% refuse energy fuel the loss of activity was 80% after 1500 hours of exposure. The deactivation was mainly due to alkali poisoning of the catalyst. Alkali (and lead during combustion of refuse energy fuel) was accumulated linearly during the time of exposure. The amount of lead was however so low that it only marginally contributed to the deactivation. It is the amount of chloride in the flue gas particles (and not the alkali content) that correlates with the deactivation of the catalyst. The alkali compounds are easily soluble in water, which makes it possible to regenerate the catalyst and prolong the lifetime. The catalyst reduces, beside NO{sub x}, also up to 70 % of the dioxin amount in the flue gas before dust collection (calculated as I-TEQ). This increases the potential for the technique in plants that combustion chlorine containing fuels where the dioxin amount can exceed the new emission threshold value from the EU-directive for waste combustion.

  13. Vísbendingar um gædi lyfjamedferda aldradra vid innlögn á landspítala

    DEFF Research Database (Denmark)

    Sigurdardóttir, Maria Sif; Gudmundsson, Adalsteinn; Gudmundsdóttir, Thorunn K

    2011-01-01

    Increased morbidity and higher prevalence of medication use commonly coexists among the elderly. When managed appropriately, older patients can benefit from drug therapy. However, drug related problems are more frequent and more serious in the elderly. The aim of the study was to assess the quali...... of medication use in older people at hospital admission.......Increased morbidity and higher prevalence of medication use commonly coexists among the elderly. When managed appropriately, older patients can benefit from drug therapy. However, drug related problems are more frequent and more serious in the elderly. The aim of the study was to assess the quality...

  14. Kloka processvägar för varierande råmaterial vid utvinning av basmetaller

    OpenAIRE

    Lennartsson, Andreas

    2015-01-01

    Copper, like silver and gold, is one of the metals that are known to have been worked by some of the oldest civilisations on record. It is used for its unique properties such as corrosion resistance, good workability, high thermal conductivity and attractive appearance. New mines are opened to maintain a supply of primary feedstock for copper smelters. These new deposits are in many instances found to have a more complex mineralogy with several minor elements. Besides treating primary materia...

  15. [Elaboration of an immunosorbent for the purification of porins from Salmonella typhi 9, 12, Vi:d].

    Science.gov (United States)

    Pelayo, R; Isibasi, A; Paniagua, J; Ortíz, V; Muy, M; González, C; Blanco, F; Islas, S; Kumate, J

    1989-01-01

    The current work was undertaken to purify porins of Salmonella typhi, which are outer membrane proteins (OMPs) that induce protection in mice against challenge with the bacteria in mucin. OMPs, isolated with a non-ionic detergent, had a 4% contamination with LPS (endotoxin) and molecular sizes ranging from 17 to 70 KDa. Porins (Mw 38-41 KDa) were isolated from OMPs preparative SDS-PAGE. Anti-porins antisera were raised in rabbits and specific IgG was purified, which was coupled to Sepharose-CNBr. This immunosorbent was used to purify LPS-free porins.

  16. Problematiken vid samägd jord- och skogsbruksfastighet : De rättsliga förhållanden

    OpenAIRE

    Toivio Blomsten, Caroline; Royson, Sanna

    2009-01-01

    The purpose of this thesis is to investigate and analyze existing law concerning joint owner-ship in agriculture and forestry businesses. Joint ownership often arises through a succes-sion of ownership, therefore we will go through the most useful methods.Even if the owners of agriculture and forestry businesses are getting older, the numbers of succession of ownerships are still low. A succession of ownership is important to plan and its time is demanding. Often it takes three to five years ...

  17. General project - Ash problem at wood fired fluidised bed plants. Phase 2; Ramprojekt - Askproblem vid skogsbraensleeldning i fluidbadd. Etapp 2

    Energy Technology Data Exchange (ETDEWEB)

    Hansson, Soeren; Kallner, Per; Ljungdahl, Boo; Wrangensten, Lars; Stalenheim, Annika; Goldschmidt, Barbara

    2003-10-01

    Some of the most common and most expensive problems concerning biomass fuelling are bed material agglomeration (fluid bed boilers) and ash deposits on superheater surfaces leading to corrosion and decreased heat transfer. During the preparation of the project it was noticed that much information was lacking concerning the causes for and preventive measures against deposit formation. The aim of the project is to increase the knowledge of which processes and conditions cause ash deposits on high temperature surfaces after the furnace. Sintering tendencies in bed recirculation cyclones are considered particularly. For this purpose a plant with a history of sintering problems in the cyclone has been chosen for measurements of gas temperature, cyclone wall temperature, gas composition, deposit growth and composition, fuel analysis, bottom ash, bed material and bed recirculation material. Three operating conditions have been investigated: normal operation, normal operation with low oxygen content, normal operation with low oxygen content and high cyclone temperature. Measurements during one week were made for each operating condition. As a reference, a less comprehensive measurement was made with two operating conditions at another CFB. In addition to the measurements, CFD modelling of the bed recirculation cyclones as well as laboratory sintering tests of collected bed material were made. The results of the measurements were in short, that the main investigated parameter high oxygen content - did not significantly influence the deposit formation or sintering tendencies of the cyclone ash. Instead, the cause seems to be a high cyclone ash temperature caused by char burning. The measurements and analysis of the cyclone ash showed that all ashes have high melting points and are not sticky at the relevant cyclone temperatures (850-900 deg C). Melting point calculations and laboratory tests are consistent. The composition of the deposits did not differ for the various operating conditions, however the growth rate on the coldest test rings in the cyclone was lower during the operating condition with high oxygen content and low temperature than during the other two operating conditions. Also the growth rate on the hottest uncooled test rings in the cyclone was lower, but here the difference between the operating conditions was much smaller. The fuel composition is mirrored in the composition of the cyclone and bottom ashes. For example, the ashes from operating condition 1 and 2 contain more potassium and calcium than the ashes from operating condition 3. The CFD (Computational Fluid Dynamics) calculations show that the cyclone temperature is highest below the cyclone entrance at the sloping wall and around the bottom of the cyclone. This is where the deposits on the sloping wall are found.

  18. Omvårdnadsåtgärder vid Nutritionsproblem hos patienter med huvud- och halscancer : En litteraturstudie

    OpenAIRE

    Widén, Malin; Bucht, Martina

    2012-01-01

    The aim of this study was to review scientific articles to evaluate which nursing treatment are in use to ease problems such as dysphagia, mucositis and xerostomia and its efficiency. The method was a literature review in which the scientific articles where found in the database PubMed. A total of sixteen articles where included, these articles where analyzed based on their quality and contents. The result showed that electrical stimulation and rehabilitation was used against dysphagia, they ...

  19. Vid, viñedos y vino en Sefarad : cultivo elaboración y comercio de un vino diferenciador

    OpenAIRE

    Ana María Rivera Medina

    2007-01-01

    Las comunidades hebreas peninsulares, a lo largo de la Edad Media, desarrollaron un complejo sistema de cultivo, elaboración y comercio del vino acorde con prescripciones religiosas ligadas al concepto de pureza. De ahí, que vista su importancia pretendemos analizar su función como bebida en las festividades religiosas y celebraciones; la jurisprudencia relativa a la propiedad, el cultivo y la elaboración del vino judío; y finalmente, mostrar cómo las comunidades sefardíes o sus individuos ac...

  20. vid113_0401p -- Point coverage of sediment types from video collected from the Delta submersible vehicle.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Delta submersible vehicle, outfitted with video equipment (and other devices), was deployed from theR/V Auriga during September 2001 to monitor seafloor...

  1. Barnfetma - sjuksköterskans roll vid behandling/Child obesity - the nurse’s role during treatment

    OpenAIRE

    Hallberg, Charolina; Rydh, Marie

    2008-01-01

    Obesity is one of the biggest threats to child- and adolescent health. The amount of obese children is today increasing more in Sweden than in the US. This may in a couple of years have bad consequences for the Swedish children’s quality of life. When a child suffers from obesity it is a big stress on the body and can lead to serious consequences in adulthood. An effective treatment in the early stages is important to prevent further obesity to develop. Purpose: The aim of this study was to b...

  2. Vid, viñedos y vino en Sefarad : cultivo elaboración y comercio de un vino diferenciador

    Directory of Open Access Journals (Sweden)

    Ana María Rivera Medina

    2007-01-01

    Full Text Available Las comunidades hebreas peninsulares, a lo largo de la Edad Media, desarrollaron un complejo sistema de cultivo, elaboración y comercio del vino acorde con prescripciones religiosas ligadas al concepto de pureza. De ahí, que vista su importancia pretendemos analizar su función como bebida en las festividades religiosas y celebraciones; la jurisprudencia relativa a la propiedad, el cultivo y la elaboración del vino judío; y finalmente, mostrar cómo las comunidades sefardíes o sus individuos acceden a la tierra, cómo se trabajan estos viñedos y se genera una industria subsidiaria, a pesar de las diversas restricciones que se imponen desde una sociedad mayoristamente cristiana.The Hebrew communities of the Iberian peninsula, along the Middle Ages, developed a complex system for the cultivation, elaboration and trade of the wine, in agreement with religious prescriptions tied to the concept of purity. In reason to its importance, we will analyze its function like drink in the religious festivities and other celebrations; the jurisprudence relative to the property, cultivation and elaboration of the Jewish wine; and, finally, we will show how the sefardíes communities or their individuals consent to the earth, how these vineyards are worked and a subsidiary industry is generated, in spite of the diverse restrictions that are imposed from a society of Christian majority.

  3. Fröproteiner som fällningsmedel för minskning av turbiditet vid vattenrening.

    OpenAIRE

    Blix, Annika

    2011-01-01

    The aim of this master’s thesis was to investigate if defattening of Parkinsonia aculeata (in swahili “mkeketa”) and Vigna unguiculata (in swahili “choroko”) would enhance the capacity of the seed’s properties in removing suspended particles from surface water. The seeds are used in local traditional treatment of drinking water in Tanzania. The aim was also to investigate the possibility to reduce high concentrations of fluoride with the seeds. The seeds contain proteins that act as coagulant...

  4. Infodivertissement vidéo : incidence sur les résultats en matière de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Aux prises avec l'un des taux de mortalité maternelle parmi les plus élevés au monde, le Nigéria a déterminé que la santé des mères et des enfants est un enjeu prioritaire. Ce projet aidera à s'attaquer au problème au moyen de recherches visant à évaluer l'accueil, le coût et l'incidence des visites à domicile. Le projet ...

  5. Evaporative and sorptive cooling. Possibilities and limitations in air treatment.; Evaporativ och sorptiv kylning. Moejligheter och begraensningar vid luftbehandling

    Energy Technology Data Exchange (ETDEWEB)

    Lindholm, T. [Chalmers Univ. of Techn., Goeteborg (Sweden). Dept. of Building Services Engineering

    2001-10-01

    A primary demand for a good indoor climate in a building is that temperature and humidity are maintained at comfortable levels, regardless of the prevailing outdoor climate. Some buildings often have a heat surplus for a great part of the year due to internal activities, even in climates with moderate ambient temperatures. This heat surplus has to be removed in order to fulfil the specified requirements on the indoor climate. The focus in this report is on possibilities and limitations using evaporative and desiccant cooling to satisfy the cooling demands in such buildings. Today the most common technical solution is to use a compressor refrigeration system for air-conditioning. As a result of the greenhouse effect and the ozone depletion debate, the prerequisites for compressor refrigeration systems have been changed. Evaporative cooling is an interesting alternative to conventional compressor refrigeration systems. However, the use of evaporative cooling presupposes all-air systems. The use of such a system will also, to a large extent, be limited by ambient conditions as well as the settled demands on the indoor climate. High outdoor humidity levels have great influence on the supply-air temperature achievable, i.e., cooling loads possible to meet. One way to considerably reduce the influence of these limitations is to use desiccant cooling, i.e., to dehumidify the ambient air before the evaporative stages. In this report, a general methodology to describe possibilities and limitations for evaporative and desiccant cooling, is presented. The major advantage of this methodology is that it may give rise to an increased understanding of these processes and, hence, be a guide to a proper dimensioning.

  6. Mapping of the image quality in myocardial scintigraphy: A national study; Kartlaeggning av bildkvalitet vid myokardscintigrafi: en nationell studie

    Energy Technology Data Exchange (ETDEWEB)

    Ohlson, Maria; Gustafsson, Agnetha (Radiofysikavd., Universitetssjukhuset, Linkoeping (SE)); Gretarsdottir, Jakobina (Diagnostik, Sahlgrenska Universitetssjukhuset, Goeteborg (SE)); Olsson, Eva (Fysiologiska kliniken, Universitetssjukhuset, Linkoeping (SE)); Johansson, Lena (Klinisk Fysiologi, Sahlgrenska Universitetssjukhuset, Goeteborg (SE))

    2008-04-15

    The aim of this study was to make a survey over the physical parameters and how they affect the image quality and the final diagnosis for myocardial perfusion SPECT in Sweden. Another aim was to evaluate the need for standardized acquisition and processing protocols for myocardial perfusion SPECT. All thirty nuclear medicine departments in Sweden that perform myocardial perfusion SPECT participated in the study. A thorax heart phantom was used to simulate two patients. All studies were acquired and processed with the parameters used clinically in each hospital respectively. A quantitative and a qualitative evaluation were performed. At each hospital, the local nuclear medicine physician interpreted the images as if they were true patient images. There are great differences in the acquiring and processing parameters used in myocardial perfusion SPECT studies in Sweden. The image quality varies greatly for the different hospital but was approved for the majority of the hospitals. Images from two hospitals were considered to be too poor to be diagnosed. The interpretations of the local nuclear medicine physicians differ but the majority has reported an adequate diagnosis. One third of the hospitals have reported false positive defects. All steps in the chain from the acquisition to the evaluation of the medicine physician must be performed with high quality. The determinative factors are the noise reduction filter, the orientation of the slices in the heart and the judgement of the local medicine physician. The acquiring and processing parameters proposed by EANM should be used. The hospitals are also recommended to investigate in the time and resources available, in order to educate all staff involved in the evaluation of myocardial studies

  7. You need to do everything with tact. Climatic change and the relation between science and the government; Je moet alles met beleid doen. Klimaatverandering en de relatie tussen wetenschap en overheid

    Energy Technology Data Exchange (ETDEWEB)

    Bregman, B.

    2011-12-15

    The author discusses the challenges in the field of climate change and climate science by means of a number of central themes in the relation between science and government: dealing with uncertainties, communication, knowledge management, the credibility of climate science and the role of social media [Dutch] De auteur bespreekt de uitdagingen m.b.t. klimaatbeleid en de klimaatwetenschap aan de hand van thema’s die centraal staan in de relatie tussen wetenschap en overheid: het omgaan met onzekerheden, communicatie, kennismanagement, de geloofwaardigheid van de klimaatwetenschap en de rol van sociale media.

  8. Advies (brom)fietsveiligheid tweede Heinenoordtunnel : een advies voor maatregelen en voorzieningen die een juiste en veilige afwikkeling van het (brom)fietsverkeer door de oeververbinding moet bevorderen. In opdracht van Directoraat-Generaal Rijkswaterstaat, Directie Zuid-Holland.

    NARCIS (Netherlands)

    Vis, A.A.

    1997-01-01

    The Dutch Department of Public Works started construction of the Second Heinenoord Tunnel in the autumn of 1996. It was decided to bore two tunnels immediately next to one another. Both tunnels are designed for two-way traffic. One tunnel handles agricultural vehicles. The other handles the

  9. Aspekte van mikrostrukturele ver-skeidenheid en inkonsekwentheid ...

    African Journals Online (AJOL)

    ties en konsekwent moet wees. Gemotiveerde afwykings van die verstekstruktuur moet aan die gebruiker verklaar word. In hierdie artikel word aandag gegee aan verskillende tipes mikrostruk-turele modelle wat in die metaleksikografie ontwikkel ...

  10. Kriteria vir 'n Afrikaanse aanleerderwoordeboek·

    African Journals Online (AJOL)

    materiaalversameling wat voldoende detail bevat en sistema ties aangebied word. Die geselek- teerde gegewens moet op sodanige wyse verwerk word dat dit maklik ontsluit en verstaan kan word. Die woordeboek moet 'n toeligtingsgedeelte bevat. Die seleksie van makrostruktuurelemente moet linguisties gemotiveer ...

  11. Yeast Interacting Proteins Database: YML064C, YLR377C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this prey as...autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this prey as

  12. Yeast Interacting Proteins Database: YLR347C, YLR377C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this prey as...autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this prey as

  13. Patent vitellointestinal duct with prolapsed (intussusceptions of proximal and distal ileal loop: A case report

    Directory of Open Access Journals (Sweden)

    Dinesh D. Mundada

    2015-02-01

    Full Text Available A wide variety of anomalies may occur as a result of the vitellointestinal duct (VID failing to obliterate completely. VID is well known because of its various complication and presentation most commonly due to Meckel's diverticulum. Small bowel prolapsed through patent VID is one of the rare presentations that have been reported. We are reporting a case of patent VID through which proximal and distal ileal segment had been intussuscepted and prolapsed through umbilicus.

  14. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  15. Yeast Interacting Proteins Database: YLR377C, YLR377C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this bait as...autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this prey as...autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this bait as...autophagy-mediated degradation depending on growth conditions; interacts with Vid30p Rows with this prey as

  16. vid116_0501n -- Point coverage of sediment observations from video collected during 2005 R/V Tatoosh camera sled survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A custom built camera sled outfitted with video equipment (and other devices) was deployed from the NOAA research vessel Tatoosh during August 2005. Video data from...

  17. Biological recipient control at the Oskarshamn nuclear power plant. Annual report for 2011; Biologisk recipientkontroll vid Oskarshamns kaernkraftverk. Aarsrapport foer 2011

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Jan; Franzen, Fredrik; Lingman, Anna

    2012-07-01

    Potential ecosystem effects caused by the effluent cooling water from the Simpevarp nuclear power plant, close to Oskarshamn on the Swedish coast of the Baltic Proper, are monitored in yearly surveys using gillnets and fyke nets. Fishing is undertaken at several sites in a coastal gradient starting at the location of the emitted cooling water, and in a reference area 100 km north of the recipient. Soft bottom macro fauna and macro vegetation are monitored both in the gradient and in the reference area. Fish mortality due to entrapment in the cooling water system and commercial landings are monitored to assess the effects on the local fishery. The water used for cooling is normally heated by 10-12 deg C when passing through the power plant. In sheltered parts of the recipient bay of Hamnefjaerden, the surface water was 4-6 deg C warmer in April-November 2011 than in the reference area comparable reference areas and the emitted water occasionally exceeded 30 deg C in the summer. Fish losses in the cooling water rinsing system were dominated by Baltic herring. Effects on abundances at the population level are estimated to be small, but local effects cannot be ruled out. Perch (Perca fluviatilis), roach (Rutilus rutilus) and silver bream (Blicca bjoerkna) dominated the catches in the surveys with gillnets in Hamnefjaerden, as well as in the archipelago surrounding the power plant. Perch abundances increased in these areas. Catches of roach decreased close to the power plant, but also in the reference area. Perch in the gillnet catches were younger and grew faster close to the power plant than in the reference area. Abnormal gonads, previously observed at high frequencies in perch and roach in Hamnefjaerden, were rare in the 2011 sampling. The abundance of young of the year perch in the recipient did not change over time. The size of the perch fry however, increased in Hamnefjaerden, as well as in the local reference area. The catch and size structure of yellow eel (Anguilla anguilla) did not change over time in the recipient since the 1980s. The prevalence of swim bladder parasites (Anguillicoloides sp.) has been 50-60% since the parasite was established in Hamnefjaerden in the late 1980's. Gillnet surveys are performed in the spring on the open coast at the power plant to study effects on Baltic herring and other marine species, normally appearing at low water temperatures. Problems due to an increasing population of grey seals forced a change in fishing methodology in 2011, and the pelagic nets were replaced with a series of demersal nets. The abundances of the long term dominants Baltic herring (Clupea harengus), sea scorpions (Myoxocephalus scorpius) and cod (Gadus morhua) have shown large periodic variations since the survey was established in the early 1970's. Cod alone has shown a long term decrease, probably reflecting the general situation in the Baltic Sea. Silver eel (Anguilla anguilla) catches decreased in the local fishery, but increased in the reference area until silver eel fishing stopped in this area in 2001. The long term development is however believed to reflect the general trends of eel in the Baltic region. Abundance and species richness in soft bottom macro fauna increased strongly in shallow sites between 1962-2011, in Simpevarp as well as in the reference area. The number of species increased also on deeper sites, but the total abundance did not change significantly. The abundance of the introduced polychaete Marenzelleria sp. increased rapidly in recent years and is now among the dominants in both areas. The trend is reflective of the general changes in the Baltic Sea. Vegetation on hard bottoms is monitored on three sites in the coastal gradient of cooling water. The algal communities are considered to have good ecological status and the studied sites are among the richest in the region. The Fucus vesiculosus cover decreased however, in recent years due to the wearing of ice. Fucus increased its distribution in deeper parts in two sites south of the power plant. The cover of filamentous green algae increased over the last decade and the cover of red algae in 5-6 m depth decreased in recent years.

  18. Vidéos – Droits réels : la décentralisation et les femmes en Asie du ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il s'agissait d'une politique née d'une promesse mirifique : des gouvernements décentralisés devaient permettre l'autonomisation de dizaines de millions de femmes dans les pays en développement. Mais le fait de transférer une partie des pouvoirs et des ressources à l'échelon local a-t-il vraiment amélioré les conditions ...

  19. Survey of development work and problems with different collection techniques of food waste; Kartlaeggning av utvecklingsarbete samt problem vid olika insamlingstekniker foer matavfall

    Energy Technology Data Exchange (ETDEWEB)

    Henriksson, Gunilla

    2010-07-01

    In accordance with Sweden's environmental objectives it has been decided that, by 2010, 35 per cent of all food waste shall be recovered through biological treatment. In order to get there, the problems regarding collection methods needs to be solved. There are several different collection systems to choose between, but at the present time there is no complete list of the methods and techniques available on the market. Lists of advantages and disadvantages with each system, of potential improvements, and of completed or ongoing development projects are also missing, and creating difficulties for municipalities and businesses which are planning on introducing a system. The goal with this study is to provide a survey of technical problems with different systems and to identify previous studies as well as new innovations within collection techniques. The expectation is that this work eventually will lead to improved collection systems. The study will cover existing collection techniques in households, large-scale kitchens, restaurants and grocery stores in Sweden. The study will only cover the so called hard parameters, i.e. primarily technical issues. The target group is on the one hand municipalities planning on starting collection of food waste and on the other hand all actors in the area, such as innovators, producers and suppliers as well as Waste Refinery's organizations. Soft issues such as issues regarding information and quality are not included. The system limits of this project span between the recycling equipment of homes and businesses to the food waste's treatment at the biological treatment plant. The methods that have been used in this project are: questionnaire survey to 133 municipalities that today are recycling food waste, telephone interviews with a number of biological treatment plants and innovators in the business, and Internet searching for relevant reports and studies in the field. The results show that the paper bag and the bioplastic bag both have shortcomings. Many of the shortcomings are related to the supplier/producer. Other problems such as misplaced waste, problems with mould, fly-maggots/flies etc. can be solved with information. Problems as corrosion on the collection vehicles and metallic substance in the plant have also been observed. A common problem when it comes to stores is how to best treat packaged material. Today there are treatment plants that treat certain packaged food waste, but a solution for glass is still missing. An issue which is not directly linked to the producer or the supplier is the issue of standardization of sorting equipment in kitchens. Many kitchens have own sorting equipment under the sink where the bags rarely fit. This leads to the bags being used in the wrong way. An important project would therefore be to gather the waste industry and kitchen suppliers to try to come up with a solution to this. There are a lot of technical problems in the process as arise when the biogas plant will digest the food waste as not are a homogenous material. The plants inquire for more effective technology for pretreatment the food waste and this could be a new research working. All that somehow affects the quality of digestate and compost are of interest to Waste Refinery, since quality issues are and will continue to be main issues within biological treatment

  20. Measurements of emissions during waste wood combustion to identify refurbishment needs; Maetning av emissioner vid foerbraenning av RT-flis foer att identifiera eventuella ombyggnadsaatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Lindau, Leif

    2003-01-01

    The background to this project is the new EU directive 2000/76/EG regarding incineration of waste. This directive may have an effect on emission limits for Swedish plants firing waste wood. It may lead to needs of refurbishment in e.g. the area of flue gas cleaning equipment. In order to produce a basis to evaluate the need for such upgrading, measurement of metals, HCI, SO{sub 2} , CO, TOC and dioxin have been carried out on three plants firing wood waste: a grate boiler (Handeloeverket P11), one circulating fluid bed boiler (Aaterbruket in Lomma), and a bubbling fluidised bed boiler (Johannes in Gaevle, firing 50% waste wood). The measurements have mainly been carried out after boiler, equivalent to upstream flue gas cleaning. The results are that the demands of the EU directive on most points can be managed with existing equipment if this consists of electrostatic precipitator or bag filter with good performance and flue gas condensor. Without flue gas condensor, there is a need for other measures for 1-10 and for grate boilers, SO{sub 2} as well. The requirements in the directive for TOC is weaker than the demand on CO, and correspondingly, the demand on CO is driving. The level of dioxin from the boiler (upstream filter) exceeds allowed emission, and is in the range of 0,1-2 ng TE/Nm{sup 3} tg, 6 % O{sub 2} . Existing equipment will meet the emission limit for the lower levels (0,1-0,3) , but not safely for the higher levels (1,5-2). Correspondingly, there may be a need for equipment upgrading, e.g. in the form of activated carbon injection upstream flue gas filter.

  1. Combustion tests in a solid fuel boiler to clarify the emissions when co-firing refuse; Proveldning i fastbraenslepanna foer att kartlaegga emissioner vid inblandning av olika avfallsfraktioner

    Energy Technology Data Exchange (ETDEWEB)

    Blom, Elisabet; Lundborg, Rickard; Wrangensten, Lars

    2002-04-01

    In this Vaermeforsk-project tests have been performed in a 60 MW moving grate steam boiler at Tekniska Verken in Linkoeping. The boiler plant has an electrostatic filter for dust reduction and also a flue gas condensing plant with heat recovery. Vaermeforsk has financed the project. During the tests the following fuel fractions have been injected into the reference fuel, a mix of recovered wood chips (70 %) and bark (30 %): Paper/plastic/wood fuel (10 % and 25 % injection on an energy basis); Meat powder (10 % and 25 % injection on an energy basis); Napkin waste (10 % injection on an energy basis); Leather waste (10 % injection on an energy basis). The highest lower heating value was noted for meat powder, approx. 24 MJ/kg with a moisture content of 3,4 %. The heating values for the other fuel fractions were on the same level or just beneath the corresponding heating value for the reference fuel. The highest chlorine content was found in the paper/plastic/wood fraction respectively the leather waste fraction with 1,2 and 1,4 % (weight) of chlorine. The meat powder had the highest nitrogen content but all the fuel mixes had a quite high content of nitrogen with values over 1 % (weight). Analyses of sulphur in the fuels showed that leather waste had the lowest content just over 0, 1 %, considered as a low sulphur level for fuels in general. However, there are problems to get balance between in- and output for sulphur and chlorine based on fuel analysis. Difficulties to take representative fuel samples, especially when it comes to chlorine, can be an explanation. Video camera recordings and flue gas analysis in the furnace showed that the injection of refuse fractions seems to improve the combustion conditions with better local combustion of CO and hydrocarbons. The results from the emission measurements in the chimney can be summarised as follows (emission values at 11 % O{sub 2}): the lowest CO emission was noted with 25 % meat powder injection (<50 mg/nm{sup 3}); The highest HCI emission, before the flue gas condensing plant, was noted for the reference fuel (approx. 245 Mg/nm{sup 3}); The highest SO{sub 2} emission, in the upper furnace, was also noted for the reference fuel (over 50 mg/nm{sup 3}). Levels after the condensing plant could not be measured. 25 % meat powder injection gave the highest NO{sub x}-emission (approx. 50 mg/MJ). The high heavy metal content in ash could not bee correlated to the content in the fuel fractions. The unburnt carbon content in bottom ash is remarkably lower for 25 % meat powder injection into reference fuel. The conclusion is that the operation parameters for the oiler are optimized for this specific fuel fraction and the amount injected. Tests with a fouling probe near the first superheater showed that at a temperature of 400 deg C 10% napkin waste gave most fouling. This is interesting as the lowest HCl-emission level was noted for napkins, maybe depending on that the chlorine is present in the depositions. The project results point in the direction that co-combustion of different refuse fractions will be possible within the existing environmental legislation and maybe also within the new EU directive 2000/76/EG. Although flue gas condensation is necessary to get acceptable emissions of HCl and SO{sub 2}. Further general research is thus needed and several R and D project areas are listed in the report. Deeper studies of the combustion process in furnace are important in future project.

  2. Additive as inhibitor of dioxin during co-combustion of wood and recovered fuel; Minskad dioxinbildning med hjaelp av additiv vid sameldning av skogsbraensle och returbraensle

    Energy Technology Data Exchange (ETDEWEB)

    Aurell, Johanna; Marklund, Stellan [Umeaa Univ. (Sweden). Environmental Chemistry; Kling, Aasa; Myringer, Aase [Vattenfall Utveckling AB, Aelvkarleby (Sweden)

    2005-05-01

    During co-combustion of biofuel and Refused Derived Fuels (RDF) there is a risk that the future level of allowed dioxin emissions could be exceeded. Dioxin can be reduced by primary combustion measures or secondary measures such as active carbon. The active carbon method is used in plants with high levels of dioxin and has a relatively high operation cost. To operate active carbon there is also need for fabric filter in the plant. The aim of the project was to investigate the potential of inhibition of dioxin formation during co-combustion of wood and recovered fuels by additives containing sulphur and nitrogen. The study was mainly conducted in pilot-scale but verifying measurements was also done in a full-scale boiler. Costs and synergy effects of the additives have been investigated. In the pilot-scale experiments a 5 kW fluidised bed reactor was used and the full-scale experiment was done at Johannes heat plant (bubbling fluidised bed). The additives ammonium sulphate, sulphur dioxide and ammonia were added in gas or liquid state. The additives containing sulphur had an inhibiting effect on the formation of dioxin in the study. The largest effect gave SO{sub 2} added with the primary air. It reduced the formation of dioxins and chloro benzenes by 58% and 73% respectively. The addition of ammonium sulphate reduced 41% of the dioxin formation and 77% of the chloro benzene formation. Nitrogen additives did not inhibit the formation of dioxin. The dioxin content in the full-scale, when co-combusting up to 25% recovered fuel, was very low (0,02-0,03 ng/Nm{sup 3}). A higher content of dioxin was measured when ammonia sulphate was added. This was probably due to the higher amount of recovered fuel (double amount) during the period when the ammonium sulphate was added. That changed the conditions of dioxin formation between the samples. The addition of sulphur was lower in the full-scale experiment compared to the pilot-scale experiments. In the full-scale experiments a sulphur:chlorine ratio of 1:1 was added, which gave about 25 ppm SO{sub 2} in the flue gas. This can be compared with the pilot-scale experiments with a sulphur:chlorine ratio of 4-6:1 that resulted in 200-300 ppm SO{sub 2}. These high amounts of sulphur in the flue-gas demand some sort of sulphur cleaning if it would be used in a full-scale plant. Based on the uncertainness in the experiments and the small amount of measurements no conclusions can been drawn concerning recommended amount additive to reduce the formation of dioxin. The conclusion is instead that the study should be complemented with further experiments. The addition of SO{sub 2} (or elementary sulphur in full-scale) is (individually) the most cost effective additive. The cost for sulphur is about 1,7 SEK/MWh, which can be compared to ammonia sulphate that cost about 2,3 SEK/MWh. Ammonia and urea are the most expensive additives and did not give any inhibited effect of the dioxin formation. The costs for the additives cannot be compared directly. The additives are often already used in the plant or, if a decision is made to use additive, there are other positive effects than dioxin inhibition. A complete cost-benefit valuation should therefore be carried out before making the choice of additive.

  3. vid116_0501c -- Point coverage of sediment observations from video collected during 2005 R/V Tatoosh camera sled survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A custom built camera sled outfitted with video equipment (and other devices) was deployed from the NOAA research vessel Tatoosh during August 2005. Video data from...

  4. Why the potent greenhouse gas laughing gas is formed in agriculture and forestry; Varfoer den starka vaexthusgasen lustgas bildas vid odling i jord- och skogsbruk

    Energy Technology Data Exchange (ETDEWEB)

    2009-12-15

    Natural activities such as agriculture and forestry, influence the concentration of greenhouse gases in the atmosphere. This is a survey of why nitrous oxide (N{sub 2}O) is produced in soil and how much is leaving the soil in different plantations. Mostly small amounts but sometimes high emissions of nitrous oxide occur, which is produced by soil fungi and bacteria converting nitrogen compounds. Denitrification is the process most often producing the greatest amounts of nitrous oxide but nitrification having a need for oxygen can be decisive since this process produces the nitrate needed in denitrification. Nitrous oxide is formed at occasions with oxygen shortage which can arise inside soil clods with high biological activity consuming the oxygen, or if the oxygen diffusion into the soil is slow since it is soaking wet or the soil pores have been compacted by for example tractor driving. Some techniques for measuring nitrous oxide leaving the soil to the air are described. To escape the tough work of measuring simple estimation methods are desired, and there are a few developed, but no one is reliable. The atmospheric nitrous oxide increase can be connected to the increased fixation of the air dinitrogen gas (N{sub 2}) into reactive nitrogen which is possible to use for living cells. Most nitrogen is fixed biologically in leguminous plants or in the manufacturing of fertilisers. Reactive nitrogen is decisive for plant photosynthesis function, but in most natural ecosystems available nitrogen is scarce so photosynthesis and plant production often increase when nitrogen is added. An increased production of bioenergy crops will increase the demand of more reactive nitrogen in addition to the nitrogen used in existing food production. Most of the soil nitrogen is tied to dead and living organic material and will not be available until the organic material is decomposed and the nitrogen is liberated. The plant community and competition between organisms of the available nitrogen can determine the nitrous oxide emission. This is one explanation why forest soils often present lower emissions than agricultural land. Another explanation of the lower emission from forests is that in Sweden and the rest of the world the most fertile soils are cultivated, while remaining forests in stony and less fertile areas suffer from nitrogen deficits. As long as the forest is growing, absorbing the nitrogen, the risk for nitrous oxide emission is low, but after clear cutting the risk increases. But there are forests where the nitrous oxide emission is high most of the time, such as fertile soils like drained fens with, typically, birch, raspberry and nettles. Biomass for energy use is sometimes specified as carbon dioxide neutral, since equal amounts of carbon dioxide is taken up by the photosynthesis as is released in the combustion or decomposition. But harvesting and manufacturing needs energy, often fossil, which adds carbon dioxide. Moreover, the cropping results in emission of nitrous oxide, which is a strong greenhouse gas with a long lifetime in the atmosphere. In the debate it has been claimed that, for climate reasons, the emission of nitrous oxide makes the exchange of oil for bioenergy meaningless. It can be concluded that biofuels almost always have a 'cost' of nitrous oxide and there is no climate neutral biofuel, but there are better and worse. In agriculture and forestry alike, the nitrous oxide production is influenced by management both in the short and the long run. As an example, addition of large amounts of nitrogen-fertilisers or manure increases the N{sub 2}O-emission when the available nitrogen exceeds the crop uptake capacity. But there are cropping systems as well where a low nitrous oxide emission has been measured in spite of an expected high emission. To get a minimum of nitrous oxide there is need for a tight connection between nitrogen liberation and plant uptake where minimal amounts are left to nitrification and denitrification. A naked soil, fallow, causes more nitrous oxide than having a crop on the land, and the more fertile the soil the higher the risk for the production of nitrous oxide. It is a challenge for both science and agricultural industry to develop agricultural methods that effectively catch the nitrogen in soil organic matter while enabling plants to yield a good harvest and yet minimize nitrous oxide production. Relating nitrous oxide to production of biomass this implies that forest products too, carry a 'cost' of nitrous oxide in spite of a low soil emission since the growth is smaller than in agriculture. Every change in agriculture and forestry production performed can have effects on the size of nitrous oxide emission, at the spot or in the surroundings or even in other countries. System analyses are needed to study the effects obtained. The EU commission has stated sustainability criterions that must be met if the biofuel is to be included in the class of renewable energy.

  5. vid119_0601b-- Point coverage of sediment types from video collected on AR-06/07 McArthurII research cruise.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Canadian ROPOS remotely operated vehicle (ROV) outfitted with video equipment (and other devices) was deployed from the NOAA Ship McAurthurII during May-June...

  6. vid116_0501s -- Point coverage of sediment observations from video collected during 2005 R/V Tatoosh camera sled survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A custom built camera sled outfitted with video equipment (and other devices) was deployed from the NOAA research vessel Tatoosh during August 2005. Video data from...

  7. vid116_0501d -- Point coverage of sediment observations from video collected during 2005 R/V Tatoosh camera sled survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A custom built camera sled outfitted with video equipment (and other devices) was deployed from the NOAA research vesselTatoosh during August 2005. Video data from...

  8. Optimisation Multi-Critères pour la Diffusion Vidéo au sein de l’Internet Media du Futur

    OpenAIRE

    Bruneau-Queyreix, Joachim

    2017-01-01

    Single-source HTTP Adaptive Streaming solutions (HAS) have become the de-facto solutions to deliver video over the Internet mostly due to their capabilities to increase end-user’s Quality of Experience (QoE) as well as their ease of deployment due to the usage of the HTTP protocol. Although HAS solutions can increase QoE by trading off the delivered video quality to minimize the number of video freezing events, they are limited by the bandwidth available on the considered communication channe...

  9. ARTISTS - huvudgator för alla : Vägledning för planerare och beslutsfattare vid utformning och ombyggnad av huvudgator

    OpenAIRE

    Svensson, Åse; Marshall, Stephen; Jones, Peter; Hydén, Christer; Draskoczy, Magda; Papaioannou, Panos; Thomsen, Hytte; Boujenko, Natalya

    2004-01-01

    Konventionella guider för utformning och förvaltning av trafikleder och stadsgator har vanligtvis inriktats antingen mot huvudtrafikleder eller mot lokala stadsgator. Det är för närvarande brist på ett tydligt och konsekvent angreppssätt för arbetet med utformning av huvudgator där signifikant genomfartstrafik och lokala funktioner kombineras. Målet är att denna rapport ska avhjälpa den bristen genom att presentera riktlinjer för utformning och förvaltning av huvudgator – med människan i foku...

