WorldWideScience

Sample records for victoria marburgvirus marv

  1. Conserved Receptor-Binding Domains of Lake Victoria Marburgvirus and Zaire Ebolavirus Bind a Shared Receptor

    National Research Council Canada - National Science Library

    Kuhn, Jens H; Radoshitzky, Sheli R; Guth, Alexander C; Warfield, Kelly L; Li, Wenhui; Vincent, Martin J; Towner, Jonathan S; Nichol, Stuart T; Bavari, Sina; Choe, Hyeryun

    2006-01-01

    .... Both fragments specifically inhibited replication of infectious Zaire ebolavirus, as well as entry of retroviruses pseudotyped with either Lake Victoria marburgvirus or Zaire ebolavirus GP(sub 1,2...

  2. Virus-Like Particle Vaccination Protects Nonhuman Primates from Lethal Aerosol Exposure with Marburgvirus (VLP Vaccination Protects Macaques against Aerosol Challenges

    Directory of Open Access Journals (Sweden)

    John M. Dye

    2016-04-01

    Full Text Available Marburg virus (MARV was the first filovirus to be identified following an outbreak of viral hemorrhagic fever disease in Marburg, Germany in 1967. Due to several factors inherent to filoviruses, they are considered a potential bioweapon that could be disseminated via an aerosol route. Previous studies demonstrated that MARV virus-like particles (VLPs containing the glycoprotein (GP, matrix protein VP40 and nucleoprotein (NP generated using a baculovirus/insect cell expression system could protect macaques from subcutaneous (SQ challenge with multiple species of marburgviruses. In the current study, the protective efficacy of the MARV VLPs in conjunction with two different adjuvants: QS-21, a saponin derivative, and poly I:C against homologous aerosol challenge was assessed in cynomolgus macaques. Antibody responses against the GP antigen were equivalent in all groups receiving MARV VLPs irrespective of the adjuvant; adjuvant only-vaccinated macaques did not demonstrate appreciable antibody responses. All macaques were subsequently challenged with lethal doses of MARV via aerosol or SQ as a positive control. All MARV VLP-vaccinated macaques survived either aerosol or SQ challenge while animals administered adjuvant only exhibited clinical signs and lesions consistent with MARV disease and were euthanized after meeting the predetermined criteria. Therefore, MARV VLPs induce IgG antibodies recognizing MARV GP and VP40 and protect cynomolgus macaques from an otherwise lethal aerosol exposure with MARV.

  3. Novel activities by ebolavirus and marburgvirus interferon antagonists revealed using a standardized in vitro reporter system.

    Science.gov (United States)

    Guito, Jonathan C; Albariño, César G; Chakrabarti, Ayan K; Towner, Jonathan S

    2017-01-15

    Filoviruses are highly lethal in humans and nonhuman primates, likely due to potent antagonism of host interferon (IFN) responses early in infection. Filoviral protein VP35 is implicated as the major IFN induction antagonist, while Ebola virus (EBOV) VP24 or Marburg virus (MARV) VP40 are known to block downstream IFN signaling. Despite progress elucidating EBOV and MARV antagonist function, those for most other filoviruses, including Reston (RESTV), Sudan (SUDV), Taï Forest (TAFV), Bundibugyo (BDBV) and Ravn (RAVV) viruses, remain largely neglected. Thus, using standardized vectors and reporter assays, we characterized activities by each IFN antagonist from all known ebolavirus and marburgvirus species side-by-side. We uncover noncanonical suppression of IFN induction by ebolavirus VP24, differing potencies by MARV and RAVV proteins, and intriguingly, weaker antagonism by VP24 of RESTV. These underlying molecular explanations for differential virulence in humans could guide future investigations of more-neglected filoviruses as well as treatment and vaccine studies. Published by Elsevier Inc.

  4. Monovalent Virus-Like Particle Vaccine Protects Guinea Pigs and Nonhuman Primates Against Infection with Multiple Marburg Viruses

    National Research Council Canada - National Science Library

    Swenson, Dana L; Warfield, Kelly L; Larsen, Tom; Alves, D. A; Coberley, Sadie S; Bavari, Sina

    2008-01-01

    .... Guinea pigs vaccinated with marburgvirus (m)VLPs or inactivated MARV (iMARV) develop homologous humoral and T cell responses and are completely protected from a lethal homologous MARV challenge...

  5. Dicty_cDB: Contig-U04401-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , 3' end ... 46 1.6 1 ( DQ447660 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447659 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447658 ) Lake Victoria marburgvirus - An...gola2005 strain An... 44 6.3 1 ( DQ447657 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447656 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447655 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447654 ) Lake Victoria marburgvirus -

  6. Development of a model for marburgvirus based on severe-combined immunodeficiency mice

    Directory of Open Access Journals (Sweden)

    Kalina Warren V

    2007-10-01

    Full Text Available Abstract The filoviruses, Ebola (EBOV and Marburg (MARV, cause a lethal hemorrhagic fever. Human isolates of MARV are not lethal to immmunocompetent adult mice and, to date, there are no reports of a mouse-adapted MARV model. Previously, a uniformly lethal EBOV-Zaire mouse-adapted virus was developed by performing 9 sequential passages in progressively older mice (suckling to adult. Evaluation of this model identified many similarities between infection in mice and nonhuman primates, including viral tropism for antigen-presenting cells, high viral titers in the spleen and liver, and an equivalent mean time to death. Existence of the EBOV mouse model has increased our understanding of host responses to filovirus infections and likely has accelerated the development of countermeasures, as it is one of the only hemorrhagic fever viruses that has multiple candidate vaccines and therapeutics. Here, we demonstrate that serially passaging liver homogenates from MARV-infected severe combined immunodeficient (scid mice was highly successful in reducing the time to death in scid mice from 50–70 days to 7–10 days after MARV-Ci67, -Musoke, or -Ravn challenge. We performed serial sampling studies to characterize the pathology of these scid mouse-adapted MARV strains. These scid mouse-adapted MARV models appear to have many similar properties as the MARV models previously developed in guinea pigs and nonhuman primates. Also, as shown here, the scid-adapted MARV mouse models can be used to evaluate the efficacy of candidate antiviral therapeutic molecules, such as phosphorodiamidate morpholino oligomers or antibodies.

  7. AcEST: BP913599 [AcEST

    Lifescience Database Archive (English)

    Full Text Available VGP_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) ...s) Value sp|Q6UY66|VGP_MABVO Envelope glycoprotein OS=Lake Victoria marbu... 31 2...P_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) GN

  8. A prophylactic multivalent vaccine against different filovirus species is immunogenic and provides protection from lethal infections with Ebolavirus and Marburgvirus species in non-human primates.

    Directory of Open Access Journals (Sweden)

    Benoit Callendret

    Full Text Available The search for a universal filovirus vaccine that provides protection against multiple filovirus species has been prompted by sporadic but highly lethal outbreaks of Ebolavirus and Marburgvirus infections. A good prophylactic vaccine should be able to provide protection to all known filovirus species and as an upside potentially protect from newly emerging virus strains. We investigated the immunogenicity and protection elicited by multivalent vaccines expressing glycoproteins (GP from Ebola virus (EBOV, Sudan virus (SUDV, Taï Forest virus (TAFV and Marburg virus (MARV. Immune responses against filovirus GP have been associated with protection from disease. The GP antigens were expressed by adenovirus serotypes 26 and 35 (Ad26 and Ad35 and modified Vaccinia virus Ankara (MVA vectors, all selected for their strong immunogenicity and good safety profile. Using fully lethal NHP intramuscular challenge models, we assessed different vaccination regimens for immunogenicity and protection from filovirus disease. Heterologous multivalent Ad26-Ad35 prime-boost vaccination regimens could give full protection against MARV (range 75%-100% protection and EBOV (range 50% to 100% challenge, and partial protection (75% against SUDV challenge. Heterologous multivalent Ad26-MVA prime-boost immunization gave full protection against EBOV challenge in a small cohort study. The use of such multivalent vaccines did not show overt immune interference in comparison with monovalent vaccines. Multivalent vaccines induced GP-specific antibody responses and cellular IFNγ responses to each GP expressed by the vaccine, and cross-reactivity to TAFV GP was detected in a trivalent vaccine expressing GP from EBOV, SUDV and MARV. In the EBOV challenge studies, higher humoral EBOV GP-specific immune responses (p = 0.0004 were associated with survival from EBOV challenge and less so for cellular immune responses (p = 0.0320. These results demonstrate that it is feasible to

  9. A prophylactic multivalent vaccine against different filovirus species is immunogenic and provides protection from lethal infections with Ebolavirus and Marburgvirus species in non-human primates.

    Science.gov (United States)

    Callendret, Benoit; Vellinga, Jort; Wunderlich, Kerstin; Rodriguez, Ariane; Steigerwald, Robin; Dirmeier, Ulrike; Cheminay, Cedric; Volkmann, Ariane; Brasel, Trevor; Carrion, Ricardo; Giavedoni, Luis D; Patterson, Jean L; Mire, Chad E; Geisbert, Thomas W; Hooper, Jay W; Weijtens, Mo; Hartkoorn-Pasma, Jutta; Custers, Jerome; Grazia Pau, Maria; Schuitemaker, Hanneke; Zahn, Roland

    2018-01-01

    The search for a universal filovirus vaccine that provides protection against multiple filovirus species has been prompted by sporadic but highly lethal outbreaks of Ebolavirus and Marburgvirus infections. A good prophylactic vaccine should be able to provide protection to all known filovirus species and as an upside potentially protect from newly emerging virus strains. We investigated the immunogenicity and protection elicited by multivalent vaccines expressing glycoproteins (GP) from Ebola virus (EBOV), Sudan virus (SUDV), Taï Forest virus (TAFV) and Marburg virus (MARV). Immune responses against filovirus GP have been associated with protection from disease. The GP antigens were expressed by adenovirus serotypes 26 and 35 (Ad26 and Ad35) and modified Vaccinia virus Ankara (MVA) vectors, all selected for their strong immunogenicity and good safety profile. Using fully lethal NHP intramuscular challenge models, we assessed different vaccination regimens for immunogenicity and protection from filovirus disease. Heterologous multivalent Ad26-Ad35 prime-boost vaccination regimens could give full protection against MARV (range 75%-100% protection) and EBOV (range 50% to 100%) challenge, and partial protection (75%) against SUDV challenge. Heterologous multivalent Ad26-MVA prime-boost immunization gave full protection against EBOV challenge in a small cohort study. The use of such multivalent vaccines did not show overt immune interference in comparison with monovalent vaccines. Multivalent vaccines induced GP-specific antibody responses and cellular IFNγ responses to each GP expressed by the vaccine, and cross-reactivity to TAFV GP was detected in a trivalent vaccine expressing GP from EBOV, SUDV and MARV. In the EBOV challenge studies, higher humoral EBOV GP-specific immune responses (p = 0.0004) were associated with survival from EBOV challenge and less so for cellular immune responses (p = 0.0320). These results demonstrate that it is feasible to generate a

  10. Molecular architecture of the nucleoprotein C-terminal domain from the Ebola and Marburg viruses.

    Science.gov (United States)

    Baker, Laura E; Ellena, Jeffrey F; Handing, Katarzyna B; Derewenda, Urszula; Utepbergenov, Darkhan; Engel, Daniel A; Derewenda, Zygmunt S

    2016-01-01

    The Filoviridae family of negative-sense, single-stranded RNA (ssRNA) viruses is comprised of two species of Marburgvirus (MARV and RAVV) and five species of Ebolavirus, i.e. Zaire (EBOV), Reston (RESTV), Sudan (SUDV), Taï Forest (TAFV) and Bundibugyo (BDBV). In each of these viruses the ssRNA encodes seven distinct proteins. One of them, the nucleoprotein (NP), is the most abundant viral protein in the infected cell and within the viral nucleocapsid. It is tightly associated with the viral RNA in the nucleocapsid, and during the lifecycle of the virus is essential for transcription, RNA replication, genome packaging and nucleocapsid assembly prior to membrane encapsulation. The structure of the unique C-terminal globular domain of the NP from EBOV has recently been determined and shown to be structurally unrelated to any other known protein [Dziubańska et al. (2014), Acta Cryst. D70, 2420-2429]. In this paper, a study of the C-terminal domains from the NP from the remaining four species of Ebolavirus, as well as from the MARV strain of Marburgvirus, is reported. As expected, the crystal structures of the BDBV and TAFV proteins show high structural similarity to that from EBOV, while the MARV protein behaves like a molten globule with a core residual structure that is significantly different from that of the EBOV protein.

  11. AcEST: DK961456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 74EF isoform B OS... 32 4.1 sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria...S VT Sbjct: 62 SPVT 65 >sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Muso

  12. Recombinant vesicular stomatitis virus vaccine vectors expressing filovirus glycoproteins lack neurovirulence in nonhuman primates.

    Directory of Open Access Journals (Sweden)

    Chad E Mire

    Full Text Available The filoviruses, Marburg virus and Ebola virus, cause severe hemorrhagic fever with high mortality in humans and nonhuman primates. Among the most promising filovirus vaccines under development is a system based on recombinant vesicular stomatitis virus (rVSV that expresses an individual filovirus glycoprotein (GP in place of the VSV glycoprotein (G. The main concern with all replication-competent vaccines, including the rVSV filovirus GP vectors, is their safety. To address this concern, we performed a neurovirulence study using 21 cynomolgus macaques where the vaccines were administered intrathalamically. Seven animals received a rVSV vector expressing the Zaire ebolavirus (ZEBOV GP; seven animals received a rVSV vector expressing the Lake Victoria marburgvirus (MARV GP; three animals received rVSV-wild type (wt vector, and four animals received vehicle control. Two of three animals given rVSV-wt showed severe neurological symptoms whereas animals receiving vehicle control, rVSV-ZEBOV-GP, or rVSV-MARV-GP did not develop these symptoms. Histological analysis revealed major lesions in neural tissues of all three rVSV-wt animals; however, no significant lesions were observed in any animals from the filovirus vaccine or vehicle control groups. These data strongly suggest that rVSV filovirus GP vaccine vectors lack the neurovirulence properties associated with the rVSV-wt parent vector and support their further development as a vaccine platform for human use.

  13. AcEST: BP918808 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ge structural protein OS=Lake Victoria marb... 30 6.5 sp|P14745|CD44_PAPHA CD44 antigen OS=Papio hamadryas G...5262|L_MABVP Large structural protein OS=Lake Victoria marburgvirus (strain Popp-

  14. Recommendations relative to the scientific missions of a Mars Automated Roving Vehicle (MARV)

    Science.gov (United States)

    Spencer, R. L. (Editor)

    1973-01-01

    Scientific objectives of the MARV mission are outlined and specific science systems requirements and experimental payloads defined. All aspects of the Martian surface relative to biotic and geologic elements and those relating to geophysical and geochemical properties are explored.

  15. Dicty_cDB: Contig-U14564-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Pseudomonas fluorescens SBW25 c... 32 9.8 DQ447651_7( DQ447651 |pid:none) Lake Victoria marburgv...uschii clone CDS3047 al... 32 9.8 DQ447650_7( DQ447650 |pid:none) Lake Victoria marburgvirus - DRC19... 32 9

  16. Risk Factors Associated with Ebola and Marburg Viruses Seroprevalence in Blood Donors in the Republic of Congo.

    Directory of Open Access Journals (Sweden)

    Nanikaly Moyen

    Full Text Available Ebola and Marburg viruses (family Filoviridae, genera Ebolavirus and Marburgvirus cause haemorrhagic fevers in humans, often associated with high mortality rates. The presence of antibodies to Ebola virus (EBOV and Marburg virus (MARV has been reported in some African countries in individuals without a history of haemorrhagic fever. In this study, we present a MARV and EBOV seroprevalence study conducted amongst blood donors in the Republic of Congo and the analysis of risk factors for contact with EBOV.In 2011, we conducted a MARV and EBOV seroprevalence study amongst 809 blood donors recruited in rural (75; 9.3% and urban (734; 90.7% areas of the Republic of Congo. Serum titres of IgG antibodies to MARV and EBOV were assessed by indirect double-immunofluorescence microscopy. MARV seroprevalence was 0.5% (4 in 809 without any identified risk factors. Prevalence of IgG to EBOV was 2.5%, peaking at 4% in rural areas and in Pointe Noire. Independent risk factors identified by multivariate analysis were contact with bats and exposure to birds.This MARV and EBOV serological survey performed in the Republic of Congo identifies a probable role for environmental determinants of exposure to EBOV. It highlights the requirement for extending our understanding of the ecological and epidemiological risk of bats (previously identified as a potential ecological reservoir and birds as vectors of EBOV to humans, and characterising the protection potentially afforded by EBOV-specific antibodies as detected in blood donors.

  17. AcEST: BP921491 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 32 3.4 sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marb... 30 9.8 >sp|Q56A10|ZN608_MOUSE Z...e structural protein OS=Lake Victoria marburgvirus (strain Ravn-87) GN=L PE=3 SV=1 Length = 2327 Score = 30.

  18. Structural basis for Marburg virus VP35-mediated immune evasion mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Ramanan, Parameshwaran; Edwards, Megan R.; Shabman, Reed S.; Leung, Daisy W.; Endlich-Frazier, Ariel C.; Borek, Dominika M.; Otwinowski, Zbyszek; Liu, Gai; Huh, Juyoung; Basler, Christopher F.; Amarasinghe, Gaya K. [Sinai; (WU-MED); (UTSMC)

    2013-07-22

    Filoviruses, marburgvirus (MARV) and ebolavirus (EBOV), are causative agents of highly lethal hemorrhagic fever in humans. MARV and EBOV share a common genome organization but show important differences in replication complex formation, cell entry, host tropism, transcriptional regulation, and immune evasion. Multifunctional filoviral viral protein (VP) 35 proteins inhibit innate immune responses. Recent studies suggest double-stranded (ds)RNA sequestration is a potential mechanism that allows EBOV VP35 to antagonize retinoic-acid inducible gene-I (RIG-I) like receptors (RLRs) that are activated by viral pathogen–associated molecular patterns (PAMPs), such as double-strandedness and dsRNA blunt ends. Here, we show that MARV VP35 can inhibit IFN production at multiple steps in the signaling pathways downstream of RLRs. The crystal structure of MARV VP35 IID in complex with 18-bp dsRNA reveals that despite the similar protein fold as EBOV VP35 IID, MARV VP35 IID interacts with the dsRNA backbone and not with blunt ends. Functional studies show that MARV VP35 can inhibit dsRNA-dependent RLR activation and interferon (IFN) regulatory factor 3 (IRF3) phosphorylation by IFN kinases TRAF family member-associated NFkb activator (TANK) binding kinase-1 (TBK-1) and IFN kB kinase e (IKKe) in cell-based studies. We also show that MARV VP35 can only inhibit RIG-I and melanoma differentiation associated gene 5 (MDA5) activation by double strandedness of RNA PAMPs (coating backbone) but is unable to inhibit activation of RLRs by dsRNA blunt ends (end capping). In contrast, EBOV VP35 can inhibit activation by both PAMPs. Insights on differential PAMP recognition and inhibition of IFN induction by a similar filoviral VP35 fold, as shown here, reveal the structural and functional plasticity of a highly conserved virulence factor.

  19. A small nonhuman primate model for filovirus-induced disease.

    Science.gov (United States)

    Carrion, Ricardo; Ro, Youngtae; Hoosien, Kareema; Ticer, Anysha; Brasky, Kathy; de la Garza, Melissa; Mansfield, Keith; Patterson, Jean L

    2011-11-25

    Ebolavirus and Marburgvirus are members of the filovirus family and induce a fatal hemorrhagic disease in humans and nonhuman primates with 90% case fatality. To develop a small nonhuman primate model for filovirus disease, common marmosets (Callithrix jacchus) were intramuscularly inoculated with wild type Marburgvirus Musoke or Ebolavirus Zaire. The infection resulted in a systemic fatal disease with clinical and morphological features closely resembling human infection. Animals experienced weight loss, fever, high virus titers in tissue, thrombocytopenia, neutrophilia, high liver transaminases and phosphatases and disseminated intravascular coagulation. Evidence of a severe disseminated viral infection characterized principally by multifocal to coalescing hepatic necrosis was seen in EBOV animals. MARV-infected animals displayed only moderate fibrin deposition in the spleen. Lymphoid necrosis and lymphocytic depletion observed in spleen. These findings provide support for the use of the common marmoset as a small nonhuman primate model for filovirus induced hemorrhagic fever. Copyright © 2011 Elsevier Inc. All rights reserved.

  20. Experimental Inoculation of Egyptian Rousette Bats (Rousettus aegyptiacus with Viruses of the Ebolavirus and Marburgvirus Genera

    Directory of Open Access Journals (Sweden)

    Megan E.B. Jones

    2015-06-01

    Full Text Available The Egyptian rousette bat (Rousettus aegyptiacus is a natural reservoir for marburgviruses and a consistent source of virus spillover to humans. Cumulative evidence suggests various bat species may also transmit ebolaviruses. We investigated the susceptibility of Egyptian rousettes to each of the five known ebolaviruses (Sudan, Ebola, Bundibugyo, Taï Forest, and Reston, and compared findings with Marburg virus. In a pilot study, groups of four juvenile bats were inoculated with one of the ebolaviruses or Marburg virus. In ebolavirus groups, viral RNA tissue distribution was limited, and no bat became viremic. Sudan viral RNA was slightly more widespread, spurring a second, 15-day Sudan virus serial euthanasia study. Low levels of Sudan viral RNA disseminated to multiple tissues at early time points, but there was no viremia or shedding. In contrast, Marburg virus RNA was widely disseminated, with viremia, oral and rectal shedding, and antigen in spleen and liver. This is the first experimental infection study comparing tissue tropism, viral shedding, and clinical and pathologic effects of six different filoviruses in the Egyptian rousette, a known marburgvirus reservoir. Our results suggest Egyptian rousettes are unlikely sources for ebolaviruses in nature, and support a possible single filovirus—single reservoir host relationship.

  1. AcEST: DK949817 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Drosophila melanogast... 34 0.58 sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria... m... 33 0.99 sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria m... 33 1.7 s... 32 3.8 sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 31 4.... 3956 >sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria marburgvirus (strain Popp-67) GN=VP30 ... NHH R+ ++T Sbjct: 11 RNHQTASSIYHETQLPSKPHYTNHHPRARSMSST 44 >sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria

  2. Comparison of the Pathogenesis of the Angola and Ravn Strains of Marburg Virus in the Outbred Guinea Pig Model.

    Science.gov (United States)

    Cross, Robert W; Fenton, Karla A; Geisbert, Joan B; Ebihara, Hideki; Mire, Chad E; Geisbert, Thomas W

    2015-10-01

    Phylogenetic comparisons of known Marburg virus (MARV) strains reveal 2 distinct genetic lineages: Ravn and the Lake Victoria Marburg complex (eg, Musoke, Popp, and Angola strains). Nucleotide variances of >20% between Ravn and other MARV genomes suggest that differing virulence between lineages may accompany this genetic divergence. To date, there exists limited systematic experimental evidence of pathogenic differences between MARV strains. Uniformly lethal outbred guinea pig models of MARV-Angola (MARV-Ang) and MARV-Ravn (MARV-Rav) were developed by serial adaptation. Changes in genomic sequence, weight, temperature, histopathologic findings, immunohistochemical findings, hematologic profiles, circulating biochemical enzyme levels, coagulation parameters, viremia levels, cytokine levels, eicanosoid levels, and nitric oxide production were compared between strains. MARV-Rav infection resulted in delayed increases in circulating inflammatory and prothrombotic elements, notably lower viremia levels, less severe histologic alterations, and a delay in mean time to death, compared with MARV-Ang infection. Both strains produced more marked coagulation abnormalities than previously seen in MARV-infected mice or inbred guinea pigs. Although both strains exhibit great similarity to pathogenic markers of human and nonhuman primate MARV infection, these data highlight several key differences in pathogenicity that may serve to guide the choice of strain and model used for development of vaccines or therapeutics for Marburg hemorrhagic fever. Published by Oxford University Press on behalf of the Infectious Diseases Society of America 2015. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  3. AcEST: DK961333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q1PDC9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|Q6UY68|VP35_MABVO Polymerase cofactor VP35 OS=Lake Vict...oria m... 32 3.9 sp|P35259|VP35_MABVM Polymerase cofactor VP35 OS=Lake Victoria m...... 32 3.9 sp|Q1PD52|VP35_MABVA Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|O54898|CAC1G_RAT Volt...dependent T-type calcium channel s... 32 5.1 sp|Q03039|VP35_MABVP Polymerase cofactor VP35 OS=Lake Victoria ...C9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria marburgvirus (strain Ravn-87) GN=VP35 PE=3 SV=1 Leng

  4. Filoviral Immune Evasion Mechanisms

    Directory of Open Access Journals (Sweden)

    Christopher F. Basler

    2011-09-01

    Full Text Available The Filoviridae family of viruses, which includes the genera Ebolavirus (EBOV and Marburgvirus (MARV, causes severe and often times lethal hemorrhagic fever in humans. Filoviral infections are associated with ineffective innate antiviral responses as a result of virally encoded immune antagonists, which render the host incapable of mounting effective innate or adaptive immune responses. The Type I interferon (IFN response is critical for establishing an antiviral state in the host cell and subsequent activation of the adaptive immune responses. Several filoviral encoded components target Type I IFN responses, and this innate immune suppression is important for viral replication and pathogenesis. For example, EBOV VP35 inhibits the phosphorylation of IRF-3/7 by the TBK-1/IKKε kinases in addition to sequestering viral RNA from detection by RIG-I like receptors. MARV VP40 inhibits STAT1/2 phosphorylation by inhibiting the JAK family kinases. EBOV VP24 inhibits nuclear translocation of activated STAT1 by karyopherin-α. The examples also represent distinct mechanisms utilized by filoviral proteins in order to counter immune responses, which results in limited IFN-α/β production and downstream signaling.

  5. Dose Response of MARV/Angola Infection in Cynomolgus Macaques following IM or Aerosol Exposure

    Science.gov (United States)

    Johnston, Sara C.; Lin, Kenny L.; Twenhafel, Nancy A.; Raymond, Jo Lynne W.; Shamblin, Joshua D.; Wollen, Suzanne E.; Wlazlowski, Carly B.; Wilkinson, Eric R.; Botto, Miriam A.; Goff, Arthur J.

    2015-01-01

    Marburg virus infection in humans causes a hemorrhagic disease with a high case fatality rate. Countermeasure development requires the use of well-characterized animal models that mimic human disease. To further characterize the cynomolgus macaque model of MARV/Angola, two independent dose response studies were performed using the intramuscular or aerosol routes of exposure. All animals succumbed at the lowest target dose; therefore, a dose effect could not be determined. For intramuscular-exposed animals, 100 PFU was the first target dose that was not significantly different than higher target doses in terms of time to disposition, clinical pathology, and histopathology. Although a significant difference was not observed between aerosol-exposed animals in the 10 PFU and 100 PFU target dose groups, 100 PFU was determined to be the lowest target dose that could be consistently obtained and accurately titrated in aerosol studies. PMID:26413900

  6. Dose Response of MARV/Angola Infection in Cynomolgus Macaques following IM or Aerosol Exposure.

    Directory of Open Access Journals (Sweden)

    Sara C Johnston

    Full Text Available Marburg virus infection in humans causes a hemorrhagic disease with a high case fatality rate. Countermeasure development requires the use of well-characterized animal models that mimic human disease. To further characterize the cynomolgus macaque model of MARV/Angola, two independent dose response studies were performed using the intramuscular or aerosol routes of exposure. All animals succumbed at the lowest target dose; therefore, a dose effect could not be determined. For intramuscular-exposed animals, 100 PFU was the first target dose that was not significantly different than higher target doses in terms of time to disposition, clinical pathology, and histopathology. Although a significant difference was not observed between aerosol-exposed animals in the 10 PFU and 100 PFU target dose groups, 100 PFU was determined to be the lowest target dose that could be consistently obtained and accurately titrated in aerosol studies.

  7. Crystal Structure of the Marburg Virus VP35 Oligomerization Domain

    Energy Technology Data Exchange (ETDEWEB)

    Bruhn, Jessica F.; Kirchdoerfer, Robert N.; Urata, Sarah M.; Li, Sheng; Tickle, Ian J.; Bricogne, Gérard; Saphire, Erica Ollmann (Scripps); (Globel Phasing); (UCSD)

    2016-11-09

    ABSTRACT

    Marburg virus (MARV) is a highly pathogenic filovirus that is classified in a genus distinct from that of Ebola virus (EBOV) (generaMarburgvirusandEbolavirus, respectively). Both viruses produce a multifunctional protein termed VP35, which acts as a polymerase cofactor, a viral protein chaperone, and an antagonist of the innate immune response. VP35 contains a central oligomerization domain with a predicted coiled-coil motif. This domain has been shown to be essential for RNA polymerase function. Here we present crystal structures of the MARV VP35 oligomerization domain. These structures and accompanying biophysical characterization suggest that MARV VP35 is a trimer. In contrast, EBOV VP35 is likely a tetramer in solution. Differences in the oligomeric state of this protein may explain mechanistic differences in replication and immune evasion observed for MARV and EBOV.

    IMPORTANCEMarburg virus can cause severe disease, with up to 90% human lethality. Its genome is concise, only producing seven proteins. One of the proteins, VP35, is essential for replication of the viral genome and for evasion of host immune responses. VP35 oligomerizes (self-assembles) in order to function, yet the structure by which it assembles has not been visualized. Here we present two crystal structures of this oligomerization domain. In both structures, three copies of VP35 twist about each other to form a coiled coil. This trimeric assembly is in contrast to tetrameric predictions for VP35 of Ebola virus and to known structures of homologous proteins in the measles, mumps, and Nipah viruses. Distinct oligomeric states of the Marburg and Ebola virus VP35 proteins may explain differences between them in polymerase function and immune evasion. These findings may provide a more accurate understanding of the

  8. As Necrópoles alto-medievais da Serra de São Mamede (Concelhos de Castelo de Vide e Marvão)

    OpenAIRE

    Prata, Sara Maria Sena Esteves

    2012-01-01

    Dissertação apresentada para cumprimento dos requisitos necessários à obtenção do grau de Mestre em Arqueologia A presente dissertação trata questões da Arqueologia funerária para as necrópoles alto-medievais identificadas na Serra de São Mamede (Concelhos de Castelo de Vide e Marvão). Para esta área geográfica, a escassez de fontes escritas, associada ao parco conhecimento sobre as realidades arqueológicas, coloca os séculos que sucederam a queda da Império Romano no Ocidente e anteced...