  10. Human Reliability Analysis. Applicability of the HRA-concept in maintenance shutdown; Analys av maensklig tillfoerlitlighet. HRA-begreppets tillaempbarhet vid revisionsavstaellning

    Energy Technology Data Exchange (ETDEWEB)

    Obenius, Aino (MTO Psykologi AB, Stockholm (SE))

    2007-08-15

    Probabilistic Safety Analysis (PSA) is performed for Swedish nuclear power plants in order to make predictions and improvements of system safety. The analysis of the Three Mile Island and Chernobyl accidents contributed to broaden the approach to nuclear power plant safety. A system perspective focusing on the interaction between aspects of Man, Technology and Organization (MTO) emerged in addition to the development of Human Factors knowledge. To take the human influence on the technical system into consideration when performing PSAs, a Human Reliability Analysis (HRA) is performed. PSA is performed for different stages and plant operating states, and the current state of Swedish analyses is Low power and Shutdown (LPSD), also called Shutdown PSA (SPSA). The purpose of this master's thesis is to describe methods and basic models used when analysing human reliability for the LPSD state. The following questions are at issue: 1. How can the LPSD state be characterised and defined? 2. What is important to take into consideration when performing a LPSD HRA? 3. How can human behaviour be modelled for a LPSD risk analysis? 4. According to available empirical material, how are the questions above treated in performed analysis of human operation during LPSD? 5. How does the result of the questions above affect the way methods for analysis of LPSD could and/or should be developed? The procedure of this project has mainly consisted of literature studies of available theory for modelling of human behaviour and risk analysis of the LPSD state. This study regards analysis of planned outages when maintenance, fuel change, tests and inspections are performed. The outage period is characterised by planned maintenance activities performed in rotating 3-shifts, around the clock, as well as many of the persons performing work tasks on the plant being external contractors. The working conditions are characterised by stress due to heat, radiation and physically demanding or monotonous work tasks. Errors and mistakes during this plant operating state may have severe consequences, both on the immediate work, as well as on the future power production. The human influence on the technical system is of great importance when analysing the LPSD condition. This should also affect the basis and performance of the analysis, to make as a realistic analysis as possible. When analysing human operation during LPSD, a holistic perspective should be used. A way to take the human abilities and performance variability into consideration is important. The study of performed analysis of human reliability for the LPSD condition shows, that the normative and/or descriptive approach and the linear cause-effect model are used. The main objective of HRAs performed within SPSAs is the quantification of human interaction and error frequency. Modelling of human behaviour in complex, sociotechnical systems differs in theory and practice. A reason may be that models as the one for functional resonance, not yet are applicable for practising analysts, due to a lack of well tried methods and the fact that analysis of the LPSD condition is performed in the PSA concept, which defines the type of results sought from the HRA, i.e. probabilities for human error. LPSD analysis methods need to be further evaluated, validated and developed. The basis for the analysis should, instead of PSA, be a holistic analysis according to how Man, Technology and Organization affect the system and plant safety. To achieve this, further activities could be to perform an in-depth study of existing analysis of the LPSD condition, to develop specifications of requirement for LPSD analysis, to further validate the HRA work process as well as to further develop practically applicable methods for human performance and variability analysis in sociotechnical systems

  11. Handling of crisis situations in the electric power system; Krishantering i elsystemet. Elnaetbolags, kommuners och hushaalls uppfattningar om roller och ansvarsfoerdelning vid elavbrott

    Energy Technology Data Exchange (ETDEWEB)

    Palm, Jenny (Linkoepnig Univ., Linkoeping (SE). Dept. of Technology and Social Change)

    2007-12-15

    In this report municipalities, grid companies and electricity users' relations and responsibilities are discussed in connection to the actors experience during two storms named Per and Gudrun. Special focus is on households' action space, that is possibilities and constrains to uphold every day routines during outages. The material consists of case studies in Oestergoetland, involving a survey to households, interviews and participating observations. The theoretical perspective used is Karl Poppers' three worlds related to everyday life. World 1 is the physical and material world; World 2 consists of people's perception and ideas and World 3 is the cultural and social world. In world 1 is the importance of information and communication as well as spare power supply capacity discussed. Municipalities and grid companies emphasise Internet as an important communication tool. For the users the phone was the most important tool used during black-outs. One problem was however to get in contact with the energy company because of the overload on the companies' switchboard. Both the municipalities and the energy companies meant that they had enough spare power supply capacity. Around one third of the households said they had a portable generator to use during long lasting power outages. In relation to World 2 most households said that 12-24 hours power outages was acceptable, then the problems start for the households and they try to inform themselves of how long the outage will last. But some households never felt the need to contact anyone and they expressed a trust to the grid companies' competence to deal with the problems causing the outage. All actors state that the municipalities have a social responsibility to their citizens and must ensure that they do not suffer during outages. The grid companies' responsibilities according to the actors are to prevent power outages, repair damages and give the customers economical compensations. The households' responsibility for emergency management was fuzzier for the actors. Both municipalities and grid companies expected the customers to have some preparedness. The household meant that they lacked any responsibility to be prepared for an outage even if they need to be prepared to survive during the power loss. When it comes to economical compensation the grid companies meant that the compensation should cover the extra costs that the households had during an outage. The household thought that the compensation paid should cover the suffering that the households experienced due to not having electricity. On top of that the households felt they should have compensation for their expenses. World 3 consist of regulation and social networks. The networks between municipalities and grid companies differ. Some municipalities totally lacked cooperation and coordination with the grid companies, while others had established personal contacts and deep relations. Through the networks the municipalities could influence how the companies prioritize when they repaired the grid. The municipalities with well developed networks also had more knowledge and were better informed than municipalities lacking contacts. The households where not represented in any networks. The municipalities and companies instead developed different tools to inform the households such as Internet. The household used their networks consisting of neighbours and friends to be informed during black-outs. Neighbours' knowledge of each other is an important aspect of the emergency management in the rural areas. Municipalities' involvement in networks also influence if the municipality had priority lists or not. Municipalities engaged in networks with the energy companies had made priority lists. Municipalities without such involvement lacked priority lists and thought that it was not possible to make prioritizations between users

  12. Optimization of lime addition in a dry air pollution control device; Optimerad rening av HCl och SO{sub 2} med minskade kalktillsatser vid torr roeasrening

    Energy Technology Data Exchange (ETDEWEB)

    Wikstroem-Blomqvist, Evalena; Samuelsson, Jessica; Ohlsson, Anna

    2006-12-15

    The focus of this project is to optimize the absorption of hydrochloric acid (HCl) and sulphuric acid (SO{sub 2}) in a dry air pollution control device system connected to a waste combustor. A significant amount of absorbent are generally added into the processes to achieve an efficient cleaning of the flue gas. Reduced absorbent consumption has double benefits on the operative expenses due to decreased purchase and landfilling costs. The objective was to study the affect of flue gas temperature and moisture, (relative humidity, RH), on the efficiency of HCl and SO{sub 2} absorption on hydrated lime. Additionally, the efficiency of a pre-treated hydrated lime with larger specific surface and pore volume was investigated. The measuring campaign was conducted on the 20 MW fluidized bed waste incinerator own by Boraas Energi och Miljoe AB in Sweden. Results from 26 experimental days with normal hydrated lime showed a positive correlation between the efficiency of the lime and RH in the flue gas. Four levels of RH between 3.28% to 4.84% were tested. The levels were adjusted by lowering the flue gas temperature and/or by adding water to the waste fuel. The smallest effect where achieved by solely adding water to the waste fuel. RH increased solely to 3.62% and the amount of lime consumption was reduced with only 5% compare to normal condition. By lowering the flue gas temperature 10 deg C to 143 deg C, RH increased to 4.06% and the amount of lime added was reduced with 13%. The largest impact was found when both the flue gas temperature and the moisture content were changed. At those process conditions RH reach 4.84 % and the usage of lime were reduced with 26%. Additional 12 experimental days were conducted to evaluate the efficiency of a pretreated hydrated lime with larger specific surface and pore volume. The results showed that the surface enlarged absorbent was almost twice as effective as the normal hydrated lime. Moreover, the results indicated an equal dependency of variation in RH (valid within temperature window between 145-165 deg C) for the surface enlarged absorbent as for the one identified for normal hydrate lime. Results that showed additional potential to reduce in the amount of surfaced enlarged absorbent needed by optimizing the processes further. The annual operative expenses of the studied waste combustor can be reduced by 700,000 SEK (100,000 USD) by increasing the RH to 4.5% and thus reduce the amount of added normal hydrate lime with 20%. Furthermore, the annual cost can be reduced with additionally 700,000 SEK by using an absorbent with higher specific surface and pore volume. Evaluation of an on-line FTIR-system measuring the levels of HCl and SO{sub 2} in the raw gas of the waste incinerator showed the 80% of the HCl was detected in the gas-phase and 20% were capture on the particles. Reverse results were obtained for SO{sub 2}. However, the levels of SO{sub 2} in the flue gas were rather low, which may have affected the results.

  13. Sexe, mensonges et vidéo. Les discours normatifs sur le sexe contre les politiques scolaires sur l’égalité filles

    OpenAIRE

    Collet, Isabelle

    2015-01-01

    En France, en janvier 2014, dans la mouvance de la Manif’ pour tous, une campagne de désinformation a été lancée afin de convaincre les parents d’élèves qu’une « théorie-du-genre » était en train de s’infiltrer dans les écoles. La cible de ces attaques était le dispositif des ABCD de l’égalité, un ensemble de fiches pédagogiques destinées à mettre en œuvre des pratiques égalitaires dans les disciplines scolaires. Selon ses opposants, il s’agissait d’une entreprise de prosélytisme homosexuelle...

  14. Quality demand, raw material utilization and costs at a marked increase in the use of forest fuels; Kvalitetskrav, raavaruutnyttjande och kostnader vid kraftigt oekad anvaendning av skogsbraensle

    Energy Technology Data Exchange (ETDEWEB)

    Arlinger, John; Brunberg, Bengt; Eriksson, Mats; Thor, Magnus [Forestry Research Inst. of Sweden, Uppsala (Sweden)

    2001-03-01

    The work has been carried on in three steps: (1) Mapping of the present quality of forest fuels at heating and cogeneration utilities and pellets producers, (2) Calculation of gross supply of forest fuels in three forestry administrations at AssiDomaen in southern, central and northern Sweden, and (3) Analysis of costs and raw material utilization in three forestry administrations at AssiDomaen in southern, central and northern Sweden. A very detailed description of the results is given in three appendixes.

  15. Biological recipient control at the Ringhals nuclear power plant. Annual report for 2011; Biologisk recipientkontroll vid Ringhals kaernkraftverk. Aarsrapport foer 2011

    Energy Technology Data Exchange (ETDEWEB)

    Jansson, Maria; Gustavsson, Frida; Fagerholm, Bjoern

    2012-07-01

    The cooling system of the Ringhals nuclear power plant affects the fish community in two steps. In the first step, seawater is used to cool the system in the nuclear power plant. Fish eggs, larvae and small juveniles are carried by the incoming water and are exposed to risk of damage or mortality. In the second step the heated water is released back into the sea, where the fish is affected by the increase in temperature. Reactor 1 and reactor 3 at Ringhals nuclear power plant produced electricity during the major part of the year 2011, with exceptions for the annual audits, and shorter stops in production. Reactor 2 only operated between January and April, due to a fire which led to a shutdown and a thorough remediation work during the rest of the year. Reactor 4 was producing electricity from January to June, but was later shutdown due to a prolonged annual audit until November. Fish eggs and fish larvae are sampled in the incoming cooling water using a modified Bongo net to monitor losses of eggs and larvae in the nuclear power plant. The abundance of shorthorn sculpin larvae (Myoxocephalus scorpius) has decreased since the sampling period started, although it is still the most abundant larvae. Also the abundance of rock gunnel larvae (Pholis gunnellus) has decreased over the years. To sample juvenile fish a modified Isaacs-Kidd midwater-trawl is used. This sampling is mainly focused on glass eels (Anguilla anguilla). The abundance of glass eels have declined strongly since the beginning of the 1980's, but a minor increase was observed in 2011. The decline of the glass eel abundance is most probably due to a general decrease in recruitment and not to a local effect caused by the nuclear power plant. The effects of the heated water released into the sea are monitored by fykenet surveys in the recipient as well as in a reference area. These two areas are monitored in two seasons to compare differences between the two areas in naturally cold and warm water of the two seasons. There was a different development in the diversity of fish between the two areas in the cold season, where the recipient showed a decreasing trend in diversity and the reference area was stable with no trend. This is possibly an effect of the warm water emissions. Species which prefer warm water have been observed to concentrate in the recipient area. Eel and shore crabs (Carcinus maenas) are good examples, showing either stable or increasing catches in the area. Species which prefer cold water, as cod (Gadus morhua), shorthorn sculpin (Myoxocephalus scorpius) and eelpout (Zoarches viviparous) were less abundant in the recipient. No new findings for Swedish water of marine alien species were made in a scuba diving survey in four shallow areas near the outlet of cooling water from Ringhals (Ringhals udde, Baatafjorden, Norra Horta and Vendelsoe). Four species already established on the Swedish west coast were found however, the japanese oyster (Crassostrea gigas), two species of red algae Dasya baillouviana, Bonnemaisonia hamifera and one brown algae, the japanese wireweed (Sargassum muticum)

  16. Exposure conditions, lung function and airway symptoms in industrial production of wood pellets. A pilot project; Exponeringsfoerhaallanden, lungfunktion och luftvaegsbesaer vid industriell produktion av traepellets. Ett pilotprojekt

    Energy Technology Data Exchange (ETDEWEB)

    Edman, Katja; Loefstedt, Haakan; Berg, Peter; Bryngelsson, I.L.; Fedeli, Cecilia; Selden, Anders [Oerebro Univ. Hospital (Sweden). Yrkes- och miljoemedicinska kliniken; Eriksson, Kaare [Umeaa Univ. Hospital (Sweden); Holmstroem, Mats; Rask- Andersen, Anna [Uppsala Univ. Hospital (Sweden)

    2002-02-01

    The production of wood pellets is a relatively new branch of the Swedish wood industry and has increased during the last years. A pilot study was performed to investigate the prevalence of airway symptoms, lung function and exposure among all 39 men employed in industrial production of wood pellets at six companies. The study included a questionnaire, medical examination, registration of nasal-PEF (peak expiratory flow) during a week, allergy screening (Phadiatop) and lung function (spirometry) before and after work shift. The results were compared with different reference data from other Swedish studies. Exposure measurements of monoterpenes and wood dust on filter and with a data logger (DataRAM) were also performed. The study group reported a higher frequency of cough without phlegm, awakening due to breathlessness and current asthma medication compared with reference data. For five of the six participants with physician-diagnosed asthma the disease debuted before the current employment and the results did not indicate an unusual asthma morbidity. Spirometry showed lower lung function before work shift than expected. However no difference over work shift was observed. A negative and non-significant correlation was seen between time with current work task and lung function. The study group reported a higher frequency of nasal symptoms mostly blockage, sneezing and dryness compared with reference data. The registrations of nasal-PEF did not show any differences between work and spare time. The prevalence of positive Phadiatop (23 %) did not differ from reference data. No association between exposure (wood dust and monoterpenes) and acute effects on lung function was observed. The wood dust exposure (0.16-19 mg/m{sup 3}) was high and 11 of 24 measurements exceeded the present Swedish occupational exposure limit of 2 mg/m{sup 3}. Peak exposures could be identified, e.g. at cleaning of engines with compressed air, with the DataRAM. The exposure to monoterpenes (0.64 and 24 mg/m{sup 3}) was low compared with the present Swedish limit of 150 mg/m{sup 3}. The monoterpene exposure does not seem to be a health or exposure problem in industrial production of wood pellets but wood dust exposure can effect the airways negatively. In this study the levels of wood dust were high and the study group reported more airway symptoms than expected. However the effect on lung function was small, but steps to reduce wood dust exposure should be done.

  17. Modulateurs, médiateurs et effets à court et long terme des jeux vidéos violents sur les conduites agressives

    OpenAIRE

    Hasan, Youssef

    2012-01-01

    Violent video games are considered as a risk factor for violence. A fairly broad consensus today is shared among the majority of researchers. A new generation of research must now work to determine 1. if there are more at risk player profiles 2. causal mechanisms by which violent video games increase aggressive behavior. Through six studies including a cross-sectional research and five experimental research studies, we provide a new perspective on the mediators and moderators of violent video...

  18. Experience of the environmental impact in the use of MSWI bottom ash as subbase layer; Erfarenheter av miljoepaaverkan vid anvaendning av slaggrus som foerstaerkningslager

    Energy Technology Data Exchange (ETDEWEB)

    Flyhammar, Peter

    2008-12-15

    This report presents an evaluation of the environmental impact that the use of MSWI bottom ash as a subbase layer in asphalt parking spaces and drives can cause. The focus has been on the migration of mobile ions such as salts (chloride and sulfate), because these substances can be used as early indicators of the migration of contaminants. The results can be seen as a conservative assessment of other types of substances which are less soluble and mobile. The background of the project was that the Malmoe City Environmental Department wanted an evaluation of the environmental impact caused by the use of bottom ash in the area of Svaagertorp, just south of Malmoe urban area, because elevated levels of chloride and sulfate in water samples from several ground water pipes were found. In response to this request, Sysav Utveckling initiated a project to assess the environmental impact of the current object. At Svaagertorp, bottom ash has been used to build a number of parking spaces and drives. A relatively large amount of bottom ash (approximately 40 000 tons) have been used. The aim of the project was to investigate the environmental impacts of the use of bottom ash in construction projects. To achieve this objective, the project should describe and evaluate the importance of various sources of pollution (the source term) describe the mechanisms that control the migration of contaminants in the area describe the local environmental impact. The evaluation of the environmental consequences was based on a synthesis of several different field studies and analysis; resistivity soundings with cpt-probe, surface resistivity measurements with a measuring system of the type ABDEM Lund Imaging System, analysis of surface and ground water samples and analysis of soil samples and soil profiles. Numerical modeling of two simplified scenarios was used to support the interpretations of the results from field surveys. Environmental impacts at Svaagertorp The overall assessment within the framework of this project is that an increased influx of chloride and sulfate to the study area as a result of the expansion of the Svaagertorp area will have no measurable impact on the groundwater in the bedrock aquifer. However, there will be some local impact on the subsoil and groundwater in the clay till, but the impact will vary considerably. This is, however, a minor problem because the groundwater in the till is not a water resource worth protecting, while it may be influenced by past activities such as agricultural management. The clay till acts as an effective barrier which prevents emissions at the surface to affect the bedrock aquifer by long transport times for contaminates and diversion, storage and dilution. Road salt used for deicing in parking spaces and drives is mainly diverted from the study area via various storm water systems. Some water, however, will infiltrate into the ground at infiltration areas and percolation and detention trenches. Contaminated storm water which infiltrated into the ground and leachate from the bottom ash is likely to migrate mainly horizontally in the upper more permeable soil layers. The horizontal migration of dissolved substances such as chloride and sulfate is limited by drains and cable and pipe trenches. A certain amount of the emissions will be spread and stored in the clay till. Less mobile substances such as heavy metals will be spread very slowly in the clay till. The presence of detention and percolation trenches and reduced ground water levels in the till can increase the migration of chloride and sulfate in the clay till in the K-Rauta subarea. However, the effects on the groundwater in the bedrock aquifer is limited because the groundwater in the clay till in subarea K-Rauta is likely to be drained towards the road cut north of Yttre Ringleden, while the leakage from the till to the bedrock is small. It should be noted that the results of the control program does not tell much about the environmental impact, especially the impact of the groundwater resources worth protecting beneath the clay till. Observed changes in chloride and sulfate concentrations in groundwater from the till are also determined largely by the location of the ground water pipes, and how they were installed. The most rapid changes can be expected in infiltration zones (green areas, detention trenches and detention ponds and percolation trenches), especially if the ground water pipes are not sealed with bentonite. Outside the infiltration zones, however, the changes are controlled to a large extent by slow transports in the till. Recommendations The experiences of this project indicate that it is important that the purpose of an environmental control program is well defined and that the information from the control points can be used to achieve the stated objective, especially when bottom ash is used in load-bearing constructions on subgrades with low permeability.

  19. Human dimensions in energy consumption. Scientific research front from a national and international perspective; Maenskliga dimensioner vid energianvaendning. Vetenskaplig forskningsfront ur nationellt och internationellt perspektiv

    Energy Technology Data Exchange (ETDEWEB)

    Ketola, Anna

    2000-07-01

    The aim of this report is to make an inventory of earlier studies of energy consumption in buildings where consideration has been taken to behaviour related and among all socio-cultural aspects. The literature study is focused on publications from 1980s and 1990s, and mainly concentrated to socio-cultural analyses. The report catches the national and international scientific discussion that have been conducted, and the debate of today within this field.

  20. vid113_0401q -- Point coverage of sediment types from video collected on AR-04-04 McArthurII research cruise.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A Phantom DH2+2 remotely operated vehicle (ROV) outfitted with video equipment (and other devices) was deployed from the NOAA Ship McAurthurII (AR04-04) in an...

  1. vid113_0401d -- Point coverage of sediment types from video collected on AR-04-04 McArthurII research cruise.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A Phantom DH2+2 remotely operated vehicle (ROV) outfitted with video equipment (and other devices) was deployed fromthe NOAA Ship McAurthurII (AR04-04) in an attempt...

  2. Sealing layer of fly ashes and sewage sludge and vegetation establishment in treatment of mine tailings impoundments; Flygaska och roetslam som taetskikt vid efterbehandling av sandmagasin med vegetationsetablering

    Energy Technology Data Exchange (ETDEWEB)

    Greger, Maria; Neuschuetz, Clara [Stockholm Univ. (Sweden). Dept. of Botany; Isaksson, Karl-Erik [Boliden Mineral AB (Sweden)

    2006-02-15

    Each year the Swedish mining industry produces 25 Mtonnes of mine tailings that are disposed of in extensive natural impoundments. As this sand, containing more or less sulphide-rich minerals, is penetrated by oxygen and water, it starts weathering resulting in formation of acidic and metal-rich drainage water. To prevent oxygen penetration the mine tailings can be covered with a sealing layer covered with a protective cover that facilitates establishment of vegetation. The aim of this study has been to examine the function of fly ash and sewage sludge in sealing layers at impoundments of pyrite rich mine tailings, and the ability of different plant species, which are suitable for establishment in these areas, to penetrate the sealing layer with their roots and what impact they have on the drainage water. Experiments have been performed in field and greenhouse environment, with sealing layers consisting of fly ash and sewage sludge mixtures, covered with protective covers of sewage sludge or till. Plant establishment has been studied in a survey of naturally established plants at sewage sludge disposal sites close to mining areas, and by sowing and planting of selected plants, for instance fast growing grass species and fibre hemp at the test plots in field and in greenhouse experiments. Large scale application of ashes, sewage sludge and an ash/sludge mixture have been performed in field at three test plots with the size of 0.3-1 ha. Leakage of nutrients and metals from sealing layers has been studied in field and greenhouse tests. In addition, the ability of plant roots to penetrate sealing layers made of different ash/sludge mixtures have been examined in greenhouse experiments. This investigation is a cooperation between Stockholm University and Boliden Mineral AB, and the field experiments have been performed at the mine tailings impoundments at Gillervattnet, Boliden. Other collaborating participants are Skellefteaa Kraft and Munksund, who have produced the ashes that have been used, and Stockholm Vatten AB, who has produced the sewage sludge. The main conclusions from this study are: It is practically possible to construct a sealing layer of fly ash upon mine tailings, and to establish plants by sowing in a protective cover of sewage sludge. Transferral of plantlets into the sludge is, however, problematic. Addition of sewage sludge to ash-containing sealing layers has several drawbacks. When sewage sludge freezes it is not possible to mix with ashes and thereby form a satisfactory sealing layer, with the method used in this study. Such sealing layer can thus not be constructed winter-time, which is the time when large amounts of ashes are produced and the mine tailings are firm enough to work upon. Furthermore, addition of sewage sludge to sealing layers increases the risk of root penetration and do not seem to have as great impact on the sealing layer permeability as has earlier been considered. Concentrations of many elements are higher in drainage water from mine waste covered with fly ash compared to drainage water from mine waste covered with sludge or mixtures of ash and sludge. Sewage sludge thus seems to have a preventive effect on metal leakage caused by the ash. Sealing layers made of fly ash have good resistance to root penetration due to high density and high degree of packing. Moreover, many ashes are toxic to plant roots as a result of high pH and alkalinity, and high levels of toxic substances, such as heavy metals. Addition of sewage sludge increases the risk of root penetration, since the sludge contains plant nutrients, for instance nitrogen, as well as it may decrease the density and possible toxicity of the ash sealing layer. The energy crop Reed Canary-grass generally reduces the leakage of nutrient elements from sewage sludge and fly ash, partly by decreasing the amount of drainage water, but also by changing the conditions in the substrate, for instance by changing the pH and redox potential. If the alkalinity is not too high the plant roots have an ability to decrease the pH in the plant substrate. Different plant species have varying ability to penetrate sealing layers. Roots of Reed Canary-grass may pulverize a hardened ash layer, probably by decreasing pH and taking up water and thereby desiccating the layer. Colt's-foot and birch are plant species with lower ability to penetrate ash-containing sealing layers. By time as the ashes become aged they seem to become penetrated by roots more easily, possibly due to a decreased pH. The conclusion from this work so far is that even though sewage sludge should not be mixed with ash in the sealing layer, due to practical difficulties and increased risk of root penetration, the presence of sewage sludge has a decreasing effect on metal levels in the drainage water. Establishment of vegetation should be performed through sowing, and plant species with low ability to penetrate sealing layers of fly ash with their roots should be chosen. Root penetration is most efficiently prevented by thorough packing of the ash layer, which also results in a low permeability, and by using ashes with high pH and high levels of toxic substances.

  3. Contrôler des populations par l’espace? Prévention situationnelle et vidéosurveillance dans les gares et les centres commerciaux

    NARCIS (Netherlands)

    Bonnet, F.

    2012-01-01

    This article focuses on situational crime prevention, a security policy which involves the shaping of space to reduce the likelihood of crime. Specifically, it focuses on the uses of situational crime prevention in two railway stations and two shopping centers. Different situational crime prevention

  4. Long term effects on wet stored calcium rich fly ash with bearing on ground improvement work; Laangtidspaaverkan av kalkrika flygaskor vid vaatlagring foer anvaendning inom markstabilisering

    Energy Technology Data Exchange (ETDEWEB)

    Lagerlund, Johan; Jansing, Christiane

    2012-02-15

    Generation of electricity and heat by means of thermal power demands a product that can be ignited. This combustible material is usually coal, oil, gas, biomass and waste. If using solid fuels as coal, biomass and waste a by product known as ash is formed in the process; FA, (FA) and bottom ash. Roughly 600 Mt ashes are annually produced throughout the world and 70 weight % of these ashes are FA, 25 weight % bottom ashes and 5 weight % slag. 41 weight % of all ashes are annually reused in some form. Given the environmental impact of combustion i.e. CO{sub 2} emissions, a widened use of biomass fuels and co-combustion is expected in the near future. This will however create new problems when reusing ashes and FA in particular. The reuse of FA within the concrete industry stand for a total of about 25 % but the reuse of non-coal derived FA in the concrete industry is prohibited. Non-coal derived FA usually has higher amounts of calcium oxide, which acts expansively in concrete. Less than 20 % of biomass or co-combustion FA are reused today in Europe. A new standard, the EN 450, is however under construction. This standard will deal with the reuse of noncoal derived FA within the cement and concrete industry. In Sweden, coal is very seldom used as a fuel. More common is the use of biomass, peat and waste. It means that the FA are all non-coal derived and thus derived from reuse within the cement and concrete industry. Beside their non-coal origin, the main part of the FA is produced during November- March. This means that it might be hard to find available FA all year around, making the reuse of FA less attractive. Hence, FA must be stored prior to use. Little research have been made on the storage of calcium rich FA from biomass and co-combustion. Storing FA in a cheap way requires an addition of water to prevent from dusting when stockpiled outdoors. Addition of water in calcium rich FA will however cause an hardening of the material, thus causing detrimental effects within the FA

  5. Framework for detailed studies on the construction and operation of repositories for spent nuclear fuel; Ramprogram foer detaljundersoekningar vid uppfoerande och drift av slutfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    2010-10-15

    This report presents a programme for the detailed investigations planned to be applied during construction and operation of the repository for spent nuclear fuel at Forsmark. The report is part of SKB's application according to the Nuclear Activities Act. The detailed investigations shall provide relevant data on and site-descriptive models for the bedrock, soil deposits and eco-system of the site in order to facilitate a step-wise design and construction of the final repository. This shall be implemented in a manner that all demands on long-term safety are fulfilled, including accurate documentation of the construction work, and so that assessments of the environmental impact of the repository can be made. For the operational phase, the detailed investigations should also provide support to the deposition process with related decisions, thereby enabling fulfilment of the design premises for the siting and construction of deposition tunnels and deposition holes, as well as for deposition of canisters, and for the subsequent backfilling and closure of the repository. The Observational Method will be applied during the construction of the repository. This method entails establishing in advance acceptable limits of behaviour regarding selected geoscientific parameters and preparing a plan with measures to keep the outcome within these limits. Predictions of expected rock properties are established for each tunnel section. The outcome after excavation is compared with the acceptable range of outcomes. Information from detailed characterization will be of essential importance for application of the Observational Method and for adapting the repository to the prevailing rock properties. SKB has for the past several decades developed methods for site characterisation, applying both above- and underground investigation techniques. Experiences from this work, put into practice during the site investigations, has resulted in a solid knowledge and understanding of the bedrock conditions at Forsmark. The detailed investigations will employ, apart from established and earlier practiced methods, also further refined and newly developed techniques and methods for investigations and modelling. The report describes the present status for investigation and modelling methodology and techniques and also provides an overview of currently planned method developments. The report also presents a proposed scenario for how the detailed investigations, in light of presently available knowledge and techniques, should be conducted. Starting points for the investigation programme in this context are the reference design of the facility and remaining uncertainties associated with the site descriptive model and underground design. The scenario high-lights those investigations which, more or less as a matter of routine work, will be performed closely coordinated with the progression of the underground excavation work. The investigations related to the development of the deposition areas will primarily be linked to the sequences pilot drilling followed by excavation of deposition tunnels, and pilot drilling with subsequent full-face drilling of deposition holes. Continuous supervision of the fulfilment of design premises and documentation of the facility are in this context important issues. Information acquired during the construction process will also provide the substantial basis for the assessment of the long-term safety of the final repository. Further, it is emphasised in the report that supplementary investigations will be performed, if the information in any respect is regarded as insufficient. Such investigations may as well be performed from the ground surface. The final repository will in different ways have an impact on the surrounding environment. Monitoring of such changes is therefore an important and integral part of the detailed investigations. Until the construction work for the final repository is initiated, the detailed investigation programme will be modified and made more circumstantial, including results of planned developments . These updates will be accounted for in ensuing versions of the programme

  6. Abatement Technologies for Volatile Organic Compounds in Emissions from Biofuel Driers; Reningsteknik foer organiska aemnen i utslaepp till luft vid biobraensletorkning

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Karin; Ehrstedt, Thomas [Sycon Energikonsult AB, Malmoe (Sweden)

    2000-06-01

    This report is a part of a program at Vaermeforsk called Drying of Biofuels and deals with abatement technologies for volatile organic compounds (VOC) in biofuel drier emissions. The report gives an account of the amount of organic matter in wood and in drying gases and also of different abatement technologies for VOC. Processes from about 20 contractors are briefly described. The conclusions from this work are that thermal or catalytic oxidizing technologies in connection with regenerative heat recovery seems to be the most suitable technique for this application. Both technologies should give a degree of purification above 95 %. The purification cost for a typical case has been estimated to about 22 SEK per kg removed organic matter in both cases. The investment cost is higher for the catalytic oxidizer (6-20 MSEK for a 60.000 Nm{sup 3} /h catalytic plant compared to 4-6,5 MSEK for a thermal plant) but the fuel cost is lower. Condensation is a usable technique but it suffers from bad degree of purification. By using a wet electrostatic precipitator (WESP) the degree of purification can be enhanced but it will still be lower than for the oxidizers. Adsorption and absorption are not suitable for gases at high temperatures containing several different organic compounds at low concentrations, which is the case in biofuel drying. This means high purification costs and low degree of purification. Other technologies that have been found less suitable are biological purification and membrane technology. World-wide there are a few reference plants based on thermal oxidizing in connection with biofuel drying. Otherwise the experiences are very limited. According to this, tests in pilot plant scale are recommended before investment in a full-scale plant for biofuel driers.

  7. Offshore wind power - Possibilities and shortcomings in the planning and design; Vindkraft till havs - Moejligheter och brister vid planering och projektering

    Energy Technology Data Exchange (ETDEWEB)

    Andre, Daniel

    2010-02-15

    The purpose of this report is to examine how the planning preparedness offshore unfolds. Planning conditions of municipalities have been investigated through interviews with municipal planners and representatives of the wind power stakeholders. At the same time, the problems and deficiencies that impede the expansion of offshore wind power have been identified. In the report, based on the survey of the state of planning, as well as the shortcomings of current systems, the Swedish National Board of Housing, Building and Planning presents opportunities for improvements. With these proposals the Swedish National Board of Housing, Building and Planning opens up for an increased cooperation with the aim to facilitate a future expansion of offshore wind power. The report primarily addresses central government agencies and authorities, county councils, as well as planners or other officers of the national, regional and municipal levels

  8. vid119_0601a-- Point coverage of sediment types from video collected on AR-06/07 McArthurII research cruise.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Canadian ROPOS remotely operated vehicle (ROV) outfitted with video equipment (and other devices) was deployed fromthe NOAA Ship McAurthurII during May-June 2006...

  9. Videosorveglianza come supporto interattivo / La vidéosurveillance comme support intéractif / Video surveillance as an interactive support

    Directory of Open Access Journals (Sweden)

    Dischi Franco

    2010-03-01

    Full Text Available Video surveillance is not and cannot be considered a system of image acquistions “end in itself”.The acquired audio-visual “product”, in addition to surveillance and security, provides a useful source of information in case of storage and automatic analysis of data in urban planning to optimise land resources and means of support, for example environmental monitoring to protect habitat, land and ecosystem.These are behavioural precognitive models of video analysis, for a perceptive context of the situation of danger.

  10. Survey lines of the video and photos from the mini-SEABOSS sampling system acquired in Boston Harbor and approaches (surveylines_vid)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — These data are the trackline from the seafloor photograph and video survey conducted September 2004 using the mini-SeaBOSS sampling system on the R/V Rafael in...

  11. Studies on planting, weed control and fertilizing when growing short rotation willow coppice; Utvaerdering av teknik foer plantering, ograesbekaempning och goedsling vid salixodling. Studier 1997

    Energy Technology Data Exchange (ETDEWEB)

    Danfors, B.