  9. Recent plant studies using Victoria 2.0

    International Nuclear Information System (INIS)

    Bixler, Nathan E.; Gasser, Ronald D.

    2000-01-01

    VICTORIA 2.0 is a mechanistic computer code designed to analyze fission product behavior within the reactor coolant system (RCS) during a severe nuclear reactor accident. It provides detailed predictions of the release of radioactive and nonradioactive materials from the reactor core and transport and deposition of these materials within the RCS and secondary circuits. These predictions account for the chemical and aerosol processes that affect radionuclide behavior. VICTORIA 2.0 was released in early 1999; a new version VICTORIA 2.1, is now under development. The largest improvements in VICTORIA 2.1 are connected with the thermochemical database, which is being revised and expanded following the recommendations of a peer review. Three risk-significant severe accident sequences have recently been investigated using the VICTORIA 2.0 code. The focus here is on how various chemistry options affect the predictions. Additionally, the VICTORIA predictions are compared with ones made using the MELCOR code. The three sequences are a station blackout in a GE BWR and steam generator tube rupture (SGTR) and pump-seal LOCA sequences in a 3-loop Westinghouse PWR. These sequences cover a range of system pressures, from fully depressurized to full system pressure. The chief results of this study are the fission product fractions that are retained in the core, RCS, secondary, and containment and the fractions that are released into the environment

  10. victoria cross awards warrants concerning the victoria cross (1920)

    African Journals Online (AJOL)

    1. WARRANTS CONCERNING THE. VICTORIA CROSS (1920). In order to get a picture of the Royal Warrants promulgated from 1856 to 1920 in respect of the .... to confirmation by us. Eighthly. - It is ordained, where such an act shall not have been performed in the sight of a commanding officer as aforesaid, then the ...

  11. VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan

    Science.gov (United States)

    2014-06-01

    1472G. VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan and Preliminary Results © Her Majesty the Queen in Right of...19 th International Command and Control Research and Technology Symposium Title: VICTORIA Class Submarine Human-in-the-Loop...TYPE 3. DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan 5a. CONTRACT

  12. Hemofilie onder die nasate van koningin Victoria

    Directory of Open Access Journals (Sweden)

    Francois P. Retief

    2013-03-01

    Full Text Available Hierdie studie bespreek die uitwerking van die sogenaamde Victoriaanse hemofilie op Europese koningshuise gedurende die negentiende en twintigste eeu. Hemofilie as molekulêre defek word verduidelik en die kliniese beeld van die siekte word aangedui. ’n Bespreking van toepaslike terapeutiese ingrepe volg. Dan word ’n historiese oorsig verskaf van die verspreiding van Victoriaanse hemofilie vanaf koningin Victoria (Britse monarg, 1837–1901 via sommige van haar dogters na ander lede van die Britse koningshuis en ook na die Duitse, Russiese en Spaanse koningshuise. Elf bevestigde gevalle van hemofilie onder lede van koningin Victoria se nageslag word vermeld, asook drie ander moontlike gevalle van die siekte. Die effek van hemofilie op die verloop van die geskiedenis word ook ondersoek.Haemophilia amongst the descendants of Queen Victoria. This study discusses the impact of ‘Victorian haemophilia’ on the royal houses of Europe during the 19th and 20th centuries. Haemophilia as a molecular defect is explained and the clinical picture of the condition is indicated. Applicable therapeutic interventions also receive attention. Next, an historical review is provided of how ‘Victorian haemophilia’ spread from Queen Victoria (British monarch, 1837–1901 via some of her daughters to other members of the British royal family and also to the royal houses of Germany, Russia and Spain. Eleven confirmed cases of haemophilia amongst the descendants of Queen Victoria are mentioned, as well as three other possible cases. The effect of haemophilia on the course of history is also investigated.

  13. The diversity of benthic mollusks of Lake Victoria and Lake Burigi ...

    African Journals Online (AJOL)

    Molluscan diversity, abundance and distribution in sediments of Lake Victoria and its satellite lake, Lake Burigi, were investigated. The survey was carried out in January and February 2002 for Lake Victoria and in March and April 2002 for Lake Burigi. Ten genera were recorded from four zones of Lake Victoria while only ...

  14. Has climate change disrupted stratification patterns in Lake Victoria ...

    African Journals Online (AJOL)

    Has climate change disrupted stratification patterns in Lake Victoria, East Africa? ... Climate change may threaten the fisheries of Lake Victoria by increasing density differentials in the water column, thereby strengthening stratification and increasing the ... Keywords: deoxygenation, fisheries, global warming, thermocline

  15. Early warnings of hazardous thunderstorms over Lake Victoria

    Science.gov (United States)

    Thiery, Wim; Gudmundsson, Lukas; Bedka, Kristopher; Semazzi, Fredrick H. M.; Lhermitte, Stef; Willems, Patrick; van Lipzig, Nicole P. M.; Seneviratne, Sonia I.

    2017-07-01

    Weather extremes have harmful impacts on communities around Lake Victoria in East Africa. Every year, intense nighttime thunderstorms cause numerous boating accidents on the lake, resulting in thousands of deaths among fishermen. Operational storm warning systems are therefore crucial. Here we complement ongoing early warning efforts based on numerical weather prediction, by presenting a new satellite data-driven storm prediction system, the prototype Lake Victoria Intense storm Early Warning System (VIEWS). VIEWS derives predictability from the correlation between afternoon land storm activity and nighttime storm intensity on Lake Victoria, and relies on logistic regression techniques to forecast extreme thunderstorms from satellite observations. Evaluation of the statistical model reveals that predictive power is high and independent of the type of input dataset. We then optimise the configuration and show that false alarms also contain valuable information. Our results suggest that regression-based models that are motivated through process understanding have the potential to reduce the vulnerability of local fishing communities around Lake Victoria. The experimental prediction system is publicly available under the MIT licence at http://github.com/wthiery/VIEWS.

  16. Adaptive responses to environmental changes in Lake Victoria cichlids

    NARCIS (Netherlands)

    Rijssel, Jacobus Cornelis van (Jacco)

    2014-01-01

    Lake Victoria cichlids show the fastest vertebrate adaptive radiation known which is why they function as a model organism to study evolution. In the past 40 years, Lake Victoria experienced severe environmental changes including the boom of the introduced, predatory Nile perch and eutrophication.

  17. Victoria Law School Ten Years On—A Time to Pause and Reflect

    OpenAIRE

    Andrew Clarke

    2013-01-01

    On 4 November 2010, a large and distinguished audience assembled at the Queen Street Campus of Victoria University to celebrate the tenth anniversary of the founding of Victoria Law School. This Foreword records the diverse achievements of Victoria Law School over the past decade.

  18. Victoria Law School Ten Years On—A Time to Pause and Reflect

    Directory of Open Access Journals (Sweden)

    Andrew Clarke

    2013-11-01

    Full Text Available On 4 November 2010, a large and distinguished audience assembled at the Queen Street Campus of Victoria University to celebrate the tenth anniversary of the founding of Victoria Law School. This Foreword records the diverse achievements of Victoria Law School over the past decade.

  19. The Bands Culture in Victoria, Australia: Live Music Benefits Career Paths, Employment and Community

    Science.gov (United States)

    Watson, Amanda; Forrest, David

    2012-01-01

    This study explores the career paths, employment, business opportunities and community contributions made available through the provision and development of the contemporary performance bands' culture in the State of Victoria. It is framed with the support given to live music performers by Arts Victoria, Small Business Victoria and Music Victoria.…

  20. Pancam Peek into 'Victoria Crater' (Stereo)

    Science.gov (United States)

    2006-01-01

    [figure removed for brevity, see original site] Left-eye view of a stereo pair for PIA08776 [figure removed for brevity, see original site] Right-eye view of a stereo pair for PIA08776 A drive of about 60 meters (about 200 feet) on the 943rd Martian day, or sol, of Opportunity's exploration of Mars' Meridiani Planum region (Sept. 18, 2006) brought the NASA rover to within about 50 meters (about 160 feet) of the rim of 'Victoria Crater.' This crater has been the mission's long-term destination for the past 21 Earth months. Opportunity reached a location from which the cameras on top of the rover's mast could begin to see into the interior of Victoria. This stereo anaglyph was made from frames taken on sol 943 by the panoramic camera (Pancam) to offer a three-dimensional view when seen through red-blue glasses. It shows the upper portion of interior crater walls facing toward Opportunity from up to about 850 meters (half a mile) away. The amount of vertical relief visible at the top of the interior walls from this angle is about 15 meters (about 50 feet). The exposures were taken through a Pancam filter selecting wavelengths centered on 750 nanometers. Victoria Crater is about five times wider than 'Endurance Crater,' which Opportunity spent six months examining in 2004, and about 40 times wider than 'Eagle Crater,' where Opportunity first landed. The great lure of Victoria is the expectation that a thick stack of geological layers will be exposed in the crater walls, potentially several times the thickness that was previously studied at Endurance and therefore, potentially preserving several times the historical record.

  1. Causes and effects of the Lake Victoria ecological revolution

    NARCIS (Netherlands)

    Goudswaard, Pleun Cornelis

    2006-01-01

    Nile perch was introduced in Lake Victoria in the 1950s and exploded in number during the 1980s. The process of colonization of the lake by this predatory fish is described and explained. The changes in a number of other fauna elements of Lake Victoria are described and explained. Not only Nile

  2. Funding Victoria's public hospitals: the casemix policy of 2000-2001.

    Science.gov (United States)

    McNair, Peter; Duckett, Stephen

    2002-01-01

    On 1 July 1993 Victoria became the first Australian state to use casemix information to set budgets for its public hospitals commencing with casemix funding for inpatient services. Victoria's casemix funding approach now embraces inpatient, outpatient and rehabilitation services.

  3. Victoria suudlus teeb maapoisist printsi, kuid mitte tulevase kuninga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Printsess Victoria tulevasest abikaasast Daniel Westlingist, printsess Madelaine'i kihluse lõpetamisest, Bernadotte'ide dünastia asutajast Jean Bernadotte'ist. Monarhia toetajate vähenemisest Rootsis. Printsess Victoria ja Daniel Westlingi pulmatseremooniast 19. juunil

  4. Coal Corporation of Victoria annual report 1986

    Energy Technology Data Exchange (ETDEWEB)

    1986-01-01

    Information is presented on operations, strategic planning, brown coal production and finance. Divisional reports are presented for the following divisions of the Coal Corporation of Victoria: marketing, technical marketing and special projects, research and development, and corporate services. The activities of the technical marketing and special projects division are discussed under the following headings: the coal for industry programme, the Brown Coal Liquefaction (Victoria) Pty. Ltd. project, dried brown coal activities, and resource development planning and policy activities. The corporation is currently conducting research into the following areas: ion exchange materials, activated carbons, and horticultural and agricultural applications of brown coal.

  5. Late-life depression and the death of Queen Victoria.

    Science.gov (United States)

    Abrams, Robert C

    2010-12-01

    The objective of this study was to evaluate relationships between the death of Queen Victoria and the depressive episode she experienced during the last year of her life. The last volume of Queen Victoria's personal Journal was reviewed from a geriatrician's perspective, tracing the onset and course of depressive symptoms from entries beginning on 17 August 1900 and ending on 13 January 1901, 9 days before her death. The Queen's own words are supplemented with observations from contemporaneous secondary sources. The antecedents of Queen Victoria's late-life depression, including multiple losses, disabilities, and chronic pain, taken together with the presentation of vegetative, affective, and late cognitive symptoms, suggested the presence of a distinctively geriatric major depressive disorder. The absence of any other medical condition to explain the clinical picture seemed probable but not certain. Although historians and biographers have long been aware of Queen Victoria's final depression, the emphasis has mostly been on her earlier and prolonged mourning for her husband Prince Albert. Re-examined now, the Queen's Journal suggests that a severe late-life depressive episode occurring approximately in her last 5 months contributed meaningfully to her death. Copyright © 2010 John Wiley & Sons, Ltd.

  6. VICTORIA PARK: A DEMOCTRATIC PUBLIC OPEN SPACE FOR INDONESIA DOMESTIC HELPERS (TKW

    Directory of Open Access Journals (Sweden)

    Parmonangan Manurung

    2016-01-01

    Full Text Available Victoria Park is the largest city park in Hong Kong. This city park is not only known in Hong Kong, but also very well known in Indonesia as a gathering place for Indonesia domestic helpers (TKW in Hong Kong. This research tried to find out some determinant factors that have been affected the public open spac of Victoria Park to be a gathering place for thousands of TKW in Sunday and holidays as their day off. In order to get the results of research, some methodological research had been conducted such as: observation (survey, mapping, interviews and literature studies. The results showed that Victoria Park has a number of factors capable of meeting the needs of domestic help-ers in Hong Kong, these factors consist of internal factors and external factors. Internally, the character and functions held Victoria Park became a very influential factor, while externally, the accessibility and support functions around Victoria Park also has a considerable influence.

  7. Prokaryotic Abundance and Activity in Permafrost of the Northern Victoria Land and Upper Victoria Valley (Antarctica).

    Science.gov (United States)

    La Ferla, Rosabruna; Azzaro, Maurizio; Michaud, Luigi; Caruso, Gabriella; Lo Giudice, Angelina; Paranhos, Rodolfo; Cabral, Anderson S; Conte, Antonella; Cosenza, Alessandro; Maimone, Giovanna; Papale, Maria; Rappazzo, Alessandro Ciro; Guglielmin, Mauro

    2017-08-01

    Victoria Land permafrost harbours a potentially large pool of cold-affected microorganisms whose metabolic potential still remains underestimated. Three cores (BC-1, BC-2 and BC-3) drilled at different depths in Boulder Clay (Northern Victoria Land) and one sample (DY) collected from a core in the Dry Valleys (Upper Victoria Valley) were analysed to assess the prokaryotic abundance, viability, physiological profiles and potential metabolic rates. The cores drilled at Boulder Clay were a template of different ecological conditions (different temperature regime, ice content, exchanges with atmosphere and with liquid water) in the same small basin while the Dry Valleys site was very similar to BC-2 conditions but with a complete different geological history and ground ice type. Image analysis was adopted to determine cell abundance, size and shape as well as to quantify the potential viable and respiring cells by live/dead and 5-cyano-2,3-ditolyl-tetrazolium chloride staining, respectively. Subpopulation recognition by apparent nucleic acid contents was obtained by flow cytometry. Moreover, the physiological profiles at community level by Biolog-Ecoplate™ as well as the ectoenzymatic potential rates on proteinaceous (leucine-aminopeptidase) and glucidic (ß-glucosidase) organic matter and on organic phosphates (alkaline-phosphatase) by fluorogenic substrates were tested. The adopted methodological approach gave useful information regarding viability and metabolic performances of microbial community in permafrost. The occurrence of a multifaceted prokaryotic community in the Victoria Land permafrost and a large number of potentially viable and respiring cells (in the order of 10 4 -10 5 ) were recognised. Subpopulations with a different apparent DNA content within the different samples were observed. The physiological profiles stressed various potential metabolic pathways among the samples and intense utilisation rates of polymeric carbon compounds and carbohydrates

  8. Chemistry models in the Victoria code

    International Nuclear Information System (INIS)

    Grimley, A.J. III

    1988-01-01

    The VICTORIA Computer code consists of the fission product release and chemistry models for the MELPROG severe accident analysis code. The chemistry models in VICTORIA are used to treat multi-phase interactions in four separate physical regions: fuel grains, gap/open porosity/clad, coolant/aerosols, and structure surfaces. The physical and chemical environment of each region is very different from the others and different models are required for each. The common thread in the modelling is the use of a chemical equilibrium assumption. The validity of this assumption along with a description of the various physical constraints applicable to each region will be discussed. The models that result from the assumptions and constraints will be presented along with samples of calculations in each region

  9. 3D DIGITAL CADASTRE JOURNEY IN VICTORIA, AUSTRALIA

    Directory of Open Access Journals (Sweden)

    D. Shojaei

    2017-10-01

    Full Text Available Land development processes today have an increasing demand to access three-dimensional (3D spatial information. Complex land development may need to have a 3D model and require some functions which are only possible using 3D data. Accordingly, the Intergovernmental Committee on Surveying and Mapping (ICSM, as a national body in Australia provides leadership, coordination and standards for surveying, mapping and national datasets has developed the Cadastre 2034 strategy in 2014. This strategy has a vision to develop a cadastral system that enables people to readily and confidently identify the location and extent of all rights, restrictions and responsibilities related to land and real property. In 2014, the land authority in the state of Victoria, Australia, namely Land Use Victoria (LUV, has entered the challenging area of designing and implementing a 3D digital cadastre focused on providing more efficient and effective services to the land and property industry. LUV has been following the ICSM 2034 strategy which requires developing various policies, standards, infrastructures, and tools. Over the past three years, LUV has mainly focused on investigating the technical aspect of a 3D digital cadastre. This paper provides an overview of the 3D digital cadastre investigation progress in Victoria and discusses the challenges that the team faced during this journey. It also addresses the future path to develop an integrated 3D digital cadastre in Victoria.

  10. Victoria Land, Ross Sea, and Ross Ice Shelf, Antarctica

    Science.gov (United States)

    2002-01-01

    On December 19, 2001, MODIS acquired data that produced this image of Antarctica's Victoria Land, Ross Ice Shelf, and the Ross Sea. The coastline that runs up and down along the left side of the image denotes where Victoria Land (left) meets the Ross Ice Shelf (right). The Ross Ice Shelf is the world's largest floating body of ice, approximately the same size as France. Credit: Jacques Descloitres, MODIS Land Rapid Response Team, NASA/GSFC

  11. Spiraal : uus Victoria & Alberti muuseum Londonis

    Index Scriptorium Estoniae

    1998-01-01

    Daniel Libeskindi projekt Victoria & Alberti Muuseumi laiendamiseks on põhjustanud konservatiivsete londonlaste pahameele, kuid kutsunud esile ka hulgaliselt toetusavaldusi. Muuseumi uus osa (kokkuvarisemise piiril näiva ehitisena) peaks külastajaile avatama 2004. a.

  12. Informal waste harvesting in Victoria Falls town, Zimbabwe: Socio-economic benefits

    NARCIS (Netherlands)

    Masocha, M.

    2006-01-01

    Waste harvesting, which occurs mostly but not exclusively at open waste dumps in Zimbabwe, constitutes one of the most important survival options for the urban poor. This paper analyses and discusses socio-economic benefits of informal waste harvesters in Victoria Falls town. Victoria Falls town has

  13. Requirements for VICTORIA Class Fire Control System: Contact Management Function

    Science.gov (United States)

    2014-07-01

    Requirements for VICTORIA Class Fire Control System Contact Management Function Tab Lamoureux CAE Integrated Enterprise Solutions...Contract Report DRDC-RDDC-2014-C190 July 2014 © Her Majesty the Queen in Right of Canada, as represented by the...i Abstract …….. The VICTORIA Class Submarines (VCS) are subject to a continuing program of technical upgrades. One such program is

  14. Critical Comments on Brian Victoria's "Engaged Buddhism: Skeleton in the Closet?"

    Directory of Open Access Journals (Sweden)

    Koichi Miyata

    2015-02-01

    Full Text Available In "Engaged Buddhism: A Skeleton in the Closet?" (Vol. 2 Brian Daizen Victoria claims, among other things, that Tsunesaburo Makiguchi (1871-1944, founder of the Soka Kyoiku Gakkai (forebear of the Soka Gakkai and Soka Gakkai International, was an active supporter of the Japanese wars of aggression. In this response, Koichi Miyata argues that Victoria's claims rest on the highly selective use of quotes, and ignore key interpretative issues associated with Japanese imperial fascism and its underlying belief structures. Miyata discusses the significance of Makiguchi's arrest and imprisonment under a law specifically aimed at opponents of the war efforts, in his analysis of critical lapses in Victoria's article.

  15. Stratigraphic architecture of bedrock reference section, Victoria Crater, Meridiani Planum, Mars

    Science.gov (United States)

    Edgar, Lauren A.; Grotzinger, John P.; Hayes, Alex G.; Rubin, David M.; Squyres, Steve W.; Bell, James F.; Herkenhoff, Ken E.

    2012-01-01

    The Mars Exploration Rover Opportunity has investigated bedrock outcrops exposed in several craters at Meridiani Planum, Mars, in an effort to better understand the role of surface processes in its geologic history. Opportunity has recently completed its observations of Victoria crater, which is 750 m in diameter and exposes cliffs up to ~15 m high. The plains surrounding Victoria crater are ~10 m higher in elevation than those surrounding the previously explored Endurance crater, indicating that the Victoria crater exposes a stratigraphically higher section than does the Endurance crater; however, Victoria strata overlap in elevation with the rocks exposed at the Erebus crater. Victoria crater has a well-developed geomorphic pattern of promontories and embayments that define the crater wall and that reveal thick bedsets (3–7m) of large-scale cross-bedding, interpreted as fossil eolian dunes. Opportunity was able to drive into the crater at Duck Bay, located on the western margin of Victoria crater. Data from the Microscopic Imager and Panoramic Camera reveal details about the structures, textures, and depositional and diagenetic events that influenced the Victoria bedrock. A lithostratigraphic subdivision of bedrock units was enabled by the presence of a light-toned band that lines much of the upper rim of the crater. In ascending order, three stratigraphic units are named Lyell, Smith, and Steno; Smith is the light-toned band. In the Reference Section exposed along the ingress path at Duck Bay, Smith is interpreted to represent a zone of diagenetic recrystallization; however, its upper contact also coincides with a primary erosional surface. Elsewhere in the crater the diagenetic band crosscuts the physical stratigraphy. Correlation with strata present at nearby promontory Cape Verde indicates that there is an erosional surface at the base of the cliff face that corresponds to the erosional contact below Steno. The erosional contact at the base of Cape Verde

  16. State Electricity Commission of Victoria. Annual report 1984-1985

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    The State Electricity Commission of Victoria is a body corporate first constituted under the Electricity Commissioner's Act 1918. It now operates under the State Electricity Commission Act 1958. It generates, transmits and distributes electricity throughout Victoria's 228,000 square kilometres and supplies directly to 1.424 million customers. In addition 277,800 customers are supplied by eleven municipal authorities which purchase electricity in bulk from the Commission. The Commission also has a regulatory responsibility to ensure the safe use of electricity. It employs 22,518 people. The installed capacity of generators in the Commission's system, plus Victoria's share of Snowy and Hume generation, totalled 6603 MW at 30 June 1985 and the main transmission system comprises 500 kV, 300 kV and 220 kV lines. Corporate objectives have been developed in seven broad areas: customers,employee, finance, ntural resources, environment, conservationand community. These areas of activity are detailed in this report.

  17. vVICTORIA Console Development: Design and Fabrication of VICTORIA Console Emulations

    Science.gov (United States)

    2011-07-01

    successful set-up and readiness to conduct experimentation on facets of new Combat System concept development including equipment capabilities, system...émulateurs, faits de bois, de plastiques et de métaux légers, ont été fabriqués selon les données matérielles et les spécifications des consoles actuelles...mise sur pied du laboratoire d’évaluation de la capacité vVictoria et assureront que celui-ci est prêt pour les essais de nouveaux concepts de système

  18. Mathematical Problems in Biology : Victoria Conference

    CERN Document Server

    1974-01-01

    A conference on "Some Mathematical Problems in Biology" was held at the University of Victoria, Victoria, B. C. , Canada, from May 7 - 10, 1973. The participants and invited speakers were mathematicians interested in problems of a biological nature, and scientists actively engaged in developing mathematical models in biological fields. One aim of the conference was to attempt to assess what the recent rapid growth of mathematical interaction with the biosciences has accomplished and may accomplish in the near future. The conference also aimed to expose the problems of communication bet~",een mathematicians and biological scientists, and in doing so to stimulate the interchange of ideas. It was recognised that the topic spans an enormous breadth, and little attempt was made to balance the very diverse areas. Widespread active interest was shown in the conference, and just over one hundred people registered. The varied departments and institutions across North America from which the participants came made it bo...

  19. No fixed place of birth: unplanned BBAs in Victoria, Australia.

    Science.gov (United States)

    McLelland, Gayle; McKenna, Lisa; Archer, Frank

    2013-02-01

    the primary objective-to present data on the incidence of unplanned births before arrival (BBAs) in Victoria between 1991 and 2008. The secondary objective-to provide an extensive literature review highlighting the issues surrounding an unplanned BBA. the incidence of BBAs in Victoria published in the relevant government reports. data were extracted from published government reports pertaining to perinatal statistics in Victoria-The Australian Institute of Health and Wellbeing and the Perinatal Data Collection Unit of Victoria. Data on place of birth for each year from both sources was identified and tabulated. Comparisons between the data sources were undertaken to provide a picture of the scope of out of hospital birth. the incidence and absolute numbers of unplanned birth before arrival (BBA) to hospital in Victoria, are low compared to the total births. However, this number is comparable to unplanned BBAs in other developed countries with similar health systems. The incidence of unplanned BBAs has slowly but steadily doubled since 1991-2008. The two data sources almost mirror each other except for 1999 when there was an unexplained difference in the reported incidence in unplanned BBAs. Maternal and neonatal outcomes are disproportionally much poorer after unplanned BBAs than either planned home births or in hospital births. Various maternal factors can increase the risk of an unplanned BBA. multiple approaches should be adopted to manage unplanned BBAs. Antenatal screening should be undertaken to identify the women most at risk. Strategies can be developed that will reduce poor neonatal and maternal outcomes, including education for women and their partners on immediate management of the newborn; ensuring paramedics have current knowledge on care during childbirth; and maternity and ambulance services should develop management plans for care of women having unplanned BBAs. Copyright © 2011 Elsevier Ltd. All rights reserved.

  20. State Electricity Commission of Victoria annual report 1983-1984

    Energy Technology Data Exchange (ETDEWEB)

    1984-01-01

    The State Electricity Commission of Victoria (SECV) generates, transmits and distributes electricity throughout Victoria's 228,000 square kilometres and supplies directly to 1.390 million customers. In addition, 278,500 customers are supplied by eleven municipal authorities which purchase electricity in bulk from the Commission. The Commission also has a responsibility to ensure the safe use of electricity. The Commission's mission statement is 'to provide cost effective energy and services and to act at all times in the best interests of the people of Victoria by being a responsible, adaptive, financially sound and efficient public utility'. The mission statement is the foundation for all activities and should provide the Commission with a sense of direction and unity of purpose. Corporate objectives have been developed in the following seven broad areas: customer, employee, finance, natural resources, environment, conservation and community. Each objective has been translated into a series of specific goals, the achievement of which will be monitored. Details relating to these areas of activity are detailed in this report.

  1. Las pinturas esquemáticas de la Cueva de Victoria (Rincón de la Victoria, Málaga : propuesta interpretativa del friso A

    Directory of Open Access Journals (Sweden)

    Rafael Maura Mijares

    2004-01-01

    Full Text Available Se recoge en este artículo nuestra reciente revisión del conjunto pictórico postpaleolítico de la cueva de la Victoria. A partir de una documentación exhaustiva de los motivos representados y del análisis de su iconografía se proponen hipótesis de carácter interpretativo.In this article we gather the recent revision of the postpalaeolithic pictorial collection in the cave of la Victoria. Starting from an exhaustive documentation of the motifs and the analysis of its iconography, we propose some interpretative hypothesis.

  2. Seabed surveys of Victoria harbour, Mahe, Seychelles

    Digital Repository Service at National Institute of Oceanography (India)

    Hashimi, N.H.; Wagle, B.G.

    The seabed surveys in the Victoria Harbour, Mahe, Seychelles shows that the prominent feature is the navigational channel aligned in the northeast-southwest direction with a width varying from 300 to 450m. The depth in the channel ranges from 14...

  3. The table grape 'Victoria' with a long shaped berry: a potential mutation with attractive characteristics for consumers.

    Science.gov (United States)

    Ferrara, Giuseppe; Gallotta, Alessandra; Pacucci, Carmela; Matarrese, Angela Maria Stella; Mazzeo, Andrea; Giancaspro, Angelica; Gadaleta, Agata; Piazzolla, Francesca; Colelli, Giancarlo

    2017-12-01

    Puglia is the most important region in Italy for table grape production. Since consumers look for new products, the number of table grape varieties has greatly increased in recent years. In a survey in the Puglia region, we identified several years ago a potential mutation of the cv. Victoria. We described this accession in comparison with the standard Victoria for some amphelographic traits. All the characteristics were very similar to the standard Victoria except for the berry shape, which was significantly more elongated. Moreover, the berry of the mutated Victoria showed higher firmness, lightness and chroma than the standard one, with a more intense yellow colour of the skin (appreciated by consumers). The molecular characterisation with 25 SSR markers showed that normal and mutant Victoria were genetically identical at all the analysed loci, thus suggesting that the two accessions could be considered as clones with the difference in berry shape probably due to a somatic mutation. This mutation of the cv. Victoria may have interesting perspective for the market since consumers are always attracted by different shape and colour of the fruits (consumers buy with eyes). This accession can be an alternative clone of the already known standard Victoria. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  4. A once in a generation upgrade to ICT systems used for public transport in Victoria; Umfassende Modernisierung. Neue ICT-Systeme fuer den SPNV in Victoria

    Energy Technology Data Exchange (ETDEWEB)

    Hammerton, Richard [Funkwerk Information Technologies York Ltd., York (United Kingdom)

    2010-07-01

    Funkwerk IT is supplying a state-of-the-art timetable and fleet planning and management system to the Australian State of Victoria. Through its agency, the Department of Transport, Victoria is undertaking a once in a generation upgrade to key ICT systems that are used for operational control of the metropolitan and regional rail networks. The new system requires a tight coupling of both planning and real-time management systems. Using its products TrainPlan, ResourcePlan and ResourceManager Funkwerk IT provides an ideal platform to cover these requirements. (orig.)