    1998-12-01

    The report describes work studies into planting of Salix, weed control in newly planted plantations and annual stands, and fertilization in tall stands of Salix. The study is a continuation of work on Salix performed at JTI during 1989 and 1991. The report gives a description of the background to the problem, a brief review of earlier work, a description of the purpose of the study, and an account of its planning, extent and accomplishment. The results presented cover planting and weed control at four sites with an early follow-up of results, a description of the weed control and, further, a review of the results after the end of the growing season. The fertilization procedure used on six occasions is also discussed, together with spreading results using diagrams illustrating the distribution of the fertilizer. As mentioned above, similar studies were conducted at JTI during 1989 and 1991 In comparisons both concerning the level of knowledge and access to mechanical equipment, we may note that there has been considerable development within the sectors dealing with planting, weed control and fertilizing. Continued major tasks are to take the technical development further and to disseminate the new knowledge to growers prepared to invest in production of Salix as biofuel 13 refs, 18 figs, 9 figs

  12. Influence of sulphur addition on emissions of organic substances during combustion; Inverkan av formen av svaveladditiv paa emissionerna av kolmonoxid och organiska aemnen vid foerbraenning

    Energy Technology Data Exchange (ETDEWEB)

    Bjurstroem, Henrik; Jonsson, Claes; Almark, Matts; Berg, Magnus; Streibel, Thorsten; Zimmermann, Ralf

    2008-02-15

    Reduction of emissions of carbon monoxide and organic substances by injecting either ammonium sulphate or elemental sulphur and the importance of the point of injection has been investigated in full scale in a grate-fired bark boiler. The effect was monitored downstream of the economizer and air preheater, immediately upstream of the electrostatic precipitator. Concentrations determined in the comprehensive monitoring program include principally carbon monoxide, TOC and several organic substances, including PAH, PCDD/F and polychlorinated benzenes (PCBz). Additionally, the gaseous PAH were determined on-line using a novel mass spectrometer, REMPI-TOF MS, that measures specifically the 2- to 4-ring PAH's. All concentrations of substances of interest here fluctuate in concert and peak simultaneously. The relationship between the concentrations is not straightforward: there appears to be a threshold in carbon monoxide concentration. Below this threshold, the concentration of organics is low and above it concentrations increase rapidly with increasing carbon monoxide concentration. It has been confirmed that using sulphur additives not only reduces the concentration of carbon monoxide, but also that of organic substances in the flue gases. These additives do not only reduce the mean level of concentrations, but also dampen the fluctuations in these concentrations. Any measure leading to a reduction in carbon monoxide will also decrease the concentration of most organics, under the conditions prevalent in this boiler. Both additives tested are equally effective per kg of pure sulphur. The point of injection, in the fuel or above the grate, is not important. The PCDD/F concentration in the flue gases is very low even without additives, and the effect of sulphur on these emissions is therefore difficult to observe. Here, the effect is masked by the variation of data. The PAH concentration is lowered by an injection of sulphur additives. The variation in data is though rather large, which may be caused by variation in particle content in the gas samples

  13. Effects of harvest season prolongation on survival and growth of willow; Effekter paa oeverlevnad och tillvaext vid foerlaengd skoerdesaesong av salix

    Energy Technology Data Exchange (ETDEWEB)

    Nordh, Nils-Erik

    2010-06-15

    Willow normally is harvested in Sweden during the winter period, when the plants are in dormancy, the soil is frozen and able to carry heavy machinery, and when the chips can be transported directly to the district heating plants. Mild and wet winters often cause harvest delays and may hamper supply of fuel to the heating plants. During the harvest season 2006/2007 only a minor part of the planned harvest could be performed, which resulted in a one-year delay of harvest of about 3000 hectares of willow. Similar problems occurred during the following harvest season. The above experiences stressed the need for a prolonged harvest season, partly to perform harvests before stem dimensions become too large for conventional harvesters, and partly to guaranty security of supply to the heating stations. Many actors on the market have shown a strong interest in prolonging the harvest season. To test the effects of harvest season, two field trials containing the clone 'Tora' were established on the farms Flosta, Altuna, 25 km north of Enkoeping, and on Teda Risberga, about 10 km south of Enkoeping. The plantation at Flosta was about to be harvested for the first time, while the stand at Teda was going to be harvested for the second time. Both plantations are located on clay soils, representative for the Maelardalen district. At both sites, seven harvests were performed, from mid-September until mid-June. Biomass at harvest and regrowth after one season were determined. A phenology study was performed to assess growth cessation and growth start, and at each of the harvests, leaf biomass also was estimated. Plant survival after harvest was nearly 100% in all cases. There was a high correlation between plant weight at harvest and regrowth during the following season. Regrowth after the different harvest occasions varied and was highest for the harvests under January, March and April at both sites. In Flosta, the September harvest and the late spring harvests were lower than the winter harvests. Teda Risberga displayed the same trends, except for the September harvest, which was at the same level as the winter harvests. This project shows that it is possible to harvest the clone 'Tora' both in late spring when growth has commenced and also early in autumn when the plants are not dormant yet, without increasing the risk for plant mortality. However, biomass production during the first season after harvest may be slightly decreased. Under the circumstances were it is necessary to harvest to prevent shoots from attaining too large dimensions to be harvested conventionally, it is possible to harvest 'Tora' from late September until June, without increasing the risk for plant mortality, but with a risk for a slightly deceased regrowth. These observations are valid for the clone 'Tora' in the Maelardalen district

  14. Mechanical pre-treatment for enzymatically enhanced energy efficient TMP; Mekanisk foerbehandling av flis foer effektiv enzymatisk paaverkan vid energieffektiv TMP tillverkning

    Energy Technology Data Exchange (ETDEWEB)

    Viforr, Silvia

    2008-11-15

    Thermomechanical pulp (TMP) processes are high energy demanding. This together with the high energy prices of nowadays results in significant costs, why less energy demanding processes are wished. This project has evaluated the potential for energy reductions in a TMP process by a mechanical pre-treatment of the wood chips combined with an enzymatic modification based on a cellulase mixture. The structure of the wood was opened up by the mechanical pre-treatment making it easier for the enzymes to penetrate into the pre-treated wood material. The enzymatic treatment was then run at optimum standard conditions. The EU project - Ecotarget 2004-2008 (www.ecotarget.com) have studied different types of enzymes that could be used for pre-treatment of wood chips in order to save energy during TMP processes. Based on these studies cellulose enzyme was recommended to be used at pre-treatment experiment performed by the Vaermeforsk project. Due to the fact that the Ecotarget-project has also been run during 2008 with activities involving enzymes, the steering board of the Vaermeforsk project took the decision to co-ordinate the experiments from both of the projects. This co-operation increased the funds and also the number of experiments for both of the projects. The experimental results from this project showed that energy reductions at a given tensile index could be achieved if gently mechanical pre-treated wood chips were enzymatically treated. An intensive mechanical pre-treatment gave negative effects on both fibre length and tear index while the light scattering coefficient was promoted, probably due to the fibre shortening. Enzymatic modification of mechanically pre-treated chips showed a favourable modification of the fibres, even regarding the fibre shortening, if compared to mechanical pre-treated chips only. The effects of cellulases was however not as expected, why a high amount of cellulases was used. Other types of enzymes which could attack the primary wall of the wood cell should be tested in mechanical pre-treatment of wood chips for energy savings in TMP processes. Such enzymes could be xylanases, pectinases or proteases. New equipments that could pre-treat wood chips more gently may also be desired

  15. How much Nitrous Oxide is produced in cultivation of biofuels on arable land in Sweden?; Hur mycket lustgas blir det vid odling av biobraenslen paa aakermark i Sverige?

    Energy Technology Data Exchange (ETDEWEB)

    Kasimir Klemedtsson, Aasa (Univ. of Goeteborg, Dept. of Earth Sciences, Goeteborg (Sweden). Physical Geography)

    2010-03-15

    Several methods that can be used to estimate the emission of nitrous oxide from arable land are discussed, all of them with their pros and cons. 1 The base for all estimation methods is field measurements, well executed with a technique designed for the production of high quality data. Published field data of good quality were collected from areas in north Europe and America, both from grain and rape crops and unfertilised grasslands where natural background emission is assumed. The compilation shows that grasslands emit in average 0.3 +- 0.1 kg N{sub 2}O-N/ha/year. In crop systems where a high amount of nitrogen is repeatedly added to the soil, the soil N store will contribute to N{sub 2}O emission coming years. This is one reason why emission is higher for unfertilised arable land (where nitrogen have been added previous years) compared to unfertilised grassland, 1 +- 0.1 kg N{sub 2}O-N/ha/year. Fertilised arable lands have higher emission, in average around 3 kg N{sub 2}O-N/ha/year. In comparison, field measurements in Sweden have shown lower emission, 0.6 and 2 kg N{sub 2}O-N/ha/year from clay and sandy soil respectively. 2 The IPCC method is the best known, where the emission from arable land is estimated as a function of added nitrogen. In reality there is no correlation between a low N-addition and the emission of nitrous oxide since the N-addition needs to be high to have influence on the nitrous oxide emission..25 or the new factor 1% of added N has been used in many LCA's as an estimator for nitrous oxide and the uncertainty span of 0,3 and 3% is seldom used. The method underestimates the size of nitrous oxide emission in many systems and cannot estimate a true emission from individual fields. 3 Globally there is a connection between the increase in reactive nitrogen and the increase of atmospheric nitrous oxide, which is the base for a method suggested by Crutzen et al. Nitrous oxide emission has been estimated to be 3-5% of both biological nitrogen fixation and fertiliser production. 4 The complexity of nitrous oxide production has caused attempts to include other influencing factors as well. Two statistical methods and the process model PnET-N-DNDC has been taken as examples. Important for these estimations of emission is the amount of available soil nitrogen and the freezing of soil. Nitrous oxide estimation by these methods results in higher emissions than shown by Swedish field data. 5 Stating and motivating a realistic size of the nitrous oxide emission from agriculture and forestry is important. Therefore field measurements and development of the process model Coup are performed. Coup computes processes in the soil and plant system and has, up to now, mostly been used to understand the processes. From now on it can also be used as a tool for assessing nitrous oxide emission from both forest and agricultural land. Since Swedish field data point to lower emission than the estimation methods provide, we are looking for a method better adapted for the estimation of emissions from Swedish agriculture. We must pinpoint clearly which circumstances lead to the high emissions we want to avoid and, in contrast, which ones give low emissions. For this more field data is of need and process based model calculations to give good answers. If everyone uses a method that shows lower emissions without proving the matter of fact, the total nitrous oxide emission from cropping systems in Europe will be underestimated. The use of the IPCC emission factor often results in lower nitrous oxide emission than 3 kg N{sub 2}O-N/ha/year. Moreover, with the IPCC method fertilised effective cropping systems having a low emission will not get credit since fertiliser addition is the only factor on which emission is calculated. And in a near future the growing agricultural production of food, feed and energy needs a minimum of nitrous oxide emission, which will be ever-increasingly important. I suggest using local data or estimation methods validated on local data for emission assessment from bio-energy cropping systems. If no local data or process model a re available I suggest the use of a method that calculates emissions around the European average value 3 kg N{sub 2}O-N/ha/year

  16. Tidsupplösning vid miljövärdering av fjärrvärme : Kontorsbyggnad med solvärmeproduktion - en fallstudie

    OpenAIRE

    Lätt, Ambjörn

    2015-01-01

    The demand for environmental assessments on buildings and energy consumption is increasing as well as the energy performance requirements for buildings. At the same time it is increasingly common with self-producers of heat and electricity generation. The main purpose with this master thesis is to investigate how time resolution affects the environmental assessment of energy consumption in office buildings connected to district heating (DH). Environmental assessments were done with both attri...

  17. Supervision of Waste Management and Environmental Protection at the Swedish Nuclear Facilities 2001; Avfall och miljoe vid de kaerntekniska anlaeggningarna. Tillsynsrapport 2001

    Energy Technology Data Exchange (ETDEWEB)

    Persson, Monica [and others

    2003-01-01

    The report summarizes the supervision of waste management and environmental protection at the nuclear facilities that was carried out by the Swedish Radiation Protection Authority in 2001. A summary of the inspections and a description of important issues connected with the supervision of the nuclear facilities are given.The inspections during 2001 have focused on theme inspections of waste management, environmental inspections considering the environmental monitoring at the Swedish nuclear facilities and review safety analysis and research programs from the Swedish Nuclear Fuel and Waste Management Co.The Swedish Radiation Protection Authority finds that the operations are mainly performed according to current regulations.

  18. Verktyg för värdering av miljöpåverkan vid investeringar i det svenska elstamnätet

    OpenAIRE

    Lövebrant, Karin

    2012-01-01

    During the period 2009-2013, investments in the Swedish national grid increase by a factor of ten compared to previous years. In order to fulfil their mission to manage the national grid in a safe, efficient and environmentally sound way, Svenska Kraftnät (Swedish National Grid) needs to take all these perspectives into account while planning new investments. To compare and relate perspectives of technology, economy and environment the same yard stick must be used. That yard stick is commonly...

  19. Radioactive discharges and environmental monitoring at the Swedish nuclear facilities 2002-2004; Utslaepps- och omgivningskontroll vid de kaerntekniska anlaeggningarna 2002-2004

    Energy Technology Data Exchange (ETDEWEB)

    Luening, Maria

    2005-11-15

    According to Swedish regulations the effective dose to an individual in the critical group, from one year of releases of radioactive substances to air and water from all facilities located in the same geographically delimited area, shall not exceed 0.1 mSv. The effective dose, which concerns the dose from external radiation and the committed effective dose from internal radiation, shall be integrated over a period of 50 years. When calculating the dose to individuals in the critical group, both children and adults shall be taken into consideration. If the calculated dose exceeds 0.01 mSv per calendar year, realistic calculations of radiation doses shall be conducted for the most affected area. SSI has not defined any radionuclide specific discharge limits. Limitation of releases is being implemented through the restriction of dose to the critical group members. For each nuclear facility, e.g. each reactor, and for each radionuclide that may be released, specific release-to-dose factors have been calculated. The factors have been calculated for hypothetical critical groups, and take into consideration local dispersion conditions in air and in the environment, local settlements, local production of food-stuffs as well as moderately conservative assumptions on diet and contribution of locally produced food-stuff to the diet of the group. For nuclear power reactors, release-to-dose factors (mSv/Bq) have been calculated for 97 radionuclides that may be discharged to the marine environment and 159 radionuclides that may be emitted to air. Discharges shall be controlled through the measurement of representative samples for each release pathway. The analyses shall include nuclide-specific measurements of gamma and alpha-emitting radioactive substances as well as, where relevant, strontium-90 and tritium. The discharges of radioactive substances from the Swedish NPPs result in very low doses well below the limits issued by SSI. Even so, the concentration of radionuclides in the discharges is relatively high compared to the similar facilities abroad. The main reasons are that the Swedish NPPs are situated at the seaside of the Baltic and Kattegatt Sea respectively, and that the radionuclides are released into a larger water volume and thus disperse easily. The environmental monitoring programme is issued by the SSI and specify type of sampling, sample treatment, radionuclides considered, reporting, etc. The site-specific monitoring programmes vary depending on the facility and are divided in a terrestrial and an aquatic part. The selection of environmental samples (biota and sediments) has been conducted in order to be highly representative of the area around the facility and to, preferably, be similar for all facilities. Also some of the species have been selected because they are part of the human food chain. Every year a basic programme involving spring and autumn sampling is conducted. Furthermore, certain samples are taken on a monthly and quarterly basis. In addition to the basic programme, extended sampling is also conducted every fourth year at most of the facilities. The extended programme focuses exclusively on samples taken in the marine environment. The environmental samples consist of local flora and fauna e.g. algae, fish, shellfish, mosses, game and sediment as well as local food products (grain, milk etc.). The samples are collected from either rope or plexiglass surfaces that are placed in the discharge water stream or outlet from the NPPs. These samples are collected monthly by manually scraping off the diatomic algae from the rope or plexiglass. The algae that are sampled are generally good bio accumulators for radionuclides. This quality together with the monthly sampling in the near vicinity of the outlet point makes diatomic algae a good bio indicator for the amount og discharges radionuclides and also take into consideration their variation in time. A selection of data from the environmental sampling programme for the years 2002-2004 for the Swedish NPPs, Studsvik and Westinghouse Electric Sweden AB, are given in Annex D. Apart from these tables some more data and graphs are given for Oskarshamn, Studsvik, Forsmark and Ringhals. This is due to the fact that during the time period 2002-2004 an extended sampling has taken place. The data from environment samples shows that the discharges give low but measurable concentrations of radionuclides in samples taken in the marine vicinity of the outlet. The concentrations of radionuclides are very low. Measurements of e.g. Co-60 shows varying low concentrations for the time interval 1983-2004 and no long-time trend can be discerned. SSI undertakes a number of checks of the measurements performed by the operator, concerning gamma emitters, alpha emitters, tritium and strontium-90. Pooled and stabilised annual samples from each monitored waste water stream shall be sent to the SSI within three months after the end of the discharge year. In addition a number of randomly chosen monthly samples of waste water are analysed by SSI. The annual samples are measured concerning gamma emitters and tritium by the SSI and the results are compared with the data submitted by the operators. These measurements are conducted at the SSI laboratories. Control measurements of Sr-90 and alpha-emitting radionuclides are performed on a case by case basis at independent external laboratories. Aerosol filters shall be sent to the SSI for control measurements on request. Normally, this exercise is performed once a year, and the filters are subjected to gamma-spectrometric analyses. Environmental measurements are checked by the SSI. A total number of up to 50 samples, obtained as sub-samples of the material analysed by the operator or the laboratory contracted by the operator, is analysed annually. All tables and all graphs have captions in both Swedish and English.

  20. Warning and reporting at radioactive fallout from nuclear weapons organization in war. Foundation in peace. Varning och rapportering vid radioaktivt nedfall fran kaernvapen. krigsorganisation pa fredens grund

    Energy Technology Data Exchange (ETDEWEB)

    Ulvsand, T.; Larsson, T.; Persson, G.; Edvarson, K.; Finck, R.

    1994-03-01

    This report discusses with the question of how to form a new radiation protection organization for Sweden in the event of nuclear war. The foundation for this is the peacetime preparedness against nuclear power plant accidents. The contents concentrate on the responsibility as well as the tasks for the different organization levels and the resources needed.

  1. Weight reduction, energy loss and gaseous emissions for different collection systems for food waste from households; Viktreducering, energifoerlust och gasemissioner vid olika insamlingssystem av matavfall fraan hushaall

    Energy Technology Data Exchange (ETDEWEB)

    Ternald, Olle (and others)

    2010-09-15

    This project investigates the weight reduction of biodegradable household waste for different types of collections systems. The report is based on empirical experiments simulating the path taken by biodegradable waste through the different systems, from kitchen to final treatment. Data from the empirical experiments have been coordinated with existing data covering the quantities of bio waste collection received by final treatment facilities. This project has resulted in updated data, which reflects the quantities of the biodegradable waste generated at household level. Through this data, it has been possible to calculate the effectiveness of the different systems for collecting biodegradable waste, including their effectiveness as a source for biogas and soil conditioner. The results regarding waste weight reduction show that systems that use paper bags give a substantial weight reduction in both the kitchen (12%) as well as in the garbage disposal container, resulting in an average total weight reduction of 27%. For the bio-plastic bag, there is a small, measurable weight reduction of 7% in the kitchen. One-family household containers also show a reduction but for multiple households contains (typically used for apartment blocks) the reduction was much smaller. The average total weight reduction for bio-plastic systems was 10%. The corresponding value for total weight reduction for plastic bags in an optical system was 2%-4%, with an average of 2%. The largest share of the reduction consists of water, but some carbon is also emitted. Another conclusion of the report it that a larger share of the biodegradable waste generated by the Swedish households is collected than previously assumed. The data for generated (collected) biodegradable waste material shows higher levels and larger differences between the different collection systems than the data for the received (weighted) material at the treatment facilities. The data shows the effectiveness of each system and is significant for the biogas extraction levels and soil conditioner qualities. It is desirable that a large share of the biodegradable household waste is collected, both from an environmental perspective as well as in order to meet the Swedish national targets for biodegradable waste collection. Correlating existing data with data from the empirical experiments shows that 185 kg of biodegradable waste is collected from households using a paper bag-based system and 122 kg from household using a plastic bag-based system. This is equivalent to a 50% higher collection level for paper bag systems compared with plastic bag systems. The equivalent amount of bio waste is reduced in the combustible waste. Based on these numbers, the paper bag based systems offers 39% more methane per connected household than an optical plastic bag based system. Per kilogram incoming wet material, the there is a 23% methane advantage for the paper-based system. However, there is no significant difference in methane content per collected amount of bio waste between the methods. The data sample for bioplastic bags is too small in order to be included in the comparison. The carbon dioxide emissions show that a decomposition process of biodegradable waste is occurring in all types of collection systems. The nitrous oxide emissions are most likely negligible from an environmental perspective, although the results are not statistically verified. No measurable emission levels of methane can be detected, which is very encouraging from an environmental perspective

  2. Heterogeneidad y poder en las políticas públicas regionales : Las experiencias de los circuitos del tabaco, la vid y el algodón

    OpenAIRE

    García, Liliana; Lampreabe, Florencia

    2009-01-01

    El proceso de re-regulación económica que se puso en marcha desde el año 2003 ha sido orientado a producir compensaciones financieras y técnicas a los agentes rurales que no pueden ganar suficiente dinero como para invertir en sus actividades. Desafortunadamente, la política pública no ha sido capaz de hacer frente a las desigualdades estructurales que han tenido lugar en las regiones periféricas de la Argentina desde principios del siglo XIX. Proponemos reconocer esta falta de políticas públ...

  3. Fields of application for the by-products of extraction and transesterification of rapeseed oil; Anvaendningsomraaden foer biprodukterna vid pressning och omfoerestring av rapsolja

    Energy Technology Data Exchange (ETDEWEB)

    Bernesson, Sven

    2007-07-01

    Rapeseed contains 40-50% oil that can be extracted by pressing and possibly subsequent extraction. The residue, rapeseed cake, normally contains 10-25% oil, but rapeseed meal subjected to extraction only contains a few percent oil. Rapeseed cake and rapeseed meal can be used as animal feed, fuel, biogas substrate or fertiliser. If the extracted oil is used as a vehicle fuel it is normally transesterified to rapeseed oil methyl ester and then glycerol is produced as a by-product. Glycerol can be used for animal feed, fuel, biogas substrate or in the chemical industry as a raw material or additive in several products. The main purpose of this work was to evaluate how rapeseed cake and rapeseed meal, together with glycerol from transesterification of rapeseed oil, could be used in different applications, and to calculate their economic values in these uses. Used as a ruminant feed, current rapeseed cultivars can provide the entire dietary protein requirement. Up to 10% of the feed or concentrate mix for pigs, poultry and horses can comprise rapeseed feed. For piglets and horses, the palatability may limit the amount fed. The amount of rapeseed cake fed is restricted by its oil content. Normally, ruminants can manage 5% fat and horses about 2% fat in concentrate, and pigs 5% and poultry 1-1.5% fat in the overall diet. Glycerol can be an energy component of the feed mix. Cattle, sheep and pigs have been successfully fed a mixture containing 5-10% glycerol, and poultry a mixture containing 5%. Glycerol works well as a binding agent in feed pellet manufacture, with an admixture of 2-3% giving a more solid pellet. Rapeseed cake and rapeseed meal may be incinerated, but produce an ash with a relatively low melting-point, causes sintering and deposits to form in the furnace. The amount of ash is rather high, about 6%. The high nitrogen content (4-6% of dry matter) gives high nitric oxide emissions, often 2-3.6 times the emissions of fuels deficient in nitrogen. The high oil content in rapeseed cake gives it a comparatively high heat of combustion. Glycerol is difficult to incinerate alone, but can be incinerated when mixed with disintegrated solid biofuels such as sawdust or wood shavings. It would probably act as a binding agent in solid biofuel pellets or briquettes. Rapeseed cake and rapeseed meal can be used as an organic fertiliser, with 4-6% nitrogen, 0.4-2% phosphorus and 0.3-1% potassium. Organically bound nitrogen is released slowly. Glycerol has no value as a fertiliser unless it contains potassium residues from the catalyst (about 0.6%) used for transesterification, and possibly also phosphorus residues (about 0.16%) from the phosphoric acid that may be used to neutralise the catalyst. Rapeseed cake, rapeseed meal and glycerol are very suitable for anaerobic digestion. Rapeseed cake and rapeseed meal are nitrogen-rich media that may cause too high a content of ammonium nitrate in the biogas reactor. The oil in rapeseed cake may cause other substrates such as farmyard manure to give a higher gas yield. There are similar observations of methane gas yield increasing when glycerol is digested together with protein-rich media. Glycerol can be used as a carbon source in biogas processes. The plant nutrients in rapeseed cake and rapeseed meal are more easily available after biodigestion. The economic value of rapeseed cake, rapeseed meal and glycerol has been calculated on the basis of the replacement value of barley and soybean meal for feed, forest wood chips for incineration, nitrogen, phosphorus and potassium for fertiliser, or sales of electricity and district heating from a large farm-scale biogas plant. Rapeseed by-products were most valuable when used as feed, followed by use for combustion and biogas with a high gas yield. They were least valuable when used as fertilisers and for biogas with a low gas yield. The world market values of barley, soybean meal and feed fat (rapeseed oil) had a large influence on the value of the by-products and on the gas yield etc. from the biogas plant. The price of forest wood chips and fertilisers had a smaller influence on the results, since these products had a lower initial value. Domestic animals can by far consume all the rapeseed cake and rapeseed meal that can be produced in Sweden. Dairy cows can consume large quantities. Much larger quantities of glycerol can be consumed by domestic animals than can be produced through transesterification of rapeseed oil of Swedish origin. This means that the glycerol from a considerable proportion of imported rapeseed oil could be used for feeding purposes. There is nothing that limits the amount of rapeseed cake, rapeseed meal and glycerol that can be used for combustion or as fertilisers, other than their economic value in these applications. Glycerol may have added value if it can be used successfully as a binding agent in feed pellets, biofuel pellets or briquettes.

  4. vid118_0503c -- Point coverage of sediment types from video collected on AR-06/07 McArthurII research cruise.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Canadian ROPOS remotely operated vehicle (ROV) outfitted with video equipment (and other devices) was deployed from the NOAA Ship McAurthurII during May-June...

  5. Estimación de potencial hídrico en vid por medio de medidas termográficas y espectrales

    Directory of Open Access Journals (Sweden)

    DI FILIPPO, M

    2011-04-01

    Full Text Available El potencial hídrico foliar (ΨL es una variable frecuentemente utilizada para medir el estado hídrico de los cultivos. Su medición con cámara de presión, es lenta, lo que impide tomar un gran número de muestras. El objetivo del trabajo fue evaluar métodos alternativos para estimar el ΨL mediante sensores remotos. Uno de los métodos evaluados fue el de la reflectancia espectral. Esta técnica requiere de análisis estadísticos para poder estimar las variables de interés. Se probaron dos análisis, el cálculo de índices a partir de los valores del espectro y el análisis de Mínimos Cuadrados Parciales (PLS. El otro método probado fue la termografía que registra las temperaturas de la canopia (TC, las cuales se relacionan con su estado hídrico. Los datos termométricos sirvieron para construir dos modelos de regresión que estimaron ΨL. Uno de los modelos fue una regresión simple con TC vs. ΨL; el otro fue una regresión múltiple construida junto con el “índice normalizado de vegetación” (NDVI = ((R900-R680/( R900-R680 y con el “índice hídrico” (WI = (R900/R970. El ensayo se llevó a cabo en un viñedo de la variedad Malbec, en Mendoza, Argentina. La reflectancia se midió durante la mañana y el ΨL al mediodía, paralelamente a la toma de imágenes termográficas. Por PLS, usando las reflectancias entre 325 y 1075 nm se pudo predecir el ΨL. Por regresión se obtuvieron las ecuaciones ΨL = -1,21659 + 0,445078 * TC; R2 =0,19, p = 0,0000 y ΨL = 1,83399 – 0,613766 * NDVI + 0,0447517 * TC -1,45787 * WI, R2 = 0,36, p = 0,0000. Al mapear mediante krigeado los ΨL observados y los estimados por los tres procedimientos, para analizar las similitudes en distribución espacial, se observó una apreciable semejanza entre ellos, a pesar de los bajos coeficientes de regresión encontrados. Aparentemente, los planos incluyen información espacial ausente en las regresiones. Se halló una mayor semejanza entre el ΨL observado y el estimado por PLS, comparado con los otros métodos.

  6. Flue gas cleaning for co-combustion of waste in biomass boilers 10-25 MW; Roekgasrening vid samfoerbraenning i biobraenslepannor i storleken 10-25 MW

    Energy Technology Data Exchange (ETDEWEB)

    Gyllenhammar, Marianne; Larsson, Sara [S.E.P. Scandinavian Energy Project AB, Goeteborg (Sweden)

    2003-11-01

    Incineration of waste fuel in existing biomass boilers in the power range 10-25 MW is not very common in Sweden today. With increasing waste streams it will be interesting to use such fuel also in these types of boilers. This report gives a description of which regulations you have to comply with when you start to burn waste fuel, the increasing costs it will bring, and different types of flue gas cleaning equipment that are available. For existing boilers the EC-directive for incineration of waste will have to be implemented from 2005. Newly built boilers have to implement the directive from the start. The new requirements that have to be met for co-combustion plants are: The flue gas has to have a temperature of 850 deg C or more for at least two seconds in the combustion chamber. Exceptions can be allowed, but then the emission limit for CO for waste combustion must be met. The emission limit will then be 50 mg/Nm{sup 3} at 11 % O{sub 2}. Exceptions can be allowed for fluid-bed combustion if 100 mg/Nm{sup 3} at 11 % O{sub 2} as a hourly average can be met. There has to be a fuel handling system that automatically stops the waste flow if the temperature drops below 850 deg C, or when any of the emission limit values are exceeded. Some operating parameters have to be measured continuously. Emission limit values for dust, TOC, HCl, HF, SO{sub 2}, NO{sub x}, CO, metals, dioxins and furans. Increased documentation, reporting and control. This report has been focusing on how to meet the regulations on emissions to air. Following conclusions have been drawn: To avoid exceeding the limit value for dust emission a bag filter or an electric precipitator will be needed. Multi-cyclones are not enough. If the limit value for dust is met, the limit value of metals will also be met. To avoid exceeding the limit value for chloride a flue gas condenser/scrubbing tower or a dry flue gas cleaning system is needed, if the waste fuel is not very low in chloride. With a low sulphur fuel a specific sulphur reduction system will not always be needed. For moderate content lime could be directly injected into the boiler. A flue gas condenser could also be an alternative. For high sulphur content a dry, semi-dry or wet flue gas cleaning system with addition of lime or sodium hydroxide will be needed. To keep safely within the limit value for PCDD/F injection of active carbon or an installation of Adiox in some kind of scrubbing tower will be needed. Adiox is a new method where the dioxins bond to carbon dispersed in plastic packing material. Dry flue gas cleaning with a bag filter combined with injection of active carbon and lime is the dominating type of flue gas cleaning equipment in this effect range for fuel classified as waste. With this technique the directive is fulfilled quite easily. Not all waste streams need this kind of advanced flue gas cleaning. To make the investment in a dry system profitable the waste fuel must represent at least 30 % of the total fuel flow and the price of the waste fuel should not be higher than 80 SEK/MWh (about 10 USD/MWh). It is a great advantage if the plant has a flue gas condenser, as it reduces chlorine and fluorine (dust and sulphur). The main reason for installing a flue gas condenser is however not emission reduction but the energy recovery. It is almost always profitable to install a flue gas condensation after a boiler that combusts wet fuel. The requirement of the flue gas keeping 850 deg C or more for at least two seconds in the combustion chamber should be possible to fulfill in most existent bio fuel fired boilers (10 to 25 MW) at full load. The requirement will probably not be fulfilled at part loads. Retrofitted plants for better mixing and bigger volume in the combustion chamber, will most probably fulfill the requirements. Especially small boilers with tight design will get problems to meet the regulations. Some retrofitting can be necessary to avoid exceeding the CO limit.

  7. Svensk domstols behörighet vid gränsöverskridande varumärkestvister - särskilt om Internetrelaterade intrång

    OpenAIRE

    Maunsbach, Ulf

    2005-01-01

    The general aim of this doctoral thesis is to analyse under what circumstances a Swedish court might adjudicate a cross-border trademark infringement case. Due to the recent technological developments (e.g. Internet) an underlying aim is to specifically identify so called Internet-related problems when it comes to ascertaining jurisdiction in cross-border cases. The study adopts a Swedish court perspective. The question raised, put simply, is whether the holder of a trademark could enf...

  8. Carbon and nitrogen pools in soil and vegetation at afforestation of a cutover peatland; Kol- och kvaevefoerraad i mark och vegetation vid beskogning av en avslutad torvtaekt

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Torbjoern; Lundin, Lars

    2006-02-15

    There are a number of land-use alternatives for cutover peat areas after finished peat cutting. One land-use alternative is afforestation. In this investigation it was studied how drainage, soil treatments including fertilization, and plantation affected the carbon storage 20 years later. The studied area is located on the mire Flakmossen in the county of Vaermland, SW Sweden. Peat was harvested on 34 hectare of this mire up to 1945. The major part of the cutover area was abandoned until 1982 when after-use activities started. The depth of the remaining peat varied between a few decimeters up to about two meters. Prior to any soil measures, determination of peatland conditions was carried out. Important to this investigation was, a priori, the carbon store, i.e. remaining peat thickness was crucial. Therefore, peat depth was thoroughly investigated on 14 hectares of the cutover area in summer 1983. The remaining peat was also sampled at different depths within 18 plots of the whole cutover peat area. These samples were analyzed on i.a. concentrations of carbon and nitrogen. As bulk density also was determined, the amounts of carbon and nitrogen in the remaining peat could be estimated. A very good correlation was found between peat depth and the carbon pool in the peat. After-use activities included two afforestation projects that in the beginning of the 1980's were set up on the abandoned peat cutover area. One project was a conventional pine plantation on 19 hectares, where the effects of different drain spacings and PK-fertilizer doses were studied. The other project was an intensively managed forest experiment carried out on 14 hectares. This area was first drained and then fertilized with on average 23 tonnes of wood fly ash, 0.4 tonnes of raw phosphate and 0.25 tonnes of superphosphate per hectares. The applied fertilizers and the uppermost 30-40 cm of the peat were then mixed by a tractor-drawn rotovator in one meter wide strips. In these strips, on the 97 established plots, six different tree species were planted. In autumn 2003, twenty years after the establishment of the intensively managed forest experiment, peat depth was measured in totally 49 plots on the two afforestation experimental areas. Peat was sampled from up to 6 depths on 30 plots and analyzed on bulk density, and concentrations of carbon and nitrogen. On 48 plots the tree biomass were estimated by measurement of breast height diameter on trees within ca 100 m2 sample plots. The carbon concentration in the tree biomass was assumed to be 50 % of dry weight, while nitrogen concentration was assumed to vary between 0.2 and 0.8 % of dry weight, depending on tree compartment and tree species. At the intense cultivation area, the peat depth was on average 8 cm smaller in autumn 2003 compared to the depth in summer 1983. If the humus layer with an accumulation of on average 4.6 cm during the 20 years until autumn 2003 would be included, the depth of organic material was only 3 cm smaller in 2003. The carbon pool in the peat had decreased by on average 2.4 kg C/m{sup 2}. With the humus layer included the decrease was only 0.5 kg C/m{sup 2}. The total tree biomass (above and under ground) contained on average 5.4 kg C/m{sup 2}. During the 20 years, since the establishment of the intense cultivation area, the total carbon pool (soil + biomass) had increased with, on average, 10 % or 4.9 kg C/m{sup 2}. However, the variation was large between the plots within this area. Some plots showed a negative carbon balance, but most plots showed a net accumulation of carbon during these 20 years. The values for the nitrogen pools in peat and biomass are more uncertain, but the total nitrogen pool (soil + biomass) might have increased somewhat 20 years after the plantation. This investigation shows that already 20 years after drainage and an extensive soil treatment including fertilization and rotovation, and planting on an abandoned peat cutover area, the carbon balance can be positive, i.e. a net accumulation of carbon was achieved within the area. Thus, afforestation of abandoned peat harvested areas can be one after-use activity to increase the carbon pool in these ecosystems in a long term perspective.

  9. Supervision of waste management and environmental protection at the Swedish nuclear facilities 1999; Avfall och miljoe vid de kaerntekniska anlaeggningarna. - Tillsynsrapport 1999

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    The report summarizes the supervision of waste management and environmental protection at the nuclear facilities that was carried out by the Swedish Radiation Protection Institute in 1999. A summary of the inspections during 1999 and a description of important issues connected with the supervision of the nuclear facilities are given. The inspections during 1999 have focused on the management of liquid discharges and components containing induced activity at some of the nuclear facilities. Also, routines for filing environmental samples, discharge water samples and documents were inspected at all the different nuclear facilities. The Swedish Radiation Protection Institute finds that the operations are mainly performed according to current regulations.

  10. Vivons-nous dans la réalité ou dans un jeu vidéo hyper réaliste ?

    OpenAIRE

    Touzet, Claude

    2016-01-01

    The Conversation (FR); Elon Musk est certainement à l'heure actuelle le personnage le plus médiatique parmi tous ceux qui pensent que nous vivons sans doute dans un simulateur de réalité virtuelle très abouti. Comme on le verra dans cet article, la technologie le permet certainement, mais peut-être pas l'éthique.

  11. Dust separation at high temperatures a method for cleaning fly ashes? Final report; Stoftavskiljning vid hoeg temperatur en metod foer rening av flygaska? Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Zintl, Frank [TPS Termiska Processer AB, Nykoeping (Sweden)

    2002-12-01

    An experimental study of separation of fly ashes by a filter at high temperatures, 300-650 deg C, with the purpose to study: Capture of heavy metals (Cd, Hg, Pb, Zn) in the fly ash; Relation between heavy metal capture and temperature; Relation between heavy metal capture and the availability of fuel chlorine. Pelletized forestry waste fuel was doped with heavy metals in two different forms. Pelletized Salix was also used, without doping. The study shows that: There is a strong inverse relation between the capture of heavy metals and the filter temperature; There is a strong relation between the availability of chlorine and the capture of heavy metals. Separation at 300-650 deg C gives much less heavy metals in the fly ash, however the ash is not clean enough to allow disposal in ordinary landfills. Thus, high temperature filtering does not seem to be a promising solution for producing 'clean' fly ash.

  12. Formation and emission of PM{sub 10} in combustion of biofuels. Final report; Bildning och emissioner av PM{sub 10} vid foerbraenning av biobraenslen. Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Johansson, Linda; Tullin, Claes [SP Swedish National Testing and Research Inst., Boraas (Sweden); Leckner, Bo [Chalmers Univ. of Technology, Goeteborg (Sweden). Dept. of Energy Technology

    2004-02-01

    Epidemiological studies have shown correlations between negative health effects and increased particle concentrations in the ambient air. Because of this correlation and the increasing biofuel combustion, there is a need to more carefully investigate formation and emissions from biofuel combustion to secure good air quality in the future. This project is limited to primary combustion particles emitted from small-scale biofuel combustion. Small-scale is here defined as combustion devices with an output less than 10 MW. The project is divided into two parts. In the first part, particles from small-scale biofuel combustion have been characterised. In the second part, the formation of particles during biofuel combustion is studied. Characterisation of particle emissions has been performed for a range of different combustion units, i.e. pellet stove with a thermal output of a few kW, domestic wood and pellet boilers and district-heating boilers with thermal outputs around 2 MW. Mass concentration of particles was measured according to Swedish Standard method. Particle mass size distribution was measured using Dekati Low Pressure Impactor (DLPI, size range 30 nm - 10 {mu}m). The number of particles and corresponding size distribution were measured with an Electrical Low Pressure Impactor (ELPI, 30 nm - 10 {mu}m). To some extent, the particle emissions were investigated regarding chemical content and morphology. In all measurement cases, gas concentrations were measured in the flue gas as a control of combustion conditions. The highest mass concentration of particles (2,200 mg/MJ{sub fuel}) was recorded in the flue gas from an old domestic wood log boiler with poor combustion conditions resulting in very high emissions of unburnt (soot). On the other hand, the lowest mass concentration of particles (20 mg/MJ{sub fueI}) was recorded during optimally adjusted pellet combustion, where 83 % of the particles were found to be inorganic. The remaining part consists of unburnt material (e.g. soot). Submicron particles (particles less than 1 {mu}m) dominated the emission, both with respect to mass and number. Analyses with EDX (Electron Dispersive X-ray), ICP-MS (Inductively Coupled Plasma Mass-Spectrometry), and IC (Ion-Chromatography) showed that the main components in the submicron particles were potassium, sulphur, chlorine, and oxygen. TOF-SIMS (Time-of-flight Secondary Ion Mass Spectrometry) analysis showed that potassium-sulphate followed by potassium chloride were the most dominant substances among alkali -sulphates -chlorides, and -carbonates. For morphology, many spherical particles around 0.1 {mu}m were found. In the second part of the project, the formation of particles during bio-fuel combustion is studied by first measurements on metal release during biofuel combustion. Results from the first part of the project have shown that the particle emission is dominated by inorganic particles at favourable combustion conditions, and the second part is therefore focused on inorganic particles, in which metals are a part. The release of metals is studied to investigate the possibilities to influence formation of combustion particles, and consequently the particle emission. To be able to perform as many tests as possible and to include wide variations in combustion conditions, the second part of the project is carried out using a laboratory reactor. To obtain a time-resolved signal of the release of metals, a large number of single pellets were fired in a laboratory reactor and chemically analysed afterwards using ICP-OES (Inductively Coupled Plasma - Optical Emission Spectrometry). The combustion lapse was interrupted after devolatisation, and after 25 %, 50 %, and 75 % of the char burnout. To obtain a time resolved signal of the emission of unburnt particulate matter a photoelectric aerosol sensor was used as a soot indicator. The results of the initial tests show that the main part of the metals was released during char combustion, but a certain metal release also take place during devolatilisation. Soot was mostly emitted during devolatilisation.

  13. Compact electrostatic filter at small-scale combustion of fuels with high ash content; Kompakt elektrostatiskt filter vid smaaskalig foerbraenning av askrika braenslen

    Energy Technology Data Exchange (ETDEWEB)

    Baefver, Linda; Yngvesson, Johan

    2009-07-01

    To facilitate combustion of these fuels in small combustion devices (50 kW - a few MW), there is a need of inexpensive dust cleaning devices. Electrostatic filters for dust cleaning at heat and power plants are well established. However, the cost of these filters is often expensive to bear for a small plant. A few electrostatic filters for residential applications are available, but the experience is limited. In the capacity-area in between, i.e. small district heating plants, it is of special importance to find new cheap alternatives for an improved dust cleaning. The Norwegian company Applied Plasma Physics (APP) have products for dust- and odour-cleaning. APP also has the electrostatic filter called RESP (Residential Electrostatic Precipitator) for combustion of wood close to commercially available. The purpose of this report is to evaluate the electrostatic filter RESP at combustion of biofuels rich in ash, and by this contribute to increased knowledge about electrostatic precipitation at small-scale applications. A sub-goal is to separate 85 % of the particles in the flue gas. Experimental tests were performed at SPs Energy laboratory. RESP was mounted downstream of a chimney, which was mounted on a multi-stoker/boiler. The multi-stoker has a nominal heat output of 65 kW at combustion of wood pellets. In this project pellets of bark or reed canary grass were fired. Dust separation efficiency over the RESP with respect to number concentration and size distribution was tested for several powers of the filter, during combustion of the two fuels. Combustion of bark was selected for a longer time test with respect to separation efficiency by particle mass. Number concentration and size distribution were measured in real time using an electrical low pressure impactor (ELPI) and mass concentration was measured by filter sampling. The combustion conditions were favourable, with low concentrations of hydrocarbons and carbon monoxide. The number concentration of particles was 2.5 x 107 /cm{sub N}3 and 1.9 x 107 /cm{sub N}3(normalised to 10 % O{sub 2}) at combustion of reed canary grass and bark respectively. The results show that the technique of RESP works well for cleaning of particles from efficient combustion of the ash-rich fuels reed canary grass and bark. The combustion device was run at 20 kW, which is a thermal output that may be present at a farm or a school. For such an application the existing RESP may be tested in field, but for larger plants a certain product development is needed. The objective to separate 85 % of the particles was reached at normal operation of the filter (60 W). Lowering the effect of the filter, a large part of the dust separation is maintained and at 20 W the separation was about 80 %. At combustion of bark a two-day test of dust separation with respect to mass was performed. It showed on a dust separation efficiency of 82 % at 30 W power of the electrostatic filter.

  14. Utvärdering av jetomrörning : En studie gällande utvärdering av omrörningssystem vid Ekeby reningsverk

    OpenAIRE

    Moberg, Emma

    2015-01-01

    Biogas is a renewable energy produced through anaerobic digestion, which means that organic matter is degraded by microorganisms under anaerobic conditions. The produced biogas can then be used for cogeneration, electricity, heat or upgraded to vehicle gas. Eskilstuna Energy & Environment AB has four digesters at Ekeby water sewage treatment plant, Eskilstuna. One of the biogas reactor (RK4) is equipped with a jet-mixing system while the remaining digester uses top-mixing. The mixing syst...

  15. Application of stable crack growth in fracture assessment of defects in ductile materials; Tillaempning av stabil spricktillvaext vid brottmekanisk bedoemning av defekter i sega material

    Energy Technology Data Exchange (ETDEWEB)

    Dillstroem, Peter (Inspecta Technology AB, Stockholm (Sweden))

    2009-06-15

    This report goes through the use of methods/standards, which consider stable (J-controlled) crack growth. We have demonstrated the following: - ASME XI, App. C, App. H, which deals with analysis of stainless steel and ferritic piping, take account of stable growth. In App. C, this corresponds to the inclusion of stable growth up to DELTAa approx 10 mm. - R6-method, BS 7910:1999 and ASME XI, Code Case N-494, contains an established formalism to take account of stable growth. A prerequisite is that you have access to relevant and authentic material data in the form of fracture resistance K{sub k}/J{sub k} and J{sub r} curves. - All of the above methods/standards are applicable in the nuclear context. We reported also that required to produce relevant and valid data (fracture resistance K{sub k}/J{sub k} and J{sub r} curves) to be used for the analysis of stable growth. This report does not specify how much stable crack that can be counted at a Safety Assessment

  16. Deep boreholes - Status and analysis of consequences of application in Sweden; Djupa borrhaal - Status och analys av konsekvenserna vid anvaendning i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Grundfelt, Bertil; Wiborgh, Marie [Kemakta Konsult AB, Stockholm (Sweden)

    2006-09-15

    In this report a review of the Very Deep Hole, VDH, concept is presented. The review includes possible repository design, the prerequisites for construction and operation, and a model study of the groundwater conditions at great depths. Based on this, the possibility of the concept to fulfil SKB's basic requirements on a repository system regarding constructability, operational safety, longterm safety and quality assurance of the properties and performance of the different parts of the repository is discussed. Because the knowledge of the geoscientific conditions at great depths as well as of the technology needed for construction and operation of a repository is limited, no analysis has been carried out of the time evolution of the properties of the engineered barriers. Neither has possible release and migration of radionuclides been analysed. In an earlier study, SKB estimated that bringing the knowledge about the VDH concept to the same level as the current knowledge of the KBS-concept would require a 30 years RandD programme costing in the order of four billions SEK. Within the Pass study at the end of the 1980s and beginning of 1990s SKB investigated different repository concepts, one of which was the VDH concept. The design proposals that were developed then have formed the basis for discussions about the VDH concept in several other countries and have been used as a basis also for the present study. A VDH repository consists of about 4,000 metres deep boreholes. Canisters containing spent nuclear fuel are emplaced between 2,000 and 4,000 metres depth in the boreholes where the groundwater in principle is expected to be stagnant for very long time periods. An earlier study on the choice of technology for producing the boreholes for disposal of spent nuclear fuel concludes that the only technology that gives a reasonable drilling speed in crystalline rock is percussion drilling. Today there is no available equipment for percussion drilling of sufficiently wide and deep holes. The investigation also concludes that traditional drilling fluids probably cannot be used. It is recommended that stiff foam that binds the cuttings should be used instead. The bottom line of the study is that it is probable that existing technology can be used to produce the deposition holes but that this will be the greatest challenge the drilling industry has been exposed to. Based on the design solution proposed in the Pass study, 45 holes are required for the disposal of the spent fuel from 40 years operation of the Swedish nuclear reactors. Each borehole will require a surface facility of about 1 ha. This area would host a 60-80 metres tall drilling rig together with the buildings and facilities needed for drilling, handling and dewatering of dill cuttings, casing of the hole, disposal of the spent fuel and sealing the hole after the disposal. The distance between the holes has been set to 500 metres, in order to avoid that holes deviating from the vertical direction come too close to each other. If the conditions on the ground and geological conditions allow, the repository can be hosted within a surface area of about 10 km{sup 2}. Within the present study, it has been estimated that 5-10 drilling sites need to be in operation for disposal or under construction simultaneously, in order to achieve a disposal time that is adapted to the Swedish nuclear programme. The available information about the geoscientific conditions at great depths in crystalline rock is based on only few boreholes, none of which are located in an area that would be a candidate repository site. The water turnover at these great depths is generally assumed to be low whereas the groundwater salinity, temperatures and rock stresses are expected to increase with an increasing depth. Today there is no established or even well thought-out technology for disposal of canisters with spent nuclear fuel in deep boreholes. In the proposed possible solutions the disposal is carried out with a tool connected to the drilling rig. The canisters are pushed down through the drilling fluid in the borehole. In the lower part of the hole, deposition slurry has been brought to displacing the drilling fluid. In this part of the hole the canisters will be pushed through the deposition slurry. There is no available technology for to verify that the canisters remain tight and that the properties of the buffer surrounding the canisters are those wanted or expected. This in combination with the conditions expected at great depth in the borehole means that it will be difficult to show that the deposited canister and the buffer have the desired properties. Hence, it is not possible today to make credible quantitative estimates of the barrier performance of the canister and the buffer. The safety of the VDH concept is principally based on the more or less stagnant groundwater conditions expected at great depth in crystalline rock. Groundwater modelling has been performed within this study based on a generic model domain. The results of these calculations show that the calculated groundwater travel time from the repository depth to the surface can be very long. The transport time is sensitive to certain assumptions such as the initial content of fresh water in the borehole and the quality of the buffer and sealing in the borehole. The results from the modelling exercise should be regarded as indicative while quantitative conclusions remain very uncertain. The conclusion of this study is that the conditions expected at great depth in the Swedish basement rock make the VDH concept an interesting alternative as well as one that is difficult to implement. The safety advantages provided by the assumed stagnant groundwater conditions are difficult to demonstrate with the certainty required for disposal of spent nuclear fuel.

  17. Kvinnliga patienters upplevelse av stød vid traumatiska livshändelser i form av sexuella övergrepp : En litteraturöversikt

    OpenAIRE

    Myhre, Mia; Jasinska, Maja

    2017-01-01

    SAMMANFATTNING  Bakgrund: Sexuella övergrepp ökar i det svenska samhället, vilket kan leda till posttraumatiskt stressyndrom. De kvinnor som utsatts för övergrepp befinner sig i ett stort behov av professionell hjälp och stöd från vårdpersonal under återhämtningsprocessen. Syfte: Syftet med studien var att undersöka hur kvinnor som varit utsatta fören traumatisk livshändelse i form av sexuellt våld upplever det stöd de har fått från vårdpersonalen. Metod: Den metod som valdes var litteraturs...

  18. Förändringar av arbetssätt vid implementering av BIM : En kvalitativ studie av två traditionella projekteringars arbetssätt och tid- och resursplanering samt vilka förändringar som är nödvändiga vid implementering av BIM

    OpenAIRE

    Jansson, Magnus; Knutsson, Kristian

    2012-01-01

    I en rapport från 2005 framtagen av FoU-Väst i samverkan med Centrum för management i byggsektorn (CMB) konstateras att en betydande del av allt slöseri i byggsektorn är kopplat till fel och konsekvenserna av dessa, med andra ord felkostnader. Studien visar att felkostnader står för cirka 10 % av ett projekts produktionskostnad.   Byggsektorn står nu, år 2012, inför förändringar i sitt arbetssätt för att minska antalet fel, öka kvaliteten och effektiviteten. BIM – Building Information Modelin...

  19. La vidéo au regard du cinéma : pour une archéologie des "idées de vidéo" dans la presse cinématographique française (1959-1995)

    OpenAIRE

    Widendaële, Arnaud

    2016-01-01

    Since the Eighties, several film scholars (Philippe Dubois, Raymond Bellour, Jean-Paul Fargier) have assigned fixed identity to video in order to emphasize its fundamental difference with cinema. We intend to reconsider the relations between cinema and video in a way which would avoid these ontological dictinctions based on technology. This thesis would like to give its heterogeneity back to video and bring to light some analogies with cinema by examining texts about electronic uses in theatr...

  20. Bylaag tot „Koers”, van Junie 1954: Ons Universiteit.

    Directory of Open Access Journals (Sweden)

    J. C. Coetzee

    1954-03-01

    Full Text Available Vir die uitvoering van sy taak en roeping moet die universiteit ’n grondslag en beginsel hê. As inrigting vir hoër onderwys en vir uitbouing van die wetenskap moet dit iewers op iets vas staan en moet dit iewers begin met sy werk. Grondslag en beginsel is onmisbaar vir enige universitêre inrigting, en alle universiteite besit dit, of hulle dit wil erken en bely, of nie.

  1. DIE TELING VAN KLEINVEE - VERLEDE. HEDE EN TOEKOMS

    African Journals Online (AJOL)

    uitstaande hoedanighede en pragtige bouvorrn- en kleur- patrone. Dit spreek boekdele vir die betreklik effektiewe oordeel en yaarneming ran veeboere oP elke gebied. Oryewingrtoertandc en aanpedng. Dilwels word gestipuleor dat slcgs gcsorg moet word dat rasse of tiper diere net iungepas moet wees by die onr.

  2. Siding in a conflict in China and in the Netherlands

    NARCIS (Netherlands)

    Yang, Huadong

    2006-01-01

    Het onderzoek van Yang biedt inzicht in de culturele verschillen tussen China en Nederland. Yang laat zien hoe conflicten kunnen escaleren als een derde, aanvankelijk neutrale, persoon een van beide kanten moet kiezen. Dit inzicht moet volgens Yang leiden tot meer begrip voor elkaars culturele

  3. dte invloed van cultivar, omgewing en bemesting op sekere ...

    African Journals Online (AJOL)

    'n bepaalde lokaliteit, indien die prys van sonneblomsaad ook op grond van proteibn- konsentrasie lasgestel word. Die prywasstelling moet egter gebaseer word op wetenskaplik gefundeerde be- vindings en prakties meetbare parameters. Voorts moet die prys vur die saad dien as stimulus vir die produksie van saad met.

  4. Gerhardus Marthinus Maritz Pelser, hoogleraar 1972-1989

    African Journals Online (AJOL)

    Tydens Pelser se dosentskap het die strukturele benadering tot taal sterk na vore gekom. Volgens hierdie benadering moet die betekenis van 'n teks langs 'n sinchro- niese weg eerder as 'n diachroniese verstaan word. Die geskiedenis rondom 'n teks is onseker, daarom moet daar op die sintaksis, die styl en semantiek ...

  5. Errata

    NARCIS (Netherlands)

    NN,

    1997-01-01

    1) In de wetenschappelijke FLORON-streeplijst dienen nog twee wijzigingen aangebracht te worden: – 5515 Populus deltoides moet worden 5115; – 1238 Spergularia salina moet worden S. marina. 2) In Gorteria 23 (4), “Verspreiding van doelsoorten (vaatplanten) in relatie tot de Ecologische Hoofdstructuur

  6. Jurie Geldenhuys Hoe skryıc môre se skrywers vandag?

    African Journals Online (AJOL)

    Verskeie stemme op die konferensie het opgeklink vir meer en beter toegeruste biblioteke om die saak van die boek te bevorder. Dié biblioteke moet deur kundiges beman word en moet ook saans oop wees. Volgens Nieuwoudt ( 2002: 13) was me. Cynthia Hugo van mening dat die hele skoolleerplan deur die letterkunde ...

  7. Erratum: Report on the summit on the future ofacademic medicine in ...

    African Journals Online (AJOL)

    The prescribed forms should be completed. 8. The ethical rules should be complied with at all times. 7. Die voorgeskrewe vorms moet voltooi word. 8. Die etiese reels moet te alle tye nagekom word. Erratum: Report on the summit on the future ofacademic medicine in SA. Please npte that this repon, which was published on ...

  8. GASSKRYWERSRUBRIEKIGUEST EDITORIAL ...

    African Journals Online (AJOL)

    woord en daad beskerm moet word teen agteruitgang of aftakel ing. Dmgewingsopvoeding bestaan myns insiens dus uit aksie. So n aksieproses moet basies bestaan uit n beplande onderrig - of opvoedingsprogram - waardeur die indi- vidu blootgestel word aan. * volgehoue inligting wat feitelik korrek is en. * waardeur sy ...

  9. Biological recipient control at the Oskarshamn nuclear power plant. Summary of studies up to the year 2008; Biologisk recipientkontroll vid Oskarshamns kaernkraftverk. Sammanstaellning av undersoekningar till och med aar 2008

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Jan; Bergstroem, Lena; Lingman, Anna

    2011-07-01

    This report describes the results from studies on the temporal development of fish and zoobenthos communities in the vicinity of the nuclear power plant in Simpevarp in the Baltic Sea over the past 40 years. Fish communities have been monitored using fyke nets and survey nets. The results indicate that the number of species and the abundance of the dominating species, perch (Perca fluviatilis) has increased in the vicinity of the power plant. Negative trends in abundance were observed in only a few fish species. The marine species cod (Gadus morhua) and herring (Clupea harengus membras), which occur predominantly in coastal areas during the colder season, showed strong variation over time, and dominated the catches during different time periods. Cod abundance decreased significantly over the years. Strong temporal variation was also seen in some other species during the colder season, probably following the concentration of herring. However, monitoring during the cold water period was affected by disturbance from seal in more recent years. Monitoring of fish diseases and parasites showed no effect of the cooling water on their prevalence. Water temperatures in the Baltic Sea show an increasing trend during the studied time period. This increase has been related to a generally increased growth rate of perch in the Baltic Sea, which was also seen in Simpevarp. However, the increase was stronger in areas affected by cooling water than in the other areas. Studies of perch young life stages showed a positive relationship between the abundance of adult perch in the Simpevarp area and the productivity of perch recruits in the Hamnefjaerden area, which is strongly affected by cooling water. However, it is not clear whether the recruits originate from the Hamnefjaerden area or if they have immigrated from adjacent areas at an early stage. Additionally, indications of a negative relationship between high winter temperatures and the development of perch gonads were seen. Fish losses due to cooling water entrainment were low compared to mortality caused by the commercial fishery, but effects on the local coastal fishery cannot be excluded. Catches per unit effort of eel in nearby commercial fisheries showed a small but decreasing trend since the 1970's. As for zoobenthos, species composition and total abundance showed strong changes over time since the 1960's. These were mainly related to large scale changes in the Baltic Sea. However, some effects of the cooling water were seen in the site located closest to the effluent.

  10. Comparison between environmental measurements and model calculations of radioactivity in fish at the Swedish nuclear power plants and Studsvik; Jaemfoerelser mellan omgivningsmaetningar och modellberaekningar av radioaktiva aemnen i fisk vid de svenska kaernkraftverken och Studsvik

    Energy Technology Data Exchange (ETDEWEB)

    Karlberg, O.

    1995-02-01

    Doses to critical groups from the activity released from swedish reactors were modelled in 1983. In this report these calculations are compared to doses calculated (using the same assumptions as in the 1983 model) from the activity measured in the water recipient. The study shows that the model overestimates activity in biota and sediments, which was expected, since the model was constructed to be conservative. 13 refs, 5 figs, 6 tabs.

  11. Cleaning of condensate from flue gas condensing plants at co-combustion of waste fuels. Follow-up of emissions; Rening av kondensat fraan roekgaskondenseringsanlaeggningar vid samfoerbraenning av avfallsbraenslen. Uppfoeljning av utslaepp

    Energy Technology Data Exchange (ETDEWEB)

    Sundquist, Lena; Dejfors, Charlotte; Wrangensten, Lars [AaF Energikonsult AB, Stockholm (Sweden)

    2002-03-01

    Limits of discharges in waste water at flue gas cleaning are one of the fields included in the EC-directive (2000/76/EG) regarding combustion of waste from December 28th, 2000. The pollutants included in the limits are suspended material, Hg, Cd, Tl, As, Pb, Cr, Cu, Ni, Zn as well as dioxins and furans. The limits of the directive applies generally for plants with combustion of waste, regardless of type of waste fraction, the degree of admixture or if it is a so called co-combustion plant or not. For new plants, the limits shall be fulfilled within two years after the date of the directive whereas existing plants have another three years to meet the new demands. In this project, the condensate from the flue gas has been analysed at five different combustion plants. Samples of the fuel have also been analysed as a reference at the evaluation of the results. The results from the analysed condensate have then been compared and evaluated with regards to the limit values in the EC-directive. However, one exception is dioxins and furans that are not included in this study. The analysis of the pure condensate show that at most plants the content of pollutants is below, or in some cases well below, the limits of the EC-directive. At plants with co-combustion of recovered biofuels, even the contents of pollutants in the non-purified raw condensate are below the limits of the directive. This means that plants with co-combustion of recovered wood waste and biofuels most likely will meet the requirements for emissions to waste water in the EC-directive. The water treatment process in these plants normally consists of a pH-adjustment stage followed by adding of chemicals before the condensate enters into a sand filter. The cleaned condensate from the sand filter is normally released to a recipient whereas the dirty condensate goes through a lamell separator in order to separate rest sludge. The most polluted raw condensate was found at a plant with 100 % combustion of municipal solid waste. However, the cleaning process of the condensate at this plant makes sure that the emissions to water are well below the limits. Another plant with admixture of municipal solid waste in the furnace had relatively high content of pollutants in the purified condensate. The cleaning process of the condensate at this plant is equivalent to the plants designed for co-combustion of recovered wood fuel. Therefore, the water cleaning process might have to be extended or adjusted, which already has been done at the plant after the sampling of this project, in order to meet the demands of the EG directive. At several of the visited plants, there have been problems with corrosion in the cleaning process of the condensate. Some components and materials have had to be changed and today exclusively plastic materials are used. One exception is the heat exchanger where metal is predominantly used to achieve good heat transfer.

  12. Effects of Non Process Elements in the chemical recovery system of a kraft pulp mill from the incineration in the recovery boiler of biological sludge; Effekter av PFG vid indunstning och foerbraenning av bioslam i ett massabruks sodapanna

    Energy Technology Data Exchange (ETDEWEB)

    Dahlbom, Johan

    2003-01-01

    The purpose of this project was to investigate the effects of incineration of biological sludge in the recovery boiler of a Swedish Kraft pulp mill, StoraEnso Pulp AB Skutskaers Bruk, which has practiced incineration of sludge in the recovery boiler during the last two years. The following aspects of the technique were investigated: Experience from operation of incineration of biological sludge in the recovery boiler; The content of Non-Process Elements (NPE) in process flows and evaluate the risks of incrustations in the system; The build-up of NPE in the chemicals recovery system and the estimated increase in make-up lime demand; and Technical risks for mills with different process equipment. This study comprises the following NPE: aluminium, silicon, phosphorus, magnesium, calcium, chloride, iron, manganese, potassium, copper, and nitrogen. The operational experience from the system for hydrolysis of the biological sludge and evaporation/incineration in the recovery boiler is excellent. The handling of the sludge takes place in a closed system that demands little supervision and maintenance. Overall, the mill has not seen any negative effects that can be explained by increased intake of NPEs to the chemical recovery system. Aluminium can lead to troublesome incrustations of sodium-aluminium-silicates on the heat surfaces in the evaporation plant. An effective elimination of aluminium by the green liquor dreg is obtained with the double salt hydrotalcite if the quotient Mg/Al is kept higher than 4-5 in the black liquor. The need for make-up lime has increased due to the build-up of phosphorus in the lime. Depending on the level of make-up lime the need will increase 2-5 kg/ t{sub 90} at a price of 2-5 kr/t{sub 90}. If a higher level of phosphorus is accepted instead of increasing lime make-up the running costs will be somewhat higher, 0,5-1 kr/t{sub 90} due to increased ballast. NO{sub x} in the flue gases from the recovery boiler has not increased since the start-up of incineration of biological sludge in the recovery boiler. A possible explanation may be that the nitrogen in the biological sludge exists in a state that gives less formation of NO{sub x} compared to nitrogen in the black liquor. For the other NPE as silicon, magnesium, calcium, chloride, iron, manganese, potassium and copper the contribution from the sludge is low. It will not give any problems for the chemical recovery system at Skutskaer. Integrated pulp and paper mills with or without recycled paper use and coating with calcium carbonate and/or kaolin will probably have increased difficulties to incinerate biological sludge in the recovery boiler. The production of paper in addition to the pulp production will generate higher amounts of biological sludge also will contain higher content of calcium, aluminium and silica and possibly other NPE from the recycled paper.

  13. Reed canary grass as an energy crop. Experiences from full-scale tests at BTC, Umeaa during the period 2000-2004; Roerflen som energigroeda. Erfarenheter fraan fullskalefoersoek vid Biobraensletekniskt Centrum (BTC) i Umeaa under aaren 2000-2004

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Sylvia; Oerberg, Haakan; Kalen, Gunnar; Thyrel, Mikael

    2006-07-01

    In the years 2000-2004, reed canary grass (RCG) has been cultivated, harvested, stored, upgraded, and combusted at Umeaa Biofuel Technology Center (BTC), SLU Roebaecksdalen, Umeaa. The entire chain from the field to hot water has been handled by personnel at BTC. Data and experiences from the different handling stages have been continuously collected. In this time period, RCG has been harvested each spring. The mean harvest level on SLU properties has been approximately 4 ton DM/ha and the dry matter content at harvest has been on average 11-12 %. Winter and harvest losses has been determined to approximately 44 %, by a comparison of harvest levels in spring and harvest levels in sample squares in late fall. An alternate method of cutting in late fall, where the crop is left in the field until spring, has been tested. With this method, the risk for cutting of green shoots is eliminated and the isolating effect of the cut ley is decreasing the frost depth in the field. Three different techniques of baling have been tested: large and small square baling, and round baling. Round baling is most suitable for the conditions at BTC, because of the low availability of large square baling equipment in the area. Otherwise large square baling is more time efficient. Thus, the low weight of round baling equipment is advantageous and gives rise to less ground damages. On BTC, the RCG bales are stored outside on an asphalt area, covered with ensilage plastic on a layer of pallets. This handling procedure is working satisfactory with relatively low material losses, but when larger quantities are stored inside storage is to prefer. The economy of RCG cultivation is, as for all agricultural crops, dependent of subsidies within EU's Common Agricultural Policy (CAP). Subsidies can be received for RCG cultivation on ordinary farmland and on fallow farmland. An extra energy crop subsidy can be received for RCG cultivation on ordinary farmland if the energy crop is utilised as energy feedstock. In comparison to other agricultural crops, RCG cultivation only to receive subsidies but without harvesting is probably the most economically competitive alternative to RCG production for energy purposes. To reach the same profitability as that alternative, the fuel price for RCG feedstock at farmgate has to be at least 62-79 SEK/MWh (ordinary farmland) and 75-107 SEK/MWh (fallow farmland) when the harvest level is 9-4 ton DM/ha (storage costs excluded). Large scale storage of RCG, at for instance a pellet production site, has to be estimated from a point of view where the warehouse also have other uses ( i.e. storage of other feedstock and pellets). Storage in a newly built warehouse where RCG storage is assumed to use half of the storage time amounts to a cost of approximately 35 SEK/MWh. Both briquette and pellet production of RCG have been performed at BTC. Briquettes are produced continuously and constitute an essential part of the fuel required for the commercial boiler. Pelletizing has been performed within different projects with an acceptable result, but fine tuning of the technique is desirable to increase the production capacity. Combustion of RCG pellets and briquettes is working well if the boilers are adapted to ash rich fuels. Due to the large amounts of ashes, an automatic ash handling equipment with high capacity is needed. It is also important that the dwell time for RCG fuel in the combustion chamber is long enough to ensure a complete combustion and to avoid high levels of uncombusted material in the ashes. Compared to wood pellet combustion, emissions of NO{sub x} and SO{sub x} are higher in RCG combustion due to a higher amount of nitrogen and sulphur in RCG feedstock

  14. Turbulence and heat transfer in condensate in drying cylinders at high g-forces. Phase 2; Turbulens och vaermeoeverfoering i kondensat i torkcylindrar vid hoega g-krafter. Fas 2

    Energy Technology Data Exchange (ETDEWEB)

    Stenstroem, Stig; Ingvarsson, David [Lund Inst. of Tech. (Sweden). Dept. of Chemical Engineering

    2006-02-15

    During paper drying a condensate layer is formed on the inside surface of the rotating cylinder which acts as resistance for heat transfer through the cylinder. The heat transfer resistance in the condensate layer is mainly dependant on the layer thickness and the turbulence in the layer. Consequently the resistance increases with higher cylinder speeds due to increased centrifugal forces and thus reduced turbulence in the layer. In order to minimize the influence of condensate on the heat transfer process the cylinder used in Phase 1 has been equipped with axial grooves. The aim of the project has been to study the water movement in the cylinder and to investigate how the drying capacity is influenced by condensate accumulating in the grooves rather than moving along the smooth surface of a paper dryer cylinder. This knowledge should be considered preferably before construction of cylinders for new machines. For existing machines with smooth cylinders the importance of axial vertical flanges for improved heat transfer has been investigated. In addition the capacity of stationary siphons has been evaluated. The results are of importance for the manufacturers of paper machines as well as the producing newsprint and printing paper companies. According to the results from the experiments the water flows mainly in the grooves, assuming that the number of grooves and that the dimensions of the grooves are adjusted to the water load. Then the surfaces between the grooves can be considered as completely dry unlike in a smooth cylinder where the surfaces more or less are covered with a thin layer of condensate. Furthermore the centrifugal force helps the water to flow down into the grooves. Consequently a high water flow will rely on a high cylinder speed in order to keep the water flowing into the axial grooves. The computer simulations show that the drying capacity increases with up to 46 % in dryer cylinders provided with axial grooves compared to smooth cylinders, assuming that the condensate will flow down into the grooves as the results from the experiments indicate. Moreover the heat transfer process is hardly affected by the design of the grooves, because the heat flow through the surfaces between the grooves determines the overall heat transfer through the cylinder. If the drying capacity on the other hand is maintained at the same level the steam pressures can be reduced. Compared with an expansion from 60 bar and 450 C to 2.7 bar this results in an increased power production by 13 % if the pressurised steam is allowed to expand to a lower pressure in the turbine. Existing smooth cylinders should be equipped with flanges resulting in an increased drying capacity of 25 %. The experiments with a stationary siphon indicate that the area of the siphon inlet should be the same as the area of the subsequent tube. Furthermore the recovered dynamic pressure is proved to be dependant on the cylinder speed squared. In Phase 2 of the project proposals to improve the heat transfer in new and existing cylinder dryers have been presented. The conclusion is that the goals in Phase 2 of the project have been reached.

  15. Separation of submicron particles from biofuel combustion with flue gas condensation or wet condensing electrostatic precipitator. Analysis of possibilities; Avskiljning av submikrona partiklar vid biobraenslefoerbraenning med roekgaskondensering eller kondenserande vaata elfilter. Analys av moejligheterna

    Energy Technology Data Exchange (ETDEWEB)

    Roennbaeck, Marie; Gustavsson, Lennart [Swedish National Testing and Research Inst., Boraas (Sweden)

    2006-11-15

    Dust particles in flue gas larger than 1 {mu}m are well separated by conventional techniques, while submicron particles are poorly separated. As the use of biofuels with high ash content is increasing, as well as knowledge about negative health effects from inhalation of submicron particles, the interest for reduction of emissions of submicron particles will probably increase. The aim of this project is to investigate possible techniques for separation of submicron particles during flue gas condensation through modification of conventional technique, or with available techniques not usually used with combustion of biofuels, e.g. a wet electrostatic precipitator. Mechanisms for separation of dust particles are briefly described. Cyclones separates particles larger than about 1 {mu}m. Fabric filters separates all particles sizes, but the efficiency reduces as the size reduces. In flue gas condensers and scrubbers the speed and size of water droplets are important for the reduction efficiency. Dry electrostatic precipitators work for all particle sizes, but with reduced efficiency for sizes between 0.1 and 3 {mu}m. Wet electrostatic precipitators separates submicron particles much better. One reason for this is that the potential between the electrodes can be higher. Among conventional flue gas condensers and scrubbers there are two types that, properly designed, can separate submicron particles, namely 'type venturi scrubbers', i.e. a scrubber where a high flue gas velocity is used to form many, small water droplets by friction forces in a nozzle, and 'type scrubber with nozzles', i.e. a scrubber where nozzles supply droplets to the flue gas. For a scrubber with nozzles, the falling velocity of the droplets must be lower and the size smaller than is common today. Also the wet electrostatic precipitator separates submicron particles with high efficiency. They are used today mainly for problematic particles, e.g. sticky or corrosive ones, or for particles with high resistivity. The wet electrostatic precipitator can be designed condensing, and in doing this the latent heat of condensation can be recovered. Ongoing and published R and D show that basic studies concerning larger biofuel plants are in progress. On smaller appliances (from single house-scale up to three MW), there are some studies published and several ongoing. The published studies from smaller appliances have targeted high degree of separation, high availability and good economy without pre-separation of dust. It may be possible to use experience from small scale appliances to larger plants in the sphere of interest of Vaermeforsk. The literature survey shows that it is theoretically possible to separate submicron particles using flue gas condensation, or using a wet electrostatic precipitator. A next step is to investigate the economy and to apply and evaluate technique. Simultaneously, the knowledge about formation and reduction mechanism of dust from biofuels has to increase, in order to reduce the need for secondary cleaning of flue gas. The ongoing studies should be followed up.

  16. Bed agglomeration risk related to combustion of cultivated fuels (wheat straw, red canary grass, industrial hemp) in commercial bed materials; Baeddagglomereringsrisk vid foerbraenning av odlade braenslen (hampa, roerflen, halm) i kommersiella baeddmaterial

    Energy Technology Data Exchange (ETDEWEB)

    Erhardsson, Thomas; Oehman, Marcus; Geyter, Sigrid de; Oehrstroem, Anna

    2006-12-15

    The market of forest products is expanding and thus resulting in more expensive biomass fuels. Therefore research within the combustion industry for alternative fuels is needed, for example cultivated fuels. Combustion and gasification research on these cultivated fuels are limited. The objectives of this work was to increase the general knowledge of silicon rich cultivated fuels by study the agglomeration characteristics for wheat straw, reed canary grass and industrial hemp in combination with commercial bed materials. Controlled fluidized bed agglomeration tests was conducted in a 5 kW, bench-scale, bubbling fluidized bed reactor. The tendencies of agglomeration were determined with the three cultivated fuels in combination with various minerals present in natural sand (quarts, plagioclase and potassium feldspar) and an alternative bed material (olivine). During the experiments bed samples and formed agglomerates were collected for further analyses with a scanning electron microscope (SEM) and with X-ray microanalysis (EDS). Wheat straw had the highest agglomeration tendency of the studied fuels followed by reed canary grass and industrial hemp. No significant layer formation was found around the different bed particles. Instead, the ash forming matter were found as individual ash sticky (partial melted) particles in the bed. The bed material mineralogical composition had no influence of the agglomeration process because of the non layer formation propensities of the used silicon rich fuels.

  17. SCR as method for combined dioxin and NO{sub x} reduction during co-combustion of biofuel and recovered fuels; SCR som metod foer kombinerad dioxin- och kvaeveoxidreduktion vid samfoerbraenning av biobraensle och avfall

    Energy Technology Data Exchange (ETDEWEB)

    Aurell, Johanna; Liljelind, Per; Marklund, Stellan [Umeaa Univ., (Sweden). Dept. of Environmental Chemistry; Kling, Aasa; Andersson, Christer [Vattenfall Utveckling AB, Aelvkarleby (Sweden)

    2003-08-01

    During co-combustion of biofuel and recovered fuels (RDF) there is a risk that the future level of allowed dioxin emissions could be exceeded. From a combustion system, dioxin can be reduced by primary, combustion regulating measures and secondary removal measures such as active carbon. The active carbon method has a relatively high cost for operation and demands a fabric filter. For some types of co-combustion a simple flue gas cleaning system with lower cost for investment and operation can be sufficient. Two methods, which has been elucidated in this report is SCR (Selective catalytic reduction) and addition of inhibitors during combustion. These both methods have a primary purpose in the plant; the catalyst reduces NO{sub x} (and the NO{sub x} fee deduction usually covers the cost for the catalyst system) and inhibitor (sulphur) is among other things used to reduce the corrosion of the heat transfer surface. The SCR catalyst can give a cost effective dioxin reduction as a bonus. Review of the literature show that inhibitors, mostly urea and sulphur compounds, in the flue gas can inhibit formation of dioxins by close to 80%. To achieve an efficient reduction the inhibitor should be added at a high temperature and with a proper concentration in relation to the amount and kind of fuel used. A commercial SCR-catalyst optimized for biofuel combustion have been tested in pilot scale with respect to dioxin reduction during high-dust combustion (without flue gas cleaning). Two parameters have been evaluated; amount of catalytic volume in relation to the flue gas and flue gas temperature. The result show that even in a high-dust system the deNOx-catalyst can reduce more than 70% of the dioxin emissions. The dioxin reduction increased when the space velocity increased in relation to the flue gas volume, the temperature had less influence on the reduction. With a catalyst volume corresponding to a full scale SCR and a temperature of 375 deg C, 73% of the I-TEQ, 40% of the PCDD and 71% of the PCDF was reduced. In the first experiments of the catalyst a high reduction of PAH was also measured (78-90%). The particle concentration (0.5 g/mn{sup 3} in the experiments) can be of importance for the reduction, which has not been investigated in this project.

  18. Stratégies vidéo-ludiques d’habitation par un pygmée d’un monde démesuré : Congo Inc. Le testament de Bismarck d’In Koli Jean Bofane

    Directory of Open Access Journals (Sweden)

    Zoé Courtois

    2017-06-01

    Full Text Available In Congo Inc., In Koli Jean Bofane’s novel, the video game theme contributes to a hybrid diegetic process that switches between the story of IRL and in game adventures of Isookanga, a young pygmy. The novel plays – in the mechanical meaning of the word – between these two sides of diegesis, which enables us to consider the tension between reality and video game : if reality is uninhabitable for the pygmy, and made disproportionate by a certain “globalisation”, the transition to data superimposes upon it the reign of information, which shapes, at last, an inhabitable imago mundi allowing, in addition, an action on reality. What is more, from a linguistic point of view, the video game produces what we could call a language of globalisation, that is to say a language spoken at the global scale regardless of socio-cultural and linguistic belongings. The gamers’ language, in this French speaking novel, is thus under the double influence of its playing field (the world and of the game itself which is conditioned by its coding, speed and performativity requirements. Henceforth, it is precisely in these diegetic and linguistic spaces under tension, and through the video game that a poetic way of inhabitablebiting the world rebuilds itself, together with a new measure of the world.

  19. Mazo un vidējo uzņēmumu pieeja finansēm, Latvijas uzņēmēju un Eiropas institūciju redzējuma salīdzinājums

    OpenAIRE

    Pence, Monta

    2016-01-01

    Bakalaura darbs sniedz ieskatu un veic izpēti par ES un Latvijas MVU iespējām piekļūt finansējumam. Pieeja finansējumam ir nozīmīgs faktors MVU attīstībai, kas ir cieši saistīta ar valsts ekonomikas kopējo attīstību. Tādeļ, darba mērķis ir atklāt, vai MVU Latvijā saskaras ar problēmu iegūt finansējumu, salīdzinot Latvijas uzņēmēju un Eiropas institūciju vērtējumu. Darbā tiek atspoguļoti MVU finansēšanas avoti, to izmantošana attiecīgi uzņēmuma attīstības posmam, analizētas finansēšanas tend...

  20. Vers un nouveau design d'audio-vidéo-cours à l'Université : " l'encre numérique " : Description du dispositif et première analyse d'usages

    OpenAIRE

    Christoffel, Eric; Trestini, Marc; Rossini, I.