  5. Eesti NATO Ühing juurutab demokraatlikke väärtusi / Victoria Punga ; interv. Aive Antsov

    Index Scriptorium Estoniae

    Punga, Victoria, 1977-

    2007-01-01

    Eesti NATO Ühingu tegevjuht organisatsiooni eesmärkidest, projektidest, koostööst teiste riikidega ning kaitsepoliitika ja majanduse seostest. Lisa: Väljavõte Victoria CVst; Eesti kaitsepoliitika viis plussi Victoria meelest

  6. Understanding virtual water flows: A multiregion input-output case study of Victoria

    Science.gov (United States)

    Lenzen, Manfred

    2009-09-01

    This article explains and interprets virtual water flows from the well-established perspective of input-output analysis. Using a case study of the Australian state of Victoria, it demonstrates that input-output analysis can enumerate virtual water flows without systematic and unknown truncation errors, an issue which has been largely absent from the virtual water literature. Whereas a simplified flow analysis from a producer perspective would portray Victoria as a net virtual water importer, enumerating the water embodiments across the full supply chain using input-output analysis shows Victoria as a significant net virtual water exporter. This study has succeeded in informing government policy in Australia, which is an encouraging sign that input-output analysis will be able to contribute much value to other national and international applications.

  7. Formula-Based Public School Funding System in Victoria: An Empirical Analysis of Equity

    Science.gov (United States)

    Bandaranayake, Bandara

    2013-01-01

    This article explores the formula-based school funding system in the state of Victoria, Australia, where state funds are directly allocated to schools based on a range of equity measures. The impact of Victoria' funding system for education in terms of alleviating inequality and disadvantage is contentious, to say the least. It is difficult to…

  8. Probabilistic Seismic Hazard Analysis of Victoria, British Columbia, Canada: Considering an Active Leech River Fault

    Science.gov (United States)

    Kukovica, J.; Molnar, S.; Ghofrani, H.

    2017-12-01

    The Leech River fault is situated on Vancouver Island near the city of Victoria, British Columbia, Canada. The 60km transpressional reverse fault zone runs east to west along the southern tip of Vancouver Island, dividing the lithologic units of Jurassic-Cretaceous Leech River Complex schists to the north and Eocene Metchosin Formation basalts to the south. This fault system poses a considerable hazard due to its proximity to Victoria and 3 major hydroelectric dams. The Canadian seismic hazard model for the 2015 National Building Code of Canada (NBCC) considered the fault system to be inactive. However, recent paleoseismic evidence suggests there to be at least 2 surface-rupturing events to have exceeded a moment magnitude (M) of 6.5 within the last 15,000 years (Morell et al. 2017). We perform a Probabilistic Seismic Hazard Analysis (PSHA) for the city of Victoria with consideration of the Leech River fault as an active source. A PSHA for Victoria which replicates the 2015 NBCC estimates is accomplished to calibrate our PSHA procedure. The same seismic source zones, magnitude recurrence parameters, and Ground Motion Prediction Equations (GMPEs) are used. We replicate the uniform hazard spectrum for a probability of exceedance of 2% in 50 years for a 500 km radial area around Victoria. An active Leech River fault zone is then added; known length and dip. We are determining magnitude recurrence parameters based on a Gutenberg-Richter relationship for the Leech River fault from various catalogues of the recorded seismicity (M 2-3) within the fault's vicinity and the proposed paleoseismic events. We seek to understand whether inclusion of an active Leech River fault source will significantly increase the probabilistic seismic hazard for Victoria. Morell et al. 2017. Quaternary rupture of a crustal fault beneath Victoria, British Columbia, Canada. GSA Today, 27, doi: 10.1130/GSATG291A.1

  9. Hospital capacity and management preparedness for pandemic influenza in Victoria.

    Science.gov (United States)

    Dewar, Ben; Barr, Ian; Robinson, Priscilla

    2014-04-01

    This study was designed to investigate acute hospital pandemic influenza preparedness in Victoria, Australia, particularly focussing on planning and management efforts. A prospective study was conducted by questionnaire and semi-structured interview of health managers across the Victorian hospital system from July to October 2011. Participants with responsibility for emergency management, planning and operations were selected from every hospital in Victoria with an emergency department to complete a questionnaire (response rate 22/43 = 51%). Each respondent was invited to participate in a phone-based semi-structured interview (response rate 11/22 = 50%). Rural/regional hospitals demonstrated higher levels of clinical (86%) and non-clinical (86%) staff contingency planning than metropolitan hospitals (60% and 40% respectively). Pandemic plans were not being sufficiently tested in exercises or drills, which is likely to undermine their effectiveness. All respondents reported hand hygiene and standard precautions programs in place, although only one-third (33%) of metropolitan respondents and no rural/regional respondents reported being able to meet patient needs with high levels of staff absenteeism. Almost half Victoria's healthcare workers were unvaccinated against influenza. Hospitals across Victoria demonstrated different levels of influenza pandemic preparedness and planning. If a more severe influenza pandemic than that of 2009 arose, Victorian hospitals would struggle with workforce and infrastructure problems, particularly in rural/regional areas. Staff absenteeism threatens to undermine hospital pandemic responses. Various strategies, including education and communication, should be included with in-service training to provide staff with confidence in their ability to work safely during a future pandemic. © 2014 The Authors. ANZJPH © 2014 Public Health Association of Australia.

  10. ('fingerponds\\') in the wetlands of Lake Victoria, Kenya

    African Journals Online (AJOL)

    The potential effect on ecosystem integrity of the use of natural wetlands for seasonal wetland fishponds ('fingerponds\\'), integrated with vegetable production for livelihood demands, was evaluated using experimental sites at Lake Victoria, Kenya. Soluble reactive phosphorous and total phosphorus, ammonium, nitrate and ...

  11. Youth suicide in Victoria: a retrospective study.

    Science.gov (United States)

    Krupinski, J; Tiller, J W; Burrows, G D; Hallenstein, H

    1994-02-07

    To determine the trends in youth suicide in Victoria and Australia as a whole, and their relation to youth unemployment. We used Australian Bureau of Statistics data to analyse suicide trends between 1907 and 1990 in young people aged 15-24 years and made an in-depth study of youth suicides between 1980 and 1990, for which computerised data are available. There has been a steady increase in youth suicide both in Victoria and Australia as a whole since 1960 in males but not females. There were significant differences in age, sex and area of residence in both the rate and the method of suicide. The increase in youth suicide was not associated with the rise in unemployment. Male (not female) suicide rates were higher in non-metropolitan areas and areas of high youth unemployment. The reasons for the increase in youth suicide remain obscure. There is a need for a prospective in-depth study to determine factors in the aetiology of youth suicide, with particular reference to possible areas for prevention.

  12. Increasing deaths involving oxycodone, Victoria, Australia, 2000-09.

    Science.gov (United States)

    Rintoul, Angela C; Dobbin, Malcolm D H; Drummer, Olaf H; Ozanne-Smith, Joan

    2011-08-01

    In light of an emerging epidemic identified in the United States and Canada, to identify trends in fatal drug toxicity involving oxycodone and the demographic characteristics and indicators of socioeconomic disadvantage of the deceased. Population-based observational study in Victoria, Australia. Decedents whose death was reported to the Victorian Coroner between 2000 and 2009 and where oxycodone was detected. Association between supply of oxycodone and deaths. Demographic characteristics of decedents. Rate ratios of the rural or metropolitan location and socioeconomic indicators of disadvantage of the deceased. Supply to Victoria has increased nine-fold from 7.5 mg per capita in 2000 to 67.5 mg per capita in 2009. Detection of oxycodone in deaths reported to the Victorian Coroner has increased from 4 (0.08/100,000 population) in 2000 to 97 (1.78/100,000 population) in 2009-a 21-fold increase in deaths. Of the 320 cases described, 53.8% (172) were the result of drug toxicity. Of these, 52.3% were unintentional and 19.8% intentional self-harm; the remaining 27.9% are either still under investigation by the coroner or intent is unknown. Drug toxicity deaths were overrepresented in both rural areas and areas indexed with high levels of disadvantage. The substantial increase in the number of deaths involving oxycodone is strongly and significantly associated with the increase in supply. Most drug toxicity deaths involving oxycodone were unintentional. This newly identified trend in fatalities in Victoria supports concerns that a pattern of increasing deaths involving oxycodone is emerging globally.

  13. Victoria Stodden: Scholarly Communication in the Era of Big Data and Big Computation

    OpenAIRE

    Stodden, Victoria

    2015-01-01

    Victoria Stodden gave the keynote address for Open Access Week 2015. "Scholarly communication in the era of big data and big computation" was sponsored by the University Libraries, Computational Modeling and Data Analytics, the Department of Computer Science, the Department of Statistics, the Laboratory for Interdisciplinary Statistical Analysis (LISA), and the Virginia Bioinformatics Institute. Victoria Stodden is an associate professor in the Graduate School of Library and Information Scien...

  14. Regional nitrogen budget of the Lake Victoria Basin, East Africa: syntheses, uncertainties and perspectives

    Science.gov (United States)

    Zhou, Minghua; Brandt, Patric; Pelster, David; Rufino, Mariana C.; Robinson, Timothy; Butterbach-Bahl, Klaus

    2014-10-01

    Using the net anthropogenic nitrogen input (NANI) approach we estimated the N budget for the Lake Victoria Basin in East Africa. The NANI of the basin ranged from 887 to 3008 kg N km-2 yr-1 (mean: 1827 kg N km-2 yr-1) for the period 1995-2000. The net nitrogen release at basin level is due primarily to livestock and human consumption of feed and foods, contributing between 69% and 85%. Atmospheric oxidized N deposition contributed approximately 14% to the NANI of the Lake Victoria Basin, while either synthetic N fertilizer imports or biological N fixations only contributed less than 6% to the regional NANI. Due to the low N imports of feed and food products (export to Lake Victoria accounted for 16%, which is much lower than for watersheds located in Europe and USA (25%). A significant reduction of the uncertainty of our N budget estimate for Lake Victoria Basin would be possible if better data on livestock systems and riverine N export were available. Our study indicates that at present soil N mining is the main source of nitrogen in the Lake Victoria Basin. Thus, sustainable N management requires increasing agricultural N inputs to guarantee food security and rehabilitation and protection of soils to minimize environmental costs. Moreover, to reduce N pollution of the lake, improving management of human and animal wastes needs to be carefully considered in future.

  15. Job-Sharing at the Greater Victoria Public Library.

    Science.gov (United States)

    Miller, Don

    1978-01-01

    Describes the problems associated with the management of part-time library employees and some solutions afforded by a job sharing arrangement in use at the Greater Victoria Public Library. This is a voluntary work arrangement, changing formerly full-time positions into multiple part-time positions. (JVP)

  16. Validation of New Crack Monitoring Technique for Victoria Class High-Pressure Air Bottles

    Science.gov (United States)

    2014-06-01

    Defence Research and Development Canada Recherche et développement pour la défense Canada Validation of new crack monitoring technique for Victoria ...Validation of new crack monitoring technique for Victoria class high-pressure air bottles Ian Thompson John R. MacKay Defence Research and Development...Canada Scientific Report DRDC-RDDC-2014-R81 June 2014 © Her Majesty the Queen in Right of Canada (Department of National Defence), 2014 © Sa Majesté

  17. Parameterization of the inherent optical properties of Murchison Bay, Lake Victoria

    Science.gov (United States)

    Okullo, Willy; Ssenyonga, Taddeo; Hamre, Børge; Frette, Øyvind; Sørensen, K.; Stamnes, Jakob J.; Steigen, Andreas; Stamnes, Knut

    2007-12-01

    Lake Victoria, Africa's largest freshwater lake, suffers greatly from negative changes in biomass of species of fish and also from severe eutrophication. The continuing deterioration of Lake Victoria's ecological functions has great long-term consequences for the ecosystem benefits it provides to the countries bordering its shores. However, knowledge about temporal and spatial variations of optical properties and how they relate to lake constituents is important for a number of reasons such as remote sensing, modeling of underwater light fields, and long-term monitoring of lake waters. Based on statistical analysis of data from optical measurements taken during half a year of weekly cruises in Murchison Bay, Lake Victoria, we present a three-component model for the absorption and a two-component model for the scattering of light in the UV and the visible regions of the solar spectrum along with tests of their ranges of validity. The three-component input to the model for absorption is the chlorophyll-a (Chl-a), total suspended materials concentrations, and yellow substance absorption, while the two-component input to the model for scattering is the Chl-a concentration and total suspended materials.

  18. Queen Victoria, her physicians, and her cataracts.

    Science.gov (United States)

    Ravin, J G

    1994-01-01

    Decreasing vision due to cataracts became a significant problem for Queen Victoria toward the end of the 19th century. Her personal physician, Sir James Reid, obtained consultations with two eminent British ophthalmologists, George Lawson and Edward Nettleship. The Queen was not satisfied, and requested an opinion from the German professor Hermann Pagenstecher. All the doctors agreed on the diagnosis, but the Queen never underwent surgery.

  19. Protection against lethal Marburg virus infection mediated by lipid encapsulated small interfering RNA.

    Science.gov (United States)

    Ursic-Bedoya, Raul; Mire, Chad E; Robbins, Marjorie; Geisbert, Joan B; Judge, Adam; MacLachlan, Ian; Geisbert, Thomas W

    2014-02-15

    Marburg virus (MARV) infection causes severe morbidity and mortality in humans and nonhuman primates. Currently, there are no licensed therapeutics available for treating MARV infection. Here, we present the in vitro development and in vivo evaluation of lipid-encapsulated small interfering RNA (siRNA) as a potential therapeutic for the treatment of MARV infection. The activity of anti-MARV siRNAs was assessed using dual luciferase reporter assays followed by in vitro testing against live virus. Lead candidates were tested in lethal guinea pig models of 3 different MARV strains (Angola, Ci67, Ravn). Treatment resulted in 60%-100% survival of guinea pigs infected with MARV. Although treatment with siRNA targeting other MARV messenger RNA (mRNA) had a beneficial effect, targeting the MARV NP mRNA resulted in the highest survival rates. NP-718m siRNA in lipid nanoparticles provided 100% protection against MARV strains Angola and Ci67, and 60% against Ravn. A cocktail containing NP-718m and NP-143m provided 100% protection against MARV Ravn. These data show protective efficacy against the most pathogenic Angola strain of MARV. Further development of the lipid nanoparticle technology has the potential to yield effective treatments for MARV infection.

  20. Levels of toxic metals in multisectoral samples from Winam Gulf of Lake Victoria.

    Science.gov (United States)

    Ongeri, D M K; Lalah, J O; Wandiga, S O; Schramm, K W; Michalke, B

    2009-01-01

    In this study, the distribution and sources of inputs of trace metals including Cd, Cu, Zn and Pb from various sources as well as Fe which is widely used in the construction industry, into Winam Gulf of Lake Victoria were investigated. The sampling sites were located up streams and down streams of four rivers (Sio, Nyamasaria, Nyando and Sondu-Miriu), in four beaches along the lake (Port Victoria, Kisumu Car Wash, Dunga and Hippo point beaches) and in three estates (Nyamasaria, Migosi and Nyawita) in Kisumu city, covering potential agrochemical and industrial sources and drinking water points, respectively. The concentrations (in microg/L) of trace metals analysed in the lake and river waters ranged from Car Wash area. The study confirmed that the concentrations of the metals accumulate downstream in the rivers both in water and sediment and these rivers are major sources of the heavy metal load into Winam Gulf of Lake Victoria.

  1. Analyses of CsI aerosol deposition tests in WIND project with ART and VICTORIA codes

    International Nuclear Information System (INIS)

    Yuchi, Y.; Shibazaki, H.; Kudo, T.

    2000-01-01

    Deposition behavior of cesium iodide (CsI) was analyzed with ART and VICTORIA-92 codes for a test of the aerosol re-vaporization test series performed in WIND project at JAERI. In the test analyzed, CsI aerosol was injected into piping of test section where metaboric acid (HBO 2 ) was placed in advance on the floor area. It was confirmed in the present analysis that similar results on the CsI deposition were obtained between ART and VICTORIA when influences of chemical interactions were negligibly small. The analysis with VICTORIA agreed satisfactorily with the test results in analytical cases that cesium metaborate (CsBO 2 ) was injected into the test section instead of CsI to simulate the pre-existence of HBO 2 effect. (author)

  2. Urbanization and mental health: psychiatric morbidity, suicide and violence in the State of Victoria.

    Science.gov (United States)

    Krupinski, J

    1979-06-01

    Australia is one of the most urbanized countries in the world with over 85% of the population living in metropolitan and other urban areas. More important, the change from a predominantly rural society to an urbanized society has occurred within the last 100 years. To assess the effects of urbanization on mental health, rates of admissions to psychiatric institutions, suicides and violent crime in Victoria have been analysed for the last hundred years. Data on admissions to psychiatric facilities in Victoria from metropolitan, other urban and rural areas, as well as results of community health surveys carried out in metropolitan and rural areas were compared to examine for evidence of urban-rural differences in psychiatric morbidity. The findings do not support the notion that the level of psychiatric and psychosocial disorders in Victoria are related to urbanization or to urban living.

  3. Fishing Business Arrangements and Sustainability in Lake Victoria ...

    African Journals Online (AJOL)

    In this article an attempt is made to analyse the existing production relations between the owners of the vessels and the crewmembers and the concern for sustainability. Our results found that the existing sharing system in Lake Victoria poses a big challenge in as far as sustainability is concerned. Some of the system such ...

  4. 78 FR 48318 - Approval and Promulgation of Air Quality Implementation Plans; Texas; Victoria County, 1997 8...

    Science.gov (United States)

    2013-08-08

    ... pollution. Inclusion of Victoria County in 30 TAC Chapter 115 volatile organic compounds (VOC) rules for the... vessels, and marine vessels would be required to vent to a control device until the VOC concentration of... Victoria County in 30 TAC Chapter 114 rule for Texas Low Emission Diesel (TxLED) compliant marine diesel...

  5. Transactional sex in the fishing communities along Lake Victoria ...

    African Journals Online (AJOL)

    The study describes the nature, context and implications of a unique form of transactional sexual relationships in the fishing communities along Lake Victoria in Kisumu County, Kenya. We conducted 12 focus group discussions and 17 key informant interviews among fishermen, fishmongers and fish transporters in Kisumu.

  6. Analysis of an Organisation: A University of the Third Age (U3A), Mornington, Victoria

    Science.gov (United States)

    Small, Michael

    2017-01-01

    The purpose of this paper is two fold: to look at Mornington U3A in organisational terms and then look at U3AM as a loosely coupled system. One outcome of the study would be to undertake further analyses of U3As in Victoria to determine the levels of bureaucracy under which each operates. Questions to be asked: are U3As in Victoria operating as…

  7. VICTORIA: A mechanistic model of radionuclide behavior in the reactor coolant system under severe accident conditions

    International Nuclear Information System (INIS)

    Heams, T.J.; Williams, D.A.; Johns, N.A.; Mason, A.; Bixler, N.E.; Grimley, A.J.; Wheatley, C.J.; Dickson, L.W.; Osborn-Lee, I.; Domagala, P.; Zawadzki, S.; Rest, J.; Alexander, C.A.; Lee, R.Y.

    1992-12-01

    The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided

  8. Aboriginal Students in Victoria. ACER Research Monograph No. 3.

    Science.gov (United States)

    de Lemos, Marion M.

    An estimated 80%-90% of all Aboriginal students enrolled in the primary and secondary schools of Victoria, Australia, were tested and surveyed to determine their numbers, distribution, attendance, achievement, attitudes, and school leaving patterns. Most of the 1244 Aboriginals surveyed attended state schools and 75% were schooled in rural areas.…

  9. Investigation of a steam generator tube rupture sequence using VICTORIA

    International Nuclear Information System (INIS)

    Bixler, N.E.; Erickson, C.M.; Schaperow, J.H.

    1995-01-01

    VICTORIA-92 is a mechanistic computer code for analyzing fission product behavior within the reactor coolant system (RCS) during a severe reactor accident. It provides detailed predictions of the release of radionuclides and nonradioactive materials from the core and transport of these materials within the RCS. The modeling accounts for the chemical and aerosol processes that affect radionuclide behavior. Coupling of detailed chemistry and aerosol packages is a unique feature of VICTORIA; it allows exploration of phenomena involving deposition, revaporization, and re-entrainment that cannot be resolved with other codes. The purpose of this work is to determine the attenuation of fission products in the RCS and on the secondary side of the steam generator in an accident initiated by a steam generator tube rupture (SGTR). As a class, bypass sequences have been identified in NUREG-1150 as being risk dominant for the Surry and Sequoyah pressurized water reactor (PWR) plants

  10. A Baseline Air Quality Assessment Onboard a Victoria Class Submarine: HMCS Windsor

    National Research Council Canada - National Science Library

    Severs, Y. D

    2006-01-01

    .... This trial thus represents a baseline habitability evaluation of Canada's Victoria class submarines to confirm compliance with the current maximum permissible contaminant limits stipulated in the Air...

  11. Influence of the Pearl River estuary and vertical mixing in Victoria Harbor on water quality in relation to eutrophication impacts in Hong Kong waters.

    Science.gov (United States)

    Yin, Kedong; Harrison, Paul J

    2007-06-01

    This study presents water quality parameters such as nutrients, phytoplankton biomass and dissolved oxygen based on 11 years of water quality data in Victoria Harbor and examined how the Pearl River estuary discharge in summer and year round sewage discharge influenced these parameters. Nutrients in Victoria Harbor were strongly influenced by both the Pearl River and sewage effluent, as indicated by the high NO(3) inputs from the Pearl River in summer and higher NH(4) and PO(4) in Victoria Harbor than both its sides. N:P ratios were low in the dry season, but increased to >16:1 in the wet season, suggesting that P is potentially the most limiting nutrient in this area during the critical period in the summer. Although there were generally high nutrients, the phytoplankton biomass was not as high as one would expect in Victoria Harbor. In fact, there were high concentrations of chl near the bottom well below the photic zone. Salinity near the bottom was lower in Victoria Harbor than at the two entrances to Victoria Harbor, suggesting strong vertical mixing within Victoria Harbor. Therefore, strong vertical mixing and horizontal advection appear to play an important role in significantly reducing eutrophication impacts in Victoria Harbor. Consequently, dissolved oxygen near the bottom was low in summer, but only occasionally dipped to 2 mgL(-1) despite the high organic loading from sewage effluent.

  12. A Bottom-Up Understanding of Illegal, Unreported, and Unregulated Fishing in Lake Victoria

    Directory of Open Access Journals (Sweden)

    Joseph Luomba

    2016-10-01

    Full Text Available Illegal, unreported, and unregulated (IUU fishing is a major concern in fisheries management around the world. Several measures have been taken to address the problem. In Lake Victoria, the alleviation of IUU fishing is implemented through the Regional Plan of Action (RPOA-IUU, which restricts use of certain fishing gear, as well as prohibits fishing in closed areas and during closed seasons. Despite the long-term efforts to monitor and control what goes on in the fisheries, IUU fishing has persisted in Lake Victoria. Inspired by interactive governance theory, this paper argues that the persistence of IUU fishing could be due to different images that stakeholders have about the situation, rather than the lack of management competency. Through structured interviews with 150 fisheries stakeholders on Ijinga Island in the southeastern part of Lake Victoria, Tanzania, using paired comparison questionnaires, the study elicits stakeholders’ perspective about the severity of different locally-pertinent fishing-related activities. The results show that while fisheries stakeholder groups agree on their judgments about certain fishing gears, some differences are also apparent. For instance, fisheries managers and scientists do not always agree with fishing people about what activities cause the most damage to fisheries resources and ecosystem. Further, they tend to consider some IUU fishing-related activities less damaging than some non-IUU fishing. Such disparity creates governability challenges, pointing to the need to revisit relevant regulatory measures and to make them consistent with the knowledge and judgments of all stakeholders. Based on these findings, we discuss governing interventions that may contribute to addressing IUU fishing in Lake Victoria and elsewhere.

  13. Antibody Responses to Marburg Virus in Egyptian Rousette Bats and Their Role in Protection against Infection.

    Science.gov (United States)

    Storm, Nadia; Jansen Van Vuren, Petrus; Markotter, Wanda; Paweska, Janusz T

    2018-02-10

    Egyptian rousette bats (ERBs) are reservoir hosts for the Marburg virus (MARV). The immune dynamics and responses to MARV infection in ERBs are poorly understood, and limited information exists on the role of antibodies in protection of ERBs against MARV infection. Here, we determine the duration of maternal immunity to MARV in juvenile ERBs, and evaluate the duration of the antibody response to MARV in bats naturally or experimentally infected with the virus. We further explore whether antibodies in previously naturally exposed bats is fully protective against experimental reinfection with MARV. Maternal immunity was lost in juvenile ERBs by 5 months of age. Antibodies to MARV remained detectable in 67% of experimentally infected bats approximately 4 months post inoculation (p.i.), while antibodies to MARV remained present in 84% of naturally exposed bats at least 11 months after capture. Reinfection of seropositive ERBs with MARV produced an anamnestic response from day 5 p.i. Although PCR-defined viremia was present in 73.3% of reinfected ERBs, replicating virus was recovered from the serum of only one bat on day 3 p.i. The negative PCR results in the salivary glands, intestines, bladders and reproductive tracts of reinfected bats, and the apparent absence of MARV in the majority of swabs collected from these bats suggest that reinfection may only play a minor role in the transmission and maintenance of MARV amongst ERBs in nature.

  14. Total mercury concentration in common fish species of Lake Victoria ...

    African Journals Online (AJOL)

    Total mercury (THg) concentration was analysed in muscles of common fish species of Lake Victoria in the eastern and southern parts of the lake using cold vapour Atomic Absorption Spectrophotometric technique. Mercury concentration in all fish species was generally lower than the WHO maximum allowable ...

  15. Energy and Environment in the Lake Victoria basin.

    OpenAIRE

    Arungu-Olende, S.

    2006-01-01

    The local and national economies of Lake Victoria basin communities are heavily dependent on energy that fuels agriculture, industry, commerce, transportation and other economic activities; and powers our houses, offices, hospitals and buildings. Energy is therefore key to facilitating the development income generating opportunities, improving living standards, reducing poverty, and ensuring the protection of the environment. The development and use of various forms of renewable and non-renew...

  16. Mitigation of environmental problems in Lake Victoria, East Africa: causal chain and policy options analyses.

    Science.gov (United States)

    Odada, Eric O; Olago, Daniel O; Kulindwa, Kassim; Ntiba, Micheni; Wandiga, Shem

    2004-02-01

    Lake Victoria is an international waterbody that offers the riparian communities a large number of extremely important environmental services. Over the past three decades or so, the lake has come under increasing and considerable pressure from a variety of interlinked human activities such as overfishing, species introductions, industrial pollution, eutrophication, and sedimentation. In this paper we examine the root causes for overfishing and pollution in Lake Victoria and give possible policy options that can help remediate or mitigate the environmental degradation.

  17. Potentially avoidable hospitalisation for constipation in Victoria, Australia in 2010-11.

    Science.gov (United States)

    Ansari, Humaira; Ansari, Zahid; Hutson, John M; Southwell, Bridget R

    2014-07-11

    When primary care of constipation fails, the patient may need emergency hospitalisation for disimpaction. This study aimed to provide population-based data on the number of unplanned admissions and the cost to the healthcare system for constipation in Victoria, Australia in financial year 2010-11. The Victorian Admitted Episodes Dataset was examined to find the number of emergency hospital separations coded as constipation (ICD-10-AM Code K390). An estimate of costs was determined from the number of weighted inlier equivalent separations (WIES) multiplied by the WEIS price, used by the Victorian Government for funding purposes. There were 3978 emergency separations for constipation in Victoria in 2010-2011, 92% in public hospitals. Fifty-five percent were female and 38% > 75 years old. One third stayed overnight and 1/3 more than 1 day. The emergency bed day rate was 7.1 per 10,000 of population. The estimate of cost, based on WEIS, was approximately $8.3 million. Potential savings could be made by reducing the number of separations in 6 Local Government Areas (LGAs). This study shows that the burden (in number of admissions, emergency bed days and overall direct costs) in managing emergency admissions for constipation in Victoria, Australia, is very significant and likely to be similar in other developed countries. Improved primary healthcare and alternative ways to achieve faecal disimpaction without emergency admission could save the public health system a proportion of this $8.3 million.

  18. medical recipients of the victoria cross during the anglo-boer war

    African Journals Online (AJOL)

    ofall orders ofchivalry - the most enviable order ofthe. Victoria Cross.' MEDICAL .... Major Babtie, a Scot by birth, obtained his Bachelor of Medicine in 1880 and entered the Army ..... a personality type that is given to this kind of action? Will one.

  19. Nutritional composition and shelflife of the lake victoria nile perch ...

    African Journals Online (AJOL)

    Nile perch, the most important commercial fish species from the Lake Victoria fishery, contributes about 67% of Kenya's total annual fish export earnings. Despite the Nile perch being an important foreign exchange earner, little information is available on its nutritional composition and shelf life on ice, information that is ...

  20. Study of genetic variation in population of Bipolaris victoriae, the ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-11-19

    Nov 19, 2008 ... Isolates of Bipolaris victoriae were analysed by random amplified polymorphic DNA (RAPD) techniques ... According to the protocol, samples ... and fungus species. But some of the isolates of fungus with high genetic similarity have the same origin (Figure. 1). Weikert et al. (2002) reported that species of ...

  1. Satellite-Based Assessment of the spatial extent of Aquatic Vegetation in Lake Victoria

    Science.gov (United States)

    Clark, W.; Aligeti, N.; Jeyaprakash, T.; Martins, M.; Stodghill, J.; Winstanley, H.

    2011-12-01

    Lake Victoria in Africa is the second largest freshwater lake in the world and is known for its abundance of aquatic wildlife. In particular over 200 different fish species are caught and sold by local fisherman. The lake is a major contributor to the local economy as a corridor of transportation, source of drinking water, and source of hydropower. However, the invasion of aquatic vegetation such as water hyacinth in the lake has disrupted each of these markets. Aquatic vegetation now covers a substantial area of the coastline blocking waterways, disrupting hydropower, hindering the collection of drinking water and decreasing the profitability of fishing. The vegetation serves as a habitat for disease carrying mosquitoes as well as snakes and snails that spread the parasitic disease bilharzia. The current control measures of invasive aquatic vegetation rely on biological, chemical and mechanical control. The objective of this study was to utilize remote sensing to map aquatic vegetation within Lake Victoria from 2000 to 2011. MODIS, Landsat 4-5TM, and Landsat 7-ETM imagery was employed to perform change detections in vegetation and identify the extent of aquatic vegetation throughout the years. The efficiency of containment efforts were evaluated and ideal time for application of such efforts were suggested. A methodology for aquatic vegetation surveillance was created. The results of this project were presented as a workshop to the Lake Victoria Fisheries Organization, SERVIR, and other partner organizations. The workshop provided instruction into the use of NASA and other satellite derived products. Time series animations of the spatial extent of aquatic vegetation within the lake were created. By identifying seasons of decreased aquatic vegetation, ideal times to employ control efforts were identified. SERVIR will subsequently utilize the methodologies and mapping results of this study to develop operational aquatic vegetation surveillance for Lake Victoria.