    2010-01-01

    7 pages; International audience; This article presents a new audio-video lecture design for University teaching and reports its impact on the students' learning process. The system is composed of an original lecture presentation tool (the Tablet PC), associated with an online workbook. The lecture is first saved, sequenced, and then uploaded in small parts in the different directories of the workbook. The students may then use its contents as much as they wish. This system was tested on relat...

  1. Effects of kaolin-additions in combustion of wood fuels on hardening and leaching properties of ash; Paaverkan av kaolintillsats vid foerbraenning av biobraensle paa askans haerdnings- och lakningsegenskaper

    Energy Technology Data Exchange (ETDEWEB)

    Steenari, Britt-Marie; Karlfeldt, Karin (Dept. of Chemical And Biological Engineering, Chalmers Univ. of Technology, SE-412 96 Goeteborg (Sweden)). e-mail: bms@chalmers.se

    2007-06-15

    In several investigations it has been shown that kaolin works well as an anti-agglomerating and anti-ash sintering agent in combustion of bio-fuels with a potassium rich ash in fluidised bed boilers. Combustion tests have shown that the kaolin addition may result in an ash melting temperature that is a couple of hundred degrees centigrade higher than for the original ash. This way the kaolin hinders the fouling of super heater surfaces by sticky ash. Many boiler owners treat their wood fuel ash with the aim to recycle it to forest soil as a nutrient source and acid neutralising agent. Therefore it was considered important to investigate if an addition of kaolin in the boiler would have a negative influence on the ash leaching properties. Thus, the aim of the project was to investigate the hardening reactions and leaching properties of normal wood ash and wood ash produced with addition of kaolin. The ash samples were produced in the same boiler and in similar combustion conditions. It was especially interesting to study if the ash would contain soluble aluminium due to the kaolin addition since aluminium in solution may have negative effects on the eco system. The results showed that an important difference between the normal fly ash and the fly ash with kaolin was that the release of potassium i leaching was decreased due to the kaolin addition, especially at high pH levels. This is positive, since potassium normally is released very fast in the forest. In addition, the kaolin containing ash has a faster initial setting/hardening process than the normal ash. The structure of the hardened ash particles is also more durable than that of the normal ash. This is also a positive effect since it indicates that it could be possible to handle the hardened ash after a shorter storage period. However, it has not been investigated if this effect remains in large scale operation and in a longer time perspective. The acid neutralising capacity of fly ash with kaolin is, calculated per kg of ash, somewhat lower that for the usual ash. The kaolin is accumulated in the fly ash since it has such a small particle size and thus dilutes the fly ash and lowers its content of acid neutralising components. This can be compensated for by spreading more ash per hectare. The leaching of aluminium from the kaolin containing ash was low at all pH levels studied (4- 13). Consequently, spreading of such an ash is not considered to pose any risk for the environment. In addition, the leaching of trace metals from the ash was not affected negatively by kaolin addition

  2. Bonus systems and their effects on safety: an interview-based pilot study at the Swedish nuclear power plants; Bonussystem och dess inverkan paa saekerheten: en intervjubaserad pilotstudie vid de svenska kaernkraftverken

    Energy Technology Data Exchange (ETDEWEB)

    Torbioern, Ingemar; Mattson, Malin (Inst. of Psychology, Stockholm Univ., Stockholm (Sweden))

    2009-03-15

    The aim of this pilot study has been to describe and analyse potential effects on safety-related behaviour and risks associated with the bonus systems currently used at Swedish nuclear plants. To this end and in order to establish a frame of reference several theories on motivation were consulted regarding the relevance of monetary rewards. In addition empirical evidence on effects upon behaviours in general and safety behaviours in particular was taken into consideration, as well as a systems and a rationalist perspective on organisations. The resulting frame of reference was used for a descriptive mapping of the bonus systems and for the formulation of a semi-structured interview schedule intended to capture the experiences of those concerned by the systems. A total of 15 interviews were performed with staff of different functions and organisational positions. Results of the study do not indicate any negative effects on safety-related behaviours. Rather they indicate that safety-behaviours may be promoted insofar as bonus rewards are linked to performance goals concerning safety. All of the bonus-systems may be characterised as low in incentive intensity, i.e. produce small effects on motivation and performance. Still, as the systems differ in design and in the way they are perceived, they also represent different challenges in order to function more efficiently as parameters

  3. Contents of a regulatory strategy for assessing future human actions in the safety evaluation of a repository for spent fuels; Innehaallet i en strategi foer myndighetsbedoemning av framtida maenskligt handlande vid vaerdering av saekerheten for slutfoervar

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Wickham, S.M.; Galson, D.A. [Galson Sciences Ltd., Oakham (United Kingdom)

    2001-08-01

    The objective of this report is to discuss issues that should be considered in the development of a regulatory strategy for assessing future human actions in any forthcoming license application for a deep repository for spent fuel in Sweden and for sites of other repositories. The report comprises an outline of key issues concerning the treatment of future human actions in safety assessment, reviews of regulatory developments, recent safety assessments and supporting studies, and international initiatives on the treatment of future human actions in safety assessment, and the principal elements of a regulatory strategy. Performance assessments (PAs) are generally accepted as providing illustrations of system performance under given sets of assumptions. The results of PAs are clearer and easier to understand if certain large uncertainties are accounted for by determining performance under several different sets of assumptions or scenarios, each of which defines a possible evolution of the disposal system. A number of assumptions can be made that would restrict the scope of an assessment without reducing the credibility of the corresponding safety case. Reducing speculation about technological development, by assuming that the techniques used in future human activities are similar to those currently in use in the region or at similar sites, will simplify the assessment. A distinction is generally made between inadvertent and intentional intrusion, with intentional activities excluded because society cannot protect future populations from their own actions if they understand the potential consequences. A division of human activities into 'recent and ongoing' and 'future' activities considers not only the timing of the activities but also the degree of control or influence that can be imposed on them. Recent and ongoing human activities are those that affect an area beyond the immediate vicinity of the disposal facility and which neither the proponent nor the regulator can influence. Examples include anthropogenic climate change and activities that have recently taken place in the vicinity of the disposal site, such as groundwater abstraction. Future human activities are those that may take place in the vicinity of the disposal system at some time in the future and which may affect the performance of the disposal system by by-passing or affecting the characteristics of the engineered and natural barriers. Institutional controls can prevent or reduce the likelihood of any disruptive activities. It may be inappropriate to treat recent and ongoing human activities in the same way as future human activities. Scenarios that include the occurrence of future human activities are conditional and are used to illustrate the potential behaviour of the system. Scenarios including recent and ongoing human activities are not conditional and may provide a better estimate of system performance than those that exclude such activities. The focus of assessments of future human actions should be on longer-term doses received by groups of people who might anyway be considered in the Reference Scenario In particular, human intrusion assessments should include groups considered in assessments of groundwater releases who may receive additional doses from new pathways arising from future human actions, and groups consuming foodstuffs contaminated by radionuclides brought to the surface during or subsequent to an intrusion and dispersed into, the biosphere. Members of a drilling crew that intrude into a repository do not fulfil the definition of a potentially exposed group because any intrusion would be an isolated activity not occurring on a day-to-day basis. The dose received by one individual from a specific short-term event cannot be compared with a regulatory criteria expressed as an average annual dose. The following outline strategy is proposed as a basis for consultation on the treatment of future human actions. Assessments must include calculations of disposal system performance without any disruptive future human actions. These calculations should include the effects of any recent and ongoing human activities that might affect the performance of the disposal system. Additional calculations should illustrate the potential effects of disruptive human actions. Assessments of future human actions should be based on present-day conditions in the region of the disposal site and similar sites. Site-specific definitions of the region considered and the period examined for defining rates and frequencies should be provided by the proponent. Assessments should consider the long-term effects of disruption through the formation of new pathways and the dispersal of radioactive material in the biosphere. The proponent should develop and justify the scenarios analysed in an assessment. (abstract truncated)

  4. Impact assessment of the effect of natural values of interim storage, encapsulation and disposal of spent nuclear fuel in Oskarshamn. Laxemar; Konsekvensbedoemning av paaverkan paa naturvaerden vid mellanlagring, inkapsling och slutfoervaring av anvaent kaernbraensle i Oskarshamn. Laxemar

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Magnus (Ekologigruppen AB, Stockholm (Sweden))

    2011-03-15

    The report describes the natural environment and its natural values in Laxemar Simpevarp, the final disposal facility's impacts on the natural environment and measures that can be taken to reduce these. Both terrestrial and aquatic environments are described. Impact on the natural environments of groundwater reduction is not discussed here but described in a separate report, together with consequences of radiation. The report shall serve as a basis for the Environmental Impact Assessment for the application according to the Environment Act.

  5. Investiguer le rapport au genre sur un espace de communication en ligne : étude de cas à partir d'une vidéo Youtube et de ses commentaires.

    OpenAIRE

    Schneider, Elisabeth

    2016-01-01

    Enquête exploratoire; As for Candace West, gender is an attribute of social relationship (West, 2009) and that we may understand it by investigating the social relations and spaces of its production, we propose to account for the analysis of a space which mediates and thematises. It is a video submitted by a teenage girl and on Youtube which have many comments. After a point on the theoretical framework that we mobilize to build this object at the intersection of works on the sociability spac...

  6. Evaluation of a new vine trellis system called Ramé / Evaluación de un nuevo sistema de conducción de la Vid denominado Ramé

    Directory of Open Access Journals (Sweden)

    Valeria Bergas

    2016-01-01

    Full Text Available You should leave 10 mm of space above the abstract and 15 mm after the abstract. The heading Abstract should be typed in bold 9-point Arial. The body of the abstract should be typed in normal 9-point Times in a single paragraph, immediately following the heading. The text should be set to 1.15 line spacing. The abstract should be centred across the page, indented 15 mm from the left and right page margins and justified. It should not normally exceed 200 words. Under this problematic context, several growers in our area proposed alternatives to conduction systems. An innovation was the system of divided canopy “Ramé”, developed by the local viticulture Luis Alberto Ramero. This system was attempted to combine high yield with high quality grape, machanize harvest and good cinditions of canopy microclimate. It's a system of vertical shoot position, with its canopy divided into two planes. These systems are characterized, in our region, by a low foliar surface exposed per hectare, a relatively low productivity (in the case of the VSP or difficulty to mechanize the harvest (in the case of the Parral. The objective of this study was to evaluate the ecophysiology of Rame system, determining if it behaves differently when it is planted with one or two plants by post (Rame single and double. Also the two modalities of Rame were compared with the trellis in VSP. Since this latter system is not included in the statistical, but planted design on the side of the test, the comparison kept a descriptive character. For the Rame we established an experimental trial with statistical design, with two treatments in trellis-training system. A treatment consisted in planting one vine per post, called simple Rame (RS and two vines per post, called double Rame (RD, leaving in this way different number of plants per unit area (1600 plantas / has and 3200 plantas / has respectively. Nevertheless, regardless of the number of plants per hectare, Rame system maintain high values of anthocyanins (1, 2 mg/Kg of grapes and IPT (43 with high production (152 qq / has. This fact, added to that the system has potential for mechanization, converts Rame in a trellis system with high potential for vine growth in the viticulture regions. The trellis VSP behaved less productive (86 qq / has, and at the same time obtained lower values of qualitative components such as anthocyanins (1.04 mg/Kg of grapes and IPT (35.

  7. The estimated additional costs for combustion of agro fuel and the potential of farmers to influence fuel quality; Identifiering av energiverkens merkostnader vid foerbraenning av aakerbraenslen samt lantbrukarens moejlighet att paaverka braenslekvaliteten

    Energy Technology Data Exchange (ETDEWEB)

    Myringer, Aase; Petersen, Martin; Olsson, Johanna; Roennbaeck, Marie; Bubholz, Monika; Forsberg, Maya

    2009-05-15

    The main objectives of this study were to identify and calculate the additional costs to energy plants of combustion of agro fuels instead of wood chips, and to determine the potential farmers have to influence fuel quality and thus identify parameters that could be used for pricing in the future. The overall aim is to increase the volume of agro fuels produced. Four agro fuels were considered in this study: willow, straw, husks and reed canary grass. These four were selected because data were available on their combustion at energy plants and because they are representative of different categories of agro fuels: short rotation coppice, crop by-products, seeds and grass. Data were obtained through literature surveys, telephone interviews with farmers, researchers, advisors and contractors, and visits to six energy plants. Combustion properties for each crop and data on combustion were compared. Measures that could be taken by farmers to improve fuel quality today and perhaps in the future were estimated. Although information and experience proved to be lacking in this area, it was possible to identify some potential measures, which are listed below for each fuel. To promote expansion of the agro fuel market, issues concerning business contacts and forms of organisation were examined. The choices and preferences of farmers as regards sale and delivery are influenced by a number of different factors, which were investigated here by studies of the literature and interviews with farmers. There was little documentary evidence available on combustion of agro fuels. Short-term trials have been carried out on small amounts of a number of crop species without specific documentation of emissions, maintenance costs, ash handling, etc. The additional costs to energy plants for combustion of agro fuels compared with wood chips were investigated on visits to energy plants by collecting data directly and by interviewing plant personnel. The additional costs were then calculated for each fuel and type of boiler, but the specific conditions prevailing in any individual plant will obviously affect the actual costs. General conclusions were: Additional costs for an outage caused by the agro fuel depend on whether there is an accumulator to cover some of the load, and on the other types of boilers and equipment available. Additional costs for ash handling depend on the technical system and business agreements concerning ash handling, which differed between the energy plants visited. Additional costs arising when a boiler and/or fuel is new can be reduced by hard work and experience. In one example (Saatenaes), feeding a new boiler with new straw with a moisture content of 20-22% caused problems with fuel feeding, more frequent soot blowing, etc. Through persistent efforts and feedback on straw quality to farmers, these problems have been eliminated. In two cases, 100% agro fuel was combusted during part load periods. In one case full load could not be achieved because of low bulk density and resulting limitations of the feeding system, and in the other case high load was known to cause problems with fouling and dust production. Using agro fuels during part load was not considered an additional cost. At the two combined heat and power plants (CHP-plants) visited, the upper limit for willow in the fuel mix was set at 15%, since additional costs caused by increased fouling are expected beyond this level (based on experience). This study has mainly focused on the cost for a plant to change from forestry fuels to agro fuels. However, a more common issue is to co-combust a cheaper fuel. This is especially true for larger boilers mainly due to the fact that the fuel availability is more uncertain if large quantities of agro fuels shall be used, and that problems like increased deposit or corrosion rate shall be avoided. Therefore this investigation has looked both at cases with combustion of 100 % agro crops (Jordbro, Kvaenum, Graestorp and Saatenaes) and at cases with co-combustion (Enkoeping and Eskilstuna). Co-combustion of agro fuels with another fuel can reduce the problems that might arise due to the fuel properties of the agro fuels, and has therefore an influence on the rate of extra costs. To increase the market for agro fuels, there is a need for: Information to farmers about existing crops and potential buyers. Initiatives from the energy companies are desirable. Tangible information to suppliers on the structure of the whole chain and the need to grow and deliver consistent amounts. Contract forms that give farmers an acceptable risk. A dialogue between farmers and the energy companies concerning the quality changes that can be achieved by decisions at harvest, storage, transport and price-setting, etc

  8. Results from a full scale application of ashes and other residuals in the final cover construction of the Tveta landfill; Utvaerdering av fullskaleanvaendning av askor och andra restprodukter vid sluttaeckning av Tveta Aatervinningsanlaeggning

    Energy Technology Data Exchange (ETDEWEB)

    Tham, Gustav (Telge AB, Soedertaelje (Sweden)); Andreas, Lale (Luleaa Univ. of Technology, Luleaa (Sweden))

    2008-06-15

    In 2000 Telge Aatervinning - a waste management and recycling company - started investigating ashes from incineration of industrial and biowaste waste. The company was given a permit from the Swedish Environmental Court to cover four hectares of the house hold waste landfill area. In 2006 the company received an unlimited permit to cover the remaining part of the landfill when the works end some thirty years later. Ashes were used the first time in 1966 for testing. Literature studies indicated the ashes can have a low hydraulic conductivity under certain conditions. In 1999 collaboration started with the Division of Waste Science and Technology at Luleaa University of Technology. Residuals from household and industrial waste were subject to investigation. Initially, biowaste incineration products were subject to testing and were later extended to other waste products, e.g. sludge, contaminated soils, foundry, and compost material. Several different sub-fractions of ashes were included in the investigation e.g. bottom and fly ash, various slag products after up-grading including dewatering, separation and sifting. Subsequently, a complete covering system of a landfill consists of residuals. Six test areas were outlined in order to give a good representation for cover construction in flat and steep areas with different compositions of liner material. The results show that in all areas the hydraulic conductivity construction yields less then 50 liters per square meters and years and can be less the than 5 liters in a repository for hazardous waste if required. In accordance with literature data the field observations show the liner material constructed only by ash material under certain conditions can form a monolithic structure due to very slow processes thus indicating small pore volumes that unable water air to interact with other media. The concept of using ash can be related to natural analogues of volcanic ashes and has been used in old defence walls and other buildings thousand years back. The last part of the report brings a number of topics for future research and a discussion about problems to with the authorities to use residuals for covering landfills

  9. Flue gas wells to minimize dust and acidic components in small-scale burning of field fuel, further development; Roekgasbrunn foer minimering av stoft och sura komponenter vid smaaskalig foerbraenning av aakerbraenslen, vidareutveckling

    Energy Technology Data Exchange (ETDEWEB)

    Yngvesson, Johan; Roennbaeck, Marie; Arkeloev, Olof

    2011-01-15

    Agricultural derived solid fuels are more problematic to combust in small-scale heating plants than conventional wood fuels. Their high content of ash, chlorine and sulphur leads to increased emissions of dust, sulphur dioxide and hydrogen chloride in the flue gases. By transporting the flue gases to a flue gas well where it condenses, and separates dust and sour components, enables a cost effective flue gas purification for small-scale heating plants (50 kW - 10 MW) of agricultural derived solid fuels. This project have studied two heating plants using flue gas wells with the aim to add to the knowledge about how a flue gas wells may look like and to quantify how much emissions of dust, chlorine and sulphur in the flue gases are reduced. The project also aimed to summon regulations and laws regarding the handling of the condensate that develop in the flue gas well. In the project measures were conducted on two different heating plants with mounted flue gas wells: a 60 kW biofuels boiler combusting grains and red canary grass and a 1 MW batch fired boiler combusting wheat straw. Measurements on flue gases were conducted with and without water injection in the flue gases. The flue gas wells reduced dust emissions of up to 80 %. The best reduction was achieved at the 60 kW heating plant when firing red canary grass. Firing grains in the same plant lead to 7 % reduction of the dust emissions. In the 1 MW heating plant firing wheat straw the flue gas well accomplished 40 % reduction of dust emissions. The boiler ability to achieve complete combustion, hence minimize the content of volatile and semi-volatile components in the flue gas, is largely affecting the flue gas well ability to reduce dust emissions. This did not, however, affect the reduction of dust in the flue. Chlorine emissions was reduced by up to 88 % by a flue gas well. Water injection made a big difference on reduction of chlorine emission from grain combustion. Sulphur emissions was reduced by 50 %, from wheat straw combustion, by a flue gas well. No reduction of sulphur was achieved from grains combustion in the 60 kW heating plant and water injection had little or no effect on the reduction rate. As the condensate was very acetic and potentially erosive an ejector fan was used to cool down the flue gases enough to enable acid resilient plastic pipes to be used for the flue gas canal. The well was drained of condensate continuously and the piping must be sweeped with regular intervals to prevent blockage of the flue gas. Plants below 20 MW is excluded from national regulations on activity emission regarding flue gas condensate. The Swedish Environmental Code does however place the responsibility for preventing harm to nature upon the practicer. The possibilities of managing the condensate from the flue gas well are spillage to a manure reservoir for spreading it as fertilization on farmland, or spillage directly to receiving waters. The later method require neutralization of the pH, commonly by using sodium hydroxide, but possibly also limestone

  10. Diez portainjertos de vid: Efectos sobre el crecimiento, la producción y la composición de la uva del cv. Sauvignon blanc en la denominación de origen rueda (España

    Directory of Open Access Journals (Sweden)

    Yuste Jesus

    2017-01-01

    Full Text Available The knowledge of the behaviour of different grapevine rootstocks is basic to achieve a good adaptation of vine to its growing area. With the objective of knowing the agronomic and qualitative response of cv. Sauvignon Blanc to the use of several rootstocks, a trial was established in 2006 in the D.O. Rueda. The vines are vertical trellised, with bilateral Royat cordon pruning, and the vine spacing is 2.60 m × 1.25 m. The row orientation is NNW (N-25°. The experimental design consisted of randomized blocks with 4 replications and elemental plot of 60 vines. Over the period 2010–2014 it has been developed the study of the following 10 rootstocks (treatments: 110R, 101-14M, 420A, 3309C, 41B, 161-49C, 196-17C, Fercal, Gravesac and RGM. The rootstocks 420A and 41B showed a production higher than 50% with respect to 196-17C and 161-49C, and higher to 100% than RGM, due to the number of clusters per vine and, in greater amount, to the cluster weight. Fercal and Gravesac showed an increase of pruning wood weight of 24% with respect to 196-17C and 161-49C, and 90% with respect to RGM, mainly due to the shoot weight. The sugar concentration increased with 101-14M, 196-17C and Fercal, and became reduced with 161-49C, 41B and RGM. The pH of must was reduced with Fercal whereas the titratable acidity increased, which also showed increase with Gravesac and 161-49C. The tartaric acid hardly increased slightly with Fercal and 161-49C, whereas the malic acid increased with Gravesac and Fercal, and was reduced with 41B, 3309C, RGM and 101-14M. The potassium concentration increased with 196-17C, Gravesac and Fercal, and was reduced with 41B, 161-49C, 420A and 3309C. The effects observed show alternatives for rootstock election according to the growing conditions and objectives of the vineyard.

  11. Michezo Video: Nairobi’s gamers and the developers who are promoting local content\\ud Michezo Vidéo: Les joueurs et les développeurs de Nairobi promouvant le contenu local

    OpenAIRE

    Callus, Paula; Potter, C.

    2017-01-01

    In Kenya, the rise of digital technologies and related new media, and an infrastructure able to support them, has seen the emergence of a growing local video games industry and a new generation of Kenyan video game developers, players and promoters. This article focuses upon the particular design strategies employed by young producers of creative digital content for games and the current networks of practice, play and support unfolding around these new gaming technologies. Interviewees for th...

  12. Saken är biff : En granskning av samförstånd och motsättningar vid införandet av en minskad nötköttskonsumtion

    OpenAIRE

    Molin, Elvira

    2017-01-01

    Svenskarna är ibland de som konsumenterna konsumerar mest nötkött i världen, de äter 26 kg per person och år. Matkonsumtionen generellt står för en tredjedel av de svenska hushållens utsläpp av växthusgaser, och g. Globalt sett står djuruppfödningen till köttproduktion för 14,5 % av utsläppen av alla växthusgaser. Kor är idisslare och deras matsmältning avger metangas vilket bidrar mer till växthuseffekten jämfört med uppfödning av andra djur som inte idisslar. För att minska de utsläppen kan...

  13. Optimal integration of energy at the Combined Energy Plant in Norrkoeping -Integration of steam, hot water and district heat to biogas plants; Optimal integrering av energianvaendningen vid energikombinatet i Norrkoeping -Integrering av aanga, hetvatten och fjaerrvaerme till biogasanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Benjaminsson, Johan; Goldschmidt, Barbara; Uddgren, Roger

    2010-09-15

    The background of this report is to investigate and highlight the benefits of establishing a biogas plant nearby a combined energy plant where steam and district heat is available. By using heat from the combined energy plant, more biogas can be produced as vehicle fuel instead of being used as fuel to heat the digester, the biogas upgrading plant or the dryer. The project's objective is to analyze where it is interesting with integration of heat to the biogas plant and to compare alternative technologies and possible integration options. The stakeholders of the study are industries with access to organic matter for biogas production and heat producers who can deliver thermal energy into biogas plants. The project was implemented by collection of information from the Haendeloe combined energy plant outside Norrkoeping where there is a cogeneration plant, an ethanol plant and a biogas plant. Case studies for the study have been carried out with proposals regarding how heat flows from the power plant and ethanol plant can be further integrated with the biogas plant. As case studies, both the current design of the biogas plant, as well as a fictional case in which half of all distillery residues was digested, have been evaluated. The case studies show that in today's biogas plant it is not economical to replace the existing biogas upgrading unit with water absorption to chemical absorption. The upgrading cost with water absorption at today's smaller facility is 0.11 kr/kWh and in order to obtain the same total cost of chemical absorption a steam price of 0.15 kr/kWh is required. For large gas flows, chemical absorption is an advantage since the technology is more suitable for upscaling in comparison with water absorption that must be delivered in multiple lines. Nevertheless, a possibility to recover waste heat from chemical absorption is necessary if the technology shall be competitive. If waste heat from both water absorption and chemical absorption may be recovered, both technologies have a biogas upgrading cost of 0.05 kr/kWh for large gas flows. When no waste heat can be recovered, the biogas upgrading cost of water absorption and chemical absorption is 0.07 and 0.10 kr/ kWh respectively. For the realization of large biogas plants, it is essential to find mechanisms for dealing with bio-manure. The report has studied a system with concentration of pellets by mechanical dewatering, evaporation, drying, and pelleting. The study shows that the concentration costs 1800 - 2100 kr/tonnes of pellets, depending on the design of the drying plant. The energy price for pellets has to be around 0.40 to 0.50 kr/kWh if the concentration shall not be a cost, according to case studies. The nutrient content of biomanure pellets with today's fertilizer prices corresponds to almost 1300 kr/tonne. Drying of distillery residues with today's system, in comparison with using half of the distillerys residues to biogas production, has been compared in the report. The sensitivity analysis shows that the two concepts with today's conditions give equivalent results

  14. Känslor och tankar : En kvalitativ undersökning kring vad någramusikhögskolestudenter känner införoch vid framträdanden

    OpenAIRE

    Tobin, Jonas

    2009-01-01

    Denna uppsats syftar till att få insikt i hur några högskolestuderande på klassisk gitarr och klassiskt piano som spelar solo upplever en konsertsituation. Huvudfrågorna har varit: Vad känner de? Har de några problem/svårigheter och i så fall hur beskriver de upplevelsen av detta? Detta har undersökts genom kvalitativa intervjuer med fem musikhögskolestudenter. Resultatet visar på att samtliga informanter upplever att de delvis påverkas negativt av nervositet i samband med en konsert. Nervosi...

  15. Análisis discursivo de una reunión cerrada en el grupo "la vid" perteneciente a la comunidad de alcohólicos Anónimos

    OpenAIRE

    Gómez Gómez, Luis Fernando

    2001-01-01

    Este trabajo es el resultado de un proyecto de investigación acerca de una comunidad sobre la cual no se han elaborado estudios de tipo lingüísticoetnográfico. Busca identificar las repercusiones socioculturales, así como el uso del lenguaje que sus miembros comparten al interior de la comunidad, a través de las reuniones de grupo, las cuales han demostrado ser una solución y alternativa para la recuperación y detención de la enfermedad del alcoholismo y de otras adicciones; estas reunione...

  16. Water quality 101: Qualité de l'eau 101 [enregistrement vidéo] introduction aux microsystèmes d'approvisionnement en eau potable = Calidad del agua 101 : nociones basicas sobre microsistemas de agua potable

    National Research Council Canada - National Science Library

    2011-01-01

    This product was created as a training tool by the federal Interdepartmental Water Quality Training Board to provide information on water quality mangement methods for potable water systems that serve...

  17. Dig protection and deep installation as risk reducing measures when laying 10 bar PE piping; Graevskydd ock djupfoerlaeggning som riskreducerande aatgaerder vid foerlaeggning av 10 bars PE-roersystem

    Energy Technology Data Exchange (ETDEWEB)

    Karlsson, Linda [SP Sveriges Tekniska Forskningsinstitut, Boraas (Sweden)

    2011-07-15

    The development of polyethylene pipes enables gas distribution with a pressure up to 10 bars. According to current Swedish legislation, the safety distance is the same for gas conduit with 10 bars as for pipe conduits made of steel with a pressure of 80 bars. To be able to reduce the safety distance, actions must be taken to ensure the safety in general, and for the excavator operators in particular, who are usually closest to the conduits when an accident may happen. Excavator operators react on visual impression or a feeling that something deviates from the normal or the expected conditions. The visual impression could be mixed soils or filling materials used around the pipes indicating that excavation activities have occurred before. Marker tape laid in the right manner seems to warn some excavator operators, but far from all. The incident frequency varies considerably between different excavator operators. The excavator operators often blame the network map or incorrect marking. Network owners deny this reason. Excavating incidents mostly occurs across the conduits and most often with smaller excavators than 17 tonnes. During 2010, three excavation related incidents involving natural gas pipelines and 26 involving town gas, were reported to Energigas Sverige. During 2009, the corresponding figures were instead seven incidents with natural gas and 17 with town gas and during 2008 there were six incidences related to natural gas pipelines and only two involved town gas. None of the reported incidents during the three years have led to either injury or death. Heavy concrete plates were used earlier which demanded machines and took much longer to install, but the new polyethylene plates can be installed by hand. Tests performed together with Gas de France and others showed that, if an excavator hits a concrete plate, it is not certain that the digging is stopped. The investigations showed that the digging was stopped immediately when protective polyethylene plates were used. The tests also showed that the new plates could resist digging forces at least as good as the concrete ones. This is most likely due the ductility of polyethylene and the brittleness of concrete. Since the polyethylene plates only have been in use for four years, it is still too early to tell whether they will affect the incident statistics or not.

  18. Influence of vegetation and sewage sludge on sealing layer of fly ashes in post-treatment of mine tailings impoundments; Inverkan av vegetation och roetslam paa taetskikt av flygaska vid efterbehandling av sandmagasin

    Energy Technology Data Exchange (ETDEWEB)

    Greger, Maria; Neuschuetz, Clara (Inst. of Bothany, Stockholm Univ., Stockholm (Sweden)); Isaksson, Karl-Erik (Boliden Mineral AB, Stockholm (Sweden))

    2009-03-15

    Mining industry produces 25 Mton mine tailings yearly that are deposited in impoundments in the nature. When this sand, containing sulphur rich minerals, reacts with oxygen and water it starts to weather and acidic metal rich water is formed. To prevent this, the sand can be covered with a sealing layer and a protective cover layer with vegetation. As sealing and cover materials fly ashes and sewage sludge can be used. The aim of this investigation was to find out: 1) how sealing layer of fly ashes with and without sewage sludge, and a cover with sewage sludge can be placed practically on mine tailings in a cold climate. 2) how such a cover should be constructed to minimize the risk of root penetration and leakage of nutrients and metals 3) which vegetation that is most suitable This was investigated in field- and greenhouse tests with a sealing layer of fly ash and/or sewage sludge with a cover layer of sewage sludge in which different plant species were established. The practical application was performed in 0.3-1 ha plots at a mine tailings impoundments at Boliden. The ability of plant roots to penetrate a sealing layer was investigated, as well as the effect of simulated root exudates on the penetration resistance in hardened ash. Leakage of nutrients and metals from cover layer of sewage sludge, in some cases with sealing layers beneath, was investigated in field and greenhouse lysimeters. Various plant species were compared on their ability to affect metal and nutrient leakage as well as root penetration and shattering of the hardened ashes. The project was a cooperation between Stockholm University and Boliden Mineral AB, and the field tests were performed at the impoundment Gillervattnet in Boliden and in Garpenberg. Cooperating were also Iggesund Paperboard, Skellefteaa Kraft, Stora Enso Fors, Umeaa Energi and Vattenfall, all producers of ashes that were used, as well as Stockholm Vatten AB, which produced the sewage sludge. The most important conclusions are that: It is possible to apply a sealing layer of ashes on mine tailings independent of season due to the quick hardening process of the ashes. Sewage sludge can, on the other hand, only be applied when the tailings are frozen. The application leads to a rise in the ground water level in the tailings Covering of mine tailings with sewage sludge and fly ash decreases the metal leakage. The higher proportion of sewage sludge in the cover layer the more N and P and less metals is released. The leakage decreases with time. Plant establishment in general decreases the leakage of metals and nutrients, especially by decreasing the amount of leakage water. Because of great amounts of nitrate in sewage sludge plants with a high uptake of nitrate is to prefer to decrease the nitrogen leakage. Some plant species can loosen up the surface of hardened fly ash, and in that way influence the sealing layer structure. This may lead to increased breaking down of secondary minerals, which can be important for the stability of the sealing layer. It is possible that excretion of sacharids from plant roots can increase shattering of ash, and that such exudation increases in the presence of ash. Estimation of the resistance needed to avoid root penetration were made to approx2,5 MPa. Addition of sewage sludge increases the risk of root penetration of a sealing layer. Since roots can affect a thin sealing layer a thickness of approximately 0.5 meter is recommended

  19. Particle size distribution of ashes and the behaviour of metals when firing Salix in a circulating fluidized bed boiler (CFB); Askans partikelfraktionsfoerdelning och metallernas beteende vid eldning av Salix i en CFB-panna

    Energy Technology Data Exchange (ETDEWEB)

    Sfiris, G.; Johansson, A. [Vattenfall Utveckling AB, Stockholm (Sweden); Valmari, T.; Kauppinen, E.; Pyykoenen, J.; Lyyraenen, J. [VTT Technical Research Centre of Finland, Espoo (Finland)

    1999-07-01

    This project is part of the Ash Recovery Programme aimed at establishing the environmental, technical and financial preconditions for returning wood ash to the forest. The programme is funded jointly by NUTEK, Sydkraft and Vattenfall. This report summarises the results of the experimental and modelling work to study the behaviour of the metals (especially Cd and K), after burning Salix in a 3-12 MW Circulating Fluidized Bed (CFB) boiler. The purpose of the study was to determine, using the experimental data, where cadmium and potassium condense, on what size particles they condense, and the decisive parameters governing these processes. Measurements of the fly ash particle size distribution carried out with a Berner Low Pressure Impactor (BLPI), coupled to a pre-cyclone. Samples were collected from three points: in the convection path at 650 deg C, after the convection path but before the secondary cyclone (160 deg C), and after the bag house (150 deg C). Wet chemical sampling was made for Cd, K, Zn and Pb, with three types of sampling equipment: collection of both particles and gas, collection of particles only, and analysis of the gas phase only. Analysis was made of samples from two places in the convection path (650 deg C and 250 deg C). Samples of bed material, bottom ash and fly ash have been subjected to scanning electron microscopy (SEM), and in addition a few fly ash particles, sampled after the convection path, were subjected to energy dispersive X-ray analysis (EDX). Based on experimental results, modelling work was carried out with an equilibrium model and with a general aerosol computer model ABC (Aerosol Behaviour in Combustion)

  20. Acceptance-criteria for the bedrock for deep geologic disposal of spent nuclear fuel. Proceedings from a seminar at Gothenburg University; Acceptanskriterier foer berggrunden vid djup geologisk slutfoervaring av anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    The seminar was directed to Nordic participants, and discussed disposal in the Nordic crystalline bedrock. Criteria for the bedrock should include: It should give durable mechanical protection for the engineered barriers; give a stable and favorable chemical environment for these barriers; have a low turnover of ground water in the near field; be easy to characterize; give favorable recipient-conditions; not have valuable minerals in workable quantities. These general criteria raise several questions coupled to the safety analysis: e.g. the need for geological, hydrological and geochemical parameters. Which data are missing, which are most difficult to find? What should the site characterization program look like to focus on factors that are of the highest importance according to the safety analysis. The demands on the conditions at a site need to be translated into quantitative criteria, which should be expressed as values that can be measured at the site or deduced from such measurements. These questions were discussed at the seminar, and 21 contributions from Finnish, Norwegian and Swedish participants are reported in these proceedings under the chapters: Coupling to the safety analysis; Methodology and criteria for site selection in a regional geoscientific perspective; Rock as a building material - prognosis and result; Geoscientific criteria for the bedrock at the repository - Mechanical protection; Geoscientific criteria for the bedrock at the repository - Low ground water turnover, chemically favorable and stable environment in the near field; Geoscientific criteria for the bedrock at the repository - Demands on the bedrock concerning the migration of radionuclides.

  1. Čínské vidění světa – ideologické pozadí tributárních vztahů

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Jakub

    2017-01-01

    Roč. 72, č. 2 (2017), s. 27-36 ISSN 0029-5302 R&D Projects: GA ČR GA15-21829S Institutional support: RVO:68378009 Keywords : Imperial China * diplomacy * tributary relations * Chinese world order Subject RIV: AB - History

  2. Radiation protection actions at Swedish nuclear power plants 1994-2002 and some reflections about the near future; Straalskydd vid svenska kaernkraftverk under perioden 1994-2002, samt reflexioner om kommande utveckling

    Energy Technology Data Exchange (ETDEWEB)

    Erixon, Stig; Godaas, Tommy; Hofvander, Peter; Lund, Ingmar; Malmqvist, Lars; Thimgren, Ingela; Oelander-Guer, Hanna

    2003-12-01

    This report provides a summary of radiation protection experiences over the years 1994-2002 in the Swedish nuclear power industry. Actions to reduce radiation levels in reactor systems, occupational exposure results and some reflections about the near future are presented.

  3. Prediktion av översvämningsrisken vid vägar - En undersökning av två översvämningar i Östersunds kommun 2008.

    OpenAIRE

    Davidsson, Emil; Persson, Erik

    2015-01-01

    Pågående klimatförändringar med påföljande ökad nederbörd ger förhöjd risk för översvämningar. Det är därför viktigt att kunna göra förutsägelser för var översvämning riskerar att ske. Förutsättningarna att göra sådana prediktioner med geografiska informationssystem ökar då Sveriges geografi karteras i allt större utsträckning. Syftet med uppsatsen är att utföra och analysera en modell för kartering av översvämningsrisk av väg. Det görs genom GIS-analys av geografiska data, baserade på platss...

  4. Framgångsfaktorer och barriärer vid integrering av klimatanpassning i  kommunal RSA : En undersökning av Värmlands småkommuner

    OpenAIRE

    Davidsson, Åsa

    2016-01-01

    Att klimatet förändras är konstaterat, skulle utsläppen av växthusgaser kraftigt minskas kan de påbörjade klimatförändringarna ändå inte helt förhindras. Förändringarna innebär att extremväder kommer inträffa oftare men med geografiska skillnader. Till seklets slut väntas i Värmland exempelvis nuvarande tioårsregn istället inträffa var femte år. Vänern kommer i och med detta utgöra en av de största översvämningsriskerna. Hur dessa förändringar påverkar samhället varierar beroende på samhället...

  5. Vad utgör en god arbetsmilljö? : En jämförelse mellan arbetsgivare och anställda vid kommunala bolag i Umeå

    OpenAIRE

    Åström, Lovisa

    2017-01-01

    What constitutes a good working environment? - A comparison between employers and employees of municipal companies in Umeå Lovisa Åström Abstract The knowledge of the work environment´s importance has grown bigger by the years, especially the value of the psychosocial environment. According to the Swedish work environment law all workplaces today must attain a systematic working environment. However not all employers understand the importance of this working method. The purpose of this study...

  6. Adaption of the radiation dose for computed tomography of the body - back-ground for the dose adaption programme OmnimAs; Straaldosreglering vid kroppsdatortomografi - bakgrund till dosregleringsprogrammet OmnimAs

    Energy Technology Data Exchange (ETDEWEB)

    Nyman, Ulf; Kristiansson, Mattias [Trelleborg Hospital (Sweden); Leitz, Wolfram [Swedish Radiation Protection Authority, Stockholm (Sweden); Paahlstorp, Per-Aake [Siemens Medical Solutions, Solna (Sweden)

    2004-11-01

    When performing computed tomography examinations the exposure factors are hardly ever adapted to the patient's size. One reason for that might be the lack of simple methods. In this report the computer programme OmnimAs is described which is calculating how the exposure factors should be varied together with the patient's perimeter (which easily can be measured with a measuring tape). The first approximation is to calculate the exposure values giving the same noise levels in the image irrespective the patient's size. A clinical evaluation has shown that this relationship has to be modified. One chapter is describing the physical background behind the programme. Results calculated with OmnimAs are in good agreement with a number of published studies. Clinical experiences are showing the usability of OmnimAs. Finally the correlation between several parameters and image quality/dose is discussed and how this correlation can be made use of for optimising CT-examinations.

  7. Bio energy production in birch and hybrid aspen after addition of residue based fertilizers - establishment of fertilization trials; Bioenergiproduktion hos bjoerk och hybridasp vid tillfoersel av restproduktbaserade goedselmedel - etablering av goedslingsfoersoek

    Energy Technology Data Exchange (ETDEWEB)

    Thelin, Gunnar (EkoBalans Fenix AB, Malmoe (Sweden))

    2009-03-15

    Sewage sludge and wood ashes could be used as fertilizers in order to increase forest tree production. In southern Sweden forest growth normally increases with approximately 10 % after ash recycling due to increased N and/or P availability. P is added with the ashes and the pH-increasing effect of the wood ash can lead to increased N net mineralization. Other positive effects of wood ash recycling are improved nutrient sustainability and less acid run-off water. Possible negative effects are heavy metal accumulation, if the content of one or more heavy metals of the recycled ash exceeds the heavy metal content of the harvested biomass, and nitrate leaching if the vegetation cannot take up nitrified N. It is important to evaluate the sustainability of fertilization systems based on residues such as sludge and wood ash. Wood ash does not contain N and the P concentration often is too low for the ashes to function as an NP fertilizer. Thus N and sometimes P must be added. Sludge is an interesting alternative. The main purpose of the project is to study sustainable production of forest bio energy in intensively cultivated birch and hybrid aspen stands. Another purpose is to establish experiments that can be used for long term studies and as demonstration objects. In the first few years the goal is to study the short term effects of residue based fertilization compared to conventional NPK fertilization on tree nutrient uptake, nutrient leaching, sustainability and economy. In the long term the goal is to design appropriate fertilization strategies in a residue based fertilization system for the intensive cultivation of birch and hybrid aspen without negative side effects such as large scale nutrient leaching. Four field experiments were established in 2008 and one additional experiment in hybrid aspen will be established in the spring of 2009. Elevated bud N and P concentrations after fertilization with both Ashes+N and NPK means good possibilities for future growth increases. But, tree growth response should be studied before any conclusions can be drawn regarding biomass production in the experiments. The similarities in plant response to Ashes+N and NPK suggests that Ashes+N can be used as a P and K resource in the fertilization of young stands of birch and hybrid aspen. If the Ashes+N treatment results in increased N availability due to the pH increase, possibly the N dose could be lowered in order to decrease the risks for N leaching without negative effects on tree N uptake. Tools for the prediction of N mineralization need to be developed. The energy harvest for fertilized birch and hybrid aspen appear to be at least as high as for fertilized Norway spruce. Intensive cultivation including fertilization of young stands appears to be energy efficient: the energy input is a small fraction of the increase in energy harvest. Residue based fertilization appears to be more energy efficient than fertilization with NPK. If production systems other than the ones currently applied are more efficient in terms of sustainable energy production it is important to review the funding of research and development within the field. Which species or species mixtures are most efficient under which soil and climatic condition? Management programs and harvesting techniques need to be developed. More studies on fertilization response and energy harvest in deciduous species with and without the use of residue based fertilizers are needed in order to develop guidelines for the sustainable production of forest bio energy. Empirical studies should be combined with modeling studies in order to improve the understanding of the systems and predictability of management measures. Residue based fertilization appears to be attractive both environmentally and economically, but it is important that such systems are evaluated closely in terms of growth response, nutrient leaching, carbon and metal balances, etc. in comparison with conventional fertilization

  8. Anställdas upplevda roller vid självbetjäning : En studie om förväntningar, upplevelser och värdeskapande från anställdas perspektiv

    OpenAIRE

    Byrinder, Ida; Hellström, Josefin

    2016-01-01

    Bakgrund - Självbetjäningstjänster ger andra förutsättningar i tjänstemötet för anställda eftersom kunder interagerar med teknik istället för människor. Tidigare forskning i samband med självbetjäningsteknologier fokuserar på kundens perspektiv vilket skapar en intressant grund att undersöka hur anställda upplever självbetjäningsteknologier och hur de kan skapa värde enligt den tjänstedominanta-logiken.  Syfte - Uppsatsens syfte är att undersöka anställdas upplevda roller när självbetjäningst...

  9. Improved combustion performance of waste-fired FB-boilers -The influence of the dynamics of the bed on the air-/fuel interaction; Foerbaettrad foerbraenningsprestanda vid avfallsfoerbraenning i FB-pannor -Baeddynamikens inverkan paa luft-/braensleomblandningen

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, Johanna (Hoegskolan i Boraas (Sweden)); Pallares, David; Thunman, Henrik; Johnsson, Filip (Chalmers (Sweden)); Andersson, Bengt-Aake (E.on/Hoegskolan i Boraas (Sweden)); Victoren, Anders (Metso Power AB (Sweden)); Johansson, Andreas (SP, Boraas (Sweden))

    2010-07-01

    One of the key benefits of fluidized bed combustion is that the bed - through mixing of fuel and air and accumulated heat - facilitates combustion at low stoichiometry and with low emissions. Even so, it is not unusual that waste-fired FB-boilers are operated at 6-8% oxygen that corresponds to 30-40% higher flows of gas than theoretically needed. In addition to that and in comparison to grate furnaces, FB-boiler can cause high pressure drop losses because of the fluidization of the bottom bed, which in turn are associated with high costs for power (fans). This work aims therefore at increasing the knowledge for how the dynamics of the bed affects the air and fuel mixture. Methods to explain and characterize the phenomenon have been derived within this work showing: - Distribution of air in a bed for various cases and the influence of pressure drop, bed height and fluidization velocity - A semi-empiric method to calculate an even bubble distribution - The relation between fluidization and fuel distribution for various fluidization flows and fuels - Dispersion rates for various fuels - Volatilization rates for waste in relation to biomass The result can be useful when optimizing units, for instance through finding as low pressure drops as possible with an even bubble distribution, low risk for sintering and unwanted emissions. The work has thereby reached its ultimate goal of increasing the generic knowledge about waste combustion in FB-boiler

  10. Nematicide Effect of Various Organic Soil Amendments on Meloidogyne ethiopica Whitehead, 1968, on Potted Vine Plants Efecto Nematicida de Varias Enmiendas Orgánicas Sobre Meloidogyne ethiopica Whitehead, 1968, en Plantas de Vid en Macetas

    Directory of Open Access Journals (Sweden)

    Lucia Rivera

    2008-09-01

    Full Text Available Five organic soil amendments were evaluated for their nematicide effect on root-knot Meloidogyne ethiopica Whitehead, 1968, on potted Vitis vinifera L. var. Chardonnay plants. The amendments included two immature composts: Compost A made with tea (Camellia sinensis (L. Kuntze residues, broiler litter and grape pomace; Compost B made with tea residues, rachis and grape pomace; and separately dried tea residues, grape pomace and broiler litter. These amendments were either incorporated or applied as cover to the substrate in 5 L pots at the beginning of spring. A chemical treatment with the nematicide fenamiphos and a control with substrate only were added for comparisons. The assay was composed of 11 treatments with six replicates, with a grape plant as experimental unit. Seven months later, the assessment of the treatments was carried out based on number of second stage juvenile, nodules, eggs per root gram and reproductive index. Fresh aerial and root plant weight were also measured. The chemical treatment presented the lowest final population of M. ethiopica. When evaluating the nematicide action of the organic amendments: compost A soil-incorporated and both grape pomace and solid dry tea residue as covers obtained low reproductive indexes, similar to the chemical treatment and control (P ≤ 0.05. No differences in aerial fresh weight were determined. However, the chemical treatment showed the smallest root mass as compared to compost B and solid dry tea residues, both as cover.Se realizó un experimento en macetas con plantas enraizadas de Vitis vinífera L. var. Chardonnay para evaluar el efecto nematicida de diferentes enmiendas orgánicas sobre el nematodo agallador Meloidogyne ethiopica Whitehead, 1968. Se usaron dos composts inmaduros: Compost A, elaborado con residuos de té (Camellia sinensis (L. Kuntze, guano de pollo seco y orujo de uva; Compost B, elaborado con residuos de té, escobajo y orujo de uva; y separadamente residuos sólidos de té; orujo de uva y guano de pollo seco. Estas enmiendas fueron aplicadas a principio de primavera, tanto en cobertera como incorporadas al suelo, considerando además un testigo químico fenamiphos y un testigo absoluto. Se determinó la población de nematodos de segundo estado juvenil (estado infestivo de Meloidogyne spp., la cantidad de nódulos, huevos por gramo de raíz y el índice reproductivo, determinando de esta manera la tasa de reproducción de los nematodos. Además se evaluó el peso fresco de la parte aérea y de la masa radical. El testigo químico fue el tratamiento que obtuvo menor población final de Meloidogyne spp., y al evaluar la actividad nematicida de las enmiendas orgánicas, el Compost A incorporado al suelo, orujo de uva en cobertera y residuos sólidos de té en cobertera obtuvieron índices reproductivos bajos, que no fueron estadísticamente diferentes del testigo químico. En el peso fresco de la parte aérea no hubo diferencias significativas. El peso fresco de la masa radical del testigo químico presentó el valor más bajo comparado con los tratamientos de Compost B en cobertera y residuos sólidos de té en cobertera.

  11. Turbulence and heat transfer in condensate in drying cylinders at high g-forces. Phase 1; Turbulens och vaermeoeverfoering i kondensat i torkcylindrar vid hoega g-krafter. Fas 1

    Energy Technology Data Exchange (ETDEWEB)

    Stenstroem, Stig; Ingvarsson, David [Lund Inst. of Tech. (Sweden). Dept. of Chemical Engineering

    2005-09-01

    Drying of paper is performed by bringing the paper into contact with a hot cylinder surface so that the water in the web is evaporated. The energy needed to heat the drying cylinder is supplied with condensing steam creating a condensate layer on the inside surface of the cylinder. For fast paper machines, the condensate layer will be close to stagnant, thus constituting a significant resistance for the heat transfer process from the steam to the paper. The traditional technique to improve the heat transfer has been to install turbulence bars on the inside surface of the cylinder but at machine speeds of up to 2000 m/min this technique is not sufficiently efficient. The goal in the project has been to study the condensate behaviour in drying cylinders at high centrifugal forces and explore different methods to improve the heat transfer in the condensate for both new and existing fast paper machines so that the capacity in the dryer section can be maintained at a high level. The results are of importance for the manufacturers of paper machines as well as the producing newsprint and printing paper companies. The project has been divided in the following parts: - Literature survey of techniques to increase the heat transfer in condensate and the removal of condensate with siphons. - Develop knowledge about the condensate behaviour in rotating cylinders at high g-forces with and without spoiler bars. This has been accomplished by designing a new cylinder where the condensate velocity relative to the cylinder could be measured at centrifugal forces corresponding to the levels today reached at fast paper machines. Such data have previously not been reported in the literature. - Present solutions for the design of the inside surface of the drying cylinder so that high heat transfer rates can be accomplished in fast paper machines. Solutions should be presented both for existing as well as new paper machines. The results in the project show that at centrifugal forces of over 40g, the condensate layer is stagnant in both smooth and cylinders equipped with spoiler bars. For new machines improved heat transfer can be accomplished by providing the cylinders with axial grooves while for existing cylinders the inner surface of the cylinder should be provided with flanges. Assuming that all the condensate is collected in the grooves, the calculations show that the drying capacity for a cylinder with grooves could be increased with up to 60 % compared with a smooth cylinder with 1 mm of condensate and with 22% compared with a cylinder equipped with spoiler bars. Recommendations for improved heat transfer have been presented for both new and existing machines. New data for the condensate flow at high centrifugal forces has been presented in the project.

  12. Pre-study of dynamic loads on the internals caused by a large pipe break in a BWR; Foerstudie av stroemningsinducerade laster paa interndelar vid brott i huvudcirkulationskretsarna i BWR

    Energy Technology Data Exchange (ETDEWEB)

    Marcinkiewicz, Jerzy; Lindgren, Anders [Det Norske Veritas Nuclear Technology AB, Stockholm (Sweden)

    2002-12-01

    Det Norske Veritas Nuclear Technology has performed a literature study of dynamic load on a BWR (Boiling Water Reactor) internals caused by a large pipe break. The goal of the study was to improve the knowledge about the physics of phenomena occurring in the RPV (Reactor Pressure Vessel) after pipe break in the main circulation system and also to make a review of calculation methods, models and computer programs including their capabilities when calculating the dynamic loads. The report presents description of relevant parts of a BWR, initial and boundary conditions, and phenomena determining the loads - rapid depressurization and propagation of pressure wave (including none-equilibrium). Furthermore, the report generally describes possible methodologies for calculating the dynamic loads on internals after the pipe break and the experiences from calculations the dynamic loads with different methods (computer programs) including comparisons with experimental data. Fluid-Structure Interaction methodology and its importance for calculation of dynamic loads on reactor internals is discussed based on experimental data. A very intensive research program for studying and calculating the dynamic loads on internals after pipe breaks has been performed in USA and Germany during the seventies and the eighties. Several computer programs have been developed and a number of large-scale experiments have been performed to calibrate the calculation methods. In spite of the fact that all experiments were performed for PWR several experiences should be valid also for BWR. These experiences, connected mainly to capabilities of computer programs calculating dynamic loads, are discussed in the report.

  13. Guidelines - guidelines based on the experience gained in the construction and evaluating 'Hamnhuset'; Guidelines - riktlinjer baserade paa de erfarenheter som erhaallits vid uppfoerande och utvaerdering av Hamnhuset

    Energy Technology Data Exchange (ETDEWEB)

    Gervind, Pernilla; Ruud, Svein

    2011-07-01

    Based on experiences from the construction and evaluation of Hamnhuset guidelines for future project has been compiled in this report. The recommendations are addressed to constructors and entrepreneurs. The recommendations treats both the building envelope, the installations and the management of the building

  14. Genetic gain in dairy cattle populations is increased using sexed semen in commercial herds

    DEFF Research Database (Denmark)

    Sørensen, Morten Kargo; Andersen, Jakob Voergaard; Pedersen, Louise Dybdahl

    2011-01-01

    Using stochastic simulation, the effect of using sexed semen to cow dams (CD) in a dairy cattle breeding scheme, with or without use of multiple ovulation and embryo transfer (MOET) to bull dams (BD), on annual genetic gain at the population level was examined. Three levels of sexed semen were...... combined with three levels of MOET: no sexed semen, sexed semen to the best CD and sexed semen to all heifers, combined with no MOET, MOET on all BD and MOET randomly on 20% of the BD. In total, nine scenarios were compared. The simulated population was monitored for 30 years and included 450 herds...... with 100 cows each. Each year 50 young bulls (YB), 10 active sires and 215 BD were selected on best linear unbiased prediction estimated breeding values by truncation selection across the simulated population, and the YB were tested within the population. Use of sexed semen alone gave a positive increase...

  15. Forecasters Handbook for the Middle East/Arabian Sea.

    Science.gov (United States)

    1983-06-01

    particular phenomenon. No original m eteoro logical /oceanographic research was involved in prep - aration of this Handbook; however, climatological information...VIB Broome VIO VIC Canberra AXM AXM VIX Carnarvon Vic Vic *Darwin AXI AXI VID VID Esperance VIE VIE Hobart VIH Melbourne vim vim Perth VIP VIP

  16. AcEST: DK955864 [AcEST

    Lifescience Database Archive (English)

    Full Text Available initis pigmentosa 1-like 1 protein OS=H... 34 0.64 >sp|Q92766|RREB1_HUMAN RAS-respo...0.49 sp|Q6CMB8|VID21_KLULA Chromatin modification-related protein VID... 34 0.64 sp|Q8IWN7|RP1L1_HUMAN Ret

  17. Blended learning

    DEFF Research Database (Denmark)

    Staugaard, Hans Jørgen

    2012-01-01

    Forsøg på at indkredse begrebet blended learning i forbindelse med forberedelsen af projekt FlexVid.......Forsøg på at indkredse begrebet blended learning i forbindelse med forberedelsen af projekt FlexVid....

  18. A Tool for the Analysis of Motion Picture Film or Video Tape.

    Science.gov (United States)

    Ekman, Paul; Friesen, Wallace V.

    1969-01-01

    A visual information display and retrieval system (VID-R) is described for application to visual records. VID-R searches and retrieves events by time address (location) or by previously stored ovservations or measurements. Fields are labeled by writing discriminable binary addresses on the horizontal lines outside the normal viewing area. The…

  19. Construction Management

    DEFF Research Database (Denmark)

    Andersson, Niclas

    Detta pilotprojekt utgör första steget i etableringen av ett samarbete mellan avdelningen för Byggnadsekonomi, vid Lunds Tekniska Högskola, och sektionen for Planlægning og Ledelse af Byggeprocesser, vid Danmarks Tekniska Universitet. Dessa båda avdelningar är varandras ämnesmässiga motsvarighete...

  20. The Vacuolar Import and Degradation Pathway Merges with the Endocytic Pathway to Deliver Fructose-1,6-bisphosphatase to the Vacuole for Degradation*

    Science.gov (United States)

    Brown, C. Randell; Wolfe, Allison B.; Cui, Dongying; Chiang, Hui-Ling

    2008-01-01

    The gluconeogenic enzyme fructose-1,6-bisphosphatase (FBPase) is degraded in the vacuole when glucose is added to glucose-starved cells. Before it is delivered to the vacuole, however, FBPase is imported into intermediate carriers called Vid (vacuole import and degradation) vesicles. Here, using biochemical and genetic approaches, we identified a requirement for SEC28 in FBPase degradation. SEC28 encodes the ε-COP subunit of COPI (coat protein complex I) coatomer proteins. When SEC28 and other coatomer genes were mutated, FBPase degradation was defective and FBPase association with Vid vesicles was impaired. Coatomer proteins were identified as components of Vid vesicles, and they formed a protein complex with a Vid vesicle-specific protein, Vid24p. Furthermore, Vid24p association with Vid vesicles was impaired when coatomer genes were mutated. Kinetic studies indicated that Sec28p traffics to multiple locations. Sec28p was in Vid vesicles, endocytic compartments, and the vacuolar membrane in various mutants that block the FBPase degradation pathway. Sec28p was also found in vesicles adjacent to the vacuolar membrane in the ret2-1 coatomer mutant. We propose that Sec28p resides in Vid vesicles, and these vesicles converge with the endocytic pathway. After fusion, Sec28p is distributed on the vacuolar membrane, where it concentrates on vesicles that pinch off from this organelle. FBPase also utilizes the endocytic pathway for transport to the vacuole, as demonstrated by its presence in endocytic compartments in the Δvph1 mutant. Taken together, our results indicate a strong connection between the Vid trafficking pathway and the endocytic pathway. PMID:18660504

  1. The vacuolar import and degradation pathway merges with the endocytic pathway to deliver fructose-1,6-bisphosphatase to the vacuole for degradation.

    Science.gov (United States)

    Brown, C Randell; Wolfe, Allison B; Cui, Dongying; Chiang, Hui-Ling

    2008-09-19

    The gluconeogenic enzyme fructose-1,6-bisphosphatase (FBPase) is degraded in the vacuole when glucose is added to glucose-starved cells. Before it is delivered to the vacuole, however, FBPase is imported into intermediate carriers called Vid (vacuole import and degradation) vesicles. Here, using biochemical and genetic approaches, we identified a requirement for SEC28 in FBPase degradation. SEC28 encodes the epsilon-COP subunit of COPI (coat protein complex I) coatomer proteins. When SEC28 and other coatomer genes were mutated, FBPase degradation was defective and FBPase association with Vid vesicles was impaired. Coatomer proteins were identified as components of Vid vesicles, and they formed a protein complex with a Vid vesicle-specific protein, Vid24p. Furthermore, Vid24p association with Vid vesicles was impaired when coatomer genes were mutated. Kinetic studies indicated that Sec28p traffics to multiple locations. Sec28p was in Vid vesicles, endocytic compartments, and the vacuolar membrane in various mutants that block the FBPase degradation pathway. Sec28p was also found in vesicles adjacent to the vacuolar membrane in the ret2-1 coatomer mutant. We propose that Sec28p resides in Vid vesicles, and these vesicles converge with the endocytic pathway. After fusion, Sec28p is distributed on the vacuolar membrane, where it concentrates on vesicles that pinch off from this organelle. FBPase also utilizes the endocytic pathway for transport to the vacuole, as demonstrated by its presence in endocytic compartments in the Deltavph1 mutant. Taken together, our results indicate a strong connection between the Vid trafficking pathway and the endocytic pathway.

  2. Spectral-Based Volume Sensor Testbed Algorithm Development, Test Series VS2

    Science.gov (United States)

    2005-01-12

    Spectral-Based Volume Sensor SFA Smoke and Fire Alert, a VIDS product of Fastcom Technology, S.A. SigniFire a VIDS product of axonX, LLC SP Shortpass...189 through -253 VS3 Volume Sensor Test Series 3 VSD-8 Visual Smoke Detection System, a VIDS product of Fire Sentry Corp. Manuscript approved... subsitute for VS2-223), Smoldering Cables, FOV, !Trans PC1 PC2 PC3 PC4 PC5 PC6 PC7 PC8 _5900A

  3. DUISTERNIS EN TOG LIG*. Gemeente van die Heer, Ons aandag ...

    African Journals Online (AJOL)

    Test

    " aangespreek word. Maar ook hierdie opvatting stel nie tevrede nie. Ons moet liewer teruggaan na die beskouing van die eers te Christengemeente. Met die Kneg van die Heere word niemand anders bedoel as Jesus Christus, die Heer nie.

  4. (1978) STRATEGTE VIR DIEREPRODUKSIE IN SUIDELIKE AFRIKA ...

    African Journals Online (AJOL)

    Veekundige" impliseer. Uiteraard verg hierdie begrippe binne die geledere van die Suid-. Afrikaanse Vereniging vir Diereproduksie (S.A.V.D.P.) geen definieering nie. Oor "strategie" moet egter nage- dink word;. 'n woord naamlik met, oorspronklik,. 'n.

  5. Met slimme methoden gewasopbrengst voorspellen : Sneller veredelen met SPICY

    NARCIS (Netherlands)

    Kierkels, T.; Heuvelink, E.; Dieleman, J.A.

    2009-01-01

    Het project SPICY moet de plantenveredeling op een hoger plan brengen. Doel is gerichter, sneller en goedkope veredelen. Daartoe worden slimme methodieken ontwikkeld of verbeterd. De methodieken zijn : verbetering van gewasmodellen, genenanalyse, fluorescentiemetingen, automatisch planten beoordelen

  6. Antibiotica nadelig voor afweerontwikkeling jonge big

    NARCIS (Netherlands)

    Leneman, M.; Smits, M.A.

    2015-01-01

    Dat er vanwege resistentie ontwikkeling terughoudend met antibiotica moet worden omgesprongen is inmiddels gemeengoed. Wetenschappelijk onderzoek bij biggen op onderzoeksbedrijf Sterksel en bij Wageningen UR Livestock Research wijst nu ook uit dat antibiotica toediening in de eerste levensfase een

  7. Milieubeleid verbetert technische efficiëntie in glastuinbouw

    NARCIS (Netherlands)

    Vlist, van der A.J.; Folmer, H.; Withagen, Cees

    2007-01-01

    Milieubeleid heeft een positief effect op technische efficiëntie in de Nederlandse glastuinbouw. Dat betekent dat onder ondernemers, beleidsmakers en politici het beeld dat milieubeleid alleen maar tot hogere kosten leidt aangepast moet worden

  8. Is er voor biologische uitstootkoeien een markt te winnen?

    NARCIS (Netherlands)

    Delen, van J.

    2004-01-01

    In samenwerking met De Groene Weg, Natuurweide en LEI werkt Praktijkonderzoek aan een project om de verwaarding van biologische uitstootkoeien door ketensamenwerking te verbeteren. Transparantie in de biologische rundvleesketen moet veehouders meer duidelijkheid geven over kwaliteitseisen,

  9. Gemaskerde depressie

    African Journals Online (AJOL)

    diagnostiese kenmerk van depressie. Ander kenmerke by kinders sluit in 'acting out' gedrag, onderprestasie op skool, leerprobleme, eetversteurings en somatisasie. Geassosieerde toestande sluit in aandagtekortl hiperaktiwiteitversteuring, gedragsversteuring en anorexia nervosa. Dit moet egter beklemtoon word dat die.

  10. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    Uit: Geleentheidsversel. Volgens die didaktiese leesmodel wat in die derdejaarskursus voorgestel word, moet die poesieleser bedag wees op die semantiese verryking wat deur die onderlinge verhouding tussen taaleenhede binne 'n gedig.

  11. Drijfmest verliest snel zijn waarde voor biogas

    NARCIS (Netherlands)

    Buisonjé, de F.E.; Verheijen, R.

    2014-01-01

    Drijfmest moet zo snel mogelijk de vergister in. Alleen een snelle vergisting levert een maximale hoeveelheid biogas op. Uit onderzoek blijkt dat het biogaspotentieel van drijfmest maandelijks met zo’n 30 procent afneemt.

  12. Slechts enkeling winkelt bewust

    NARCIS (Netherlands)

    Meeusen, M.J.G.

    2009-01-01

    Negen op de tien mensen winkelen zonder nadenken. Slechts een kleine minderheid is actief op zoek naar informatie over duurzaamheid en dierenwelzijn. Eten moet vooral lekker, gezond, makkelijk en betaalbaar zijn, blijkt uit onderzoek van het LEI

  13. Stralingsniveaumetingen rond het terrein van de EPZ kerncentrale te Borssele in 2006

    NARCIS (Netherlands)

    Farahmand M; Gorts PC; LSO

    2009-01-01

    Het stralingsniveau aan de terreingrens van kerncentrale Borssele lag in 2006 onder het toegestane maximum. Dit blijkt uit controlemetingen van het RIVM.
    Volgens de Kernenergiewetvergunning moet de centrale ervoor zorgen dat personen buiten de terreingrens een effectieve stralingsdosis

  14. Stralingsniveaumetingen rond het terrein van de EPZ kerncentrale te Borssele in 2007

    NARCIS (Netherlands)

    Farahmand M; Gorts PC; LSO

    2009-01-01

    Het stralingsniveau aan de terreingrens van kerncentrale Borssele lag in 2007 onder het toegestane maximum. Dit blijkt uit controlemetingen van het RIVM.
    Volgens de Kernenergiewetvergunning moet de centrale ervoor zorgen dat personen buiten de terreingrens een effectieve stralingsdosis

  15. Nanotechnologies in medical devices

    NARCIS (Netherlands)

    Geertsma RE; Park MVDZ; Puts CF; Roszek B; van der Stijl R; de Jong WH; PRV; V&Z

    2015-01-01

    Nanotechnologie wordt steeds meer gebruikt voor medische hulpmiddelen. Talrijke medische disciplines profiteren van de innovaties die nanotechnologie mogelijk maakt. Ook neemt de kennis over hoe je de veiligheid van nanotechnologie moet beoordelen toe. Recente wetenschappelijke leidraden geven aan

  16. Bedrijven willen best aan bioplastics

    NARCIS (Netherlands)

    Bolck, C.H.

    2010-01-01

    Bioplastic kan een volwaardig alternatief voor conventioneel plastic zijn. Dan moet nog wel het gat tussen fundamenteel onderzoek en het gebruiksproduct gedicht worden. De vraag naar toegepast onderzoek en ontwikkelwerk is groot.

  17. Builenbrand geeft opbrengst- en kwaliteitsverlies bij snijmais

    NARCIS (Netherlands)

    Wel, van der C.

    1994-01-01

    In sterk aangetaste maos moet de voederwaarde met in-vitro-onderzoek worden vastgesteld. Door het lagere drogestofgehalte van aangetaste planten zijn de verliezen in de kuil groter dan bij een gezond gewas.

  18. Afleidingsmateriaal voor varkens breed gewogen = Practical aspects of environmental enrichment

    NARCIS (Netherlands)

    Zonderland, J.J.

    2007-01-01

    Het verstrekken van afleidingsmateriaal dient om het welzijn van varkens te verbeteren, maar moet daarnaast ook voor een varkenshouder praktisch toepasbaar zijn. In deze rapportage worden de praktische aspecten van een tiental afleidingsmaterialen beschreven

  19. Presentatie handboek 'Categorisering wegen' : verslag van het onderdeel 'duurzaam-veilig' van de PAO-cursus 'De bakens verzetten in het verkeersveiligheidsbeleid', 9 t/m 11 december 1997, Delft.

    NARCIS (Netherlands)

    Janssen, S.T.M.C.

    2012-01-01

    Voor de vormgeving van een duurzaam-veilig wegennet zijn vanuit drie veiligheidsprincipes, twaalf functionele eisen opgesteld. Voor het gemotoriseerde verkeer worden drie wegcategorieën voorgesteld. Elke categorie, met onderscheid naar bebouwing, moet vervolgens voldoen aan enkele operationele

  20. De ethiek van Erich Fromm, een humanistisch appèl

    NARCIS (Netherlands)

    Santing, Eppinus Cornelis

    1984-01-01

    De probleemstelling die aan deze studie ten grondslag ligt. kan worden weergegeven met behulp van de volgende vragen: a. Welke opvattingen heeft Fromm omtrent ethiek ontwikkeld? b. Welke betekenis moet aan deze opvattingen worden toegekend? ... Zie: Inleiding

  1. Die kerkregtelike posisie van die ouderling en diaken in die ...

    African Journals Online (AJOL)

    ) en die Diakonale Dienskomitees (DDK). Die ADR en die RDR moet slegs as komplimentêr gesien word ten opsigte van die gemeentelike barmhartigheid, omdat die swaartepunt van die barmhartigheid steeds in die gemeente, waar die kerk ...

  2. Die naslaanpotensiaal van lemmakandidate vir ʼn ...

    African Journals Online (AJOL)

    Kate H

    Afrikaans-woordeboek in die gedrukte medium plaas welbekende tradisionele beperkinge op die leksikograaf, waarvan die vernaamste dié op ruimte is. Gegee die konteks, teikengebruiker, gebruikersituasie en funksie van die woordeboek moet ...

  3. Roheline revolutsioon - ökosiki tagasitulek : well fashioned eco style in the UK

    Index Scriptorium Estoniae

    2006-01-01

    Loodussõbralikust moest, ökoloogilistest materjalidest, jätkusuutlikest tootmismeetoditest moetööstuses, rõivaste taaskasutamisest. Briti ökodisainerite loomingu näitusest "Well Fashioned: Eco Fashion in the UK" Londonis

  4. Duurzame gewasbescherming roos in 2020 : Kennisdeling in de praktijk - Eindrapport

    NARCIS (Netherlands)

    Klein, E.; Hoogendoorn, M.; Buurma, J.S.

    2013-01-01

    Doel van dit project is het bewerkstelligen van verminderen van milieubelasting door effectiever gebruik van middelen en methoden en kennishiaten opheffen rondom gewasbescherming middels netwerken en onafhankelijke kennisdeling (digitaal handboek geïntegreerde gewasbescherming Roos). Dit moet mede

  5. Kamkleur, verenkleed en gewicht geven gezondheid kippen aan : Gezondheidstoestand is het best te beoordelen met directe waarnemingen

    NARCIS (Netherlands)

    Bestman, M.W.P.; Wagenaar, J.P.; Livestock Research,

    2006-01-01

    Diergezondheid verdient nog flink aandacht, ook in de biologische pluimveehouderij. Om in de toekomst de weerstand bij leghennen te kunnen vergroten, moet eerst de gezondheidstoestand goed beoordeeld worden. Hou kunnen praktijkonderzoekers en pluimveehouders dit eenvoudig en effectief meten

  6. Longitudinale studie naar de aanwezigheid van legionella en amoeben in drinkwaterinstallaties

    NARCIS (Netherlands)

    Schalk JAC; Redeker S; Docters van Leeuwen AE; Lodder WJ; de Roda Husman AM; LZO; cib

    2012-01-01

    In Nederland wordt bij prioritaire instellingen met collectieve leidingwaterinstallaties, zoals ziekenhuizen en verzorgingstehuizen, twee keer per jaar gecontroleerd of legionella in de waterleidingen aanwezig is. De concentratie legionellabacteriën in het water moet wettelijk lager zijn dan 100

  7. Increasing civic engagement using 140 characters?

    NARCIS (Netherlands)

    Mirjam Lasthuizen; Sonja Utz; Sanne Gaastra; Raymond van Dongelen

    2012-01-01

    Sowijs deed onderzoek naar verschillende strategieën voor burgerparticipatie via sociale media. Hoe moet je Twitteren om mensen te betrekken en gebruik je dan wel of geen hashtags. Lees het in dit whitepaper!

  8. A phenomenological investigation of experiences of pregnancy by ...

    African Journals Online (AJOL)

    Prenatale opvoeding moet voorbereidende leiding ten opsigte van die moederlike rol bied. Key words: Experiences, Pregnant, Unmarried, Adolescents, Qualitative research design, Trustworthiness, Emotions, Relationships, Physical problems, Religion (Health SA Gesondheid : interdisciplinary research journal: 2003 8(1): ...

  9. loofwaar- le Feni se re in die ie sin gee oging om e herstel. waag Art ...

    African Journals Online (AJOL)

    27 Jan 2006 ... die ma van 'n dienspligtige wat skryf hoe die kind haar “geterriseer” het: “Ek wil nie die kind sleg maak nie maar ek dink u moet dit weet. Om hom beter te verstaan.” Die ma versoek dat Rafael “tog nie met sy eerste naweekpas huis toe moet kom nie, die was- goed sal haar te swaar val en haar man wil.

  10. Ex-Ante Beleidsevaluatie met System Dynamics (Ex-Ante Policy at System Dynamics)

    Science.gov (United States)

    2008-03-01

    specifiekprobleem. Dit betekent dat een op te stellen model een duidelijk doel moet hebben. en dat dit doel moet zijn bet oplossen van bet onderhavige...2007 A055 Biiage D I Z%6 Nr. Variabele Initille Stuur- Doel - Omschrijving waarde kenmerken kenmerken (0-100%) (gemak en (prioriteit) regelbereik...DV 2007 A055 Bijlage D 14/6 Nr. Varnabele Initilgle Stuur- Doel - Omschrijving waarde kenmerken kenmerken (0-1000%) (gemak en (prioriteit) regelbereik

  11. Job Oriented Training: Onderwijskundige Grondslag en Onderbouwing (Job Oriented Training: Foundation and Empirical Support)

    Science.gov (United States)

    2008-07-01

    moet actief/constructief zijn, gebaseerd op integrale taaktraining binnen een ’relevante realiteit’, leren moet uitdagend zijn en gericht op reflectie en...mogelijk ervaring te laten opdoen met het uitvoeren van de integrale taak in een ’relevante realiteit’. Die relevante realiteit kon steeds beter...bijvoorbeeld. (v.d. Hulst. Muller en Coetsier, 2007a). 1.2 Beschrijving JOT JOT wordt gekenmerkt door het van meet af aan werken aan de integrale taak, binnen

  12. Voorbereiding pilot studie ‘Power for Teens’ voor tieners met overgewicht en angstige en depressieve klachten.

    OpenAIRE

    Bouwman, Miranda; Tuinstra, Jolanda; Visser, Marieke; Cox, R.F.A

    2015-01-01

    Abstract Het huidige onderzoek richtte zich op de voorbereidingen die nodig zijn voor het uitvoeren van een pilot studie van de interventie ‘Power for Teens’. Dit is een interventie voor jongeren met overgewicht, angstige en depressieve klachten en een lage self-efficacy. Voordat de pilot studie uitgevoerd kan worden, moet uitgezocht worden op welke manier jongeren geworven kunnen worden voor het pilot onderzoek. Ook moet bekend worden met welke vragenlijsten angst, depressie, zelfvertrouwen ...

  13. Die owerheidsinmenging met betrekking tot kerklike tughandelinge.

    Directory of Open Access Journals (Sweden)

    L. Roeleveld

    1982-06-01

    Full Text Available Volgens art 29 NGB is die merktekens van die ware kerk die suiwere prediking van die Evangelie, die suiwere bediening van die Sakramente en die gebruik van die kerklike tug. Art. 32 NGB spreek uit dat die Kerkorde nie mag afwyk van wat Christus ingestel het nie. Menslike vindinge en wette om die gewetens te bind en te dwing, moet daarom verwerp word. Die ekskommunikasie of die ban moet toegepas word volgens die Woord van God.