  2. Coal Corporation of Victoria strategic plan

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-01

    The Coal Corporation has been established by the Victorian Parliament to plan for and to manage the responsible utilisation of the brown coal resource (Victoria's most abundant fossil resource) in order to underpin economic growth and job creation. For each of 5 issues, the Strategic Plan outlines the current situation, reviews recent factors which have affected or may affect the situation and outlines the goals, strategies and targets which have been set for the period 1985/1989. In each case, the achievements to date are also outlined. The issues addressed are: project development, marketing, resource planning and inter corporate relations, organisation of the Corporation, and finance.

  3. Dam safety management in Victoria (Australia)

    International Nuclear Information System (INIS)

    Adem, J.

    1996-01-01

    The Victoria state government's decision to make dam owners accountable for safety and upkeep of their dams was reported. To give effect to this decision a series of guidelines have been developed which outline the required activities and skills to ensure that dams are properly managed within a framework of 'light-handed' regulation. The guidelines are also intended to ensure that dam management becomes an integral part of the business decision making process, not just a set of prescribed technical procedures. Details of the direction being taken and the proposed controls to ensure compliance with national and international standards were described. 4 refs., 2 figs

  4. Immune Response to Marburg Virus Angola Infection in Nonhuman Primates.

    Science.gov (United States)

    Fernando, Lisa; Qiu, Xiangguo; Melito, P Leno; Williams, Kinola J N; Feldmann, Friederike; Feldmann, Heinz; Jones, Steven M; Alimonti, Judie B

    2015-10-01

    The 2005 outbreak of Marburg virus (MARV) infection in Angola was the most lethal MARV infection outbreak in history, with a case-fatality rate (90%) similar to that for Zaire ebolavirus (EBOV) infection. However, very little is known about the pathogenicity of MARV Angola, as few studies have been conducted to date. Therefore, the immune response was examined in MARV Angola-infected nonhuman primates. Cynomolgus macaques were infected with MARV Angola and monitored for survival. The effect of MARV Angola on the immune system was examined by immunophenotyping whole-blood and by analyzing cytokine and chemokine levels in plasma and spleen specimens, using flow cytometry. The prominent clinical findings were rapid onset of disease and death (mean time after infection, 6.7 days), fever, depression, anorexia, petechial rash, and lymphopenia. Specifically, T, B, and natural killer cells were severely depleted in the blood by day 6. The typical cytokine storm was present, with levels of interferon γ, tumor necrosis factor, interleukin 6, and CCL2 rising in the blood early during infection. MARV Angola displayed the same virulence and disease pathology as EBOV. MARV Angola appears to cause a more rapid onset and severe outcome of infection than other MARV strains. © Crown copyright 2015.

  5. Australian doctors and the visual arts. Part 4. Doctors as supporters of art galleries and artists in Victoria.

    Science.gov (United States)

    Hamilton, D G

    1986-07-07

    The contribution of doctors to the visual arts is being discussed in a series of six articles. Doctor-artists in New South Wales and Victoria, and doctors as collectors, donors, gallery supporters and writers in New South Wales, have been discussed in earlier articles. This, the fourth article, deals with doctors as supporters of art galleries and artists in Victoria.

  6. Development and characterization of a guinea pig model for Marburg virus

    Directory of Open Access Journals (Sweden)

    Gary Wong

    2018-01-01

    Full Text Available The Angolan strain of Marburg virus (MARV/Ang can cause lethal disease in humans with a case fatality rate of up to 90%, but infection of immunocompetent rodents do not result in any observable symptoms. Our previous work includes the development and characterization of a MARV/Ang variant that can cause lethal disease in mice (MARV/Ang-MA, with the aim of using this tool to screen for promising prophylactic and therapeutic candidates. An intermediate animal model is needed to confirm any findings from mice studies before testing in the gold-standard non-human primate (NHP model. In this study, we serially passaged the clinical isolate of MARV/Ang in the livers and spleens of guinea pigs until a variant emerged that causes 100% lethality in guinea pigs (MARV/Ang-GA. Animals infected with MARV/Ang-GA showed signs of filovirus infection including lymphocytopenia, thrombocytopenia, and high viremia leading to spread to major organs, including the liver, spleen, lungs, and kidneys. The MARV/Ang-GA guinea pigs died between 7–9 days after infection, and the LD50 was calculated to be 1.1×10–1 TCID50 (median tissue culture infective dose. Mutations in MARV/Ang-GA were identified and compared to sequences of known rodent-adapted MARV/Ang variants, which may benefit future studies characterizing important host adaptation sites in the MARV/Ang viral genome.

  7. VICTORIA: A mechanistic model of radionuclide behavior in the reactor coolant system under severe accident conditions. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Heams, T J [Science Applications International Corp., Albuquerque, NM (United States); Williams, D A; Johns, N A; Mason, A [UKAEA, Winfrith, (England); Bixler, N E; Grimley, A J [Sandia National Labs., Albuquerque, NM (United States); Wheatley, C J [UKAEA, Culcheth (England); Dickson, L W [Atomic Energy of Canada Ltd., Chalk River, ON (Canada); Osborn-Lee, I [Oak Ridge National Lab., TN (United States); Domagala, P; Zawadzki, S; Rest, J [Argonne National Lab., IL (United States); Alexander, C A [Battelle, Columbus, OH (United States); Lee, R Y [Nuclear Regulatory Commission, Washington, DC (United States)

    1992-12-01

    The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided.

  8. The burden of hospitalised fall-related injury in community-dwelling older people in Victoria: a database study.

    Science.gov (United States)

    Vu, Trang; Day, Lesley; Finch, Caroline F

    2014-04-01

    To estimate the burden of hospitalised fall-related injury in community-dwelling older people in Victoria. We analysed fall-related, person-identifying hospital discharge data and patient-level hospital treatment costs for community-dwelling older people aged 65+ years from Victoria between 1 July 2005 and 30 June 2008, inclusive. Key outcomes of interest were length of stay (LOS)/episode, cumulative LOS (CLOS)/patient and inpatient costs. The burden of hospitalised fall-related injury in community-dwelling older people aged 65+ years in Victoria was 284,781 hospital bed days in 2005-06, rising to 310,031 hospital bed days in 2007-08. Seventy-one per cent of episodes were multiday. One in 15 acute care episodes was a high LOS outlier and 14% of patients had ≥1 episode classified as high LOS outlier. The median CLOS/patient was nine days (interquartile range 2-27). The annual costs of inpatient care, in June 2009 prices, for fall-related injury in community-dwelling people aged 65+ years in Victoria rose from $213 million in 2005-06 to $237 million in 2007-08. The burden of hospitalised fall-related injury in community-dwelling older women, people aged 85+ years and those with comorbidity was considerable. The burden of hospitalised fall-related injury in community-dwelling older people aged 65+ years in Victoria is significantly more than previously projected. Importantly, this study identifies that women, patients with comorbidity and those aged 85+ years account for a considerable proportion of this burden. A corresponding increase in falls prevention effort is required to ensure that the burden is properly addressed. © 2014 The Authors. ANZJPH © 2014 Public Health Association of Australia.

  9. Lake Victoria's Water Budget and the Potential Effects of Climate ...

    African Journals Online (AJOL)

    This paper presents the Lake Victoria water budget for the period 1950-2004 and findings of a study on potential climate change impact on the lake's Hydrology through the 21st Century. The mass balance components are computed from measured and simulated data. A2 and B2 emission scenarios of the Special Report ...

  10. Existence versus extinction : Human-hippo conflicts in Lake Victoria Area, Kenya

    NARCIS (Netherlands)

    Post, A.W.C.H.M.

    2017-01-01

    This PhD dissertation examines the role of different organisations and affected communities in human-wildlife governance, with a focus on human-hippo conflicts in Lake Victoria Area, Kenya. The hippo population in this area is under pressure due to human activities that impact on the wetland

  11. Nile perch fish processing waste along Lake Victoria in East Africa ...

    African Journals Online (AJOL)

    Nile perch fish processing waste along Lake Victoria in East Africa: Auditing and characterization. ... African Journal of Environmental Science and Technology ... If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  12. B chromosomes have a functional effect on female sex determination in Lake Victoria cichlid fishes.

    Directory of Open Access Journals (Sweden)

    Kohta Yoshida

    2011-08-01

    Full Text Available The endemic cichlid fishes in Lake Victoria are a model system for speciation through adaptive radiation. Although the evolution of the sex-determination system may also play a role in speciation, little is known about the sex-determination system of Lake Victoria cichlids. To understand the evolution of the sex-determination system in these fish, we performed cytogenetic analysis in 11 cichlid species from Lake Victoria. B chromosomes, which are present in addition to standard chromosomes, were found at a high prevalence rate (85% in these cichlids. In one species, B chromosomes were female-specific. Cross-breeding using females with and without the B chromosomes demonstrated that the presence of the B chromosomes leads to a female-biased sex ratio in this species. Although B chromosomes were believed to be selfish genetic elements with little effect on phenotype and to lack protein-coding genes, the present study provides evidence that B chromosomes have a functional effect on female sex determination. FISH analysis using a BAC clone containing B chromosome DNA suggested that the B chromosomes are derived from sex chromosomes. Determination of the nucleotide sequences of this clone (104.5 kb revealed the presence of several protein-coding genes in the B chromosome, suggesting that B chromosomes have the potential to contain functional genes. Because some sex chromosomes in amphibians and arthropods are thought to be derived from B chromosomes, the B chromosomes in Lake Victoria cichlids may represent an evolutionary transition toward the generation of sex chromosomes.

  13. Un paso de América: Alfonso Reyes, Victoria Ocampo y el cosmopolitismo en la década de 1930 / Un paso de América: Alfonso Reyes, Victoria Ocampo and the Cosmopolitanism in the 1930’s

    Directory of Open Access Journals (Sweden)

    Gorica Majstorovic

    2014-12-01

    Full Text Available El artículo trata de las construcciones americanistas del cosmopolitismo (entendido en relación a la geopolítica imperial en los textos de Victoria Ocampo y Alfonso Reyes de los años treinta. Al analizar su relación con los movimientos de inmigración y la subsiguiente revalorización de la nación, el artículo postula que en Alfonso Reyes la mediación cosmopolita es «des-jerarquizada», ubicada casi siempre en una «periferia», a diferencia de Victoria Ocampo cuyas visiones cosmopolitas son mediadas desde un «centro» —ya sea París o Buenos Aires— y relacionadas con una jerarquía de valores estéticos y políticos.The article deals with Americanist constructions of cosmopolitanism (understood in relation to the imperial geopolitics in the texts of Victoria Ocampo and Alfonso Reyes in the 1930’s. Upon analyzing its relationship with immigration movements and the subsequent revaluation of the nation, the article suggests that in Alfonso Reyes cosmopolitan mediation is «dis-hierarchized», almost always located in a periphery, unlike Victoria Ocampo whose cosmopolitan visions are mediated from a «center» —either Paris or Buenos Aires— and related to a hierarchy of aesthetic and political values.

  14. Genomic analysis of codon usage shows influence of mutation pressure, natural selection, and host features on Marburg virus evolution.

    Science.gov (United States)

    Nasrullah, Izza; Butt, Azeem M; Tahir, Shifa; Idrees, Muhammad; Tong, Yigang

    2015-08-26

    The Marburg virus (MARV) has a negative-sense single-stranded RNA genome, belongs to the family Filoviridae, and is responsible for several outbreaks of highly fatal hemorrhagic fever. Codon usage patterns of viruses reflect a series of evolutionary changes that enable viruses to shape their survival rates and fitness toward the external environment and, most importantly, their hosts. To understand the evolution of MARV at the codon level, we report a comprehensive analysis of synonymous codon usage patterns in MARV genomes. Multiple codon analysis approaches and statistical methods were performed to determine overall codon usage patterns, biases in codon usage, and influence of various factors, including mutation pressure, natural selection, and its two hosts, Homo sapiens and Rousettus aegyptiacus. Nucleotide composition and relative synonymous codon usage (RSCU) analysis revealed that MARV shows mutation bias and prefers U- and A-ended codons to code amino acids. Effective number of codons analysis indicated that overall codon usage among MARV genomes is slightly biased. The Parity Rule 2 plot analysis showed that GC and AU nucleotides were not used proportionally which accounts for the presence of natural selection. Codon usage patterns of MARV were also found to be influenced by its hosts. This indicates that MARV have evolved codon usage patterns that are specific to both of its hosts. Moreover, selection pressure from R. aegyptiacus on the MARV RSCU patterns was found to be dominant compared with that from H. sapiens. Overall, mutation pressure was found to be the most important and dominant force that shapes codon usage patterns in MARV. To our knowledge, this is the first detailed codon usage analysis of MARV and extends our understanding of the mechanisms that contribute to codon usage and evolution of MARV.

  15. La construcción de legitimidad del Frente para la Victoria (1988-1991 Frente para la Victoria's construction of legitimacy (1988-1991

    Directory of Open Access Journals (Sweden)

    Pamela Sosa

    2011-06-01

    Full Text Available El trabajo aborda la construcción de legitimidad del Frente para la Victoria (FV en el escenario político de Santa Cruz desde su nacimiento en 1988 hasta llegar a la gobernación en 1991. Se identifican tres fuentes de legitimidad construidas de manera alternativa al debilitamiento de la credibilidad de los partidos políticos tradicionales: la UCR, el PJ, el PI y el MID, entre otros. En este contexto, el Frente para la Victoria desplegó sus estrategias de legitimación apelando a la unidad de lo diverso y sumando referentes individuales de todo el arco político. Por otro lado, apeló a través de sus discursos y la conformación de los elencos y organizaciones a representar la fragmentación social propia de una sociedad compuesta por capas migratorias y, por último, construyó una novedosa oferta política a-partidaria acorde a las representaciones de la crisis estatal a mediados del '80 a partir de la reivindicación de los valores de la gestión, la eficiencia, el orden, el trabajo y la gobernabilidad. Sus estrategias de legitimación muestran cómo la primera etapa de construcción de poder político del FV fue efecto de su trayectoria en la frontera de los débiles grupos sociales y políticos.O trabalho aborda a construção de legitimidade do Frente para la Victoria (FV no cenário político de Santa Cruz desde seu nascimento em 1988 até chegar ao governo em 1991. Identificam-se três fontes de legitimidade construídas de maneira alternativa ao enfraquecimento da credibilidade dos partidos políticos tradicionais: a UCR, o PJ, o PI e o MID, entre outros. Neste contexto, o Frente para la Victoria desdobrou suas estratégias de legitimação apelando à unidade do que for diverso e somando referências individuais de todo o arco político. Por outro lado, apelou, através de seus discursos e a conformação dos elencos e organizações, a representar a fragmentação social própria de uma sociedade composta por camadas migrat

  16. Marburg virus evades interferon responses by a mechanism distinct from ebola virus.

    Directory of Open Access Journals (Sweden)

    Charalampos Valmas

    2010-01-01

    Full Text Available Previous studies have demonstrated that Marburg viruses (MARV and Ebola viruses (EBOV inhibit interferon (IFN-alpha/beta signaling but utilize different mechanisms. EBOV inhibits IFN signaling via its VP24 protein which blocks the nuclear accumulation of tyrosine phosphorylated STAT1. In contrast, MARV infection inhibits IFNalpha/beta induced tyrosine phosphorylation of STAT1 and STAT2. MARV infection is now demonstrated to inhibit not only IFNalpha/beta but also IFNgamma-induced STAT phosphorylation and to inhibit the IFNalpha/beta and IFNgamma-induced tyrosine phosphorylation of upstream Janus (Jak family kinases. Surprisingly, the MARV matrix protein VP40, not the MARV VP24 protein, has been identified to antagonize Jak and STAT tyrosine phosphorylation, to inhibit IFNalpha/beta or IFNgamma-induced gene expression and to inhibit the induction of an antiviral state by IFNalpha/beta. Global loss of STAT and Jak tyrosine phosphorylation in response to both IFNalpha/beta and IFNgamma is reminiscent of the phenotype seen in Jak1-null cells. Consistent with this model, MARV infection and MARV VP40 expression also inhibit the Jak1-dependent, IL-6-induced tyrosine phosphorylation of STAT1 and STAT3. Finally, expression of MARV VP40 is able to prevent the tyrosine phosphorylation of Jak1, STAT1, STAT2 or STAT3 which occurs following over-expression of the Jak1 kinase. In contrast, MARV VP40 does not detectably inhibit the tyrosine phosphorylation of STAT2 or Tyk2 when Tyk2 is over-expressed. Mutation of the VP40 late domain, essential for efficient VP40 budding, has no detectable impact on inhibition of IFN signaling. This study shows that MARV inhibits IFN signaling by a mechanism different from that employed by the related EBOV. It identifies a novel function for the MARV VP40 protein and suggests that MARV may globally inhibit Jak1-dependent cytokine signaling.

  17. Dietary shifts in Brycinus sadleri (Pisces : Characidae) from southern Lake Victoria

    NARCIS (Netherlands)

    Wanink, J.H.; Joordens, J.C.A.

    2007-01-01

    We studied the diet of Brycinus sadleri in Lake Victoria after extensive environmental changes during the 1980s. To check for diet expansion following these changes, as observed in some other fish species, we compared our results with data from the 1950s. Stomach contents were analysed in relation

  18. Nile perch fish processing waste along Lake Victoria in East Africa ...

    African Journals Online (AJOL)

    In East Africa, Nile perch fish processing into chilled fish fillet for export along Lake Victoria generate large proportions of both solid and liquid wastes. However, no thorough auditing and characterization of the waste has been done that would guide potential value addition through bioconversions and waste management.

  19. Eutrophication, Nile perch and food-web interactions in south-east Lake Victoria

    NARCIS (Netherlands)

    Cornelissen, I.J.M.

    2015-01-01

    The increasing eutrophication, the introduction of Nile perch (Lates niloticus) and the increasing fishing pressure has changed Lake Victoria tremendously the last century. Since the 1960s, eutrophication increased primary production, enabling an increase in fish production. However,

  20. Strategic Actions for Increasing the Submission of Digital Cadastral Data by the Surveying Industry Based on Lessons Learned from Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Hamed Olfat

    2018-02-01

    Full Text Available ePlan, as a digital cadastral data initiative, is a collaborative program between the land authorities and the surveying industry which aims to replace paper and PDF cadastral plans and surveys with digital data. ePlan is currently operational in Australia, New Zealand and Singapore. ePlan was introduced in the State of Victoria in 2011 and has been operational in this jurisdiction for 2D plans since 2013. On average, one ePlan application is currently submitted to a digital plan lodgment portal every two weeks. The low uptake of ePlan is caused by several technical and non-technical challenges. This paper provides an overview of cadastral information transitioning from paper to digital in Victoria. The research methodology to identify the challenges in Victoria for the adoption of ePlan is then described. This is followed by a discussion on the identified challenges. The paper then proposes a generic framework of strategic actions to increase the uptake of digital cadastral data based on the lessons learned from Victoria. The initiatives suggested by this framework to address the ePlan challenges in Victoria and increase its uptake are also introduced. The paper concludes with a direction for future research.

  1. Neutron activation analysis on sediments from Victoria Land, Antarctica. Multi-elemental characterization of potential atmospheric dust sources

    International Nuclear Information System (INIS)

    Baccolo, G.; Maggi, V.; Baroni, C.; Clemenza, M.; Motta, A.; Nastasi, M.; Previtali, E.; University of Milano-Bicocca, Milan; Delmonte, B.; Salvatore, M.C.

    2014-01-01

    The elemental composition of 40 samples of mineral sediments collected in Victoria Land, Antarctica, in correspondence of ice-free sites, is presented. Concentration of 36 elements was determined by instrumental neutron activation analysis, INAA. The selection of 6 standard reference materials and the development of a specific analytical procedure allowed to reduce measurements uncertainties and to verify the reproducibility of the results. The decision to analyze sediment samples from Victoria Land ice-free areas is related to recent investigations regarding mineral dust content in the TALos Dome ICE core (159deg11'E; 72deg49'S, East Antarctica, Victoria Land), in which a coarse local fraction of dust was recognized. The characterization of Antarctic potential source areas of atmospheric mineral dust is the first step to identify the active sources of dust for the Talos Dome area and to reconstruct the atmospheric pathways followed by air masses in this region during different climatic periods. Principal components analysis was used to identify elements and samples correlations; attention was paid specially to rare earth elements (REE) and incompatible/compatible elements (ICE) in respect to iron, which proved to be the most discriminating elemental groups. The analysis of REE and ICE concentration profiles supported evidences of chemical weathering in ice-free areas of Victoria Land, whereas cold and dry climate conditions of the Talos Dome area and in general of East Antarctica. (author)

  2. Comparison of mortality following hospitalisation for isolated head injury in England and Wales, and Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    Belinda J Gabbe

    Full Text Available BACKGROUND: Traumatic brain injury (TBI remains a leading cause of death and disability. The National Institute for Health and Clinical Excellence (NICE guidelines recommend transfer of severe TBI cases to neurosurgical centres, irrespective of the need for neurosurgery. This observational study investigated the risk-adjusted mortality of isolated TBI admissions in England/Wales, and Victoria, Australia, and the impact of neurosurgical centre management on outcomes. METHODS: Isolated TBI admissions (>15 years, July 2005-June 2006 were extracted from the hospital discharge datasets for both jurisdictions. Severe isolated TBI (AIS severity >3 admissions were provided by the Trauma Audit and Research Network (TARN and Victorian State Trauma Registry (VSTR for England/Wales, and Victoria, respectively. Multivariable logistic regression was used to compare risk-adjusted mortality between jurisdictions. FINDINGS: Mortality was 12% (749/6256 in England/Wales and 9% (91/1048 in Victoria for isolated TBI admissions. Adjusted odds of death in England/Wales were higher compared to Victoria overall (OR 2.0, 95% CI: 1.6, 2.5, and for cases <65 years (OR 2.36, 95% CI: 1.51, 3.69. For severe TBI, mortality was 23% (133/575 for TARN and 20% (68/346 for VSTR, with 72% of TARN and 86% of VSTR cases managed at a neurosurgical centre. The adjusted mortality odds for severe TBI cases in TARN were higher compared to the VSTR (OR 1.45, 95% CI: 0.96, 2.19, but particularly for cases <65 years (OR 2.04, 95% CI: 1.07, 3.90. Neurosurgical centre management modified the effect overall (OR 1.12, 95% CI: 0.73, 1.74 and for cases <65 years (OR 1.53, 95% CI: 0.77, 3.03. CONCLUSION: The risk-adjusted odds of mortality for all isolated TBI admissions, and severe TBI cases, were higher in England/Wales when compared to Victoria. The lower percentage of cases managed at neurosurgical centres in England and Wales was an explanatory factor, supporting the changes made to the NICE

  3. Employment Shifts in the Technical and Further Education Workforce in Victoria.

    Science.gov (United States)

    Shah, Chandra

    2003-01-01

    Analyzes changes in Technical and Further Education (TAFE) work force in Victoria, Australia, that occurred during the period 1993-98. Main changes include increased participation of women, significant growth in part-time employment, decline in full-time (mainly male) employment, and an increased use of seasonal teachers. (Includes 10 figures and…

  4. Water hyacinth hotspots in the Ugandan waters of Lake Victoria in ...

    African Journals Online (AJOL)

    Water hyacinth invaded Lake Victoria in the 1980s and, by 1998, had attained peak coverage of approximately 2 000 ha in the Ugandan waters of the lake. Control interventions, especially via biological means, significantly reduced the weed's coverage to non-nuisance levels (<10 ha) by 1999. Although resurgence was ...

  5. Royal Ageing: The Queen Mother and Queen Victoria

    OpenAIRE

    Mike Hepworth

    2002-01-01

    This paper is a reflection on the contribution of the image of the Queen Mother to the cultural construction of role models of positive ageing. The interest lies in the Queen Mother's performance in public of her roles as woman and royal personage particularly as she grew older. It is suggested that cultural analysis of the icon of the Queen Mother as a blend of gender and power suggests certain significant parallels with the imagery cultivated around the career of Queen Victoria in the later...

  6. Measuring the cost of leaving care in Victoria

    OpenAIRE

    Catherine Forbes; Brett Inder; Sunitha Raman

    2006-01-01

    On any given night in Victoria, around 4,000 children and young people live under the care and protection of the State. For many young people, this care extends over a long period of time, sometimes until their 18th birthday. It is well documented that young people leaving State care often lack the social and economic resources to assist them in making the transition into independent living. As a consequence, the long-term life outcomes from this group are frequently very poor. A recent repor...

  7. Australian doctors and the visual arts. Part 3. Doctor-artists in Victoria.

    Science.gov (United States)

    Hamilton, D G

    1986-06-09

    The contribution of doctors to the visual arts is being discussed in a series of six articles. The first two articles dealt with doctors and the visual arts in New South Wales. In this, the third, doctor-artists in Victoria are discussed.

  8. Monitoring geodynamic activity in the Victoria Land, East Antarctica: Evidence from GNSS measurements

    Science.gov (United States)

    Zanutta, A.; Negusini, M.; Vittuari, L.; Cianfarra, P.; Salvini, F.; Mancini, F.; Sterzai, P.; Dubbini, M.; Galeandro, A.; Capra, A.

    2017-10-01

    GNSS networks in Antarctica are a fundamental tool to define actual crustal displacements due to geological and geophysical processes and to constrain the glacial isostatic models (GIA). A large network devoted to the detection and monitoring of crustal deformations in the Northern Victoria Land (Victoria Land Network for DEFormation control - VLNDEF), was monumented during the 1999-2000 and 2000-2001 field campaigns, as part of Italian National Program for Antarctic Research and surveyed periodically during the Southern summer seasons. In this paper, GPS observations of VLNDEF collected over a more than 15-year span, together with various selected POLENET sites and more than 70 IGS stations, were processed with Bernese Software, using a classical double difference approach. A solution was obtained combining NEQs by means of ADDNEQ2/FODITS tools embedded in Bernese Software. All the Antarctic sites were kept free and a subset of 50 IGS stations were used to frame VLNDEF into ITRF2008. New evidence provided by analysis of GPS time series for the VLNDEF network is presented; also displacements along the vertical component are compared with the recently published GIA models. The absolute velocities indicate an overall displacement of the northern Victoria Land region along the south-east direction (Ve = 10.6 mm/yr, Vn = -11.5 mm/yr) and an average uplift rate of Vu = 0.5 mm/yr. Two GIA models have been analyzed: ICE-6G_C-VM5a proposed by Argus et al. (2014), Peltier et al. (2015) and W12A_v1 by Whitehouse et al. (2012a,b). Up rates, predicted over the VLNDEF sites by the mentioned GIA models, have been extracted and compared with those observed. A preliminary comparison with GPS-derived vertical rates shows that the Victoria Land ICE-6G_C-VM5 and W12A_v1 GIA models predict overestimated uplift rates of 0.7 and 0.9 mm/yr weighted mean residuals respectively. The mean horizontal relative motions within the Victoria Land (VL) area are in most cases negligible, while only

  9. Complex adenovirus-vectored vaccine protects guinea pigs from three strains of Marburg virus challenges

    International Nuclear Information System (INIS)

    Wang Danher; Hevey, Michael; Juompan, Laure Y.; Trubey, Charles M.; Raja, Nicholas U.; Deitz, Stephen B.; Woraratanadharm, Jan; Luo Min; Yu Hong; Swain, Benjamin M.; Moore, Kevin M.; Dong, John Y.

    2006-01-01

    The Marburg virus (MARV), an African filovirus closely related to the Ebola virus, causes a deadly hemorrhagic fever in humans, with up to 90% mortality. Currently, treatment of disease is only supportive, and no vaccines are available to prevent spread of MARV infections. In order to address this need, we have developed and characterized a novel recombinant vaccine that utilizes a single complex adenovirus-vectored vaccine (cAdVax) to overexpress a MARV glycoprotein (GP) fusion protein derived from the Musoke and Ci67 strains of MARV. Vaccination with the cAdVaxM(fus) vaccine led to efficient production of MARV-specific antibodies in both mice and guinea pigs. Significantly, guinea pigs vaccinated with at least 5 x 10 7 pfu of cAdVaxM(fus) vaccine were 100% protected against lethal challenges by the Musoke, Ci67 and Ravn strains of MARV, making it a vaccine with trivalent protective efficacy. Therefore, the cAdVaxM(fus) vaccine serves as a promising vaccine candidate to prevent and contain multi-strain infections by MARV

  10. Potentially avoidable hospitalisation for constipation in Victoria, Australia in 2010–11

    Science.gov (United States)

    2014-01-01

    Background When primary care of constipation fails, the patient may need emergency hospitalisation for disimpaction. This study aimed to provide population-based data on the number of unplanned admissions and the cost to the healthcare system for constipation in Victoria, Australia in financial year 2010–11. Methods The Victorian Admitted Episodes Dataset was examined to find the number of emergency hospital separations coded as constipation (ICD-10-AM Code K390). An estimate of costs was determined from the number of weighted inlier equivalent separations (WIES) multiplied by the WEIS price, used by the Victorian Government for funding purposes. Results There were 3978 emergency separations for constipation in Victoria in 2010–2011, 92% in public hospitals. Fifty-five percent were female and 38% > 75 years old. One third stayed overnight and 1/3 more than 1 day. The emergency bed day rate was 7.1 per 10,000 of population. The estimate of cost, based on WEIS, was approximately $8.3 million. Potential savings could be made by reducing the number of separations in 6 Local Government Areas (LGAs). Conclusions This study shows that the burden (in number of admissions, emergency bed days and overall direct costs) in managing emergency admissions for constipation in Victoria, Australia, is very significant and likely to be similar in other developed countries. Improved primary healthcare and alternative ways to achieve faecal disimpaction without emergency admission could save the public health system a proportion of this $8.3 million. PMID:25015386

  11. Distribution of Nile perch Lates niloticus in southern Lake Victoria is ...

    African Journals Online (AJOL)

    Although Nile perch Lates niloticus is assumed to be sensitive to low oxygen concentrations, it was found in deep water in Lake Victoria, where oxygen depletion is common during the rainy season. Since factors determining Nile perch distribution are not well understood its spatial distribution in the Mwanza Gulf of Lake ...