  14. Data of evolutionary structure change: 1YDVA-2V0TH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-2V0TH 1YDV 2V0T A H --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...SGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVW-------LTPQQAQEAHALIRSWVSSKIGADVA...VID> 0 1YDV A 1YDVA A 1YDVA VDLID--NFDNV 1YDV A 1YDVA

  15. Data of evolutionary structure change: 1C5RA-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C5RA-3BSQC 1C5R 3BSQ A C IVGGYTCGANTVPYQVSLNSG-YHFCGGSLINSQWVVSA...AHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDS... 3BSQ C 3BSQC 3BSQ C 3BSQC VSW...VID> 2 3BSQ C 3BSQC

  16. Data of evolutionary structure change: 1BGAA-1GNXA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BGAA-1GNXA 1BGA 1GNX A A TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAH...NWLETRR -ALTFPEGFLWGSATASYQIEGAAAEDGRTPSIWDTYARTPGRVRNGDTGDVATDHYHRWREDVALMAELGLGAYRFSLAWPRIQPT...RDGDLRLAHQKLDFLGVNYYSPTLVSAHSPWPGADRVAFHQPPGETTAMGWAVDPSGLYELLRRLSSDFPALPLVITENGAAFHDYADPEGNVNDPERIAYVRDHLAA...> 0 1BGA A 1BGAA...VID> 1 1BGA A 1BGAA

  17. Characterization of Vertical Impact Device Acceleration Pulses Using Parametric Assessment: Phase I

    Science.gov (United States)

    2015-04-01

    Vertical Impact Device (VID). The VID is a Monterey Research Laboratory IMPAC3636 high-G impact test machine with seismic suspension , and is currently...nitrogen and oil suspension system. Programmers are used to control the shape, peak acceleration, and duration of the shock pulse. The...cable, pulley, and lifting tube driven by one hydraulic cylinder, for each of the two side supports. Pneumatic friction brakes in the carriage assembly

  18. Simplified methods for estimation of doses, received from a ground contamination and from flying through a cloud of radioactive particles, at long distances from nuclear weapon explosions; Mallar foer dosuppskattning fraan markbelaeggning och vid flygning genom radioaktiva partikelmoln paa stora avstaand fraan kaernvapenexplosioner

    Energy Technology Data Exchange (ETDEWEB)

    Thaning, L.; Tovedal, H.

    1995-04-01

    By using a simple Lagrangian model for atmospheric dispersion, the activity deposited on ground from nuclear weapon explosions of different yields has been calculated on different distances (in hours after the detonation). The external dose for the first month to a person without any shelter, is estimated and presented in simple figures. Both situations with dry-deposition only and with wet-deposition included are considered. The external dose from the cloud and the internal dose from inhaled activity received when flying through the radioactive cloud are estimated as functions of flight level and distance from the detonation and shown in a number of tables. In order to determine where the cloud and contamination will occur, some kind of trajectory calculations have to be done. In this work only ground bursts have been considered.

  19. Utilisation of ash from the co-combustion of CandD wood with biofuels. A series of experiments with a 24 MW{sub th} bubbling fluidised bed; Askanvaendning vid samfoerbraenning av RT-flis med olika biobraenslen. Foersoeksprogram i en 24 MW{sub th} bubblande baedd

    Energy Technology Data Exchange (ETDEWEB)

    Bjurstroem, Henrik; Wikman, Karin [AaF-Process AB, Stockholm (Sweden)

    2005-10-01

    The composition of ashes and their potential uses depend to a large extent on the fuel that is being used. However, the frequent mixing of fuels affects the usability of the ashes. In this project, the effect of alternate firing and of co-combustion on the ashes has been studied in the 24 MW{sub th} BFB plant of Fortum Vaerme Nynaeshamn. In these experiments, we have started from the fuel ordinarily used, i.e. waste wood, switched first to logging residues, then to a mixture of waste wood and logging residues, as close to a 50 % - 50 % mixture as is feasible on a plant scale, and finally back to waste wood. The chemical composition of samples taken from fuels and from the different ashes was determined. The leaching properties of the bottom ash were determined using a two-step procedure (EN 12475-3). The composition of the ashes was followed for eleven days after switching from waste wood to logging residues. Ca 2,5 t/d bottom ash, ca 1 t/d 'eco-ash' (a mixture of cyclone ash and boiler ash) and ca 2,5 t/d baghouse filter ash were produced during the experiments. At the same time, ca 2 t/d sand, 0,5 t/d lime and 0,1 t/d active carbon were used. The bottom ash is rather coarse as the fraction below 2 mm was recirculated to the bed. From an environmental point of view, it is equivalent to the FB bottom ashes studied in Varmeforsk report nr 852 and one should be able to use it under similar conditions, whether the fuel was waste wood or logging residues. The best use would probably not be as a road construction material as its particle size distribution is narrow, 2-8 mm, but as a draining layer. The baghouse filter ash may be used under all circumstances in landfill covers, or for rehabilitation of rock caverns. This ash is the one that best meets requirements for being recycled to forestland when logging residues are burned. However, the logging residue ash in these experiments is not recyclable: the fuel itself has too high a chromium content and the fluidised bed has a memory effect. The 'eco-ash' is coarser than the filter ash and has not been studied in detail. It should be able to complement the particle size distribution of filter ash in its uses. The content of environmentally disruptive elements in the waste wood is so much larger than that in logging residues that, in practice, they may not be co-combusted if one wish to obtain an ash that is may be recycled to forestland. When firing waste wood and logging residues alternatively, the transition from waste wood ash to logging residue ash is slow: given the experimental conditions, it requires more than the 11 days that we had at our disposal. The transition time depends largely on the rate of turnover of the bed.

  20. The relationship between playing computer or video games with mental health and social relationships among students in guidance schools, Kermanshah/Lien entre pratique des jeux vidéo sur ordinateur ou sur console, santé mentale et relations sociales chez des collégiens de Kermanshah

    National Research Council Canada - National Science Library

    S Reshadat; S R Ghasemi; M Ahmadian; N RajabiGilan

    2013-01-01

    .... This cross-sectional study aimed to evaluate the relationship between playing computer or video games with mental health and social relationships among students in guidance schools in Kermanshah...

  1. Analysis reports on the ecotoxicological evaluation of discharges of spent water at the cogeneration/central heating plants Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes and Aelmhult; Analysrapporter avseende ekotoxikologisk bedoemning av utslaepp av utgaaende vatten vid Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes och Aelmhult

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Jonas; Axby, Fredrik; Persson, Maarten; Rossander, Annelie; Schultz, Emma; Svaerd, Sara [Carl Bro AB, Kristianstad (Sweden)

    2007-04-15

    The discharges to water at six biofuelled Swedish cogeneration/district heating plants are evaluated in light of the EU Water Framework Directive concerning ecotoxicological impacts. Ecotoxicological data for the 33 prioritized substances are also reviewed.

  2. Réalité virtuelle : Simulation sonore en trois dimensions par Nicolas Tsingos. Phobies à l'épreuve du virtuel, entretien avec Isabelle Viaud-Delmon ; propos recueillis par Dominique Chouchan. Le jeu vidéo est un produit de très haute technologie par David Alloza

    OpenAIRE

    Tsingos, Nicolas; Viaud-Delmon, Isabelle; Alloza, David

    2009-01-01

    National audience; En synthèse d'images, on s'intéresse à la simulation des formes, des couleurs, des ombres, de l'éclairage... La sonorisation d'un monde synthétique est tout aussi exigeante si l'on veut qu'elle reflète notre perception spatiale des sons.

  3. Musikens påverkan på fysisk prestation, subjektivt skattad ansträngning och upplevd koncentration : - en studie beträffande musik kontra tystnad vid Coopertest gjord på 32 ungdomar och unga vuxna mellan 15-30 år

    OpenAIRE

    Melin, Sofie; Samnell, Isabelle

    2016-01-01

    Bakgrund: Musik påverkar muskelspänning, hjärtfrekvens, blodtryck och känslor. En ökning av positiva känslor kan ge en bättre prestation. Syfte: Att undersöka musikens påverkan på fysisk prestation mätt i tid, subjektivt skattad ansträngningsgrad och upplevd koncentration. Samt om musikens påverkan på prestation skiljer sig mellan kön och hur fysisk prestation samverkar med subjektivt skattad ansträngningsgrad. Metod: Studien var en kvasiexperimentell engruppsstudie med komparativ och korrele...

  4. Particle dispersion at road building using fly ash - model review, investigation of influence of humidity content for dust emission and fly ash particle characterisation; Partikelspriding vid byggnation av vaeg med aska - modelloeversikt, undersoekning av fuktighetsgradens betydelse foer damning och karaktaerisering av partiklar fraan flygaska

    Energy Technology Data Exchange (ETDEWEB)

    Gustafsson, Mats; Wik, Ola; Frogner-Kockum, Paul

    2009-03-15

    Ashes from incineration may have very good properties, such as building materials in roads. This use assumes that the ashes do not have serious environmental and health effects. Since ash might generate large amounts of dust in handling the issue on the extent of dusting and dust properties has proved to be important to assess the risks of environmental impacts during use. Inhalable particles in the ambient air are a problem that has attracted much attention and is regarded as one of the most serious health related air pollutants. The present project has aimed to: describe appropriate models for calculating the emission and dispersion of dust in the air during the construction of ash containing roads, evaluate a new method to examine the importance of moisture for dusting from fly ash and investigate the properties of fly ash, making it possible to identify ash in samples of airborne particles. The target audience is ash manufacturers, contractors and consultants with a need for knowledge of ash dusting. Project modules have included: a literature review to identify appropriate modelling tools to describe the emission and dispersion of dust from road building with ash a method study in which a piece of equipment called Duster, have been evaluated for assessing the significance of the ash humidity to dusting, and an electron microscope study where morphology and composition of some ashes, cement and Merit have been studied to find ways to identify ash particles in dust samples. The results show that there is a lack of overall model tools that can describe the emissions from all the management operations of ashes at road building and that existing models sometimes lack key variables. Also, because of high silt content of ashes, some models are deemed inferior compared to when used for ordinary mineral material. Furthermore, attempts with the Duster shows that the method works, but with limited precision, and that dusting from the ash samples was reduced significantly at moisture contents above about 15%. The particle characterization study showed that ash specific chemical signal elements are preferred in the characterization. Important signal elements of ash can be S, Hg, Cd, and the ratio Mg/Al, but elements most appropriate might vary between specific types of ash and applications. The project has brought new knowledge about the possibilities to characterize ash particles and on the moisture needed to avoid dusting from ash. A method to try dusting from ash surfaces has been evaluated in laboratory and the project has also shown available, but in some respects inadequate, models for emission and dispersion of dust from handling of ash

  5. Monitoring of test roads with MSWI bottom ash in the sub-base. Measurements with falling weight deflectometer on test structures in Malmoe and Umeaa. Analyses of ground water and leachate along test structures in Umeaa; Uppfoeljning av slaggrusprovvaegar. Fallviktsmaetning paa provstraeckor paa Toerringevaegen i Malmoe och Daavamyran i Umeaa. Grundvatten- och lakvattenanalyser paa provstraeckor vid Daavamyran i Umeaa

    Energy Technology Data Exchange (ETDEWEB)

    Arm, Maria; Larsson, Lennart; Tiberg, Charlotta; Lind, Bo; Arvidslund, Ola

    2008-12-15

    A number of test roads and test areas with processed municipal solid waste incinerator bottom ash, here called MSWI gravel, have been built in Sweden during the last 10-15 years. The main purpose of the projects reported here was to take advantage of the existing test roads to increase the knowledge of the long-term strength and environmental impact of MSWI gravel, when it is used as a road material. Two test roads with MSWI gravel in the sub-base were monitored through falling weight deflectometer (FWD) measurements and, for one of the roads, by means of sampling and analyses of groundwater and leachate within and along the road. The first road, constructed in 1998, is named Toerringevaegen and is situated outside Malmoe in the south of Sweden. The second road, Daava test road, was constructed in 2001 and is situated outside Umeaa in the north of Sweden. The roads were monitored regarding strength from 2004 to 2008 and Daava test road was also monitored regarding environmental impact from 2006 to 2008. For both roads, comparison was made over time and between the test sections with MSWI gravel and reference sections with crushed rock. Comparison was also made with results from previous studies on these test roads, resulting in a uniquely long monitoring period. The results from Toerringevaegen show that the road section with MSWI gravel in the sub-base retains its strength after several years. The three measurements performed at the Daava road revealed an initially decreasing strength and then a stabilisation. As in previous studies, the strength of the MSWI gravel was found to be about 70% of that of the crushed rock, which has to be taken into account in the design phase. It was concluded that regarding the strength properties MSWI gravel is suitable as sub-base material if the road is properly designed. It can also be used as a filling material, in embankments and as a capping layer. This confirms the conclusions from previous studies. The results from the leachate analyses showed increased cumulative leaching of calcium and sulphate from both sections at the Daava test road, which was surprising. Furthermore, most compounds leached in greater amount from the reference section than from the test section. There was a significant decrease in the leaching of copper, TOC, chloride and sodium over time from the test section, while the decrease of chromium leaching was not as significant. During the first years after construction, the test section leached greater amount of organic compounds analysed than the reference section did, but the concentrations in the leachates decreased significantly and after five-six years they were comparable with those of the reference section. During the last years, the concentrations of organic acids in the leachates from the reference section were higher than in the leachates from the test section. The reason for this is unknown. When results from previous laboratory leaching tests on the MSWI gravel used were compared with the newly proposed maximum values for waste to be used in construction works (general use) and with current limit values for waste disposed in landfills for inert waste, it was clear that chloride, sulphate and copper and initially to some extent chromium were critical compounds. However, all compounds with proposed or fixed limit values were not analysed in the previous study. Comparison between the leachates from the test section and results from previous laboratory leaching of the MSWI gravel showed significantly different patterns. This should be taken into account in the assessment of potential use

  6. Greenhouse gases during storage and after application of digested and non-digested dairy cattle slurry including ammonia emissions and barley yield; Vaexthusgaser fraan roetad och oroetad noetflytgoedsel vid lagring och efter spridning, samt bestaemning av ammoniakavgaang och skoerd i vaarkorn

    Energy Technology Data Exchange (ETDEWEB)

    Rodhe, Lena; Ascue, Johnny; Tersmeden, Marianne; Willen, Agnes; Nordberg, Aake; Salomon, Eva; Sundberg, Martin

    2013-07-01

    Given that the manure-based biogas production is likely to increase in the coming years , it's important to find a proper handling of digested manure that have low emissions of both climate gases methane (CH{sub 4}) and nitrous oxide (N{sub 2}O ) as ammonia (NH{sub 3}) , which indirectly contributes to emissions of N{sub 2}O. The project have; Quantified GHG emissions, from undigested and digested manure during storage in winter and summer, and during land application in autumn and spring. Examined the effect on GHG emissions of covering digested manure during storage in winter and summer, and quantified NH{sub 3} emissions, yield and apparent nitrogen (N) recovery in spring barley.

  7. Vērtību stereotipu piedēvēšana latviešu un krievvalodīgo skolēnu vidēs kā rezultāts grupas piederībai. Pārmaiņas desmit gados.

    OpenAIRE

    Irbīte, Anita

    2013-01-01

    Pētījuma ietvaros tika pētīts, kā vairāk kā desmit gadu laikā mainās vērtību stereotipi majoritātes (latvieši) un minoritātes (krievvalodīgie Latvijā) kontekstā. 210 latviešu un krievvalodīgo Rīgas vidusskolu skolēni aizpildīja Švarca vērtību aptauju par sevi, par savu iekšgrupu, par ārgrupu (latvieši par krievvalodīgajiem, krievvalodīgie par latviešiem), un par mūsdienu cilvēku. Minoritātes un majoritātes sev piedēvētie vērtību stereotipi bija mainījušies šo vairāk kā desmit gadu laikā-lielā...

  8. Novi vid visokoeksplozivnih bombi ogromne snage (Новый вид взрывных устройств огромной фугасной мощности

    Directory of Open Access Journals (Sweden)

    Alexander I. Golodyaev

    2014-02-01

    Full Text Available Известны гидриды разных металлов и сплавов. Они способны накапливать и отдавать водород. При определенных условиях процесс выделения идет лавинообразно, в форме «физического» взрыва. Методы получения условий  лавинообразного выделения. Метод получения нужных параметров гидридов. Перспективы взрывных устройств.

  9. Advice for the operation of potable water field test equipment: Conseils pour l'utilisation de l'équipement d'analyse de l'eau sur le terrain [enregistrement vidéo] = Consejos sobre el uso de los equipos de analisis del agua potable sobre el terreno

    National Research Council Canada - National Science Library

    2012-01-01

    This product was created as a geneal awareness tool by the federal Interdepartmental Water Quality Training Board to provide information on water quality mangement methods for potable water systems in federal facilities. Cet outil...

  10. Att fokusera på "varandet" i en värld av görande : stöd till personalen i ett palliativt förhållningssätt vid vård- och omsorgsboende för äldre

    OpenAIRE

    Beck, Ingela

    2013-01-01

    The aim of this thesis was to study nurse assistants’ experience of palliative care and to investigate how an intervention with a focus on a palliative care approach in residential care facilities influenced the nurse assistants and their work situation. The thesis is based on two qualitative and two quantitative studies, focusing on nurse assistants working at residential care facilities for older people. The qualitative studies were based on focus-group interviews before the intervention (I...

  11. House owners' views on investing in district heating - a study of applied sales strategies and the customers choice at conversion from electric heating; Smaahusaegarnas syn paa att koepa fjaerrvaerme - en studie av tillaempade foersaeljningsstrategier och kunders val vid konvertering fraan direktverkande el

    Energy Technology Data Exchange (ETDEWEB)

    Sernhed, Kerstin; Pyrko, Jurek [Div. of Efficient Energy Systems, Dept. of Energy Sciences, Lund University, Lund (Sweden)

    2006-07-15

    This report presents results from the project 'Converting direct resistive electric heating into district heating - customer related aspects'. The main objective of this study was to investigate how specific households within one housing area (Sandsbro in Vaexjoe with 110 one-family houses) experienced the conversion process, in order to understand the reasons behind 'yes' or 'no' responses to the utility's offer. A qualitative approach with semi-structured in-depth interviews with a specially selected sample of households from 10 converted and 13 not converted houses was chosen as the main method. The investigation led to the following conclusions and recommendations: Household reactions to the terms of sale and conversion: Many households felt that the decisions were rushed - there is a need for better planning, especially for the older households. The information provided was evaluated as detailed and sufficient. The 'demonstration villa' was a good idea but the installation should be done more professionally - aesthetics are very important here. Home visits were the only personal contact and should be conducted in all houses in order to answer questions and explain problems. Co-ordination of excavation should be better in order to limit the time the ground is open. A few of the households undertook some of the works themselves to reduce costs but the compensation was often considered as too low to motivate customers. Household opinions on the product and/or service: Almost all households felt that the thermal comfort was better than before - more stable indoor temperature, no problems with overheated radiators or smell of burning dust. On the other hand, hot water comfort was worse - longer waiting time for hot water and too low water temperature during summer. Aesthetics were considered very important and could be crucial for the decision to convert the heating system. Many of the interviewed households were uncertain how to adjust and take care of the system - there is a notable need for information here. Household understanding of the economic terms of the district heating conversion: It was clear that many of the interviewed households did not have a view about the change of energy costs after conversion. It was also difficult for them to make a profitability analysis before the decision. However, the offer was considered to be very favourable in this specific case. It is important that the offer and investment comes at the right time for the households - regardless of the price. One argument raised against district heating conversion was fear of monopoly and high energy costs. All households, even those not converted, were convinced that the investment would be paid back in the future because of an increased property value following conversion. Household reasons to say 'no' to district heating conversion: The household has recently invested in a new heating system or in a secondary system, Negative views about aesthetics of the waterborne system, It's too labour intensive to convert, Wrong facts or misunderstanding. Household reasons to say 'yes' to district heating conversion: Improved thermal comfort, Convenience, Low investment costs, Expectations about lower energy costs, Few alternatives to direct resistive space heating, Better than electricity from an environmental point of view. Statistical analysis proved that variables such as 'age', 'type of household' and 'energy use level' could, to some extent, be related to the decision to convert from electric radiators to district heating.

  12. A szociális és szolidáris gazdaság csírái a magyarországi vidéki térségekben (Seeds of Social and Solidarity Economy in Hungarian Rural Areas

    Directory of Open Access Journals (Sweden)

    Éva Fekete

    2014-12-01

    Full Text Available The social and solidarity economy (SSE is an emerging sector of the European economies. It’s importance is demonstrated by millions of employees and significant share of GDP. In recognition of its perceptivity, ministries dedicated to SSE have been established in many countries. However, there is a lively debate about on the definition of SSE itself. Opinions on the role of employment, the relations to governments and attitudes to competitiveness differ from each other. In the first part of my paper a clarification of the conceptual issues will be summarized. After that we may follow our investigations on SSE in two directions. First, we will see the special appearance of the SSE in rural areas and then the situation in Hungary will be presented. As an intersection of this two lines, SSE initiatives in the Hungarian rural areas will be discussed. We can speak about the role of the social land programs, the cooperatives, the LEADER groups and the “START” public work in building SSE in the Hungarian rural space.

  13. Caracterización de variedades tintas de vid (Vitis vinifera L.) de la D.O. Jumilla. Evolución de su composición durante la maduración y efecto en la calidad del vino.

    OpenAIRE

    Lara Fernández, José Félix

    2013-01-01

    El objetivo fundamental de esta Tesis Doctoral fue contribuir al conocimiento sobre la calidad de la uva destinada a vinificación determinando su momento óptimo de maduración. Para ello, se han estudiado cuatro variedades de uva tinta, Syrah, Merlot, Petit Verdot y Monastrell, cultivadas de modo tradicional en la Denominación de Origen Jumilla. Además, la variedad de uva Monastrell se cultivó de forma ecológica o en secano. A lo largo de la maduración se determinaron en las uvas Se parámetros...

  14. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI; Omgivningskontroll vid kaernkraftverken och Studsvik 1992-1993. Resultat fraan maetning av radionuklidhalter i miljoeprover, samt SSIs stickprovsmaetningar

    Energy Technology Data Exchange (ETDEWEB)

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs.

  15. Nivåbaserade läseböcker : Att utgå från samma berättelse vid frågan om nivåbaserade läseböcker eller inte?

    OpenAIRE

    Lindblom, Therese; Stenius Johnson, Peggy

    2018-01-01

    Syftet med studien är att undersöka hur tre olika nivåer av samma läsebok anpassas för att anses vara lättlästa och passa elever som befinner sig i nybörjarstadiet av sin läsning. Böckerna som analyseras är läseböcker för årskurs ett, uppdelade i tre olika nivåer och utgår från samma berättelse av titeln, Den magiska kulan. Vi har använt oss av både kvalitativa och kvantitativa datainsamlingsmetoder, där vi använt oss av verktyget Sparv samt genomfört en semiotisk bildanalys. Vårt resultat vi...

  16. Experiences of health care providers managing sexual assault victims in the emergency unit Part 1: Background and methodology

    Directory of Open Access Journals (Sweden)

    Rebecca M. Skhosana

    2009-09-01

      Opsomming: Die doel van hierdie studie was om die ervaringe van gesondheidsorgverskaffers wat slagoffers van seksuele aanranding in die ongevalle-eenheid van 'n gemeenskapshospitaal in die Nkangala-distrik in die provinsie van Mpumalanga hanteer, te verken en te beskryf. ’n Kwalitatiewe fenomenologiese ontwerp  is  toegepas. Doelbewuste  steekproefneming is gebruik  om  deelnemers te  selekteer uit die groep gesondheidsorgverskaffers wat in die ongevalle-eenheid werksaam was en meer as vier slagoffers  van seksuele aanranding hanteer het. Data is by wyse van  individuele onderhoude ingesamel en volgens die Tesch-metode van data-analise deur die navorser en die  onafhanklike medekodeerder geanaliseer. Hoofkategorieë, subkategorieë en temas is geïdentifiseer. Deelnemers het uitdrukking gegee aan hulle emosies, uitdagings, die houding en gedrag van polisiebeamptes, teenstrydighede in riglyne en behoefte-identifikasie. Aanbevelings  is dat multidissiplinêre spanlede betrokke moet wees by gemeenskapsaktiwiteite en dat die gemeenskap moet deelneem aan sake wat verband hou met seksuele aanranding. Die regering moet duidelike riglyne ontwikkel wat op landelike en stedelike Suid-Afrika van toepassing is. Gesondheidsorgwetenskappe moet  daarop gerig wees om meer forensiese verpleeg-kundiges op te  lei. Alle toepaslike departemente moet saamwerk om die komplikasies te verlig wat deur voorvalle van seksuele aanranding veroorsaak word.

  17. Erediens en kollekte

    Directory of Open Access Journals (Sweden)

    D. Kempff

    1960-03-01

    Full Text Available Die Heidelbergse Kategismus verklaar in Sondag 38: „ . . . en dat ek, veralo p die sabbat, dit is op die rusdag, metdie gemeente van God ywerig moet opkom om die Woord van God te hoor,. . . en aan die armes Christelike liefdegawes te bring; . . . ” Die bewysplek uitdie Skrif vir hierdie laaste stelling, is I Kor. 16 : 2 wat lui: „Op elke eerste dagvan die week moet elkeen van julle opsy sit en opspaar namate sy voorspoed is, sodat die insameling nie eers plaasvindas ek kom nie”.

  18. Flexvidere

    DEFF Research Database (Denmark)

    Rasmussen, Palle; Lolle, Elisabeth Lauridsen; Jensen, Charlotte Heigaard

    i andre uddannelser, og denne bog indeholder, foruden overvejelser om de første to års arbejde på FlexVid-holdene, eksempler på, hvordan man på andre hold og i andre uddannelser arbejder med blended learning, forhåbentlig til inspiration for endnu flere undervisere og studerende i og uden for UCN...... på at implementere de modeller for fleksible arbejdsformer, som blev beskrevet i Bog 1 på hvert af de fire førsteårs hold, som begyndte i august 2012, kaldet FlexVid-hold. Med udgangspunkt i FlexVid-holdene har vi undervejs arbejdet på at anvende de vigtigste principper for arbejdet på andre hold og...

  19. Jämförelse av vertikala accelerationer av järnvägsbroar för höghastighetståg.

    OpenAIRE

    Shoaibi, Martin

    2014-01-01

    Under de senaste decennierna parallellt med klimatdiskussionen har det vuxit fram ett stort intresse för höghastighetståg och en förbättrad infrastruktur i Sverige. I delar av Europa men speciellt i Kina och Japan har utvecklingen av höghastighetståg fått ett enormt lyft. Ett problem vid höjda tåghastigheter är att broarna vid en kombination av låg massa och låg egenfrekvens riskerar att orsaka resonans och höga accelerationsnivåer vid passage. Ballastspår är namnet för det traditionella järn...

  20. Lagval för upphovsrättsliga förpliktelser : Om artikel 8 i Rom II-förordningen

    OpenAIRE

    Jönsson, Tobias

    2010-01-01

    Den här uppsatsen syftar till att utreda vilket lands lag som blir tillämplig vid en internationell tvist gällande utomobligatoriska förpliktelser vid immaterialrättsintrång, särskilt vid upphovsrättsintrång. Tyngdpunkten ligger i de problem som uppstår då någon gör sig skyldig till ett upphovsrättsintrång med relation till flera länder. Utgångspunkten är Rom II-förordningen och dess åttonde artikel. I artikeln stadgas det att tillämplig lag för en utomobligatorisk förpliktelse som har sin gr...

  1. Vitello-intestinal duct fistula--a rare presentation of a patent vitello-intestinal duct: a case report.

    Science.gov (United States)

    Ali, Akhtar; Jawale, Atul R; Cama, Jitoko

    2010-09-01

    Patent Vitello-intestinal Duct (VID) results as of failed obliteration of the fetal omphalocele coelom (herniated loops of intestine in the umbilical cord) during the development of the midgut. We report a case of an infant who presented at 11 months of the age with history of persistent umbilical discharge since birth. The VID was confirmed with a fistulogram using gastrograffin contrast studies and a wedge resection with primary anastomosis. The infant was discharged 5 days post-op without any post-operative complications. This case report highlight a rare cause of umbilical discharge and the surgical intervention required.

  2. Obravnava slepega in slabovidnega posameznika v patronažnem varstvu

    OpenAIRE

    Bezjak, Aleš

    2017-01-01

    Teoretična izhodišča: Vid je eden izmed petih čutil ter zajema štiri stopnje, in sicer normalni vid, zmerno slabovidnost, hudo slabovidnost in slepoto. Obstajajo različne motnje vida, kot so refrakcijske napake, starostna degeneracija mrežnice, katarakta, glavkom, diabetična retinopatija idr. Da omogočimo lažje gibanje in orientacijo slepemu in slabovidnemu posamezniku, moramo domače in širše okolje prilagoditi. Pri prilagoditvi na nove razmere igra pomembno vlogo družina, prav tako pa tudi p...

  3. Säkerhetsöverlåtelse - pant eller omsättningsköp?

    DEFF Research Database (Denmark)

    Lindskoug, Patrik

    2015-01-01

    I det nyligen publicerade betänkandet SOU 2015:18, Lösöreköp och registerpant, föreslås att traditionsprincipen ska avskaffas och att borgenärsskydd ska tillerkännas en förvärvare redan vid avtal om köp av lösöre respektive en panthavare vid registrering av panträtt i lösöre, i båda fallen oavsett...

  4. Dépendance aux images et élaboration de la violence

    OpenAIRE

    Houssier, Florian

    2014-01-01

    Dans cet article, l'auteur explore l'usage des images violentes dans un jeu vidéo en interrogeant la fonction métapsychologique des images à l'adolescence. A partir de l'exposé d'un cas clinique, une discussion s'ouvre sur la différence entre le retrait sur les objets internes et l'importance des rêveries adolescentes que le jeu vidéo prolongerait, au service du processus adolescent. Image dependence and elaboration of violence. The author explores the use of violent images in a video game...

  5. Yttre och inre motivationsfaktorer i arbetslivet : - en kvalitativ studie om vad anställda upplever påverkar deras motivation

    OpenAIRE

    Isaksson, Josefine; Liljeblad, Antonia

    2017-01-01

    Denna studie syftade till att bidra med kunskap om hur olika faktorer påverkar anställdas motivation i arbetet. Syftet preciserades med frågeställningarna “Hur påverkar yttre faktorer anställdas arbetsmotivation vid ett svenskt företag?” och “Hur påverkar inre faktorer anställdas arbetsmotivation vid ett svenskt företag?” En kvalitativ metod användes i form av semistrukturerade intervjuer. Intervjudeltagarna var tio anställda på ett större svenskt företag inom banksektorn. Inte...

  6. Technicien en audiovisuel (h/f) | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    À l'occasion, réaliser un enregistrement audio ou vidéo d'une conférence, d'un séminaire ou d'une autre activité. Faire le montage de bandes sonores et vidéo et en produire des copies. Diagnostiquer et corriger sur-le-champ les problèmes mineurs liés à l'équipement. Prévoir, s'il y a lieu, de l'équipement de réserve.

  7. ¿Es posible mejorar la eficiencia en el uso del agua de un viñedo mediante un acolchado orgánico del suelo?

    OpenAIRE

    López Urrea, R.; Montoro, A.; Martínez, L.; Mañas, F.; J. M. Sánchez; Intrigliolo, D.S

    2016-01-01

    El objetivo de este trabajo fue evaluar el efecto que un acolchado orgánico del suelo (restos de poda) puede tener sobre la evapotranspiración del cultivo (ETc) de la vid con el fin de mejorar la eficiencia en el uso del agua. El estudio se realizó durante la campaña de 2015 en la finca “Las Tiesas”, Albacete (España). Las medidas se llevaron a cabo en un lisímetro monolítico de pesada ubicado en el centro de una parcela de vid (Vitis vinífera L., cv. Tempranillo) de 1 ha de su...

  8. Active protection of mice against Salmonella typhi by immunization with strain-specific porins.

    Science.gov (United States)

    Isibasi, A; Ortiz-Navarrete, V; Paniagua, J; Pelayo, R; González, C R; García, J A; Kumate, J

    1992-01-01

    NIH mice were immunized with between 2.5 and 30 micrograms of two highly purified porins, 34 kDa and 36 kDa, isolated from the virulent strain Salmonella typhi 9,12, Vi:d. Of mice immunized with 10 micrograms of porins, 90% were protected against a challenge with up to 500 LD50 (50% lethal doses) of S. typhi 9,12,Vi:d and only 30% protection was observed in mice immunized with the same dose of porins but challenged with the heterologous strain Salmonella typhimurium. These results demonstrate the utility of porins for the induction of a protective status against S. typhi in mice.

  9. Analyse de traces spatiales dans le sport électronique d'équipe : application aux MOBA

    OpenAIRE

    Rioult, François; Metivier, Jean-Philippe; Helleu, Boris; SCELLES, Nicolas; Durand, Christophe

    2010-01-01

    National audience; Le développement et la professionalisation du jeu vidéo suscitent le besoin d'outils adaptés à l'analyse de la pratique des joueurs, selon un axe sportif, tactique et stratégique. Très populaires et par nature informatique, ces jeux fournissent de nombreuses traces que nous analysons ici sous l'angle du jeu d'équipe. En prenant l'exemple de jeu vidéo le plus proche d'un sport traditionnel, les MOBA (Multiplayer Online Battle Arena), opposant deux équipes de cinq joueurs sel...

  10. REDAKSIONEEL IN MEMORIAM: PROFESSOR WILLEM VORSTER ...

    African Journals Online (AJOL)

    moet dink nie. Tog het baie hom agterna geloop omdat hy 'n visie gehad het. In sy arbeid het tradisionele wetenskaplike dissiplines vervioei. Sy teologiese arbeid was interdissipiinêr en muitidissiplinêr van aard. Hy het hard gewerk en min gerus en baie geproduseer. Hy wou ook hê dat die werk sonder hom moes aangaan ...

  11. SUID-AFRIKAANSEMEDlESETYDSKRIF SOUTH AFRICAN ...

    African Journals Online (AJOL)

    20 Feb 1971 ... eenvoudig futiel om te dink dat enigiemand wat verant- woordelike werk doen daarin kan slaag om van klerikale laste bevry te wees. Selfs die boer wat tradisioneel as een van die ongebonde lede van die samelewing beskou word, moet horn aan die tirannie van boekhouding, inkomste- belastingsvorms ...

  12. Pieter-Dirk Uys

    African Journals Online (AJOL)

    8 Apr 2016 ... te preek oor wat hulle moet dink nie. My taak is om elkeen vir hom- of haarself te laat dink. Ek wil mense laat positief voel, want ons het elkeen 'n verantwoorde- likheid om iets positiefs, opbouend en hoopvol by te dra” (Uys in Fourie). Op 'n plaaslike, maar ook universele vlak, sal Uys waarskynlik nooit ...

  13. W elke plaats behoort het Oude Testament te b

    African Journals Online (AJOL)

    Test

    ken, dat wij staan in de kerk, die het Evangelie van Jezus Christus te verkondigen heeft. Juist daarom moet telkens weer de vraag opkomen, of wij we! het recht hebben, het Oude Testament in de Christelijke verkondiging te gebruiken. Deze vraag komt ditmaal niet op uit de verlegenheid van den Christusprediker, die niet ...

  14. Twin hub network : Identificatie van kansrijke netwerken

    NARCIS (Netherlands)

    Kreutzberger, E.D.; Konings, J.W.; Macharis, C.; Meers, D.

    2014-01-01

    Twin hub network gaat over de bundeling rail container stromen van en naar de zeehavens Rotterdam en Antwerpen en van kleinere zeehavens in de range Duinkerken – Amsterdam. Door de bundeling moet het mogelijk worden om grotere treinladingen en/of hogere treinfrequenties te organiseren en meer inland

  15. Voedselveiligheid van nieuwe eiwitten

    NARCIS (Netherlands)

    Spiegel, van der M.; Noordam, M.Y.; Fels-Klerx, van der H.J.

    2013-01-01

    De consumptie van dierlijke eiwitten is sterk toegenomen door een stijgende wereldbevolking en opgekomen economieën als China en India. Dit heeft grote gevolgen voor de voedselvoorziening en het milieu. Om land- en energieverbruik terug te dringen moet een eiwittransitie plaatsvinden waarbij minder

  16. Vertaal beteken twee here dien. Dus kan niemand dit." Met hierdie ...

    African Journals Online (AJOL)

    Test

    vertaling vrij bewerkt voor Nederland, maar de eigen kleur van den. Bijbel móest worden bewaard. Ieder lezer heeft er het recht op, dat hij zoo dicht mogelijk bij het oorspronkelijke gebracht wordt." Dit is nie my bedoeling om 'n sistematiese skema van beginsels wat by Bybelvertaling in ag geneem moet word, op te stel nie.

  17. ,,Die kleur-krisis en die Weste"

    Directory of Open Access Journals (Sweden)

    J. H. Coetzee

    1953-03-01

    Full Text Available Wie vandag onbevange en met ’n opregte begeerte na die volle waarheid oor die sogenaamde „kleurvraagstuk” in Suid-Afrika wil skryf, moet voorwaard bid dat hom die deel van Esegiël te beurt mag val: „Jou voorhoof maak ek hard soos ’n diamant, harder as ’n rots . . . ."

  18. DIE KERK SE VISIE OP DIE RESENTE GEBEURE IN SUID-AFRIKA ...

    African Journals Online (AJOL)

    Test

    van kleur of ras of beskawing moet uitgewis word. Hierdie denkrigting word in Suid-Afrika voorgestaan deur die Progressiewe Party, die Liberale. Party sowel as verskillende meer of minder kommunisities-gekleurde organisasies en die Engelse Pers. Dit word ook voorgestaan deur die. Engelse Kerke in ons land. Dit is ook ...

  19. Chinese growth held in check

    NARCIS (Netherlands)

    Costa, J.M.; Heuvelink, E.; Botden, N.P.G.

    2003-01-01

    China heeft een enorm potentieel voor groenten en fruitproductie. De bedrijfs- en marktstructuur zijn weinig efficiënt. De kwaliteit van de productieketen voldoet niet aan internationale normen en er is schaarste aan grond en water. Deze problemen moet worden opgelost voordat China een belangrijke

  20. Forming New Concepts of Women's Identity in Contemporary ...

    African Journals Online (AJOL)

    E.K.M. Dido, Agaat (2004) van Marlene van. Niekerk en Die boek van toeval en toeverlaat. (2007) van Ingrid Winterbach. Een bijkomend criterium is, dat er zo veel over het vrouwe- lijke hoofdpersonage bekend moet zijn, dat je er een psychoanalytische benadering op los kunt laten. Voor haar analyse maakt Vitácková.

  1. Die Nuwe Testament en mitologie: Die probleem van die ...

    African Journals Online (AJOL)

    29 Mei 2015 ... as verwysingsraamwerk verkondig kan word. Indien wel, moet teologie die Christusverkondiging ontmitologiseer. (Bultmann [1941] 1967:16). Wat mites tot uitdrukking bring. Mites verklaar die kragte wat op mense inwerk en hulle lewens begrens, as bonatuurlik. 'n Mitiese kosmologie of wêreldbeskouing.