  12. Radon in an underground cave system in Victoria

    International Nuclear Information System (INIS)

    Hedt, J.C.; Boal, T.J.

    1998-01-01

    Radon levels in a cave system in Victoria have been measured. The variation of radon and radon progeny levels with time, position throughout the cave and season have been determined. The radiation exposure of tour guides were estimated. The data is being used to develop a radiation management plan for the tour guides. Radon concentration within a cave system was proven to be dependent to a large extent upon the rate of air exchange with outside. Cave ventilation is the single most important factor in determining if there is diurnal variation in the radon concentration

  13. Malaria vectors in Lake Victoria and adjacent habitats in western Kenya.

    Directory of Open Access Journals (Sweden)

    Noboru Minakawa

    Full Text Available The prevalence of malaria among the residents of the Lake Victoria basin remains high. The environment associated with the lake may maintain a high number of malaria vectors. Lake habitats including water hyacinths have been suspected to be the source of vectors. This study investigated whether malaria vectors breed in the lake habitats and adjacent backwater pools. Anopheline larvae were collected within the littoral zone of the lake and adjacent pools located along approximately 24.3 km of the lakeshore in western Kenya, and their breeding sites characterized. Three primary vector species, Anopheles arabiensis, Anopheles gambiae s.s. and Anopheles funestus s.s., and three potential vectors, were found in the lake habitats. Unexpectedly, An. arabiensis was the most dominant vector species in the lake sampling sites. Its habitats were uncovered or covered with short grass. A potential secondary malaria vector, Anopheles rivulorum, dominated the water hyacinths in the lake. Most breeding sites in the lake were limited to areas that were surrounded by tall emergent plants, including trees, and those not exposed to waves. Nearly half of adjacent habitats were lagoons that were separated from the lake by sand bars. Lagoons contained a variety of microhabitats. Anopheles arabiensis dominated open habitats, whereas An. funestus s.s. was found mainly in vegetated habitats in lagoons. The current study confirmed that several breeding sites are associated with Lake Victoria. Given that Lake Victoria is the second largest lake in the world, the lake related habitats must be extensive; therefore, making targeted vector control difficult. Further exploration is necessary to estimate the effects of lake associated habitats on malaria transmission so as to inform a rational decision-making process for vector control.

  14. A Single Amino Acid Change in the Marburg Virus Glycoprotein Arises during Serial Cell Culture Passages and Attenuates the Virus in a Macaque Model of Disease.

    Science.gov (United States)

    Alfson, Kendra J; Avena, Laura E; Delgado, Jenny; Beadles, Michael W; Patterson, Jean L; Carrion, Ricardo; Griffiths, Anthony

    2018-01-01

    Marburg virus (MARV) causes disease with high case fatality rates, and there are no approved vaccines or therapies. Licensing of MARV countermeasures will likely require approval via the FDA's Animal Efficacy Rule, which requires well-characterized animal models that recapitulate human disease. This includes selection of the virus used for exposure and ensuring that it retains the properties of the original isolate. The consequences of amplification of MARV for challenge studies are unknown. Here, we serially passaged and characterized MARV through 13 passes from the original isolate. Surprisingly, the viral genome was very stable, except for a single nucleotide change that resulted in an amino acid substitution in the hydrophobic region of the signal peptide of the glycoprotein (GP). The particle/PFU ratio also decreased following passages, suggesting a role for the amino acid in viral infectivity. To determine if amplification introduces a phenotype in an animal model, cynomolgus macaques were exposed to either 100 or 0.01 PFU of low- and high-passage-number MARV. All animals succumbed when exposed to 100 PFU of either passage 3 or 13 viruses, although animals exposed to the high-passage-number virus survived longer. However, none of the passage 13 MARV-exposed animals succumbed to 0.01-PFU exposure compared to 75% of passage 3-exposed animals. This is consistent with other filovirus studies that show some particles that are unable to yield a plaque in cell culture can cause lethal disease in vivo . These results have important consequences for the design of experiments that investigate MARV pathogenesis and that test the efficacy of MARV countermeasures. IMPORTANCE Marburg virus (MARV) causes disease with a high case fatality rate, and there are no approved vaccines or therapies. Serial amplification of viruses in cell culture often results in accumulation of mutations, but the effect of such cell culture passage on MARV is unclear. Serial passages of MARV

  15. Use of regionalisation approach to develop fire frequency curves for Victoria, Australia

    Science.gov (United States)

    Khastagir, Anirban; Jayasuriya, Niranjali; Bhuyian, Muhammed A.

    2017-11-01

    It is important to perform fire frequency analysis to obtain fire frequency curves (FFC) based on fire intensity at different parts of Victoria. In this paper fire frequency curves (FFCs) were derived based on forest fire danger index (FFDI). FFDI is a measure related to fire initiation, spreading speed and containment difficulty. The mean temperature (T), relative humidity (RH) and areal extent of open water (LC2) during summer months (Dec-Feb) were identified as the most important parameters for assessing the risk of occurrence of bushfire. Based on these parameters, Andrews' curve equation was applied to 40 selected meteorological stations to identify homogenous stations to form unique clusters. A methodology using peak FFDI from cluster averaged FFDIs was developed by applying Log Pearson Type III (LPIII) distribution to generate FFCs. A total of nine homogeneous clusters across Victoria were identified, and subsequently their FFC's were developed in order to estimate the regionalised fire occurrence characteristics.

  16. Hospital-treated injuries from horse riding in Victoria, Australia: time to refocus on injury prevention?

    Science.gov (United States)

    O'Connor, Siobhán; Hitchens, Peta L; Fortington, Lauren V

    2018-01-01

    The most recent report on hospital-treated horse-riding injuries in Victoria was published 20 years ago. Since then, injury countermeasures and new technology have aimed to make horse riding safer for participants. This study provides an update of horse-riding injuries that required hospital treatment in Victoria and examines changes in injury patterns compared with the earlier study. Horse-riding injuries that required hospital treatment (hospital admission (HA) or emergency department (ED) presentations) were extracted from routinely collected data from public and private hospitals in Victoria from 2002-2003 to 2015-2016. Injury incidence rates per 100 000 Victorian population per financial year and age-stratified and sex-stratified injury incidence rates are presented. Poisson regression was used to examine trends in injury rates over the study period. ED presentation and HA rates were 31.1 and 6.6 per 100 000 person-years, increasing by 28.8% and 47.6% from 2002 to 2016, respectively. Female riders (47.3 ED and 10.1 HA per 100 000 person-years) and those aged between 10 and 14 years (87.8 ED and 15.7 HA per 100 000 person-years) had the highest incidence rates. Fractures (ED 29.4%; HA 56.5%) and head injuries (ED 15.4%; HA 18.9%) were the most common injuries. HA had a mean stay of 2.6±4.1 days, and the mean cost per HA was $A5096±8345. Horse-riding injuries have remained similar in their pattern (eg, types of injuries) since last reported in Victoria. HA and ED incidence rates have increased over the last 14 years. Refocusing on injury prevention countermeasures is recommended along with a clear plan for implementation and evaluation of their effectiveness in reducing injury.

  17. Diel vertical migration of major fish-species in Lake Victoria, East Africa

    NARCIS (Netherlands)

    Goudswaard, P.C.; Wanink, J.H.; Witte, F.; Katunzi, E.F.B.; Berger, M.R.; Postma, D.J.

    2004-01-01

    Understanding of migration patterns is essential in the interpretation of hydro-acoustic stock assessment data of partly demersal partly pelagic fish stocks. In this paper we provide this kind of information for some species that were common in the Mwanza Gulf of Lake Victoria in the 1980s, before

  18. Diel vertical migration of major fish-species in Lake Victoria, East Africa.

    NARCIS (Netherlands)

    Goudswaard, KPC; Wanink, JH; Witte, F; Katunzi, EFB; Berger, MR; Postma, DJ

    2004-01-01

    Understanding of migration patterns is essential in the interpretation of hydro-acoustic stock assessment data of partly demersal partly pelagic fish stocks. In this paper we provide this kind of information for some species that were common in the Mwanza Gulf of Lake Victoria in the 1980s, before

  19. Collapse and reorganization of a food web of Mwanza Gulf, Lake Victoria

    NARCIS (Netherlands)

    Downing, A.S.; Van Nes, E.H.; Janse, J.H.; Witte, F.; Cornelissen, I.J.M.; Scheffer, M.; Mooij, W.M.

    2012-01-01

    Lake Victoria (in East Africa) is the world's second largest fresh-water system. Over the past century the ecosystem has undergone drastic changes. Some 30 years after the introduction of Nile perch and tilapia in the 1950s, the highly diverse community of native haplochromines collapsed, leaving a

  20. Marburg haemorrhagic fever: A rare but fatal disease

    African Journals Online (AJOL)

    The causative virus is the Marburgvirus of the Filoviridae family. The disease is clinically indistinguishable from Ebola haemorrhagic fever though the latter's causative agent is unrelated. Transmission of the Marburgvirus is via close contact with blood or other body fluids (faeces, vomitus, urine and respiratory secretions) ...

  1. MARATHON Verification (MARV)

    Science.gov (United States)

    2017-08-01

    variable business rules, unique entity behaviors, and extensive supply-demand relations. Senior leaders’ demand for animation and interactive...simulations provide dynamic animation / visualization / run-time plots. M4 has additional automated testing facilities thanks to the clojure.test library...marathon.vnv Clojure scripts) and software-assisted interactive forensic analysis (via Excel workbooks and the Clojure Read -Evaluate-Print Loop [REPL]) to

  2. Can a Skin Cancer Control Program make a Difference? A Profile of the SUNSMART Programme in Victoria

    International Nuclear Information System (INIS)

    Sinclair, C.; Dobbinson, S.; Montague, M.

    2000-01-01

    SunSmart is a programme of the Anti-Cancer Council of Victoria. It is an evidence-based health promotion programme where decisions about the form and content of the programme are influenced by available evidence and community consultation processes. A systematic evaluation and research strategy is in place to ensure that as much information as possible is available on process, impact and outcomes. Over the past 19 years the Anti-Cancer Council of Victoria has made a substantial impact in Victoria in relation to sun protection. It is one of the very few campaigns that has been able to demonstrate substantial changes not only in behaviour and attitudes but also in the downturn of skin cancer rates. Substantial sustainable changes have also occurred in the physical landscape as public authorities and commercial operators design their environment to be as sun protective as possible. This paper focuses on the key strategies that have encouraged positive change in the behaviour and attitudes of the Victorian population and the research that has documented the outcomes. (author)

  3. Intracellular Crosslinking of Filoviral Nucleoproteins with Xintrabodies Restricts Viral Packaging

    Directory of Open Access Journals (Sweden)

    Tamarand Lee Darling

    2017-09-01

    Full Text Available Viruses assemble large macromolecular repeat structures that become part of the infectious particles or virions. Ribonucleocapsids (RNCs of negative strand RNA viruses are a prime example where repetition of nucleoprotein (NP along the genome creates a core polymeric helical scaffold that accommodates other nucleocapsid proteins including viral polymerase. The RNCs are transported through the cytosol for packaging into virions through association with viral matrix proteins at cell membranes. We hypothesized that RNC would be ideal targets for crosslinkers engineered to promote aberrant protein–protein interactions, thereby blocking their orderly transport and packaging. Previously, we had generated single-domain antibodies (sdAbs against Filoviruses that have all targeted highly conserved C-terminal regions of NP known to be repetitively exposed along the length of the RNCs of Marburgvirus (MARV and Ebolavirus (EBOV. Our crosslinker design consisted of dimeric sdAb expressed intracellularly, which we call Xintrabodies (X- for crosslinking. Electron microscopy of purified NP polymers incubated with purified sdAb constructs showed NP aggregation occurred in a genus-specific manner with dimeric and not monomeric sdAb. A virus-like particle (VLP assay was used for initial evaluation where we found that dimeric sdAb inhibited NP incorporation into VP40-based VLPs whereas monomeric sdAb did not. Inhibition of NP packaging was genus specific. Confocal microscopy revealed dimeric sdAb was diffuse when expressed alone but focused on pools of NP when the two were coexpressed, while monomeric sdAb showed ambivalent partition. Infection of stable Vero cell lines expressing dimeric sdAb specific for either MARV or EBOV NP resulted in smaller plaques and reduced progeny of cognate virus relative to wild-type Vero cells. Though the impact was marginal at later time-points, the collective data suggest that viral replication can be reduced by crosslinking

  4. Recombinant Marburg viruses containing mutations in the IID region of VP35 prevent inhibition of Host immune responses.

    Science.gov (United States)

    Albariño, César G; Wiggleton Guerrero, Lisa; Spengler, Jessica R; Uebelhoer, Luke S; Chakrabarti, Ayan K; Nichol, Stuart T; Towner, Jonathan S

    2015-02-01

    Previous in vitro studies have demonstrated that Ebola and Marburg virus (EBOV and MARV) VP35 antagonize the host cell immune response. Moreover, specific mutations in the IFN inhibitory domain (IID) of EBOV and MARV VP35 that abrogate their interaction with virus-derived dsRNA, lack the ability to inhibit the host immune response. To investigate the role of MARV VP35 in the context of infectious virus, we used our reverse genetics system to generate two recombinant MARVs carrying specific mutations in the IID region of VP35. Our data show that wild-type and mutant viruses grow to similar titers in interferon deficient cells, but exhibit attenuated growth in interferon-competent cells. Furthermore, in contrast to wild-type virus, both MARV mutants were unable to inhibit expression of various antiviral genes. The MARV VP35 mutants exhibit similar phenotypes to those previously described for EBOV, suggesting the existence of a shared immune-modulatory strategy between filoviruses. Published by Elsevier Inc.

  5. Ebola Virus and Marburg Virus in Human Milk Are Inactivated by Holder Pasteurization.

    Science.gov (United States)

    Hamilton Spence, Erin; Huff, Monica; Shattuck, Karen; Vickers, Amy; Yun, Nadezda; Paessler, Slobodan

    2017-05-01

    Potential donors of human milk are screened for Ebola virus (EBOV) using standard questions, but testing for EBOV and Marburg virus (MARV) is not part of routine serological testing performed by milk banks. Research aim: This study tested the hypothesis that EBOV would be inactivated in donor human milk (DHM) by standard pasteurization techniques (Holder) used in all North American nonprofit milk banks. Milk samples were obtained from a nonprofit milk bank. They were inoculated with EBOV (Zaire strain) and MARV (Angola strain) and processed by standard Holder pasteurization technique. Plaque assays for EBOV and MARV were performed to detect the presence of virus after pasteurization. Neither EBOV nor MARV was detectable by viral plaque assay in DHM or culture media samples, which were pasteurized by the Holder process. EBOV and MARV are safely inactivated in human milk by standard Holder pasteurization technique. Screening for EBOV or MARV beyond questionnaire and self-deferral is not needed to ensure safety of DHM for high-risk infants.

  6. Lake Victoria wetlands and the ecology of the Nile tilapia, Oreochromis niloticus Linne

    NARCIS (Netherlands)

    Balirwa, J.S.

    1998-01-01

    An ecological study of wetlands was undertaken in northern Lake Victoria (East Africa) between 1993 and 1996 with a major aim of characterising shallow vegetation-dominated interface habitats, and evaluating their importance for fish, in particular, for the stocked and socio-economically

  7. Neoliberal policies and urban reconfigurations. Victoria, San Fernando, province of Buenos Aires, a city understood from theory

    Directory of Open Access Journals (Sweden)

    Laura Ester Donadío

    2016-07-01

    Full Text Available This article aims to explain from a theoretical conceptual approach the particularities that exist in Victoria, San Fernando, Buenos Aires, from its urban production. Through a series of field works, semi-structured interviews and observations, it was possible to perceive that in this locality, there are three logics of city production, market, state and necessity, according to Abramo, P. (2002. The post-development cities of Latin America, a space in which constant tensions are generated that alter the harmonious development of daily life and the interaction of those who inhabit the area. On the other hand, it is also perceived that the inhabitants naturalize that way of life, their spatial disposition, the progressive privatization of public areas and the proliferation of closed housing estates. Here is a quote that we have heard repeatedly in interviews with the neighbors: "No one in Victoria gives a ball to anyone." At the moment of understanding Victoria from the theory, we take into account such concepts as the "heterotopy" of Foucault M. (1967 - understood as the juxtaposition of spaces that would be incompatible -the term "com-fusa city" (Abramo P. - as an urban structure that interweaves two traditional models (the Mediterranean compact and the Anglo-Saxon diffused, the notion of "privatopia" by I.Rodriguez Chumillas (2005 and E. Mckenzie (1994 as private spatial consolidation, and finally the concepts: informative and dual cities of R Castells (1995 terms that emerge from the process of globalization, which may be useful to think about the reality of Victoria .

  8. Genetic analyses of resistance against Leptopilina victoriae in Drosophila bipectinata.

    Science.gov (United States)

    Takigahira, Tomohiro; Kohyama, Tetsuo I; Suwito, Awit; Kimura, Masahito T

    2015-06-01

    Drosophila bipectinata from Iriomote-jima (IR) is susceptible to the endoparasitoid Leptopilina victoriae from Kota Kinabalu (L. victoriae KK), but D. bipectinata from Kota Kinabalu (KK) and Bogor (BG) is resistant. The cross experiments between the resistant (KK) and susceptible (IR) populations of D. bipectinata suggested that the resistance to this parasitoid is a dominant trait and controlled by a single locus or few linked loci on an autosome. In the AFLP analysis using the IR, KK and BG populations of D. bipectinata and the resistant and susceptible populations derived from a mixed population of these three geographic populations, a DNA fragment almost specific to susceptible flies was detected. It also revealed that genes from the IR population were more frequently maintained in the mixed population compared with those from the KK and BG populations, suggesting that at least a number of genes from the IR population are more advantageous under the laboratory conditions. This explains our previous results that the resistance was lowered in the mixed population although the resistance itself is suggested to incur only low costs; i.e., the resistance gene(s) from the KK and BG populations would have been linked with some genes that are disadvantageous under the laboratory conditions.

  9. Surviving neoliberalism, maintaining values: Community health mergers in Victoria, Australia.

    Science.gov (United States)

    Roussy, Véronique; Livingstone, Charles

    2018-04-01

    Independent, not-for-profit community health services in the state of Victoria, Australia, provide one of that country's few models of comprehensive primary health care (PHC). Recent amalgamations among some such agencies created regional-sized community health organisations, in a departure from this sector's traditionally small local structure. This study explored the motivations, desired outcomes, and decision-making process behind these mergers. Qualitative exploratory study was based on 26 semistructured interviews with key informants associated with 2 community health mergers, which took place in 2014 in Victoria, Australia. Thematic data analysis was influenced by concepts derived from institutional theory. Becoming bigger by merging was viewed as the best way to respond to mounting external pressures, such as increasingly neoliberal funding mechanisms, perceived as threatening survival. Desired outcomes were driven by comprehensive PHC values, and related to creating organisational capacity to continue providing quality services to disadvantaged communities. This study offers insights into decision-making processes geared towards protecting the comprehensiveness of PHC service delivery for disadvantaged communities, ensuring financial viability, and surviving neoliberal economic policy whilst preserving communitarian values. These are relevant to an international audience, within a global context of rising health inequities, increasingly tight fiscal environments, and growing neoliberal influences on health policymaking and funding. Copyright © 2018 John Wiley & Sons, Ltd.

  10. Layers of 'Cabo Frio' in 'Victoria Crater'

    Science.gov (United States)

    2006-01-01

    This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is an approximately true color rendering of images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 750-nanometer, 530-nanometer and 430-nanometer filters.

  11. Three Licentiates of the Royal College of Surgeons of Edinburgh who were decorated with the Victoria Cross.

    Science.gov (United States)

    Kaufman, M H

    2011-08-01

    Since the Victoria Cross was introduced in January 1856 by Queen Victoria to reward acts of valour in the face of the enemy, initially during the Crimean War, over 1350 medals have been awarded. Of these, three were awarded to medical officers who had previously gained the Licentiate Diploma of the Royal College of Surgeons of Edinburgh (LRCS Edin) - Valentine Munbee McMaster on 25 September 1857, Henry Thomas Sylvester on 20 November 1857 (although the acts of valour for which he was awarded his VC occurred on two occasions in September 1855) and Campbell Mellis (or Millis) Douglas on 7 May 1867.

  12. LAKE VICTORIA AND THE COMMON PROPERTY DEBATE: IS THE TRAGEDY OF THE COMMONS A THREAT TO ITS FUTURE?

    Directory of Open Access Journals (Sweden)

    Erick Ochieng OGELLO

    2013-12-01

    Full Text Available Lake Victoria is the largest among the African Great Lakes in East African region that are believed to have both dynamic and fragile aquatic ecosystems. Within two decades, the lake has experienced extensive resource exploitation leading to constrained productivity and drastic decline of native biodiversity. Intensive non-selective fishing, catchment vegetation degradation, industrial and agricultural pollution, the introduction of exotic species and uneven patchwork of governmental laws are some of the reasons for the current ecological woes facing Lake Victoria. This paper intends to stimulate recognition of Lake Victoria and its catchment as a lived Com­mons, to be shared, protected, managed and enjoyed by all who live around it. The paper compares the original biodiversity status of the lake with the current status and discusses the role of unlimited access as a function of the loss of the Lake’s biological wealth. The Lake’s water resource base, fishery, wetlands and other aquatic resources have been exhaustively discussed. In this review, we uphold the Hardin’s school of thought that freedom of the commoners causes resource overuse leading to poverty. Therefore, limiting freedom could be essential. However, there is need for provision of alternative means of survival since people with no choices would continue over-exploiting ecosystems even under limited access. The Lake Victoria basin commons should be protected by strict legal and clear political frame­work based on public trust doctrine, reinforced in law that the Lake is vital for the survival of people, plants and animals living on or near it and therefore must be protected for the common good. The political jurisdictions should consider governing the Lake basin as one integrated watershed. It is our fervent hope that bordering communities will secure grass root movements to protect and nurture Lake Victoria and its environs for the benefit of the present and future

  13. Did the use of chloroform by Queen Victoria influence its acceptance in obstetric practice?

    Science.gov (United States)

    Connor, H; Connor, T

    1996-10-01

    Examination of contemporaneous publications suggests that the use of chloroform by Queen Victoria in 1853 did not result in the major breakthrough in the acceptability of obstetric anaesthesia with which the event has been credited by some later writers.

  14. The Killing of the Workers' Educational Association of Victoria: A Myth Challenged

    Science.gov (United States)

    Dadswell, Gordon

    2004-01-01

    On 21 March 1941, the Council of the Workers' Educational Association of Victoria, Australia, (the Association) voted the organisation out of existence. The demise was in no way contemplated, and there was no practical reason why the Council acted in the way it did. This paper is the story of the destruction of a successful adult education…

  15. Isotopic character of Cambro-Ordovician plutonism, southern Victoria Land

    International Nuclear Information System (INIS)

    Cox, S.C.; Parkinson, D.L.; Allibone, A.H.; Cooper, A.F.

    2000-01-01

    Previous mapping of granitoid rocks in the Dry Valleys area of southern Victoria Land, Antarctica, identified the calc-alkaline (DV1a), adakitic (DV1b), and monzonitic (DV2) suites. A fourth older suite comprising alkaline gabbro, syenite, and A-type granite occurs in the Mt Dromedary area c. 80 km to the south. U-Pb zircon dating of Bonney Pluton, the largest calc-alkaline DV1a intrusion, indicates emplacement of this regional-scale body at 505 +/- 2 Ma. Pb-loss and inherited zircon were common to Bonney Pluton analyses of this study. U-Pb dating of monazite from Valhalla Pluton, a principal DV1b suite adakitic intrusion, indicates emplacement at 488 +/- 2 Ma. The Bonney Pluton age constrains the peak of calc-alkaline plutonism at 505 Ma and the Valhalla Pluton age records the major pulse of adakitic plutonism that is inferred to mark the final stages of subduction c. 490 Ma along this section of the East Antarctic margin. Nd and Sr isotope data for the calc-alkaline DV1a suite and adakitic DV1b suite define distinct ranges for each suite, supporting their subdivision on the basis of field relationships, petrography, and whole-rock geochemistry. Calc-alkaline DV1a suite granite magmas have eNd(T) = -4.2 to -6.1 and Sri = 0.7071-0.7079, whereas the adakitic DV1b suite rocks have a wider range of eNd(T) = -1.9 to -7.2 and Sri = 0.7065-0.7097. The isotopic data suggest a significant mantle component and subordinate crustal component in the source region of both suites. Time-dependent variations in the isotopic ratios of DV1a and DV1b suites imply a progressive increase in the proportion of more radiogenic material in the source region of the granitoid rocks, either mantle- or crust-derived material. Larger adakitic DV1b plutons are more 'evolved' than equivalent, smaller plutons of the same DV1b suite. Vanda Dikes and monzonitic DV2 suite intrusions are characterised by particularly low Sri = 0.7044-0.7067 and near-constant eNd(T) = -4.8 to -5.3, which indicate a

  16. A recovery-based outreach program in rural Victoria.

    Science.gov (United States)

    Prabhu, Radha; Browne, Mark Oakley

    2007-04-01

    A recovery-based outreach program for people with severe mental illness in regional Victoria is described. The paper covers a description of the program, the services provided and outcomes achieved. The program emphasized active collaboration between patients and clinicians as outlined in the collaborative recovery model and recognized that recovery from mental illness is an individual, personal process. The program provided service to 108 people over 3 years and had a positive impact on clinicians, patients and carers. The benefits of recovery orientation, multidisciplinary teams, collaborative relationships and carer involvement are discussed. The paper highlights the need for a focus on recovery and comprehensive care for people with severe mental illness.

  17. Towards understanding hydroclimatic change in Victoria, Australia – preliminary insights into the "Big Dry"

    Directory of Open Access Journals (Sweden)

    A. S. Kiem

    2010-03-01

    Full Text Available Since the mid-1990s the majority of Victoria, Australia, has experienced severe drought conditions (i.e. the "Big Dry" characterized by streamflow that is the lowest in approximately 80 years of record. While decreases in annual and seasonal rainfall totals have also been observed, this alone does not seem to explain the observed reduction in flow. In this study, we investigate the large-scale climate drivers for Victoria and demonstrate how these modulate the regional scale synoptic patterns, which in turn alter the way seasonal rainfall totals are compiled and the amount of runoff per unit rainfall that is produced. The hydrological implications are significant and illustrate the need for robust hydrological modelling, that takes into account insights into physical mechanisms that drive regional hydroclimatology, in order to properly understand and quantify the impacts of climate change (natural and/or anthropogenic on water resources.

  18. Critical influences on succession management for non-commissioned ranks within Victoria police

    OpenAIRE

    Owbridge, Lynne Michelle

    2017-01-01

    This thesis examines issues affecting succession management within noncommissioned ranks (NCRs) of policing services. Using Victoria Police (VicPol) as a case study, this research explored the organisation's capacity to build individual and organisational capability through adequate recruitment of new police, professional learning, and retaining talent within NCRs. A grounded theory approach was used to explore VicPol's recruitment, foundation training, transfer, promotion, ...

  19. Comparing electricity distribution network revenues and costs in New South Wales, Great Britain and Victoria

    International Nuclear Information System (INIS)

    Mountain, Bruce; Littlechild, Stephen

    2010-01-01

    A decade ago, electricity distribution network revenues per customer in New South Wales (NSW) were twice those in Great Britain (GB). Recent price controls imply that by 2014 they will be nearly four times as high. This paper examines possible reasons for this. The main reason does not seem to be geography, operating environment or industry structure. GB and Victoria have managed to accommodate increasing demand at broadly constant or even declining costs and revenues while delivering higher quality of service, while NSW has not. The regulatory framework and the practice of the regulatory body within that framework seem relevant. Australian regulators have not used benchmarking techniques as the GB regulator has. Perhaps the most important explanatory factor is private ownership in GB and Victoria compared to state ownership in NSW. This could also impact on the nature and effectiveness of regulation. (author)

  20. Paediatric doses from diagnostic radiology in Victoria

    International Nuclear Information System (INIS)

    Boal, T.J.; Cardillo, I.; Einsiedel, P.F.

    1998-01-01

    This study examines doses to paediatric patients from diagnostic radiology. Measurements were made at 29 hospitals and private radiology practices in the state of Victoria. Entrance skin doses in air were measured for the exposure factors used by hospital radiology departments and private radiology practices for a standard size 1, 5, 10 and 15 year old child, for the following procedures: chest AP/PA, lat; abdomen AP; pelvis AP; lumbar spine AP, lat; and skull AP, lat. There was a large range of doses for each particular procedure and age group. Factors contributing to the range of doses were identified. Guidance levels for paediatric radiology based on the third quartile value of the skin entrance doses have been recommended and are compared with guidance levels. Copyright (1998) Australasian Physical and Engineering Sciences in Medicine

  1. Supervision and Satisfaction among School Psychologists: An Empirical Study of Professionals in Victoria, Australia

    Science.gov (United States)

    Thielking, Monica; Moore, Susan; Jimerson, Shane R.

    2006-01-01

    This study examined the supervision arrangements and job satisfaction among school psychologists in Victoria, Australia. Participation in professional supervision was explored in relation to the type of employment and job satisfaction. The results revealed that the frequency of participation in supervision activities was less than optimal, with…

  2. Poética de la autotraducción: María Victoria Atencia

    Directory of Open Access Journals (Sweden)

    López Martínez, María Isabel

    2015-12-01

    Full Text Available Self-translation is an ancient but poorly researched practice. This article analyses an exceptional case: the reflection on self-translation as exposed in poetry. A case in point is the poem «Voz traducida», from the poetry collection De la llama en que arde (1988. Indeed, the poem selected for examination was written by M.ª Victoria Atencia (Málaga, 1931, an expert both in writing poetry and in translating literature. Her book of poems also contains an original text, «Rosas», in Galician, and its corresponding Spanish translation. Both translation and reflection are complementary in her compositions. These poetic creations attest to the fact that artfulness works as a depiction of the next creation. Furthermore, this study will deeply explore the poet’s most important literary thoughts.La autotraducción es una práctica antigua, pero poco estudiada. El presente artículo analiza un caso excepcional: la reflexión sobre la autotraducción expuesta en la lírica. Para ello, se analiza el poema de M.ª Victoria Atencia «Voz traducida», perteneciente al libro titulado De la llama en que arde (1988. Es un ejemplo de que la tarea de traducir funciona como un motivo que origina una nueva creación. Además, permite que el lector conozca facetas importantes del pensamiento literario de la escritora. M.ª Victoria Atencia, además de poeta, es una experta traductora. El libro contiene también dos versiones del poema «Rosas», en gallego y en español, pruebas de la dimensión práctica de los planteamientos teóricos de la autora y de su coherencia estética. Ambas facetas, la traducción y la reflexión, son complementarias en la obra de la autora.

  3. Focus on Form and Corrective Feedback Research at the University of Victoria, Canada

    Science.gov (United States)

    Chen, Sibo; Nassaji, Hossein

    2018-01-01

    The Department of Linguistics at University of Victoria (UVic) in Canada has a long-standing tradition of empirical approaches to the study of theoretical and applied linguistics. As part of the Faculty of Humanities, the department caters to students with a wide range of backgrounds and interests, and provides crucial language teaching support in…

  4. Layers of 'Cabo Frio' in 'Victoria Crater' (Stereo)

    Science.gov (United States)

    2006-01-01

    This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is a red-blue stereo anaglyph generated from images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 430-nanometer filters.

  5. The Tangible Economic benefits of the 20th Session of the United Nations World Tourism Organisation General Assembly to Victoria Falls, Zimbabwe

    Directory of Open Access Journals (Sweden)

    Cleopas Njerekai

    2014-01-01

    Full Text Available This paper is a documentation of the tangible economic benefits that accrued to the town of Victoria Falls, Zimbabwe, by co-hosting with Zambia, the 20th session of the United Nations World Tourism Organisation (UNWTO General Assembly (GA in 2013. The paper intends to offset speculations, half-truths and exaggerations on the tangible economic benefits of the event to the town and to contribute significantly to the scanty existing literature on the impact of these events to developing countries. A single case study research design focusing on the town was adopted for this study. The study participants to the research included tourism and hospitality organizations, the Victoria Falls municipality authorities, service providers and Victoria Falls town residents. Researcher administered questionnaires, semi-structured interviews and observation check lists were used to collect the data. In general, although the GA brought some significant transformative effects to the town of Victoria Falls in terms of employment creation, infrastructural development, revenue generation and the country's image, future host cities and countries to this event should mobilize adequate funds for the event, time it appropriately, ensure a fair spread of the benefits to various sectors and put up structures that do not turn into white elephants soon after the event.

  6. Reconstruction of Late Pleistocene Paleoenvironments using bulk geochemistry of paleosols from the Lake Victoria Region

    Science.gov (United States)

    Beverly, Emily J.; Peppe, Daniel J.; Driese, Steven G.; Blegen, Nick; Faith, J. Tyler; Tryon, Christian A.; Stinchcomb, Gary E.

    2017-11-01

    The impact of changing environments on the evolution and dispersal of Homo sapiens is highly debated, but few data are available from equatorial Africa. Lake Victoria is the largest freshwater lake in the tropics and is currently a biogeographic barrier between the eastern and western branches of the East African Rift. The lake has previously desiccated at 17 ka and again at 15 ka, but little is known from this region prior to the Last Glacial Maximum. The Pleistocene terrestrial deposits on the northeast coast of Lake Victoria (94 to 36 ka) are ideal for paleoenvironmental reconstructions where volcaniclastic deposits (tuffs), fluvial deposits, tufa, and paleosols are exposed, which can be used to reconstruct Critical Zones (CZ) of the past (paleo-CZs). The paleo-CZ is a holistic concept that reconstructs the entire landscape using geologic records of the atmosphere, hydrosphere, lithosphere, biosphere, and pedosphere (the focus of this study). New paleosol-based mean annual precipitation (MAP) proxies from Karungu, Rusinga Island, and Mfangano Island indicate an average MAP of 750108 mm yr-1 (CALMAG), 800182 mm yr-1 (CIA-K), and 1010228 mm yr-1 (PPM1.0) with no statistical difference throughout the 11 m thick sequence. This corresponds to between 54 and 72% of modern precipitation. Tephras bracketing these paleosols have been correlated across seven sites, and sample a regional paleo-CZ across a 55 km transect along the eastern shoreline of the modern lake. Given the sensitivity of Lake Victoria to precipitation, it is likely that the lake was significantly smaller than modern between 94 ka and 36 ka. This would have removed a major barrier for the movement of fauna (including early modern humans) and provided a dispersal corridor across the equator and between the rifts. It is also consistent with the associated fossil faunal assemblage indicative of semi-arid grasslands. During the Late Pleistocene, the combined geologic and paleontological evidence suggests a

  7. A review of mercury in Lake Victoria, East Africa: implications for human and ecosystem health.

    Science.gov (United States)

    Campbell, Linda; Dixon, D G; Hecky, R E

    2003-01-01

    Lake Victoria, East Africa, has been the site of many recent studies measuring mercury (Hg) concentrations in water, fish, sediment, soil, and humans. Most of these studies were motivated by concerns about Hg contamination from processing of gold ore on the southern shores. Total Hg (THg) concentrations in fish were usually below permissible World Health Organization (WHO) concentrations and international marketing limits and do not threaten the lucrative export industry. Nile perch 3-10 kg and most >10 kg had THg concentrations above the WHO threshold concentrations for at-risk groups (200 ng/g). Elevated THg concentrations in large Nile perch are not of major concern because Nile perch are rarely consumed by the people living on Lake Victoria and very large Nile perch are becoming increasingly rare in catches. Water THg concentrations were below Canadian drinking water guidelines but were elevated relative to those in the northern Great Lakes. Sediment and soil THg concentrations were within inter-national guidelines and are comparable to those in northern latitudes but are lower than those in the Amazon basin. Biomass burning and soil erosion are estimated to be the major sources of THg for the lake and probably constitute a larger source of THg than gold mining in Tanzania.THg concentrations in urine and hair from human volunteers indicate that while gold miners and frequent skin-bleaching cream users are at risk of inorganic mercury poisoning, the rest of the population, including fishermen, is not. Human exposure assessments demonstrated that fish consumption and soil geophagy constitute major sources of THg for humans, but the total estimated daily intake of THg was below the Health Canada tolerable daily intake (TDI) limits. The use of beauty creams containing high inorganic Hg concentrations, however, caused the estimated THg exposure to exceed the TDI. The high THg content in the hair of regular cream users supports this assessment. The nutritional

  8. Reconstruction of Late Pleistocene Paleoenvironments Using Bulk Geochemistry of Paleosols from the Lake Victoria Region

    Directory of Open Access Journals (Sweden)

    Emily J. Beverly

    2017-11-01

    Full Text Available The impact of changing environments on the evolution and dispersal of Homo sapiens is highly debated, but few data are available from equatorial Africa. Lake Victoria is the largest freshwater lake in the tropics and is currently a biogeographic barrier between the eastern and western branches of the East African Rift. The lake has previously desiccated at ~17 ka and again at ~15 ka, but little is known from this region prior to the Last Glacial Maximum. The Pleistocene terrestrial deposits on the northeast coast of Lake Victoria (94–36 ka are ideal for paleoenvironmental reconstructions where volcaniclastic deposits (tuffs, fluvial deposits, tufa, and paleosols are exposed, which can be used to reconstruct Critical Zones (CZ of the past (paleo-CZs. The paleo-CZ is a holistic concept that reconstructs the entire landscape using geologic records of the atmosphere, hydrosphere, lithosphere, biosphere, and pedosphere (the focus of this study. New paleosol-based mean annual precipitation (MAP proxies from Karungu, Rusinga Island, and Mfangano Island indicate an average MAP of 750 ± 108 mm year−1 (CALMAG, 800 ± 182 mm year−1 (CIA-K, and 1,010 ± 228 mm year−1 (PPM1.0 with no statistical difference throughout the 11 m thick sequence. This corresponds to between 54 and 72% of modern precipitation. Tephras bracketing these paleosols have been correlated across seven sites, and sample a regional paleo-CZ across a ~55 km transect along the eastern shoreline of the modern lake. Given the sensitivity of Lake Victoria to precipitation, it is likely that the lake was significantly smaller than modern between 94 and 36 ka. This would have removed a major barrier for the movement of fauna (including early modern humans and provided a dispersal corridor across the equator and between the rifts. It is also consistent with the associated fossil faunal assemblage indicative of semi-arid grasslands. During the Late Pleistocene, the combined geologic and

  9. NAPLAN Scores as Predictors of Access to Higher Education in Victoria

    OpenAIRE

    Brendan Houng; Moshe Justman

    2014-01-01

    This paper examines the extent to which year-9 performance on the National Assessment Program—Language Arts and Numeracy (NAPLAN) predicts access to higher education as determined by subsequent achievement on year-12 Victoria Certificate of Education (VCE) exams. VCE performance is measured via three binary indicators: achieving an Australian tertiary admission rank (ATAR) above 50 ("ATAR50"), above 70 ("ATAR70"), and above 90 ("ATAR90"); and two continuous indicators: ATAR and the Tertiary E...

  10. Perception of Aquaculture Education to Support Further Growth of Aquaculture Industry in Victoria, Australia

    Science.gov (United States)

    Awal, Sadiqul; Christie, Andrew; Watson, Matthew; Hannadige, Asanka G. T.

    2012-01-01

    Purpose: The central aim of this study was to determine the perception of aquaculture educational provisions in the state of Victoria, and whether they are sufficient to ultimately support further growth of the industry. Design/methodology/approach: Questionnaires were formulated and distributed to participants in a variety of ways, including via…

  11. Chlamydia pecorum Infection in Free-ranging Koalas ( Phascolarctos cinereus ) on French Island, Victoria, Australia.

    Science.gov (United States)

    Legione, Alistair R; Amery-Gale, Jemima; Lynch, Michael; Haynes, Leesa; Gilkerson, James R; Sansom, Fiona M; Devlin, Joanne M

    2016-04-28

    We detected Chlamydia pecorum in two koalas ( Phascolarctos cinereus ) from a closed island population in Victoria, Australia, previously free of Chlamydia infection. The ompA and multilocus sequence type were most closely related to published isolates of livestock rather than koala origin, suggesting potential cross-species transmission of C. pecorum .

  12. Factors relating to hospitalisation and economic burden of paediatric constipation in the state of Victoria, Australia, 2002-2009.

    Science.gov (United States)

    Ansari, Humaira; Ansari, Zahid; Lim, Tracy; Hutson, John M; Southwell, Bridget R

    2014-12-01

    Constipation is common, with severe symptoms requiring hospitalisation. Constipation can be a primary (present at admission and requires treatment or investigation) or principal (first listed) diagnosis for hospitalisation. In the USA, constipation is the second most common ambulatory care digestive diagnosis with total costs >US$1.7 billion/year. Incidence of hospitalisation for constipation in children peaks at toilet-training age. This study determined the burden of paediatric constipation to hospital care in Victoria, Australia. The Victorian Admitted Episodes Dataset was analysed retrospectively, examining hospital admissions with a primary diagnosis of constipation in the 7-year period 2002/2003 to 2008/2009. For children, constipation was recorded as a primary diagnosis in 8688 admissions (3.6/1000 of population). In-hospital prevalence was ∼1.0%. Mean length of stay was 4.4 days (median 1.0, range 0-993, standard deviation 16.7). There were 1121 readmissions in 668 children. Average treatment cost was A$4235/admission (median A$1461, range A$0-$278 816), with annual costs of ∼A$5 505 500. Children in the highest socio-economic area had ∼50% fewer admissions (P disadvantage, public hospital, planned admission, longer length of stay and association with other medical conditions. This study identified that constipation in children is a significant cost burden in Victoria (costing public hospitals ∼A$5.5 million/year). Hospitalisation in Victoria is 10-fold higher than in the USA with 10% readmissions within a month. We conclude that strategies aimed at reducing hospitalisation for constipation could result in significant savings for the paediatric public health system in Victoria, Australia. © 2014 The Authors. Journal of Paediatrics and Child Health © 2014 Paediatrics and Child Health Division (Royal Australasian College of Physicians).

  13. The radiocarbon dating project at Aboriginal Affairs, Victoria

    International Nuclear Information System (INIS)

    Godfrey, M.C.S.

    1997-01-01

    The purpose of this project has been to publish a complete list of the age estimates relating to the archaeological sites in the State of Victoria from 1951 to 1995, and to assess the value and the limitations of this information for interpreting the prehistory of this region. This project has recorded 476 dates coming from 14 laboratories, and ranging in age from the time of European settlement to the limit of the technique at around 40,000 years BP. However, the available evidence indicates that large discrepancies may exist in these results, and this has lead to the recommendation that this data should not be used in research projects requiring dating accuracies of less than a few hundred years

  14. Live Attenuated Recombinant Vaccine Protects Nonhuman Primates Against Ebola and Marburg Viruses

    National Research Council Canada - National Science Library

    Jones, Steven M; Feldmann, Heinz; Stroher, Ute; Geisbert, Joan B; Fernando, Lisa; Grolla, Allen; Klenk, Hans-Dieter; Sullivan, Nancy J; Volchkov, Viktor E; Fritz, Elizabeth A; Daddario, Kathleen M; Hensley, Lisa E; Jahrling, Peter B; Geisbert, Thomas W

    2005-01-01

    ...). Here, we developed replication-competent vaccines against EBOV and MARV based on attenuated recombinant vesicular stomatitis virus vectors expressing either the EBOV glycoprotein or MARV glycoprotein...

  15. ‘A token of their love’: Queen Victoria Memorials in New Zealand

    OpenAIRE

    Stocker, Mark

    2016-01-01

    This article provides an overview of the four metropolitan sculptural memorials to Queen Victoria in late-colonial New Zealand, which all immediately precede the colony’s Dominion status (1907). In chronological order, they were erected in Auckland, Christchurch, Wellington, and Dunedin. While the Auckland memorial was unveiled within the Queen’s lifetime, her death in 1901 catalysed the commission of more ambitious counterparts in Wellington and Dunedin, and a degree of intercity rivalry was...

  16. A real-options analysis of wine grape farming in north west Victoria

    OpenAIRE

    Seyoum, Emayenesh; Chan, Chris

    2012-01-01

    This paper reports a use of a real-options valuation methodology to analyse wine grape farm investment under price and yield uncertainty. Revenue levels to incentivise entry and exit were calculated for three different sizes of wine grape farms in North West Victoria. The modelling identified lower exit and higher entry triggers than indicated by conventional net present value calculation. The wide gap of estimated indeterminacy in farm investment highlights the intertwined influence of numer...

  17. The origins of the Frente para la Victoria in Argentina (1988-2003

    Directory of Open Access Journals (Sweden)

    Pamela SOSA

    2017-10-01

    Full Text Available The article reconstructs the trajectory of the Frente para la Victoria in the Argentinean province of Santa Cruz between 1988 y 2003. Period during which this political force was formed, forged its main attributes and amass the political capital that allow it to reach the presidency of the Nation in 2003, position that holds to December 2015. This organization was built outside the dominant structures and groups of the provincial politics.

  18. Marburg virus VP35 can both fully coat the backbone and cap the ends of dsRNA for interferon antagonism.

    Directory of Open Access Journals (Sweden)

    Shridhar Bale

    2012-09-01

    Full Text Available Filoviruses, including Marburg virus (MARV and Ebola virus (EBOV, cause fatal hemorrhagic fever in humans and non-human primates. All filoviruses encode a unique multi-functional protein termed VP35. The C-terminal double-stranded (dsRNA-binding domain (RBD of VP35 has been implicated in interferon antagonism and immune evasion. Crystal structures of the VP35 RBD from two ebolaviruses have previously demonstrated that the viral protein caps the ends of dsRNA. However, it is not yet understood how the expanses of dsRNA backbone, between the ends, are masked from immune surveillance during filovirus infection. Here, we report the crystal structure of MARV VP35 RBD bound to dsRNA. In the crystal structure, molecules of dsRNA stack end-to-end to form a pseudo-continuous oligonucleotide. This oligonucleotide is continuously and completely coated along its sugar-phosphate backbone by the MARV VP35 RBD. Analysis of dsRNA binding by dot-blot and isothermal titration calorimetry reveals that multiple copies of MARV VP35 RBD can indeed bind the dsRNA sugar-phosphate backbone in a cooperative manner in solution. Further, MARV VP35 RBD can also cap the ends of the dsRNA in solution, although this arrangement was not captured in crystals. Together, these studies suggest that MARV VP35 can both coat the backbone and cap the ends, and that for MARV, coating of the dsRNA backbone may be an essential mechanism by which dsRNA is masked from backbone-sensing immune surveillance molecules.

  19. Reforming Victoria's primary health and community service sector: rural implications.

    Science.gov (United States)

    Alford, K

    2000-01-01

    In 1999 the Victorian primary care and community support system began a process of substantial reform, involving purchasing reforms and a contested selection process between providers in large catchment areas across the State. The Liberal Government's electoral defeat in September 1999 led to a review of these reforms. This paper questions the reforms from a rural perspective. They were based on a generic template that did not consider rural-urban differences in health needs or other differences including socio-economic status, and may have reinforced if not aggravated rural-urban differences in the quality of and access to primary health care in Victoria.

  20. A decreasing trend in fall-related hip fracture incidence in Victoria, Australia.

    Science.gov (United States)

    Cassell, E; Clapperton, A

    2013-01-01

    In Victoria, Australia, the age-standardised incidence of fall-related hip fracture hospitalisations decreased significantly by 25% over the period 1998/1999-2008/2009. Significant decreases in fall-related hip fractures were observed in males and females, across all 5-year age groups, in Australian-born and overseas-born Victorians, in all socio-economic quintiles and in community-dwelling older people. The study aim was to investigate trends in the incidence of fall-related and hip fracture hospitalisations among Victorians aged 65 years and older overall and by age, gender, country of birth, socio-economic status (SES) and location of the event (home, residential care institution, etc.) over the 11-year period 1998/1999 to 2008/2009. Annual counts and age-standardised rates for fall-related hospitalisations among people aged 65 years and older were estimated using Victorian hospital admissions data. The statistical significance of changes in trends over time were analysed using a log-linear regression model of the rate data assuming a Poisson distribution of cases. Although the age-standardised incidence of fall-related hospitalisations increased significantly by 13% (95% confidence interval [CI], 9% to 18%) in Victoria, the age-standardised incidence of fall-related hip fracture hospitalisations decreased from 600/100,000 in 1998/1999 to 467/100,000 in 2008/2009 - an estimated overall reduction of 25% (95% CI, -29% to -22%). By contrast, the age-standardised incidence of fall-related hospitalisations for fractures at other body sites either increased significantly or showed no significant change. Significant decreases in fall-related hip fractures were observed in both males and females, across all 5-year age groups, in both Australian-born and overseas-born Victorians, in all socio-economic quintiles and in community-dwelling older people but not in people living in residential care facilities. Despite the downward trend in the age-standardised incidence of

  1. Layers of 'Cabo Frio' in 'Victoria Crater' (False Color)

    Science.gov (United States)

    2006-01-01

    This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is an enhanced false color rendering of images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 750-nanometer, 530-nanometer and 430-nanometer filters.

  2. Temporal associations with declining Trichomonas vaginalis diagnosis rates among women in the state of Victoria, Australia, 1947 to 2005.

    Science.gov (United States)

    Marrone, John; Fairley, Christopher K; Saville, Marian; Bradshaw, Catriona; Bowden, Francis J; Horvath, Leonie B; Donovan, Basil; Chen, Marcus; Hocking, Jane S

    2008-06-01

    To investigate the temporal associations between Trichomonas vaginalis (TV) diagnoses in women at a large urban sexual health clinic and a major Papanicolaou (Pap) smear screening laboratory in Victoria, Australia with Pap smear screening rates and the introduction of nitroimidazole treatments. An ecological analysis of TV diagnosis rates at the Melbourne Sexual Health Centre and the Victorian Cytology Service, Pap smear screening rates and nitroimidazole prescription data. Diagnoses of TV at the Melbourne Sexual Health Centre peaked in the 1950s at 20% to 30% and then rapidly declined through the 1960s and 1970s to below 1% in 1990. A similar pattern was observed at the Victorian Cytology Service. Metronidazole prescribing and opportunistic Pap smear screening began in Victoria in the 1960s coinciding with declining TV. The availability of tinidazole in 1976 led to further declines in TV in the late 1970s. A national cervical screening program introduced in 1991 was temporally associated with further declines in TV. Our analyses suggest that the introduction of metronidazole was associated with a large reduction in TV among Victorian women in the 1960s. The subsequent availability of tinidazole and increased Pap smear screening may have contributed to the current low TV prevalence in Victoria.

  3. Cross-Protection against Marburg Virus Strains by Using a Live, Attenuated Recombinant Vaccine

    National Research Council Canada - National Science Library

    Daddario-DiCaprio, Kathleen M; Geisbert, Thomas W; Geisbert, Joan B; Stroeher, Ute; Hensley, Lisa E; Grolla, Allen; Fritz, Elizabeth A; Feldmann, Friederike; Feldmann, Heinz; Jones, Steven M

    2006-01-01

    .... MARV is also considered to have potential as a biological weapon. Recently, we reported the development of a promising attenuated, replication-competent vaccine against MARV based on recombinant vesicular stomatitis virus (VSV...

  4. Communicating Risk with Parents: Exploring the Methods and Beliefs of Outdoor Education Coordinators in Victoria, Australia

    Science.gov (United States)

    Dallat, Clare

    2009-01-01

    This paper examines the risk communication strategies currently being employed by seven outdoor education co-ordinators in Government schools in Victoria, Australia. Of particular interest are the beliefs and assumptions held by these co-ordinators in relation to communicating risk with parents. Current policy stipulates that parents must be…

  5. Adverse events in surgical inpatients: A comparative analysis of public hospitals in Victoria

    OpenAIRE

    Katharina Hauck; Xueyan Zhao; Terri Jackson

    2010-01-01

    We compare adverse event rates for surgical inpatients across 36 public hospitals in the state of Victoria, Australia, conditioning on differences in patient complexity across hospitals. We estimate separate models for elective and emergency patients which stay at least one night in hospitals, using fixed effects complementary log-log models to estimate AEs as a function of patient and episode characteristics, and hospital effects. We use 4 years of patient level administrative hospital data ...

  6. Is the organisation and structure of hospital postnatal care a barrier to quality care? Findings from a state-wide review in Victoria, Australia.

    Science.gov (United States)

    McLachlan, Helen L; Forster, Della A; Yelland, Jane; Rayner, Joanne; Lumley, Judith

    2008-09-01

    to describe the structure and organisation of hospital postnatal care in Victoria, Australia. postal survey sent to all public hospitals in Victoria (n=71) and key-informant interviews with midwives and medical practitioners (n=38). Victoria, Australia. providers of postnatal care in Victorian public hospitals. there is significant diversity across Victoria in the way postnatal units are structured and organised and in the way care is provided. There are differences in numerous practices, including maternal and neonatal observations and the length of time women spend in hospital after giving birth. Although the benefits of continuity of care are recognised by health care providers, continuity is difficult to provide in the postnatal period. Postnatal care is provided in busy, sometimes chaotic environments, with many barriers to providing effective care and few opportunities for women to rest and recover after childbirth. The findings in this study can, in part, be explained by the lack of evidence that has been available to guide early postnatal care. current structures such as standard postnatal documentation (clinical pathways) and fixed length of stay, may inhibit rather than support individualised care for women after childbirth. There is a need to move towards greater flexibility in providing of early postnatal care, including alternative models of service delivery; choice and flexibility in the length of stay after birth; a focus on the individual with far less emphasis on care being structured around organisational requirements; and building an evidence base to guide care.

  7. Outbreaks of sarcoptic mange in free-ranging koala populations in Victoria and South Australia: a case series.

    Science.gov (United States)

    Speight, K N; Whiteley, P L; Woolford, L; Duignan, P J; Bacci, B; Lathe, S; Boardman, W; Scheelings, T F; Funnell, O; Underwood, G; Stevenson, M A

    2017-07-01

    To describe outbreaks of sarcoptic mange caused by Sarcoptes scabiei in free-ranging koalas in Victoria (December 2008 to November 2015) and South Australia (October 2011 to September 2014). Koalas affected by mange-like lesions were reported by wildlife carers, veterinary practitioners or State Government personnel to the Faculty of Veterinary and Agricultural Sciences at The University of Melbourne and the School of Animal and Veterinary Sciences at The University of Adelaide. Skin scrapings were taken from live and dead koalas and S. scabiei mites were identified. Tissues from necropsied koalas were examined histologically. Outbreaks of sarcoptic mange were found to occur in koalas from both Victoria (n = 29) and South Australia (n = 29) for the first time. The gross pathological and histopathological changes are described. We present the first reported cases of sarcoptic mange outbreaks in free-ranging koalas. © 2017 Australian Veterinary Association.

  8. The near boiling reactor: design of a small nuclear reactor for extending the operational envelope of the Victoria Class Submarine

    International Nuclear Information System (INIS)

    Cole, C.; Bonin, H.

    2005-01-01

    A small, inherently safe nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope, has been conceptually designed. The final reactor concept, named the Near Boiling (NB) Reactor, employs TRISO fuel particles in Zirconium cladded fuel rods. The reactor is light water moderated and cooled. The core life is specifically designed to coincide with the refit cycle of the Victoria Class Submarine. The reactor employs a simple and reliable control and shut down system that requires little intervention on the part of the submarine's crew. Also, a kinetic model is developed that demonstrates the inherent safety features of the reactor during several accident scenarios. (author)

  9. The near boiling reactor: design of a small nuclear reactor for extending the operational envelope of the Victoria Class Submarine

    Energy Technology Data Exchange (ETDEWEB)

    Cole, C.; Bonin, H. [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada)]. E-mail: chris.cole@rmc.ca; bonin-h@rmc.ca

    2005-07-01

    A small, inherently safe nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope, has been conceptually designed. The final reactor concept, named the Near Boiling (NB) Reactor, employs TRISO fuel particles in Zirconium cladded fuel rods. The reactor is light water moderated and cooled. The core life is specifically designed to coincide with the refit cycle of the Victoria Class Submarine. The reactor employs a simple and reliable control and shut down system that requires little intervention on the part of the submarine's crew. Also, a kinetic model is developed that demonstrates the inherent safety features of the reactor during several accident scenarios. (author)

  10. Two new species of zooplanktivorous haplochromine cichlids from Lake Victoria, Tanzania

    Directory of Open Access Journals (Sweden)

    Marnix de Zeeuw

    2013-01-01

    Full Text Available Two new species of zooplanktivorous haplochromine cichlids from Lake Victoria, Tanzania, are described and illustrated. These species closely resemble each other. Their affinities to other zooplanktivorous haplochromines from Lake Victoria are discussed. Haplochromis argens sp. n., which featured under nicknames (mainly H. “argens” in more than 50 papers, was caught both in the Mwanza Gulf and the Emin Pasha Gulf, whereas H. goldschmidti sp. n. was only found in the Emin Pasha Gulf. Of the latter species only males are available, but it seems unlikely that it represents a case of male colour polymorphism as several presumably unrelated characters differ in sympatry between the two species, suggesting that there is no gene flow. Statistical analysis revealed that the overall difference between the two species is greater than that between the populations from the two locations. Body depth of the two species in sympatry in the Emin Pasha Gulf was more similar than that of H. goldschmidti sp. n. and the allopatric population of H. argens sp. n. from the Mwanza Gulf, which may indicate an overall environmental effect. However, several measurements related to the width of snout and mouth differed more between the populations of the two species in sympatry than between the allopatric populations. In contrast to a group of zooplanktivorous species that recovered successfully after environmental changes in the lake, H. argens sp. n. is among a group that became extremely rare and probably is in danger of extinction; the conservation status of H. goldschmidti sp. n. is currently unknown.

  11. Sir James Reid and the Death of Queen Victoria: An Early Model for End-of-Life Care.

    Science.gov (United States)

    Abrams, Robert C

    2015-12-01

    An appraisal of the last ten days of Queen Victoria's life, viewed primarily from the perspective of her personal physician, Sir James Reid, is presented. Sir James' clinical encounters with his patient and the Royal Family are examined to reveal his strategic and medical thinking and gauge his level of success in basic palliative aims. It was found that the lack of effective medical interventions, tensions within the Royal Family, the importance of his post to Sir James' professional career, and the political ramifications unavoidably connected with the illness of a head of state, all presented challenges to Reid's efforts to ease the physical and emotional pain of Queen Victoria's dying. Key features of Sir James' approach included reliance on physician-patient and physician-family relationships, emphasis on emotional support for the patient, and the careful selection of interventions for the family. In the first years of the 20th century, an era when the contemporary concepts of palliative care, hospice, and family dynamics did not exist, Sir James' management of the Queen's final illness suggested an early model for end-of-life care. By the end of Queen Victoria's life, Sir James was seen to have preserved his patient's comfort and dignity, at the same time advancing family and societal acceptance of the death of this matriarchal figure. © The Author 2014. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  12. The influence of climate variability on numbers of three waterbird species in Western Port, Victoria, 1973 2002

    Science.gov (United States)

    Chambers, Lynda E.; Loyn, Richard H.

    2006-05-01

    Seasonal and annual movements of Australian waterbirds are generally more complex than those of their Northern Hemisphere counterparts, and long-term data are needed to understand their relationships with climatic variables. This paper explores a long-term (1973 2002) set of waterbird counts from coastal Victoria and relates them to climatic data at local and continental scales. Three species (Black Swan Cygnus atratus, White-faced Heron Egretta novaehollandiae and Grey Teal Anas gracilis) were chosen for this analysis. Black Swans have large local breeding populations near the study region; White-faced Herons have smaller local breeding populations and Grey Teal breed extensively in ephemeral inland floodplains, such as those in the Murray-Darling Basin. All showed significant relationships with streamflow, regional rainfall and the Southern Oscillation Index (SOI) at appropriate scales and time-lags, with streamflow explaining the most variance. Black Swans showed a strong seasonal cycle in abundance and local climate variables had the greatest influence on the counts. Numbers were positively correlated with streamflow in southern Victoria three to six seasons before each count. Broader-scale climatic patterns were more important for the other two species. Numbers of White-faced Herons were positively correlated with streamflow or rainfall over various parts of Australia seven to nine seasons before each count. Numbers of Grey Teal showed weak seasonal cycles, and were negatively correlated with rainfall in Victoria or the Murray-Darling Basin in the seasons before or during each count, and positively with streamflow in the Murray-Darling Basin 15 18 months before each count.