  2. E-Science : de wetenschap in de 21ste eeuw

    NARCIS (Netherlands)

    Adriaans, P.; Diederen, P.; Heimeriks, G.J.

    2011-01-01

    Wie het veld van wetenschapsbeoefening in het eerste decennium van de 21ste eeuw overziet, moet concluderen dat de uitdagingen waar we voor staan niet kleiner zijn geworden. Op veel gebieden zijn wetenschappers aangelopen tegen problemen van een tot dusverre ongekende omvang en complexiteit.

  3. Art. XXIX van die Nederlandse geloofsbelydenis

    Directory of Open Access Journals (Sweden)

    C. van der Waal

    1978-06-01

    Full Text Available Daar word allereers gespreek oor die noodsaak om ‘diligemment’ en ‘avec bonne prudence par la parole de Dieu’ te onderskei wat die ware kerk is. Die eerste Nederlandse teks gee die belydenis aldus: “Wy ghelooven, dat men moet neerstelicken onderscheiden met goeder wijsheyt by den woorde Gods, welcke de rechte ende ware kerk sy”.

  4. n groot letterkundige en geesverwant gesê: ,,De wereld blijft niet ...

    African Journals Online (AJOL)

    Test

    In hoe- verre hierdie boek sal inslaan en invloed sal uitoefen, moet die tyd ons nog leer. Nadat ons nou hierdie paar lyne getrek het, kan ons daarbo die veel- aangehaalde gedig van TENNYSON as paslike opskrif sit:—. „Flower in the crannied wall,. I pluck you out of the crannies;. I hold you here, root and all, in my hand,.

  5. Annotatie bij uitspraak Hoge Raad 1 februari 2013, nr. 11/05047, LJN BY188o

    NARCIS (Netherlands)

    E.F.V. Boot; G.W. van der Voet (Gerdien)

    2013-01-01

    markdownabstract__Inleiding__ In deze Arubaanse aanvaringszaak gaat het om de vraag aan de hand van welke maatstaf moet warden bepaald of sprake is van een fout van de foods in de zin van art. 6:170 lid van het Burgerlijk Wetboek van Aruba (hierna: BWA), in het bijzonder of concordantie van

  6. Ethische aspecten van big data

    NARCIS (Netherlands)

    N. (Niek) van Antwerpen; Klaas Jan Mollema

    2017-01-01

    Big data heeft niet alleen geleid tot uitdagende technische vraagstukken, ook gaat het gepaard met allerlei nieuwe ethische en morele kwesties. Om verantwoord met big data om te gaan, moet ook over deze kwesties worden nagedacht. Want slecht datagebruik kan nadelige gevolgen hebben voor

  7. Stadsvarkens als schakel in de circulaire economie

    NARCIS (Netherlands)

    Vijn, M.P.

    2017-01-01

    Aan welke regelgeving moet je voldoen om varkens in de stad te houden en te voeden met reststromen? Wageningen University & Research heeft hier onderzoek naar gedaan voor de Stichting Stadsvarkens in Ede. Deze stichting heeft als doelstelling het realiseren van een lokale circulaire economie door de

  8. Stralingsrisico's en verantwoordelijkheden

    NARCIS (Netherlands)

    Berkhout, W.E.R.

    2013-01-01

    De ontdekking door Wilhelm Conrad Röntgen van ‘zijn’ straling heeft een grote invloed gehad op de medische diagnostiek. Omdat de straling ook een risico met zich meebrengt, uitgedrukt in de effectieve dosis, moet er zorgvuldig mee worden omgesprongen. Vanwege dit risico worden door de overheid eisen

  9. Cas Vos

    African Journals Online (AJOL)

    Owner

    Ecstasy, Skype, Google en YouTube waarmee die tydlose aard van die gelykenis opnuut in- geklee word. In die slotstrofe word die tuiskoms ingeklee met verwysings na elemente wat ons in die afdeling “Portrette” leer ken het en wil die digter dus dat ons die verhaal ook teen daardie agtergrond moet lees. Die slotreël, “nou ...

  10. Comfortabel werken en de Arbo Innovation 2005 producten

    NARCIS (Netherlands)

    Vink, P.

    2005-01-01

    Op 19 januari 2005 werd tijdens de arbobeurs door de RAI de Arbo Innovation Award 2005 uitgereikt. Deze prijs is bedoeld voor bedrijven die op de arbobeurs staan met een innovatief product. Dat product moet een nieuwe technologie of een nieuw inzicht in zich hebben en een brede toepassing. De

  11. Zuivering recirculatiewater in de rozenteelt: Fase 0: Uitvoeren biotoetsen Fase 1: Testen effectiviteit zuiveringstechnologie Fase 2: Bedrijfseconomische haalbaarheid zuiveringsapparatuur

    NARCIS (Netherlands)

    Maas, van der A.A.; Os, van E.A.; Blok, C.; Meijer, R.J.M.; Enthoven, N.

    2010-01-01

    Om aan de eisen van de Kaderrichtlijn Water te voldoen moet in de glastuinbouwsector de emissie van nutriënten en gewasbeschermingsmiddelen sterk worden gereduceerd. Overheid en de glastuinbouwsector zijn in GlaMi-verband overeengekomen, dat in 2027 de emissie nagenoeg nul zal zijn. Spuiwater is een

  12. EVA geen FDA

    NARCIS (Netherlands)

    Folbert, J.P.; Dagevos, J.C.

    2001-01-01

    De oprichting van een Europese Voedselautoriteit die in 2002 operationeel moet zijn. Velen zien hierin een evenbeeld van de Amerikaanse FDA (Food and Drug Administration). Deze instantie werkt echter niet zo ideaal als vaak wordt voorgesteld. Het belangrijkste verschil tussen beide instanties is de

  13. 'n Vergelyking tussen die teologie van die Nederlandse ...

    African Journals Online (AJOL)

    'Denken wij niet te weinig aan de engelen?' Miskien moet ons ook vra: Denken wij niet te weinig aan de hemelvaart?' veral ^ 'n mens sien watter ryke en troosryke betekenis die Heidelbergse Kategismus daaraan gee. Kort en kragtig stel die. Heidelbergse Kategismus die feit van Jesus Christus sc hemelvaart, maar voeg.

  14. Het ons kerkwees in strukture gestol?

    African Journals Online (AJOL)

    Met sy twee-ryke leer val die ware kerk onder direkte sorg van God. Nietemin moet die Woord wat die geloof werk, in die aardse regime gepreek word. Die sigbare institusionele aspek van die kerk, die voorsiening van predikers, en tot 'n sekere mate die beheer oor hulle, kom die vors van die land wat die Here gebruik toe.

  15. Die vlugtige taal van vergeet: Die metafoor by Breyten Breytenbach ...

    African Journals Online (AJOL)

    From his first book of poetry, die ysterkoei moet sweet (“the iron cow must sweat”, 1964), till his most recent one, die windvanger (“the windcatcher”, 2007), metaphor has been a central means towards the creation of meaning for Breytenbach. This article will investigate the use of metaphor particularly in this recent book.

  16. DIE AANWENDING VAN VOEDSELHULPBRONNE VIR ...

    African Journals Online (AJOL)

    (b) Grane en proteibne moet verkieslik aangewend word in die rantsoene van spesies wat dit meer doeltreffend kan benut te wete melkkoeie en enkelmaagdiere. Namate die hoender en vark meer direk met die mens vir hierdie voedsels gaan begin nreeding, sal hulle outomaties begin terugtree, in orde van belangrikheid.

  17. Het ontwikkelen van een web performance en security analyse applicatie

    NARCIS (Netherlands)

    O. Hawker

    2017-01-01

    Doelstelling van de opdracht is om vier security en performance aspecten van een website te meten of bepalen. Dit wordt gedaan met behulp van een site crawler. De resultaten van de metingen inclusief de trends van vorige scans worden aan de gebruiker gepresenteerd. Als laatst moet er rekening met de

  18. die doel en wese van opvoedende onderwys en die implikasies ...

    African Journals Online (AJOL)

    kan word is waardevol vir die ontwikkeling en voortbestaan van die rnens. :1et die verworwe kenni s van die mens kan hy vaardighede aanleer (fisiese en psigiese). Die mens moet hom dus '' ... in die w~reld orii:!nteer •.. " volgens Harmse (1979, b1.26). Hierdie orientasie kan noodwendig nie doeltreffend plaasvind indien 'n ...

  19. Nieuw vaccin tegen campylobacter

    NARCIS (Netherlands)

    Wagenaar, J.A.

    2008-01-01

    Het vaccin dat de kip moet beschermen tegen de bacterie Campylobacter werkt in het laboratorium. Dat wil bacterioloog Jaap Wagenaar wel kwijt. Wanneer het er komt en zelfs of het er komt, daarover laat Wagenaar zich niet uit. "Het is een hele klus om het immuunsysteem van kippen effectief op te

  20. De zin en onzin van fair value in de jaarrekening : de zoektocht naar natuurlijke breuklijnen in het historische kostprijsoppervlak

    NARCIS (Netherlands)

    Hoeven, R.L. ter

    2006-01-01

    Ter Hoeven stelt dat fair value in de regelgeving van de International Accounting Standards Board (IASB) is ingevoerd zonder een onderliggende theoretische onderbouwing. Dit heeft geleid tot inconsistenties in de wijze waarop de fair value moet worden bepaald. “Het is onbegrijpelijk dat pas

  1. Hogere kwaliteit door betere communicatie : Optimale geboortezorg met de sociocratische kringorganisatiemethode

    NARCIS (Netherlands)

    van der Meij, Karuna; Schuitmaker-Warnaar, T.J.; Hallensleben, Eric

    2016-01-01

    Betere communicatie en samenwerking verhogen de kwaliteit van de zorg. De Sociocratische Kringorganisatiemethode blijkt daarbij een goed hulpmiddel. Ook bij een beladen discussie of het VSV naast reguliere echo’s ook commerciële echo’s moet aanbieden in het gezamenlijke echobureau. Het VSV in Gouda

  2. kardinale aspekte van nasionale diensplig met spesifieke verwysing ...

    African Journals Online (AJOL)

    In his introduction he discusses the evolution of compulsory military service in the briefest terms, and then proceeds to a comparative overview of the subject within the .... dog kennis moet geneem word van die feit dat vanwee die land se beleid van gewapende neu- traliteit, heelwat klem gele word op konstante paraatheid.

  3. Die wonderbaarlike vermeerdering van brood (Matt 14:13—21 en ...

    African Journals Online (AJOL)

    skeie metodes is, word dit vir die onderhawige doel gesamentlik han- teer. Dit gaan van die standpunt uit dat ons moet aanvaar dat die tradisies van en aangaande ... (1974: 111 — 114; 114-120) onderskei, benev^ens tussen duiweluitdry- w^ings en genesingwonders, ook tussen 'Geschenkwunder' ('gawe- wonders') en ...

  4. CoCo’s en het risico van een nieuwe crisis

    NARCIS (Netherlands)

    Chan, S.; van Wijnbergen, S.

    2014-01-01

    CoCo’s (contingent convertibles) zijn nieuw, razend populair en volgens velen de oplossing voor het too big to fail-probleem, waarbij de belastingbetaler moet bijspringen als het misgaat. De BIS heeft ze onder voorwaarden goedgekeurd als bankkapitaal, in de verwachting dat systeemrisico’s afnemen

  5. kerkleierskap as bemiddeling van 'n onmoontlike werklikheid: '

    African Journals Online (AJOL)

    19 Mei 2010 ... leadership; management of change; complexity; postmodernism ... The question to be answered in this article is: What is the role of leaders in a world typified as complex? Because of the complexity of .... Wanneer die Kerk oor haar wese en bestaansdoel moet besin, bestaan daar egter 'n groot gevaar dat ...

  6. Onderzoekers foerageren ook

    NARCIS (Netherlands)

    Blacquiere, T.

    2012-01-01

    Het is mei. Tenzij het regent, zijn de bijen de hele lange dag aan het zoeken en binnenhalen van nectar, stuifmeel, propolis, water. Dat foerageren gebeurt om te voorzien in de behoeften van het hele bijenvolk op dít moment: als het heet is moet er meteen water worden gehaald om het volk te koelen.

  7. (vierde druk) Tussen tekst en lezer. Een historische inleiding in de bijbelse hermeneutiek 1: De vroege kerk - Schleiermacher. Amsterdam: VU University Press, 2009. xxv + 453pp.

    NARCIS (Netherlands)

    Zwiep, A.W.

    2017-01-01

    De bijbel is weer helemaal terug in het publieke domein, getuige allerlei discussies in de media over schepping en evolutie, over religie en geweld, over vrijheid van godsdienst en vrijheid van meningsuiting. De vraag hoe de bijbel in dergelijke debatten geïnterpreteerd moet worden – kun je van de

  8. Abraham Kuyper en volksideologie onder die Afrikaners

    Directory of Open Access Journals (Sweden)

    K. Smit

    1989-06-01

    Full Text Available Om die waarheid te sê, Kuyper is lank nie meer gewild in Gereformeerde geledere in Suid-Afrika nie. Deels moet dit gewyt word aan die assosiasie van apartheidsideologie met Kuyper se idee van skeppingsordeninge (’n idee wat ook verbind kan word met Hitler se regverdiging van sy uitwissingsoperasies.

  9. Nieuwe afzetkanalen verleiden de consument

    NARCIS (Netherlands)

    Soethoudt, J.M.

    2008-01-01

    Nieuwe afzetkanalen bieden kansen om de afzet van biologische producten te vergroten. Waar moet je als bedrijf aan denken als je actief wilt worden in de lucratieve markt van horeca en bedrijfscatering? Welke andere creatieve manieren zijn er om afzet te verhogen en nieuwe kanalen aan te boren? Deze

  10. Romantic Modernism : Nostalgia in the World of Conservation

    NARCIS (Netherlands)

    Denslagen, Wim

    2009-01-01

    Mag de monumentenzorg steun verlenen aan de reconstructie van de oude geveltjes wanneer daarachter vrijwel alles modern is? Moet de monumentenzorg alleen nog de voorgevel willen beschermen, als de rest van het monument is verdwenen? Volgens de gangbare opvattingen in de wereld van de monumentenzorg

  11. Interview; kunst of kliederen; “De ene graffiti is de andere niet”

    NARCIS (Netherlands)

    Keus, R; Vanderveen, G.N.G.

    2010-01-01

    De aanpak van graffiti staat bij veel gemeenten hoog op de agenda. Het tegengaan van overlast en verloedering is hierbij meestal de belangrijkste reden. Maar om een aanpak echt te laten slagen, moet er volgens onderzoekster Gabry Vanderveen eerst goed worden nagegaan welke vormen van graffiti voor

  12. VTN of GFN, dat is de vraag. [VTN or GFN, that is the question

    NARCIS (Netherlands)

    Meulenberg, M.T.G.

    1996-01-01

    Moet de marketing van de Nederlandse voedingstuinbouw via een of meerdere organisaties lopen? Naast de voordelen die een centrale organisatie heeft worden door de fruittelers enkele kanttekeningen gemaakt m.b.t. het samengaan van de marketing van handfruit met die van verse groente

  13. Advies aanpassing richtlijn certificatie arbodiensten

    NARCIS (Netherlands)

    Gort, J.; Scheppingen, A. van

    2003-01-01

    De hoofdvraagstelling voor dit onderzoek van TNO Arbeid is: Hoe moet de certificatieregeling arbodiensten worden aangepast, zodanig dat naast toepassing van de bestaande kwaliteitsnorm ISO 9001:2000 de prestaties van arbodiensten kunnen worden beoordeeld en verbeterd? Deze vraag kan worden

  14. Ligt de toekomst van Schiphol in Dubai? : over de opkomst van Dubai als mega hub en hoe samenwerking met deze luchthaven de concurrentiepositie van Schiphol kan versterken

    NARCIS (Netherlands)

    el Makhloufi, Abdel; Onstein, Sander

    2015-01-01

    Schiphol dreigt in rap tempo zijn concurrentiepositie als hub te verliezen aan Dubai. Het behoud en versterking van de hub-functie van Schiphol moet een hoge prioriteit krijgen bij het kabinet, stakeholders en Metropoolregio Amsterdam. Een strategisch samenwerkingsverband met Dubai kan daarbij het

  15. die ••zuidafrikaanse vliegeniers korps" : vliegtuie en personeel vir en ...

    African Journals Online (AJOL)

    behoort Ite. Edwin Cheere Emmett en Marthinus Steyn Williams ook te gaan'. Die eersgenoemde moet, na sy terugkeer, na Swakopmund gestuur word om daar as raadgewer m.b.t. plaaslike werksaamhede op te tree. Lte. Kenneth Reid van der. Spuy en Gordon Shergold Creed', wat saam met It. B. H. Turner van Frankryk.

  16. i,tt r

    African Journals Online (AJOL)

    gespuit en die materiaal word deeglik verneng. Dit is belangrik dat elke individuele strooipartikel met die byt- soda in aanraking moet kom. Vir did doel kan 'n gewone vo€rnenger toegerus word soos aangedui in Fig. l. Fis,l .lte. Die bytsoda deurtrekte materiaal word dan ge- kompakeer in 'n verkorrelingsmasjien of wafelpen.

  17. Varroabestrijding en Amitraz

    NARCIS (Netherlands)

    Steen, van der J.J.M.

    2010-01-01

    Dat de varraomijt bestreden moet worden is voor iedere imker duidelijk. Niet bestrijden leidt tot zwakke volken en wintersterfte. Onderzoeken van PRI Bijen@wur en vele buitenlandse onderzoeksinstellingen komen, als het gaat over wintersterfte, altijd hetzelfde uit: de varroamijt is oorzaak nummer

  18. die ondersteuning van okkulte-gerehabiliteerdes: 'n pastoraal ...

    African Journals Online (AJOL)

    admin

    Seale (1991:54) beklemtoon ook die inskakeling van die okkulte-bevryde by die kerkgemeenskap as nasorg. Smit (1992b:51) sluit hierby aan wanneer hy daarop wys dat die okkulte-gerehabiliteerde moet leer hoe om daagliks. Satan en sonde te oorwin en dus die pad van heiligmaking te stap. Volgens. Van Zyl (1992:20) ...

  19. "Ek is nie meer een van ons nie": Breyten en di volk. 'n Verkenning ...

    African Journals Online (AJOL)

    These events include the reception of the Paris based poet's debut, Die ysterkoei moet sweet (The Iron Cow Must Sweat) (1964); the granting of a literary award ... (1982); his return to South Africa to receive a literary award (1986); the reception of his first art exhibition, Painting the Eye (1994); the reception of his first play, ...

  20. PARTIKULIERE EN ALGEMENE SINODES

    African Journals Online (AJOL)

    Die vraag wat ontstaan, is “Watter van hierdie sake moet deur die partikuliere en watter deur die algemene sinode verrig word?” Volgens die skrywer lê die oplossing hiervoor in die toepassing van twee erkende gereformeerde kerkregtelike beginsels: dat meerdere vergaderings nie sake hanteer wat op mindere.

  1. Retaining professional nurses in South Africa: Nurse managers ...

    African Journals Online (AJOL)

    Nurse managers have to address shortcomings in their managerial and leadership skills and implement changes within a multigenerational nursing workforce and challenging working environments. Opsomming. Suid-Afrika ervaar 'n ernstige tekort aan verpleegkundiges wat aangespreek moet word ten einde krisisse in ...

  2. Die bepaling van die 'sentrum van hoofbelange' by oorgrens ...

    African Journals Online (AJOL)

    As die filiaal se geregistreerde kantoor en die opvatting van derde partye op die selfde plek dui (sodat die vermoede in werking tree), moet die houermaatskappy meer, beter en swaarder getuienis aanvoer om die vermoede te weerlê. Die vermoede sal egter nie sonder meer weerlê word nie. 'n Essensiële en delikate ...

  3. Exoten in de Nederlandse kustwateren : Situatiebeschrijving en beheers- en onderzoeksvoorstellen

    NARCIS (Netherlands)

    Tien, N.S.H.; Dankers, N.M.J.A.

    2004-01-01

    De effecten van het introduceren van exoten zijn moeilijk te voorspellen. Ook is het moeilijk uitspraken te doen of effecten te beschrijven in termen van schadelijk, onschadelijk, ongewenst, verarming of verrijking (Carlton, 2002). Onderscheid moet hierbij gemaakt worden tussen ecologische en

  4. Regenvastheid van zwavel

    NARCIS (Netherlands)

    Jong, de P.F.; Scholten-Grit, G.; Anbergen, R.H.N.; Heijne, B.

    2004-01-01

    Binnen de biologische fruitteelt is het aantal gewasbeschermingsmiddelen dat toegepast mag worden zeer beperkt. De meest belangrijke ziekte waar tegen bestreden moet worden, is schurft (Venturia inaequalis). Het middel zwavel is het meest toegepaste fungicide dat op dit moment wordt ingezet op

  5. Die hantering van neweskikkers en onderskikkers in Afrikaanse ...

    African Journals Online (AJOL)

    moet die sintaksis en die gevolge van die gebruik van 'n newe- alternatiewelik onderskikker baie duidelik illustreer, en nie sinne wees waarin die gebruik van die trefwoord, naamlik newe- of onderskikker, geïllustreer word nie. Neweskikker. 'n Neweskikker verbind woorde (penne, potlode en uitveërs), woordgroepe (blaf-.

  6. Een vorstelijke palts te Zutphen ? : macht en prestige op en rond het plein 's-Gravenhof van de Karolingische tijd tot aan de stadsrechtverlening

    NARCIS (Netherlands)

    Groothedde, Michael

    2013-01-01

    De stad Zutphen is een van de oudste steden van Nederland. De site representeert niet alleen een stadskern van regionaal en nationaal belang. Door de historische context en archeologische verschijningsvorm moet de vindplaats Zutphen van internationaal belang worden geacht. Sinds 2002 heeft het

  7. Datamining zonder data

    NARCIS (Netherlands)

    Rijswijk, van J.H.

    1999-01-01

    De Dienst Landbouwkundig Onderzoek onderzoekt welke methode er ontwikkeld moet worden om aan de hand van data inzicht te krijgen in de kennis die op de verschillende instituten aanwezig is over de groene ruimte. Dit wordt gedaan in het project Datamining Groene Ruimte, dat valt binnen het

  8. ROM als tomtom: Als routine outcome monitoring echt routine zou zijn

    NARCIS (Netherlands)

    Tiemens, B.G.; Sonsbeek, A.M.S. van

    2017-01-01

    Achtergrond: Om het gebruik van rom in de behandeling te bevorderen is er meer aandacht voor implementatie-strategieën dan voor de daadwerkelijke functie van rom. Doel: De vraag beantwoorden wat rom de behandelaar en cliënt moet opleveren om routine te kunnen worden. Methode: De functie van rom

  9. Dynamic water resource management for achieving self-sufficiency of cities of tomorrow

    NARCIS (Netherlands)

    Agudelo Vera, C.M.

    2012-01-01

    Steden kunnen beschouwd worden als producenten van primaire en secundaire grondstoffen. Volgens onze hypothese, moet deze zelfvoorziening uitgaan van de kleinst mogelijke ruimtelijke schaal. De mogelijkheden om energie en water in Nederland te ‘oogsten’ zijn geëvalueerd, uitgaande van gemiddelde

  10. Advies Kennissysteem Natura 2000 : een centrale bibliotheek voor dosis-effectinformatie gebaseerd op zoekacties

    NARCIS (Netherlands)

    Broekmeyer, M.E.A.; Dirksen, J.; Apeldoorn, van R.C.; Veen, van der M.

    2008-01-01

    Dit document bevat een advies over het opzetten van een kennissysteem toegespitst op een centraal informatiesysteem over dosis-effect informatie. Een dergelijk systeem moet kennis over ontsluiten voor vergunnigsverleners en de opstellers van beheerplannen. Het advies is gebaseerd op een aantal

  11. Gevolgen verzilting Volkerak zijn te beperken (interview met o.a. Wim Voogt)

    NARCIS (Netherlands)

    Thoenes, E.; Voogt, W.

    2009-01-01

    Om van het probleem blauwalg af te komen moet het Volkerak-Zoommeer weer in verbinding komen met de zee. Aangrenzende landbouwgebieden en zelfs het Westland dreigen een tekort aan zoet water te krijgen. Mogelijke oplossingen moeten nu op hun haalbaarheid worden getoetst

  12. Martin Bossenbroek

    African Journals Online (AJOL)

    Owner

    Anders as met die Jameson-inval in 1896 is die Transvaalse president in 1900 'n verleent- heid vir die Duitse keiser: “Paul Kruger paste niet meer in de logica van Wilhelm II. Inge- droogde stopverf uit een vorig denkraam. Hij moet weg, Duitsland uit.” (429). Steungroepe vir Kruger in Nederland: “Jonge dames en heren van ...

  13. Incidenteel zeer zware gevallen van dode knoppen bij peer

    NARCIS (Netherlands)

    Wenneker, M.; Anbergen, R.H.N.; Joosten, N.N.

    2007-01-01

    Uit PPO-onderzoek blijkt dat Alternaria de primaire oorzaak is van dode bloemknoppen bij peer. Hoewel niet alle Alternaria-infecties tot dode knoppen leiden, moet de ziekte niet worden onderschat. De directe bestrijding van Alternaria vemindert het optreden van dode knoppen

  14. Veel middelen fytoftora: ook aanbod middelen Alternaria voldoende.(interview)

    NARCIS (Netherlands)

    Schepers, H.T.A.M.

    2007-01-01

    PPO-Lelystad heeft het middelenschema voor fytoftora en Alternaria geactualiseerd. Door het afnemende gebruik van mancozebhoudende middelen komt Alternaria vaker voor, wat lagere opbrengsten veroorzaakt. Om zijn sterke kant uit te buiten, moet een middel worden ingezet in het aangegeven

  15. Superplasticiteit bij Cern

    NARCIS (Netherlands)

    Snippe, Q.H.C.; Snippe, Corijn

    2008-01-01

    Op CERN, het Europees onderzoekscentrum voor subatomaire fysica in Genève, wordt dit jaar een nieuwe deeltjesversneller, de Large Hadron Collider (LHC), in werking gesteld die nieuwe inzichten moet bieden over hoe de kleinste deeltjes der materie zich gedragen. Om hierachter te komen, is op plaatsen

  16. Oor die metodiek van *n holistiese geskiedenis van Oud-Israel

    African Journals Online (AJOL)

    archaeology, historical geography, sociology, psychology and secondary literature. 1. INLEIDING. In 'n vorige bydrae (kyk Scheffler 1988a:665-683) het ek betoog dat indien historio- grafie reg wil laat geskied aan die voile spektrum van menslike lewe, dit komprehen- sief of omvattend moet wees. Dit geld ook veral wat die ...

  17. Ester: Vroulike durf binne 'n manlike bestel

    African Journals Online (AJOL)

    Test

    7 Jun 2011 ... koning gereël) die mooiste deelnemer daaraan as koningin in. Vasti se plek gekies moet word. Die boek dra die naam van die hooffiguur, die mooi Joodse meisie Ester, met wie die leser eers kennismaak nadat haar pleegvader Mordegai (binne sy Joodse geslagsregister en as weggevoerde banneling) ...

  18. JLM FRANKEN, P:eí

    African Journals Online (AJOL)

    Test

    Groot Trek. Dit was die Trek wat Retief belangrik gemaak het, en waarin hy 'n held geword het, en waardeur sy nagedagtenis vereer word. Die boek van Franken kan dan ook alleen 'n inleiding vorm tot die. Retief van die Trek. As hierdie inleiding 560 bladsye moet beslaan, hoeveel dan nie 'n boek oor Retief van die Trek ...

  19. Slim bewegen tussen haven en stad

    NARCIS (Netherlands)

    van Duin, Ron

    2017-01-01

    Wat moet de havenstad Rotterdam gaan doen met alle toekomstige kansen en bedreigingen? Welke disruptieve veranderingen zijn bij uitstek geschikt voor de haven- en stadsontwikkeling en welke ontwikkelingen zien wij op ons afkomen? Op welke manier kunnen we daar op inspelen met het onderzoek en het

  20. Imago van geringe innovatiekracht is te wijten aan de oude cultuur

    NARCIS (Netherlands)

    Edo Beerda; Dr Ruben Vrijhoef

    2012-01-01

    Interview door Edo Beerda met aanstaande lector Vrijhoef. De ‘oude bouw’ werkt feodaal, vindt de specialist in ketenintegratie. De nieuwe professional moet aan een slimmer bouwproces handen en voeten geven. Vrijhoef treedt over twee weken aan als lector Nieuwe Cultuur in de Bouwketen in Utrecht.

  1. Transportbrandstof uit biogas geeft hoger rendement en verduurzaamt

    NARCIS (Netherlands)

    Kasper, G.J.

    2013-01-01

    Bij vergisting van mest ontstaat biogas dat met een WKK kan worden omgezet in elektriciteit en warmte. Probleem is vaak dat de warmte onvoldoende benut wordt. Het opwerken van biogas tot transportbrandstof kan een oplossing hiervoor zijn, waarbij gelet moet worden op schaalgrootte van vergisting,

  2. Veiligheidsfilosofie bestaande bouw. toepassing en interpretatie NEN 8700

    NARCIS (Netherlands)

    Steenbergen, R.D.J.M.; Vrouwenvelder, A.C.W.M.; Scholten, N.

    2012-01-01

    Op 1 april 2012 is het nieuwe Bouwbesluit 2012 van kracht geworden en behoren nieuwe aanvragen van omgevingsvergunningen voor nieuwbouw te zijn gebaseerd op de Eurocodes. Voor beoordeling van bestaande bouw en voor verbouwprojecten moet NEN 8700 worden toegepast. Deze norm sluit aan op de Eurocodes

  3. Memorandum op die beswaarskrif oor die diakenamp

    Directory of Open Access Journals (Sweden)

    L. Floor

    1976-06-01

    Full Text Available Die probleem in die beswaarskrif voor die Sinode 1973 spits hom toe op die vraag: wat is die objek van die diakonale diens? Is dit die hele gemeente of alleen ’n gedeelte van die gemeente nl. die armes? In verband hiermee moet ook gevra word: welke spesifieke opdrag is inherent aan die diakenamp?

  4. Die binding van die konfessie

    Directory of Open Access Journals (Sweden)

    P. J. Coetzee

    1970-06-01

    Full Text Available Ons moet waak teen twee uiterstes. Aan die een kant het die dogma as onversoenlike vyand die dogmatisme en aan die ander kant die antidogmatisme — dit hou enersyds die gevaar in van verabsolutering (oorskatting, en ander- syds die gevaar van relativisme (onderskatting.

  5. Stralingsniveaumetingen rond het terrein van de EPZ kerncentrale te Borssele in 2011

    NARCIS (Netherlands)

    Farahmand M; LSO; mev

    2012-01-01

    Het stralingsniveau aan de terreingrens van kerncentrale Borssele lag in 2011 onder het toegestane maximum. Dit blijkt uit controlemetingen van het RIVM.

    Volgens de kernenergiewetvergunning moet de centrale ervoor zorgen dat personen buiten de terreingrens een effectieve

  6. Die geheim van die prediking: om mondig te word | Cilliers | Acta ...

    African Journals Online (AJOL)

    Hierdie artikel gaan uit van die oortuiging dat prediking 'n spraakgebeure is waarin die stem van die prediker - simbool van sy of haar persoonlikheid en spiritualiteit - 'n belangrike rol het om te speel. Die stem van die prediker mag nie misken word in die dinamiese struktuur van kommunikasie nie, en moet inteendeel op 'n ...

  7. GESINSPOLITIEK EN DIE OUER-KIND VERHOUDING Families can ...

    African Journals Online (AJOL)

    Administrator

    Afrikaanse reg weer te gee en die moontlike implikasies van die hoofstukke oor fundamentele regte in die twee grondwette op die besluitnemingsproses aanwesig binne die ouer-kind verhouding te bespreek. Die kind en die ouer se individuele belange kan in konflik kom waar daar besluite geneem moet word aangaande ...

  8. Bybelse teologie - dogmatiese teologie

    African Journals Online (AJOL)

    bedoeling van die Reformatore was, toegepas is, is daar ook 'n metodo- logiese probleem met die sola Scriptura-pnnsipe ervaar (Ebeling 1960: 74; kyk ook Boers 1979: 18). Sola Scriptura het ingehou dat die teologie nie net inhoudelik op die Bybel gegrond moet word nie, maar ook formeel wat die denkkategorieë betref ...

  9. HeinrichOhlhoff Oorlog en poésie: primér 'n Celliers perspektief

    African Journals Online (AJOL)

    kan niet besproken worden op het nivieau van de individuele ... maar moet worden beschouwd op het niveau van de cultuurtekst. .... kamp dood: Die kindertjies, Breggie en Iaap en Faan, het suster die een na die ander sien gaan; en jy sé daar's 'n plekkie vir my nog gebly, waar moeder kan rus aan klein Fanie se sy.

  10. SP ENGE LB RECHT . EVANGE LIE ENWET IN DEEXEGESEVANH ...

    African Journals Online (AJOL)

    Test

    Kanon, ons Reformatorisch verstaan van de Schrift, en ons geloovig ..... van de vijandschap. Deze is dus geen natuurlijke, van zelf sprekend? zaak, maar berust op het woord Gods. Zij is er nu, en stoort de volledige gemeenschap van den mensch met ... te zeggen : Gij moet strijden, immer opnieuw den kamp aanvaarden,.

  11. ne boeregeinterneerdes in portu- gal

    African Journals Online (AJOL)

    vroeere filoE1rExile Camp waar 'n gedeelte van die aldaar-gehuisvestes na 'n paar dae toegelaat .... jaar onzes Heren 1912, op last van de Regering van de Unie van Zuid Afrika, zijnde te dien tijd. Viscount ... 23.1.1902 in die kamp te Peniche was.20 Tewens vermoed ons dat Voster as Vorster gelees moet word.

  12. Old School Hacking Treft Smartphones : Hoe operators hun netwerk kunnen beveiligen

    NARCIS (Netherlands)

    Fransen, F.; Hartog, T; Muller, F.; Veugen, P.J.M.

    2011-01-01

    Smartphones en tablets zijn vatbaar voor allerhande virussen en mal-ware infecties. Meestal is het de taak van de gebruiker om zich daaryegen te beschermen. Hij moet pincodes instellen, firewalls opzetten en virussscanners installeren, Cybercriminaliteit is echter niet een probleem van de

  13. De zogenaamde vitamine K deficientie van de pasgeborene

    NARCIS (Netherlands)

    Doorm, Johannes Marius van

    1976-01-01

    Veel obstetrici en kind.erartsen dienen pasgeborenen vitamine K toe om het risico van bloedingen in de neonatale periode te verkleinen. De basis voor deze benadering is de veronderstelling dat de oorzaak van de bloedingsneiging moet worden gezocht in een lage plasmaspiegel van de vier van vitamine K

  14. dte gebruik van eenvoudige toetse om melkvervangers te evalueer

    African Journals Online (AJOL)

    Die huidige vereistes vir standaarde van melkver- vangers in Suid-Afrika, hou min verband met die dier se benutting daarvan. Dit maak slegs voorsiening vir mini- mum en maksimum kalsium, fosfor, vet, vesel en pro- teibn. Verder word dit gestel dat 60% van die produk uit melkprodukte moet bestaan. Fluidige standaarde ...

  15. Voorspellen van het uitbetalingsgewicht van zetmeelaardappelen uit stikstofmetingen tijdens het groeiseizoen

    NARCIS (Netherlands)

    Akkermans, L.M.W.; Haren, van R.J.F.

    2002-01-01

    Dit onderzoek gaat over de relatie tussen de opbrengst van zetmeelaardappelen en stikstofmetingen tijdens het groeiseizoen. De bedoeling is een instrument te ontwikkelen waarmee tijdens het groeiseizoen kan worden beslist of er al dan niet moet worden bijgemest. De stikstofwaarden zijn op twee

  16. Annotatie bij Hoge Raad 29 januari 2008 (Bevelsbevoegdheid art. 2 Politiewet)

    NARCIS (Netherlands)

    Brouwer J.G., Jan; Schilder A.E., [No Value

    2008-01-01

    Samenvatting: Art. 2 Politiewet 1993 bevat een algemene taakomschrijving voor de politie en kan niet worden aangemerkt als een wettelijk voorschrift op basis waarvan vorderingen of bevelen kunnen worden gegeven waaraan op straffe van overtreding van art. 184, eerste lid, Sr moet worden voldaan.

  17. 'Onaantastbare straatjongens, wie durft ze wat te doen?'

    NARCIS (Netherlands)

    Jan Nap; Eric Bervoets; Mike Koning; Marnix Eysinks Smeets

    2011-01-01

    OPINIE-Marnix Eysink Smeets/ Eric Bervoets/Jan Nap/Mike Koning. Veel criminele straatjongens wanen zich onaantastbaar. Burgers houden zich afzijdig. Want als zelfs de overheid niet in staat is hen aan te pakken, wie dan wel? Een fnuikende cirkel van onmacht, die dringend moet worden doorbroken,

  18. Op de schouders van het verleden: leiderschap vraagt historisch besef

    NARCIS (Netherlands)

    Keulen, S.; Kroeze, R.

    2011-01-01

    Anders dan de retoriek van managementgoeres doet vermoeden, tonen ze vooral tijdsgebonden opvattingen van goed management. Hun werk is daarom nuttig als barometer van de tijdgeest, maar als manager moet je er je koers nooit door laten bepalen. Historisch besef en kennis van het (bedrijfs)verleden

  19. BEPS: quo vadis Nederland?

    NARCIS (Netherlands)

    Cornelisse, R.P.C.

    2015-01-01

    Schrijver blikt vooruit op de ontwikkelingen die dit jaar in de fiscale wereld gaan plaatsvinden. Hij stelt de vraag aan de orde of Nederland de ontwikkelingen op dit terrein moet afwachten of dat het verstandiger is juist niet af te wachten maar pro-actief haar fiscale stelsel op korte termijn

  20. ISSN 1727-3781

    African Journals Online (AJOL)

    HP4510s

    natuurlik direk verband met die feit dat 'n spesifieke individu as die directing mind van die regspersoon aangewys moet word. Voortvloeiend uit hierdie verslag het die. Britse Home Office in 2005 'n wetsontwerp ter tafel gelê waaruit die Corporate. Manslaughter and Corporate Homicide Act van 2007 op sy beurt voortgevloei ...