  13. Late holocene trends of phytoplankton productivity and anoxia as inferred from diatom and geochemical proxies in Lake Victoria, Eastern Africa

    Science.gov (United States)

    Andama, M.; Lejju, J. B.; Tolo, C. U.

    2013-11-01

    Lake Victoria ecosystem has undergone major ecological changes in the recent decades. Sedimentary diatom analysis and Fe / Mn determined by Energy Dispersive X-ray Fluorescence (EDXRF) have provided phytoplankton (diatom) productivity and the resultant anoxia (Fe / Mn) in Lake Victoria at Napoleon Gulf during the late Holocene (1778 cal yr BP (calibrated years before present) to 2008 AD) with radiocarbon dates determined using Accelerator Mass Spectrometry standard method. The results showed that increased total diatom counts in Napoleon Gulf during the late Holocene correspond with increased Fe / Mn ratio (anoxia) in some of the profiles and not in others and in most cases those that correspond correlate very well with increased eutrophication from nitrate input (Total Nitrogen, TN). Therefore slightly increased anoxia not related to increased diatom productivity was recorded in Lake Victoria at Napoleon Gulf from the period 1778 to 1135 cal yr BP. There was slightly increased diatom productivity at Napoleon Gulf from the period 857 to 758 cal yr BP but it did not increase anoxia in the lake. The period 415 cal yr BP to 2008 AD recorded increased anoxia at Napoleon Gulf related to high diatom productivity especially from 415 to 390 cal yr BP and 191 cal yr BP to 2008 AD.

  14. "Embodied Knowing": Exploring the Founding of the Melbourne Rudolf Steiner School in 1970S Victoria, Australia

    Science.gov (United States)

    Bak, Tao

    2018-01-01

    Education in Victoria, Australia not only underwent significant change in the 1970s, but was witness to a widespread educational reform project. Whilst exploration of the more widespread alternatives has been of some interest, the smaller progressive traditions that emerged in some ways "alongside" the broader reforms have rarely been…

  15. La memoria del último exilio español en la escritura de tres mujeres: Victoria Kent, Dolores Ibárruri y Carmen Parga

    Directory of Open Access Journals (Sweden)

    Bettina Pacheco

    2011-11-01

    Full Text Available Resumo: Este artigo realiza uma breve análise de três obras de testemunhos do exílio escritas por mulheres: Victoria Kent, destacada advogada socialista cromprometida com o governo da República Espanhola; Dolores Ibárruri, a mítica Pasionária; e Carmen Parga, republicana exilada na Rússia e México. As três dão sua visão, a sua maneira e através da escrita, sobre o drama vivido oferecendo sua concepção particular do exílio. Antes de entrar nas obras aludidas, examina-se brevemente as duas concepções sobre a dramática experiência do exilado que Cláudio Guillén reconheceu na escrita dos clássicos: Ovídio e Plutarco.Palavras-chave: Literatura comparada; literatura espanhola; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Resumen: Este artículo realiza um somero análisis de três obras testimoniales del exílio escritas por mujeres: Victoria Kent, destacada abogada socialista comprometida com el gobierno de la República Española; Dolores Ibárruri, la mítica Pasionaria; y Carmen Parga, republicana exiliada en Rusía y México. Las tres dan su visión, a su manera y a través de la escritura, sobre el drama vivido ofreciendo su concepción particular del exílio. Antes de entrar en las obras aludidas, se examina brevemente las dos concepiones sobre la dramática experiencia del exilado que Cláudio Guillén há reconocido em la escritura de dos clássicos: Ovídio y Plutarco.Palabras-clave: Literatura comparada; literatura española; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Keywords: Comparative literature; Spanish literature; Victoria Kent; Dolores Ibárruri; Carmen Parga; latin literature; Ovid; Plutarch; exile.

  16. Possible implications of Rabbit Calicivirus Disease for malleefowl Leipoa ocellata Gould in the north-west of Victoria

    NARCIS (Netherlands)

    Sandell, P.

    1999-01-01

    Parks Victoria and the Department of Natural Resources & Environment (NRE) are collaborating with agencies from the other States and the Commonwealth of Australia in a national program of detailed monitoring and surveillance of the effects of Rabbit Calicivirus Disease (RCD). A component of the

  17. A Review of the Taxation of Property: Local Government Rates in Victoria 1

    OpenAIRE

    Johnson, David T.

    1993-01-01

    The paper reviews the taxation of property in Victoria and in particular the method of raising revenue for local government from rural landowners. A major contradiction between the apparent philosophical basis and its application is identified. A modification to the existing method of calculation is suggested based on the use value of rural land. The advantages and disadvantages of the use value modification are discussed and compared to the system of property taxes presently used. The use me...

  18. Marburg Virus Reverse Genetics Systems

    Directory of Open Access Journals (Sweden)

    Kristina Maria Schmidt

    2016-06-01

    Full Text Available The highly pathogenic Marburg virus (MARV is a member of the Filoviridae family and belongs to the group of nonsegmented negative-strand RNA viruses. Reverse genetics systems established for MARV have been used to study various aspects of the viral replication cycle, analyze host responses, image viral infection, and screen for antivirals. This article provides an overview of the currently established MARV reverse genetic systems based on minigenomes, infectious virus-like particles and full-length clones, and the research that has been conducted using these systems.

  19. The reduction of the intrapartum still birth rate at the Queen Victoria Memorial Hospital.

    Science.gov (United States)

    Anderson, I; Chang, A; Renou, P; Wood, C

    1977-06-18

    A significant reduction in intrapartum anoxic fetal deaths has occurred at the Queen Victoria Memorial Hospital over the last ten years. The possible explanations for this include a variety of factors, which may either improve the health of the population presenting to the hospital, or improve obstetric care. Epidemiological evidence suggests that the use of fetal diagnostic techniques has contributed to the reduction of intrapartum anoxic still births.

  20. Health (Radiation Safety) Act 1983 (Victoria) No. 9889 of 17 May 1983

    International Nuclear Information System (INIS)

    1983-01-01

    This Act amends the Health Act 1958 by adding a new Section entitled ''Radiation Safety''. In addition to establishing guidelines for the registration and licensing of certain radiation apparatus and sealed radioactive sources, this new Section authorises the Governor in Council to make regulations concerning, inter alia, transport and disposal of radioactive substances and public health and safety. The Act also sets up a Radiation Advisory Committee and a Radiographers and Radiation Technologists Registration Board of Victoria and amends the Nuclear Activities (Prohibitions) Act 1983 in respect of certain licensing provisions. (NEA) [fr

  1. Birth centre confinement at the Queen Victoria Medical Centre: four years' experience.

    Science.gov (United States)

    Morris, N; Campbell, J; Biro, M A; Lumley, J; Rao, J; Spensley, J

    1986-06-09

    A review of the first four years of the functioning of the birth centre at the Queen Victoria Medical Centre is presented. In that time, 1040 pregnant women were accepted for confinement there. Of these, 52 withdrew for non-obstetric reasons, while 470 were transferred to alternative obstetrical care--274 because of antepartum complications and 196 because of intrapartum problems. Therefore, 518 women were delivered in the birth centre. The care of the women is entrusted almost entirely to a team of midwives and this review demonstrates an enviable safety record.

  2. Species-specific relationships between water transparency and male coloration within and between two closely related Lake Victoria cichlid species

    NARCIS (Netherlands)

    Castillo Cajas, Ruth F; Selz, Oliver M; Ripmeester, Erwin A P; Seehausen, Ole; Maan, Martine E

    2012-01-01

    Environmental variation in signalling conditions affects animal communication traits, with possible consequences for sexual selection and reproductive isolation. Using spectrophotometry, we studied how male coloration within and between populations of two closely related Lake Victoria cichlid

  3. Turning attention to clinician engagement in Victoria.

    Science.gov (United States)

    Jorm, Christine; Hudson, Robyn; Wallace, Euan

    2017-11-16

    The engagement of clinicians with employing organisations and with the broader health system results in better safer care for patients. Concerns about the adequacy of clinician engagement in the state of Victoria led the Victorian Department of Health and Human Services to commission a scoping study. During this investigation more than 100 clinicians were spoken with and 1800 responded to surveys. The result was creation of a clear picture of what engagement and disengagement looked like at all levels - from the clinical microsystem to state health policy making. Multiple interventions are possible to enhance clinician engagement and thus the care of future patients. A framework was developed to guide future Victorian work with four elements: setting the agenda, informing, involving and empowering clinicians. Concepts of work or employee engagement that are used in other industries don't directly translate to healthcare and thus the definition of engagement chosen for use centred on involvement. This was designed to encourage system managers to ensure clinicians are full participants in design, planning and evaluation and in all decisions that affect them and their patients.

  4. Reconstruction of a semi-arid late Pleistocene paleocatena from the Lake Victoria region, Kenya

    Science.gov (United States)

    Beverly, Emily J.; Driese, Steven G.; Peppe, Daniel J.; Arellano, L. Nicole; Blegen, Nick; Faith, J. Tyler; Tryon, Christian A.

    2015-11-01

    The effect of changing environment on the evolution of Homo sapiens is heavily debated, but few data are available from equatorial Africa prior to the last glacial maximum. The Karungu deposits on the northeast coast of Lake Victoria are ideal for paleoenvironmental reconstructions and are best studied at the Kisaaka site near Karunga in Kenya (94 to > 33 ka) where paleosols, fluvial deposits, tufa, and volcaniclastic deposits (tuffs) are exposed over a 2 km transect. Three well-exposed and laterally continuous paleosols with intercalated tuffs allow for reconstruction of a succession of paleocatenas. The oldest paleosol is a smectitic paleo-Vertisol with saline and sodic properties. Higher in the section, the paleosols are tuffaceous paleo-Inceptisols with Alfisol-like soil characteristics (illuviated clay). Mean annual precipitation (MAP) proxies indicate little change through time, with an average of 764 ± 108 mm yr- 1 for Vertisols (CALMAG) and 813 ± 182 to 963 ± 182 mm yr- 1 for all paleosols (CIA-K). Field observations and MAP proxies suggest that Karungu was significantly drier than today, consistent with the associated faunal assemblage, and likely resulted in a significantly smaller Lake Victoria during the late Pleistocene. Rainfall reduction and associated grassland expansion may have facilitated human and faunal dispersals across equatorial East Africa.

  5. A hamster model for Marburg virus infection accurately recapitulates Marburg hemorrhagic fever.

    Science.gov (United States)

    Marzi, Andrea; Banadyga, Logan; Haddock, Elaine; Thomas, Tina; Shen, Kui; Horne, Eva J; Scott, Dana P; Feldmann, Heinz; Ebihara, Hideki

    2016-12-15

    Marburg virus (MARV), a close relative of Ebola virus, is the causative agent of a severe human disease known as Marburg hemorrhagic fever (MHF). No licensed vaccine or therapeutic exists to treat MHF, and MARV is therefore classified as a Tier 1 select agent and a category A bioterrorism agent. In order to develop countermeasures against this severe disease, animal models that accurately recapitulate human disease are required. Here we describe the development of a novel, uniformly lethal Syrian golden hamster model of MHF using a hamster-adapted MARV variant Angola. Remarkably, this model displayed almost all of the clinical features of MHF seen in humans and non-human primates, including coagulation abnormalities, hemorrhagic manifestations, petechial rash, and a severely dysregulated immune response. This MHF hamster model represents a powerful tool for further dissecting MARV pathogenesis and accelerating the development of effective medical countermeasures against human MHF.

  6. The Meaning of ‘General Paralysis of the Insane’ in Victoria, Australia; 1886 to 1906

    Directory of Open Access Journals (Sweden)

    Roberts, Phillip

    2014-06-01

    Full Text Available This paper presents a conclusion to the meaning of the historical diagnosis “general paralysis of the insane” in nineteenth century Victorian Registrar General”s reports. Most studies suggest that in the past the diagnosis refers to neuro-syphilis, and while after 1906 this is not disputed, this paper will show that the diagnosis had a much broader meaning incorporating many forms of degenerative brain disease during the study period (Victoria 1886 to 1906. It is acknowledged, however, that the use of this diagnosis may have varied dramatically in the past based on a doctor’s education and/or background. This conclusion has been arrived at by analysing both government and general hospital records on the Australian, Victorian population. This paper also presents methods for determining the meaning of obsolete medical diagnoses where the definition is poorly understood.En este trabajo presenta una conclusión sobre el significado de la “parálisis general de los locos” como diagnóstico en los informes del Victorian Registrar General durante el siglo XIX. La mayoría de los estudios sugieren que en el pasado el diagnóstico se refiere a la neuro-sífilis, y aunque después de 1906 no se discute, este trabajo mostrará que el diagnóstico tiene un significado mucho más amplio e incorpora muchas formas de enfermedad degenerativa del cerebro durante el período de estudio (Victoria 1886 a 1906. Se reconoce, sin embargo, que el uso de este diagnóstico puede haber variado drásticamente en el pasado dependiendo de la formación y del ambiente médico. Se ha llegado a esta conclusión mediante el análisis de los registros hospitalarios de la población de Victoria, Australia. Este documento también presenta métodos para determinar el significado de los diagnósticos médicos obsoletos cuya definición es confusa.

  7. Myxomatosis in the Mallee region of Victoria, Australia.

    Science.gov (United States)

    Shepherd, R C; Edmonds, J W; Nolan, I F; Gocs, A

    1978-10-01

    Sharp reductions in the wild rabbit (Oryctolagus cuniculus (L.)) population in the Mallee are associated with annual myxomatosis epizootics. The extent to which the population reductions are the direct result of the epizootics varies with time of epizootic occurrence. All grazing animals in the Mallee are under nutritional stress each summer and autumn. When the epizootic occurs during the early summer heavy losses occur in a previously healthy population. Similar losses which occur in the late summer and autumn are the result of a nutritional stress - epizootic complex. The end result in each case is a population reduction of about 80%. This reduction occurs in a population which is the most resistant to myxomatosis known in Victoria and in association with epizootics caused by field strains of myxoma virus of moderate virulence only. The earlier summer epizootics are of considerable economic importance because they sharply reduce the pressure on the limited food available for other grazing animals.

  8. Cardboard Boxes and Invisible Fences: Homelessness and Public Space in City of Victoria v. Adams

    Directory of Open Access Journals (Sweden)

    Sarah Buhler

    2009-02-01

    Full Text Available This paper analyzes the recent decision of the British Columbia Supreme Court in City of Victoria v. Adams. Specifically, the paper considers three interlocking themes that emerge from the decision: (1 the nature of “public space” in the context of homelessness; (2 the autonomy of homeless individuals; and (3 the meaning and value of the “homeless body.” With reference to each theme, the paper explores how the judgment in Adams grapples with the purportedly normative “Law and Economics”- type arguments put forth by the City of Victoria. By drawing on insights from Critical Legal Studies theory and feminist jurisprudence, the paper shows that Adams subverts and destabilizes certain “normative” perspectives about public space and homelessness. However, the paper goes on to argue that in its conflation of “cardboard box” shelters with the “invisible fences” envisioned by Justice Wilson in Morgentaler, Adams presents an ambiguous victory for anti-poverty advocates. The paper argues that the decision may serve to increase barriers for a broader and more progressive understanding of section 7 in the future. Dans cet article, on analyse le jugement récent de la Cour Suprême de la Colombie Britannique dans City of Victoria v. Adams. Plus précisément, on considère trois thèmes qui ressortent du jugement et qui s’entrecroisent : (1 la nature d’«espace public» dans le contexte de l’itinérance; (2 l’autonomie des sans-abri; et (3 la signification et la valeur du «corps sans abri». En rapport avec chaque thème, on explore comment l’arrêt Adams compose avec les arguments supposément normatifs du genre «La Loi et l’Économie» avancés par la ville de Victoria. En s’inspirant de perceptions tirées de la théorie des Critical Legal Studies et de la jurisprudence féministe, l’auteure démontre que l’arrêt Adams subvertit et déséquilibre certaines perspectives «normatives» au sujet de l

  9. The State Electricity Commission of Victoria and the greenhouse effect

    International Nuclear Information System (INIS)

    Hoy, R.D.

    1990-01-01

    The State Electricity Commission of Victoria is examining how the greenhouse issue may affect its electricity supply system in the future. Possible generation scenarios for 2005 are presented in order to show how the Toronto goal of a 20% reduction on 1988 levels of CO 2 emissions could be achieved. The main approaches to achieving these emission reductions include energy conservation and cogeneration, new gas-fired plant, use of renewable energy, reduction of energy system losses, retirement of older brown coal plant and an extensive tree planting program. It is estimated that achieving the Toronto goal would require electricity prices to rise by 1% to 1.5%, on average, each year by more than they otherwise would have, for the next 15 years. 12 refs., 3 tabs

  10. Water and waste water management Generation Victoria - Latrobe Valley

    Energy Technology Data Exchange (ETDEWEB)

    Longmore, G. [Hazelwood Power Corporation, VIC (Australia); Pacific Power (International) Pty. Ltd., Sydney, NSW (Australia)

    1995-12-31

    Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled `SECV Latrobe Valley Water and Wastewater Management Strategy`. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs.

  11. Water and waste water management Generation Victoria - Latrobe Valley

    International Nuclear Information System (INIS)

    Longmore, G.

    1995-01-01

    Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled 'SECV Latrobe Valley Water and Wastewater Management Strategy'. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs

  12. Gambling revenues as a public administration issue: electronic gaming machines in Victoria.

    Science.gov (United States)

    Pickernell, David; Keast, Robyn; Brown, Kerry; Yousefpour, Nina; Miller, Chris

    2013-12-01

    Gambling activities and the revenues derived have been seen as a way to increase economic development in deprived areas. There are also, however, concerns about the effects of gambling in general and electronic gaming machines (EGMs) in particular, on the resources available to the localities in which they are situated. This paper focuses on the factors that determine the extent and spending of community benefit-related EGM-generated resources within Victoria, Australia, focusing in particular on the relationships between EGM activity and socio-economic and social capital indicators, and how this relates to the community benefit resources generated by gaming.

  13. Visibility in health statistics: a population data linkage study more accurately identifying Aboriginal and Torres Strait Islander Births in Victoria, Australia, 1988-2008

    Directory of Open Access Journals (Sweden)

    Rebecca Ritte

    2017-04-01

    This is the first time that the VPDC and RBDM birth data were linked in Victoria. The matched birth information established a more complete population profile of Aboriginal and/or Torres Strait Islander births. These data will provide a more accurate baseline to enhance the Victorian and Australian governments’ ability to plan services, allocate resources and evaluate funded activities aimed at eliminating disparity experienced by Aboriginal and/or Torres Strait Islander peoples. Importantly, it has established a more accurate denominator from which to calculate Aboriginal infant mortality rates for Victoria, Australia. *Until 2009, the mother’s Indigenous identification only was recorded in the VPDC

  14. Out of the ashes: the new bachelor of midwifery curriculum at Victoria University.

    Science.gov (United States)

    Carolan, Mary; Kruger, Gina; Brown, Vera

    2007-09-01

    In the past decade, midwifery education has changed significantly in Australia. Previously, a nursing qualification (division 1) was required for entry into midwifery programs and on completion, graduands obtained a postgraduate diploma of midwifery. More recently, bachelor of midwifery programs have also been offered in Australia and currently, a considerable percentage of midwives are prepared for practice in this way. In Victoria, the bachelor of midwifery has been available since 2002, and at this time the third group of graduands are poised to enter the field. Implementation of the bachelor of midwifery program has given rise to many concerns about the development and applicability of this course. Concerns include: complexities of registration with a regulatory board set up primarily for nursing registration; concerns about readiness for practice among bachelor of midwifery graduands; escalating requirements within midwifery courses; and difficulties with meeting course requirements. As this course comes of age in Victoria, it is useful to reflect on some of the challenges encountered along the way. Thus, this paper reports on the journey of one university as it approaches the end of a first year of implementing an independent bachelor of midwifery program, following 5 years involvement as a consortium partner. In particular, it addresses concerns and difficulties encountered during early implementation of the program and then outlines strategies used to improve and strengthen the course. The basic premise of the paper is lessons learnt along the way.

  15. Regions of High Out-Of-Hospital Cardiac Arrest Incidence and Low Bystander CPR Rates in Victoria, Australia.

    Science.gov (United States)

    Straney, Lahn D; Bray, Janet E; Beck, Ben; Finn, Judith; Bernard, Stephen; Dyson, Kylie; Lijovic, Marijana; Smith, Karen

    2015-01-01

    Out-of-hospital cardiac arrest (OHCA) remains a major public health issue and research has shown that large regional variation in outcomes exists. Of the interventions associated with survival, the provision of bystander CPR is one of the most important modifiable factors. The aim of this study is to identify census areas with high incidence of OHCA and low rates of bystander CPR in Victoria, Australia. We conducted an observational study using prospectively collected population-based OHCA data from the state of Victoria in Australia. Using ArcGIS (ArcMap 10.0), we linked the location of the arrest using the dispatch coordinates (longitude and latitude) to Victorian Local Government Areas (LGAs). We used Bayesian hierarchical models with random effects on each LGA to provide shrunken estimates of the rates of bystander CPR and the incidence rates. Over the study period there were 31,019 adult OHCA attended, of which 21,436 (69.1%) cases were of presumed cardiac etiology. Significant variation in the incidence of OHCA among LGAs was observed. There was a 3 fold difference in the incidence rate between the lowest and highest LGAs, ranging from 38.5 to 115.1 cases per 100,000 person-years. The overall rate of bystander CPR for bystander witnessed OHCAs was 62.4%, with the rate increasing from 56.4% in 2008-2010 to 68.6% in 2010-2013. There was a 25.1% absolute difference in bystander CPR rates between the highest and lowest LGAs. Significant regional variation in OHCA incidence and bystander CPR rates exists throughout Victoria. Regions with high incidence and low bystander CPR participation can be identified and would make suitable targets for interventions to improve CPR participation rates.

  16. Differential Regulation of Interferon Responses by Ebola and Marburg Virus VP35 Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Megan R.; Liu, Gai; Mire, Chad E.; Sureshchandra, Suhas; Luthra, Priya; Yen, Benjamin; Shabman, Reed S.; Leung, Daisy W.; Messaoudi, Ilhem; Geisbert, Thomas W.; Amarasinghe, Gaya K.; Basler, Christopher F.

    2016-02-11

    Suppression of innate immune responses during filoviral infection contributes to disease severity. Ebola (EBOV) and Marburg (MARV) viruses each encode a VP35 protein that suppresses RIG-I-like receptor signaling and interferon-α/β (IFN-α/β) production by several mechanisms, including direct binding to double stranded RNA (dsRNA). Here, we demonstrate that in cell culture, MARV infection results in a greater upregulation of IFN responses as compared to EBOV infection. This correlates with differences in the efficiencies by which EBOV and MARV VP35s antagonize RIG-I signaling. Furthermore, structural and biochemical studies suggest that differential recognition of RNA elements by the respective VP35 C-terminal IFN inhibitory domain (IID) rather than affinity for RNA by the respective VP35s is critical for this observation. Our studies reveal functional differences in EBOV versus MARV VP35 RNA binding that result in unexpected differences in the host response to deadly viral pathogens.

  17. Pesticide residues in Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) from Southern Lake Victoria, Tanzania

    International Nuclear Information System (INIS)

    Henry, L.; Kishimba, M.A.

    2006-01-01

    Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers (α and β) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels

  18. Marburg Virus Glycoprotein GP2: pH-Dependent Stability of the Ectodomain α-Helical Bundle†

    Science.gov (United States)

    Harrison, Joseph S.; Koellhoffer, Jayne F.; Chandran, Kartik; Lai, Jonathan R.

    2012-01-01

    Marburg virus (MARV) and Ebola virus (EBOV) constitute the family Filoviridae of enveloped viruses (filoviruses) that cause severe hemorrhagic fever. Infection by MARV is required for fusion between the host cell and viral membranes, a process that is mediated by the two subunits of the envelope glycoprotein GP1 (surface subunit) and GP2 (transmembrane subunit). Upon viral attachment and uptake, it is believed that the MARV viral fusion machinery is triggered by host factors and environmental conditions found in the endosome. Next, conformational rearrangements in the GP2 ectodomain result in the formation of a highly stable six-helix bundle; this refolding event provides the energetic driving force for membrane fusion. Both GP1 and GP2 from EBOV have been extensively studied, but there is little information available for the MARV glycoproteins. Here we have expressed two variants of the MARV GP2 ectodomain in Escherichia coli and analyzed their biophysical properties. Circular dichroism indicates that the MARV GP2 ectodomain adopts an α-helical conformation, and one variant sediments as a trimer by equilibrium analytical ultracentrifugation. Denaturation studies indicate the α-helical structure is highly stable at pH 5.3 (unfolding energy, ΔGunf H2O, of 33.4 ± 2.5 kcal/mol and melting temperature, Tm, of 75.3 ± 2.1 °C for one variant). Furthermore, we found the α-helical stability to be strongly dependent on pH with higher stability under lower pH conditions (Tm values ranging from ~92 °C at pH 4.0 to ~38 °C at pH 8.0). Mutational analysis suggests two glutamic acid residues (E579 and E580) are partially responsible for this pH-dependent behavior. Based on these results, we hypothesize that pH-dependent folding stability of the MARV GP2 ectodomain provides a mechanism to control conformational preferences such that the six-helix bundle ‘post-fusion’ state is preferred under conditions of appropriately matured endosomes. PMID:22369502

  19. Design of a small nuclear reactor for extending the operational envelope of the Victoria Class Submarine

    International Nuclear Information System (INIS)

    Cole, C.J.P.

    2003-01-01

    The purpose of this research is to conceptually design a small, inherently safe, quasi-homogeneous nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope. This research is in its early stages. The purpose of this paper is to outline the background of the research, present results found to date, and indicate the direction of the research over the next two years. The Canadian Forces has recently acquired four U.K. built Upholder Class submarines to replace the ageing Oberon Class submarines purchased in the early 1960's. The Upholders, like the Oberons, are diesel-electric powered. The Upholders were renamed the Victoria Class upon commissioning in Canada. Submarines are strategic military weapons that have several roles including: intelligence gathering, inflicting surprise attacks, controlling shipping lanes and covert operations. For each of these roles the submarine must remain undetected. To remain undetected, it is imperative that the submarine remains submerged. To remain submerged and continue to function, a submarine requires an air-independent power generation system, such as a nuclear reactor. (author)

  20. The Fontaine Pluton : an early Ross Orogeny calc-alkaline gabbro from southern Victoria Land, Antarctica

    International Nuclear Information System (INIS)

    Cottle, J.M.; Cooper, A.F.

    2006-01-01

    The Fontaine Pluton is a previously undescribed mafic intrusion outcropping at Fontaine Bluff on the south side of the Carlyon Glacier in southern Victoria Land, Antarctica. It is the southern-most member of a laterally extensive mafic suite emplaced at mid-crustal depths during the initial stages of the Ross Orogeny. The pluton comprises recrystallised hornblende-biotite gabbro, which in places shows well-defined centimetre to metre scale primary igneous layering. Recrystallised ultramafic enclaves composed of amphibole-chlorite-talc are inferred to be remnants of a chemically and mineralogically distinct cumulate fraction. The intrusion has a 87 Sr/ 86 Sr (i) ratio of 0.70679 and a 143 Nd/ 144 Nd (i) ratio of 0.51187 (εNd (i) = -1.2). This, coupled with other geochemical data, implies that the Fontaine Pluton was formed by c. 15% partial melting of a depleted mantle source that was subsequently contaminated by continental crust. Preliminary U-Pb geochronology on zircon suggests an emplacement age for the pluton of 546 ± 10 Ma. These new data indicate that Ross Orogeny magmatism in this area of southern Victoria Land was initiated in the late Neoproterozoic along a subducting plate margin. (author). 55 refs., 10 figs., 3 tabs

  1. DNA barcoding of schistosome cercariae reveals a novel sub-lineage within Schistosoma rodhaini from Ngamba Island Chimpanzee Sanctuary, Lake Victoria.

    Science.gov (United States)

    Standley, C J; Stothard, J R

    2012-10-01

    While Schistosoma rodhaini is typically considered a parasite of small mammals and is very scantly distributed in the Lake Victoria basin, it is known to hybridize with the more widespread Schistosoma mansoni, the causative agent of intestinal schistosomiasis. As part of broader parasitological and malacological surveys for S. mansoni across Lake Victoria, schistosome cercariae were harvested from a field-caught Biomphalaria choanomphala taken on Ngamba Island Chimpanzee Sanctuary, Uganda. Upon DNA barcoding, these cercariae were found to be a mixture of both S. rodhaini and S. mansoni, with further phylogenetic analysis revealing a hitherto unknown sub-lineage within S. rodhaini. Despite repeated sampling for eggs and miracidia from both chimpanzees and staff on Ngamba Island Sanctuary, detection of S. rodhaini within local definitive hosts awaits additional efforts, which should be mindful of a potential host role of spotted-necked otters.

  2. Molecular records of climate variability and vegetation response since the Late Pleistocene in the Lake Victoria basin, East Africa

    NARCIS (Netherlands)

    Berke, M.A.; Johnson, T.C.; Werne, J.P.; Grice, K.; Schouten, S.; Sinninghe Damsté, J.S.

    2012-01-01

    New molecular proxies of temperature and hydrology are helping to constrain tropical climate change and elucidate possible forcing mechanisms during the Holocene. Here, we examine a similar to 14,000 year record of climate variability from Lake Victoria, East Africa, the world's second largest

  3. The Development and Use of Individual Learning Plans for Deaf and Hard of Hearing Students in Victoria, Australia

    Science.gov (United States)

    Brown, P. Margaret; Byrnes, Linda J.

    2014-01-01

    This study investigated the Individual Learning Plans of eighty-eight students who were deaf and hard of hearing attending facilities and schools for the deaf in Victoria Australia. The students' assessment and planning portfolios were scrutinised for evidence of formal and informal assessment used to generate goals for the Individual Learning…

  4. State Electricity Commission of Victoria annual report 1991/92

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    The 73rd annual report of the State Electricity Commission (SEC) of Victoria covers the financial year ended 30 June 1992. A total revenue of 3,300 million dollars and a net profit of 155.7 million dollars was recorded. There was continued improvement in employee productivity. Progress was made on the Victorian Power Pool (VicPool) pooling arrangement in anticipation of open access to the power grid. A 3-year business plan was formulated and corporate strategy revised. The Strategic Research Program on brown coal technologies, aimed at reducing costs of electricity and emissions of CO[sub 2], continued. Environmental activities continued in the areas of renewable energy source development, air quality monitoring, acid rain, water management, land rehabilitation and improvements to powerlines. The report includes statistical data on customer statistics, electricity sales, power stations, brown coal and briquette production and financial sales.

  5. Occupational skin disease in Victoria, Australia.

    Science.gov (United States)

    Cahill, Jennifer L; Williams, Jason D; Matheson, Melanie C; Palmer, Amanda M; Burgess, John A; Dharmage, Shyamali C; Nixon, Rosemary L

    2016-05-01

    To describe the characteristics of patients with occupational skin disease (OSD) in a tertiary referral clinic in Victoria, Australia. A retrospective review was conducted of records from patients seen at the Occupational Dermatology Clinic in Melbourne, Australia between 1 January 1993 and 31 December 2010. Of the 2894 people assessed in the clinic during the 18-year period, 44% were women and 56% were men. In all, 2177 (75%) were diagnosed with occupational skin disease (OSD). Of the patients with a work-related skin condition, 45% (n = 979) were considered to be atopic. The most common diagnosis in those with OSD was irritant contact dermatitis (ICD) (44%), followed by allergic contact dermatitis (33%) and endogenous eczema (11%). Women were significantly more likely to have soaps and detergents (P Occupational groups with the highest incidence of OSD were the hair and beauty professions (70 per 100 000), followed by machine and plant operators (38 per 100 000) and health-care workers (21 per 100 000). We confirm the importance of occupational contact dermatitis as the most common cause of OSD, with ICD being the most common diagnosis. There are differences in the causes of ICD between our group of male and female workers. For the first time in Australia, rates of OSD in certain industries have been calculated. © 2015 The Australasian College of Dermatologists.

  6. Studies of Reservoir Hosts for Marburg virus

    DEFF Research Database (Denmark)

    Swanepoel, Robert; Smit, Sheilagh B; Rollin, Pierre E

    2007-01-01

    To determine reservoir hosts for Marburg virus (MARV), we examined the fauna of a mine in northeastern Democratic Republic of the Congo. The mine was associated with a protracted outbreak of Marburg hemorrhagic fever during 1998-2000. We found MARV nucleic acid in 12 bats, comprising 3.0%-3.6% of...

  7. Sand dune movement in the Victoria Valley, Antarctica

    Science.gov (United States)

    Bourke, Mary C.; Ewing, Ryan C.; Finnegan, David; McGowan, Hamish A.

    2009-08-01

    We use vertical aerial photographs and LiDAR topographic survey data to estimate dune migration rates in the Victoria Valley dunefield, Antarctica, between 1961 and 2001. Results confirm that the dunes migrated an average of 1.5 m/year. These values are consistent with other estimates of dune migration from cold climate deserts and are significantly lower than estimates from warm deserts. Dune migration rates are retarded by the presence of entrained ice, soil moisture and a reversing wind regime. Dune absorption, merging and limb extension are apparent from the time-series images and account for significant changes in dune form and the field-scale dune pattern. Dune-field pattern analysis shows an overall increase in dune-field organization with an increase in mean dune spacing and a reduction in total crest length and defect density. These data suggest that dunes in other cold desert environments on Earth, Mars or Titan, that may also have inter-bedded frozen laminae, still have the potential to migrate and organize, albeit at lower rates than dunes in warm deserts.

  8. A pharyngeal jaw evolutionary innovation facilitated extinction in Lake Victoria cichlids.

    Science.gov (United States)

    McGee, Matthew D; Borstein, Samuel R; Neches, Russell Y; Buescher, Heinz H; Seehausen, Ole; Wainwright, Peter C

    2015-11-27

    Evolutionary innovations, traits that give species access to previously unoccupied niches, may promote speciation and adaptive radiation. Here, we show that such innovations can also result in competitive inferiority and extinction. We present evidence that the modified pharyngeal jaws of cichlid fishes and several marine fish lineages, a classic example of evolutionary innovation, are not universally beneficial. A large-scale analysis of dietary evolution across marine fish lineages reveals that the innovation compromises access to energy-rich predator niches. We show that this competitive inferiority shaped the adaptive radiation of cichlids in Lake Tanganyika and played a pivotal and previously unrecognized role in the mass extinction of cichlid fishes in Lake Victoria after Nile perch invasion. Copyright © 2015, American Association for the Advancement of Science.

  9. Productivity changes in the Gas and Fuel Corporation of Victoria

    International Nuclear Information System (INIS)

    Rushdi, A.

    1994-01-01

    The study reveals that the total factor productivity in the Gas and Fuel Corporation of Victoria (GFCV) continued to increase throughout the study period except for a brief period between 1983-84 and 1984-85 which was mainly the result of the decline in the industrial demand for gas and a decelerated growth rate in residential demand. The productivity gains were found to be highly sensitive to the rates of depreciation and discount rates assumed. The estimated terms of trade suggest that the increase in gas prices was lower that the increase in the aggregate input prices the GFCV paid, particularly to capital and labour. However, while the price index of reticulated gas increased to 2.17, the purchase price declined to 0.96 over the study period. The productivity gains by GFCV seem to have been shared with its customers. (Author)

  10. Pesticide residues in Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) from Southern Lake Victoria, Tanzania

    Energy Technology Data Exchange (ETDEWEB)

    Henry, L. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania); Kishimba, M.A. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania)]. E-mail: kishimba@chem.udsm.ac.tz

    2006-03-15

    Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers ({alpha} and {beta}) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels.

  11. Language in the Workplace Project and Workplace Communication for Skilled Migrants Course at Victoria University of Wellington, New Zealand

    Science.gov (United States)

    de Bres, Julia; Holmes, Janet; Joe, Angela; Marra, Meredith; Newton, Jonathan; Riddiford Nicky; Vine, Bernadette

    2009-01-01

    The School of Linguistics and Applied Language Studies (LALS) at Victoria University of Wellington conducts research and teaching in Linguistics, Applied Linguistics, Writing and Deaf Studies. It incorporates a Deaf Studies Research Unit, which undertakes research on topics relating to deaf people and their language in New Zealand, and the New…

  12. Birth centre confinement at the Queen Victoria Medical Centre. I. Obstetric and neonatal outcome.

    Science.gov (United States)

    Campbell, J; Hudson, H; Lumley, J; Morris, N; Rao, J; Spensley, J

    1981-10-03

    A review of hte first 175 confinements at the Queen Victoria Medical Centre Birth Centre is presented. The design, structure and function of hte Birth Centre is described and the safety of the programme demonstrated. Seventy-four pregnancies (42%) accepted for Birth Centre confinement required transfer because of antepartum or intrapartum complications. There were satisfactory obstetric and neonatal outcomes in all pregnancies. The first year's experience has allowed a reassessment of the risk factors, which will permit greater use of the Birth Centre without any increases risk to mothers or babies.

  13. Perceptions of prescribed burning in a local forest community in Victoria, Australia.

    Science.gov (United States)

    Bell, Tina; Oliveras, Immaculada

    2006-11-01

    The general perceptions of prescribed burning were elicited from forest users for an area that has been subject to this form of land management for at least 20 years. The largest group consisted of local residents living in and around the Wombat State Forest with two smaller groups of students from a nearby university campus and local professional land managers. A questionnaire was given to each participant in order to explore how the forest was used, to determine the level of knowledge of burning in the targeted forest and Victoria and the perception of the appearance, effectiveness of protection, and accessibility to the forest after prescribed burning. Generally all groups had similar responses with community members having stronger views on the effectiveness and practicalities of prescribed burning, whereas students were more neutral in their opinions. All participants claimed knowledge of prescribed burning activities within Victoria, but fewer had experience of planned fires in the Wombat State Forest. All groups agreed that areas that had not been recently burned had a better appearance than those that had, but this result may have included a range of value judgments. Land managers had a greater understanding of the ecological importance of season and timing of burning; however, some students and community members were equally knowledgeable. Prescribed burning did not impede access to the forest, nor did smoke from prescribed burns pose any great problem. The majority of the participants felt that the amount of prescribed burning done in the forest was adequate for engendering a feeling of protection to life and property, yet many were still suspicious of this management practice. These initial findings indicate several areas in which further research would be useful including the efficacy of education programs for community members and improved communication of burn plans by land managers.

  14. A Comparison of digestive Tract Morphology in muskoxen and caribou from Victoria Island, Northwest Territories, Canada

    Directory of Open Access Journals (Sweden)

    Hans Staaland

    1997-04-01

    Full Text Available Although caribou and muskoxen coexist in close proximity on southeastern Victoria Island, they appear primarily adapted to different diets and foraging strategies. Visual inspection and analysis of rumen contents for fiber and lignin from the study (unpubl. also indicate a predominantly graminoid diet in the muskoxen and a more varied diet with a substantial browse component in the caribou.This should reduce the likelihood of competition for limited food resources in winter.

  15. Marching Backwards into the Future: The Introduction of the English Creative Music Movement in State Secondary Schools in Victoria, Australia

    Science.gov (United States)

    Burke, Harry

    2014-01-01

    In 1910, Victoria established an elite form of state secondary education that remained essentially unchanged until the introduction of a progressive curriculum during the late 1960s. This radical and voluntary curriculum introduced child-centred learning and personal development skills to state secondary schools. Many state secondary music…

  16. Tsetse fly (G. f. fuscipes distribution in the Lake Victoria basin of Uganda.

    Directory of Open Access Journals (Sweden)

    Mugenyi Albert

    2015-04-01

    Full Text Available Tsetse flies transmit trypanosomes, the causative agent of human and animal African trypanosomiasis. The tsetse vector is extensively distributed across sub-Saharan Africa. Trypanosomiasis maintenance is determined by the interrelationship of three elements: vertebrate host, parasite and the vector responsible for transmission. Mapping the distribution and abundance of tsetse flies assists in predicting trypanosomiasis distributions and developing rational strategies for disease and vector control. Given scarce resources to carry out regular full scale field tsetse surveys to up-date existing tsetse maps, there is a need to devise inexpensive means for regularly obtaining dependable area-wide tsetse data to guide control activities. In this study we used spatial epidemiological modelling techniques (logistic regression involving 5000 field-based tsetse-data (G. f. fuscipes points over an area of 40,000 km2, with satellite-derived environmental surrogates composed of precipitation, temperature, land cover, normalised difference vegetation index (NDVI and elevation at the sub-national level. We used these extensive tsetse data to analyse the relationships between presence of tsetse (G. f. fuscipes and environmental variables. The strength of the results was enhanced through the application of a spatial autologistic regression model (SARM. Using the SARM we showed that the probability of tsetse presence increased with proportion of forest cover and riverine vegetation. The key outputs are a predictive tsetse distribution map for the Lake Victoria basin of Uganda and an improved understanding of the association between tsetse presence and environmental variables. The predicted spatial distribution of tsetse in the Lake Victoria basin of Uganda will provide significant new information to assist with the spatial targeting of tsetse and trypanosomiasis control.

  17. Victoria Khiterer. Jewish City or Inferno of Russian Israel? A History of the Jews in Kiev Before February 1917.

    Directory of Open Access Journals (Sweden)

    Kimberly St. Julian-Varnon

    2017-09-01

    Full Text Available Book review of Victoria Khiterer. Jewish City or Inferno of Russian Israel? A History of the Jews in Kiev Before February 1917. Academic Studies Press, 2016. Jews of Russia and Eastern Europe and Their Legacy, series editor, Maxim D. Shrayer. xx, 474 pp. Illustrations. Tables. Maps. Appendix. Bibliography. Index. $89.00, cloth.

  18. Hydro-climatic trends and water resource management implications based on multi-scale data for the Lake Victoria region, Kenya

    International Nuclear Information System (INIS)

    Koutsouris, A J; Destouni, G; Jarsjoe, J; Lyon, S W

    2010-01-01

    Unreliable rainfall may be a main cause of poverty in rural areas, such as the Kisumu district by Lake Victoria in Kenya. Climate change may further increase the negative effects of rainfall uncertainty. These effects could be mitigated to some extent through improved and adaptive water resource management and planning, which relies on our interpretations and projections of the coupled hydro-climatic system behaviour and its development trends. In order to identify and quantify the main differences and consistencies among such hydro-climatic assessments, this study investigates trends and exemplifies their use for important water management decisions for the Lake Victoria drainage basin (LVDB), based on local scale data for the Orongo village in the Kisumu district, and regional scale data for the whole LVDB. Results show low correlation between locally and regionally observed hydro-climatic trends, and large differences, which in turn affects assessments of important water resource management parameters. However, both data scales converge in indicating that observed local and regional hydrological discharge trends are primarily driven by local and regional water use and land use changes.

  19. High seroprevalance of Neospora caninum in dogs in Victoria, Australia, compared to 20 years ago

    Directory of Open Access Journals (Sweden)

    Sarah Sloan

    2017-10-01

    Full Text Available Abstract Background Canids are definitive hosts of the apicomplexan parasite Neospora caninum, the leading cause of abortion in cattle worldwide. For horizontal transmission from canids to occur, oocysts of N. caninum must be shed by the definitive host into the environment of susceptible intermediate hosts such as cattle. The purpose of this study was to determine the prevalence of N. caninum in canids in Victoria, Australia’s leading dairy producing state. Results Neospora-like oocysts were observed in 8% (18/234 of faecal samples from wild dogs, domestic dogs and red foxes from Victoria, Australia. However, none tested positive for N. caninum DNA using a quantitative PCR. In a separate sample population, blood sera from 483 domestic dogs were tested for anti-N. caninum antibodies using competitive ELISA. A subset of cELISA samples were re-tested using indirect fluorescence antibody test (IFAT. A seroprevalence of 29.8% (144/483; 95% CI: 11.7–47.8% was calculated when using cELISA; whereas it was 32.9% (27/80; 95% CI: 15.8–51.8% using IFAT. Potential risk factors were evaluated using univariable analyses and then assessed in separate multivariable models. Using ‘aged’ dogs as a reference, the seroprevalence of ‘adolescent’ and ‘adult’ dogs was 88% (P = 0.05 and 91% (P = 0.08, respectively, indicating seroprevalence increases with age. There was a 19% higher likelihood of infection in rural locations (P = 0.10 relative to urban areas. Jack Russell Terriers had a 22% higher risk of a cELISA-positive result (P = 0.05 regardless of geographical location, age or sex. Conclusion These results demonstrate that exposure to N. caninum in domestic dogs is widespread in Victoria, although faecal oocyst shedding is infrequent. Our results indicate increased N. caninum seroprevalance status in dogs over the past two decades. The results imply that dogs get either exposed to the infected meat more frequently or that vertical dam to

  20. An exploration of emergency department presentations related to high heel footwear in Victoria, Australia, 2006-2010.

    Science.gov (United States)

    Williams, Cylie M; Haines, Terry P

    2014-01-23

    Many women are warned against the dangers of wearing high heel footwear however there is limited empirical evidence demonstrating an association between wearing high heel with injury. Gait laboratory testing has found a higher heel height placed the foot in a position that increases the risk of ankle sprain. Women have also been surveyed about wearing high heels and approximately half of those reported inconvenience and pain after wearing a high heel shoe. This study aims to explore emergency department presentations of injuries and the estimated costs that have been directly attributed to wearing high heeled footwear within Victoria, Australia during 2006-2010. The Victorian Emergency Minimum Dataset (VEMD) was searched for all injuries attributed to wearing high heel footwear presenting to emergency departments in Victoria Australia, between the years of 2006-2010. The VEMD produced a report detailing sex, age at presentation, month of presentation, time of day of presentation, day of presentation, location that injury occurred and type of injury for presentation. Monash Health in Victoria Australia, provided emergency department estimates for injury types to calculate an estimated cost of an acute injury related to wearing high heel footwear. There were 240 injuries presenting to Victorian emergency departments directly attributed to wearing high heeled footwear. The majority of people injured were women (n = 236) and all were less than 55 years of age. More injuries presented on a Sunday (n = 83) and more in the 8 am-12 pm time bracket (n = 64). There were also more injuries presenting in the months of November, December and January (n = 80). The most commonly injured body part was the ankle (n = 123). The emergency department estimate of the cost of these injuries over this time-frame was almost $72,000 (mean of $316.72 per presentation). People who wear high heel footwear on weekends appear to be at higher risk for injury that leads to

  1. Biological Diversity and Resilience: Lessons from the Recovery of Cichlid Species in Lake Victoria

    Directory of Open Access Journals (Sweden)

    Alex O. Awiti

    2011-03-01

    Full Text Available A fundamental feature of the Anthropocene is the inexorable erosion of the self-repairing capacity or adaptive renewal of natural systems because of natural perturbation, exploitation, or management failure. The concept of resilience offers a systematic framework for understanding the dynamics and variables that govern response dynamics of ecosystems. Resilience of haplochromine cichlids is assessed using limnological and biodiversity changes in Lake Victoria, the world's second largest freshwater lake, over the last five decades. The review explores the resurgence of the haplochromine cichlids using Holling's adaptive renewal cycle and attempts to illustrate how resilience-based management approaches might learn from an inadvertent management experiment. The introduction in the 1980s of the Nile perch (Lates niloticus, a fecund and voracious predator of the endemic phytoplankton feeding haplochromine cichlids, anthropogenic eutrophication, and deep water hypoxia have combined in a synergistic way to increase the vulnerability of the lake ecosystem to perturbations that were hitherto absorbed. However, the upsurge in commercial Nile perch fishing appears to be enabling the resurgence of the haplochromine cichlids. The resurgence of haplochromine cichlids is characterized by phenotypic plasticity, ecological and life history traits and demonstrates the critical role of response diversity in the maintenance of systems resilience. Resilience of the haplochromine cichlids resides in the requisite functional response diversity and habitat diversity that provide the resources for renewal and regeneration. This paper concludes that management of Nile perch fisheries and control of nutrient loading into Lake Victoria could halt or reverse eutrophication, hence offer the best promise for a diverse, productive, and resilient social-ecological system.

  2. Myxomatosis: the occurrence of antibody to a soluble antigen of myxoma virus in wild rabbits, Oryctolagus cuniculus (L.), in Victoria, Australia.

    Science.gov (United States)

    Edmonds, J W; Shepherd, R C; Nolan, I F

    1978-10-01

    The occurrence of antibody of myxoma virus in wild rabbits following epizootics is highest in the semi-arid north-west of Victoria and lowest in temperate southern Victoria. Occurrence ranges up to about 90% in the north-west and to about 70% in the south except on the Western Plains where epizootics are rare and antibody occurrence seldom exceeds 30%. The establishment of the European rabbit flea may be changing the pattern of occurrence of antibody in the north-west by causing spring outbreaks of myxomatosis. It is suggested that the effects of the replacement of a simple recurring system of epizootic and breeding season several months apart by the occurrence of myxomatosis twice in the same year, once coincident with the breeding season, will be complex. The occurrence of detectable antibody may be less dependent on the infection rate and may be dependent to some extent on the relative timing of spring myxomatosis and the breeding season.

  3. Efficient renewable energy scenarios study for Victoria

    International Nuclear Information System (INIS)

    Armstrong, Graham

    1991-01-01

    This study examines the possible evolution of Victorian energy markets over the 1998-2030 period from technical, economic and environmental perspectives. The focus is on the technical and economic potential over the study period for renewable energy and energy efficiency to increase their share of energy markets, through their economic competitiveness with the non-renewables of oil, gas and fossil fulled electricity. The study identifies a range of energy options that have a lower impact on carbon dioxide emissions that current projections for the Victorian energy sector, together with the savings in energy, dollars and carbon dioxide emissions. In addition the macroeconomic implications of the energy paths are estimated. Specifically it examines a scenario (R-efficient renewable) where energy efficiency and renewable energy sources realise their estimated economic potential to displace non-renewable energy over the 1988-2030 period. In addition, a scenario (T-Toronto) is examined where energy markets are pushed somewhat harder, but again on an economic basis, so that what is called the Toronto target of reducing 1988 carbon dioxide (CO 2 ) emissions by 20 per cent by 2005 is attained. It is concluded that over the next forty years there is substantial economic potential in Victoria for significant gains from energy efficiency in all sectors - residential, commercial, industrial and transport - and contributions from renewable energy both in those sectors and in electricity generations. 7 figs., 5 tabs

  4. Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS.

    Directory of Open Access Journals (Sweden)

    Chrispine Nyamweya

    Full Text Available Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May and mixing (June-August. Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.

  5. Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS).

    Science.gov (United States)

    Nyamweya, Chrispine; Desjardins, Christopher; Sigurdsson, Sven; Tomasson, Tumi; Taabu-Munyaho, Anthony; Sitoki, Lewis; Stefansson, Gunnar

    2016-01-01

    Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS) to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May) and mixing (June-August). Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza) and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents) that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.

  6. Community genetics reveal elevated levels of sympatric gene flow among morphologically similar but not among morphologically dissimilar species of Lake Victoria cichlid fish

    NARCIS (Netherlands)

    Konijnendijk, N.; Joyce, D.A.; Mrosso, H.D.J.; Egas, M.; Seehausen, O.

    2011-01-01

    We examined genetic structure among five species of Lake Victoria haplochromine cichlids in four island communities, using a full factorial sampling design that compared genetic differentiation between pairs of species and populations of varying morphological similarity and geographical proximity.

  7. Among the gift of forgviness, the “amancia” and the friendship ethics: Victoria Ocampo bids Pierre Drieu La Rochelle farewell

    Directory of Open Access Journals (Sweden)

    María Celia Vázquez

    2015-12-01

    Full Text Available En ocasión de despedir a Pierre Drieu La Rochelle, Victoria Ocampo intenta, si no justificar el acto aberrante que comete el amigo al convertirse en colaboracionista, al menos atenuar los cargos que se le imputan, mediante una serie de argumentos tendientes tanto a purificar su nombre mancillado y profanado por los detractores, como a tornar lo más excusable posible la conversión al fascismo. Mientras le otorga el beneficio de la duda respecto de algunas de las peores imputaciones que recaen sobre él, le presta un crédito de confianza póstumo, que consiste en el don del perdón ¿Qué otra cosa si no el recuerdo del amor puede llevar a Victoria a declararse públicamente a favor de un personaje tan controvertido? El amor, o mejor la amancia, funciona como el motor de lo positivo del deseo, y procura la energía que arrastra a Ocampo a querer escribir in memoriam, a pesar de haberse distanciado de Drieu (en vida de él.

  8. Crystal Structure of Marburg Virus VP40 Reveals a Broad, Basic Patch for Matrix Assembly and a Requirement of the N-Terminal Domain for Immunosuppression.

    Science.gov (United States)

    Oda, Shun-Ichiro; Noda, Takeshi; Wijesinghe, Kaveesha J; Halfmann, Peter; Bornholdt, Zachary A; Abelson, Dafna M; Armbrust, Tammy; Stahelin, Robert V; Kawaoka, Yoshihiro; Saphire, Erica Ollmann

    2016-02-15

    Marburg virus (MARV), a member of the filovirus family, causes severe hemorrhagic fever with up to 90% lethality. MARV matrix protein VP40 is essential for assembly and release of newly copied viruses and also suppresses immune signaling in the infected cell. Here we report the crystal structure of MARV VP40. We found that MARV VP40 forms a dimer in solution, mediated by N-terminal domains, and that formation of this dimer is essential for budding of virus-like particles. We also found the N-terminal domain to be necessary and sufficient for immune antagonism. The C-terminal domains of MARV VP40 are dispensable for immunosuppression but are required for virus assembly. The C-terminal domains are only 16% identical to those of Ebola virus, differ in structure from those of Ebola virus, and form a distinct broad and flat cationic surface that likely interacts with the cell membrane during virus assembly. Marburg virus, a cousin of Ebola virus, causes severe hemorrhagic fever, with up to 90% lethality seen in recent outbreaks. Molecular structures and visual images of the proteins of Marburg virus are essential for the development of antiviral drugs. One key protein in the Marburg virus life cycle is VP40, which both assembles the virus and suppresses the immune system. Here we provide the molecular structure of Marburg virus VP40, illustrate differences from VP40 of Ebola virus, and reveal surfaces by which Marburg VP40 assembles progeny and suppresses immune function. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  9. Las guerras de las mujeres en la guerra :[homenaje a la teórica deminista Victoria Sau

    Directory of Open Access Journals (Sweden)

    Lourdes Pérez González

    2011-12-01

    This paper pays tribute to the work of the feminist theorist Victoria Sau. The article relies on the three mythological or literary figures used by the author to exemplify the different stages of feminism -Cassandra, Antigone and Lysistrata- in order to review the roles played in different moments and places by women in war, understood as a defence mechanism intended to preserve the patriarchal system. As long as this mechanism is not dismantled, these roles will not disappear.

  10. The Life and Work of Marvin Kenneth Simon

    KAUST Repository

    Alouini, Mohamed-Slim

    2016-12-30

    It is a measure of the importance and profundity of Marvin Kenneth Simon\\'s contributions to communication theory that a tribute article and tutorial about his life and work is of current research relevance in spite of the continually accelerating rate of evolution in this area. Marv, as the entire community affectionately knew him, was one of the most prolific and influential communications researchers of his generation. Moreover, he laid the foundation for many of the techniques used in communication systems today. Marv\\'s death on September 23, 2007 continues to engender pangs not only of sadness at the passing of a great friend to many in our community, but also of regret that he is no longer with us to help in resolving the many challenges facing communication systems today.

  11. A Single Amino Acid Change in the Marburg Virus Matrix Protein VP40 Provides a Replicative Advantage in a Species-Specific Manner

    Science.gov (United States)

    Koehler, Alexander; Kolesnikova, Larissa; Welzel, Ulla; Schudt, Gordian; Herwig, Astrid

    2015-01-01

    ABSTRACT Marburg virus (MARV) induces severe hemorrhagic fever in humans and nonhuman primates but only transient nonlethal disease in rodents. However, sequential passages of MARV in rodents boosts infection leading to lethal disease. Guinea pig-adapted MARV contains one mutation in the viral matrix protein VP40 at position 184 (VP40D184N). The contribution of the D184N mutation to the efficacy of replication in a new host is unknown. In the present study, we demonstrated that recombinant MARV containing the D184N mutation in VP40 [rMARVVP40(D184N)] grew to higher titers than wild-type recombinant MARV (rMARVWT) in guinea pig cells. Moreover, rMARVVP40(D184N) displayed higher infectivity in guinea pig cells. Comparative analysis of VP40 functions indicated that neither the interferon (IFN)-antagonistic function nor the membrane binding capabilities of VP40 were affected by the D184N mutation. However, the production of VP40-induced virus-like particles (VLPs) and the recruitment of other viral proteins to the budding site was improved by the D184N mutation in guinea pig cells, which resulted in the higher infectivity of VP40D184N-induced infectious VLPs (iVLPs) compared to that of VP40-induced iVLPs. In addition, the function of VP40 in suppressing viral RNA synthesis was influenced by the D184N mutation specifically in guinea pig cells, thus allowing greater rates of transcription and replication. Our results showed that the improved viral fitness of rMARVVP40(D184N) in guinea pig cells was due to the better viral assembly function of VP40D184N and its lower inhibitory effect on viral transcription and replication rather than modulation of the VP40-mediated suppression of IFN signaling. IMPORTANCE The increased virulence achieved by virus passaging in a new host was accompanied by mutations in the viral genome. Analyzing how these mutations affect the functions of viral proteins and the ability of the virus to grow within new host cells helps in the understanding

  12. The spatial and temporal distribution of heavy metals in sediments of Victoria Harbour, Hong Kong

    International Nuclear Information System (INIS)

    Tang, Chloe Wing-yee; Ip, Carman Ching-man; Zhang Gan; Shin, Paul K.S.; Qian Peiyuan; Li Xiangdong

    2008-01-01

    Victoria Harbour has received substantial loadings of pollutants from industrial and municipal wastewater discharged since the 1950s. Inputs of contaminants have declined dramatically during the last two decades as a result of better controls at the source and improved wastewater treatment facilities. To assess the spatial and temporal changes of metal contaminants in sediments in Victoria Harbour, core and grab sediments were collected. The central harbour areas were generally contaminated with heavy metals. The spatial distribution of trace metals can probably be attributed to the proximity of major urban and industrial discharge points, and to the effect of tidal flushing in the harbour. In the sediment cores, the highest concentrations of trace metals were observed to have accumulated during the 1950s-1980s, corresponding with the period of rapid urban and industrial development in Hong Kong. From the late 1980s, there has been a major decline in the concentrations of trace metals, due to a reduction in industrial activities and to the enactment of wastewater pollution controls in the territory. The Pb isotopic compositions of the sediments revealed the anthropogenic inputs of Pb to the harbour. The 206 Pb/ 207 Pb ratios varied from 1.154 to 1.190, which were lower than those of background geological materials in Hong Kong ( 206 Pb/ 207 Pb: 1.201-1.279). The data also indicated that the Pb in the harbour sediments most likely originated from mixed sources, including the leaded gasoline used in the past and other anthropogenic sources

  13. The spatial and temporal distribution of heavy metals in sediments of Victoria Harbour, Hong Kong

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Chloe Wing-yee; Ip, Carman Ching-man [Department of Civil and Structural Engineering, The Hong Kong Polytechnic University, Hung Hom, Kowloon (Hong Kong); Zhang Gan [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Shin, Paul K.S. [Department of Biology and Chemistry, City University of Hong Kong, Tat Chee Avenue, Kowloon (Hong Kong); Qian Peiyuan [Department of Biology and Coastal Marine Laboratory, Hong Kong University of Science and Technology, Clear Water Bay, Kowloon (Hong Kong); Li Xiangdong [Department of Civil and Structural Engineering, The Hong Kong Polytechnic University, Hung Hom, Kowloon (Hong Kong)], E-mail: cexdli@polyu.edu.hk

    2008-07-01

    Victoria Harbour has received substantial loadings of pollutants from industrial and municipal wastewater discharged since the 1950s. Inputs of contaminants have declined dramatically during the last two decades as a result of better controls at the source and improved wastewater treatment facilities. To assess the spatial and temporal changes of metal contaminants in sediments in Victoria Harbour, core and grab sediments were collected. The central harbour areas were generally contaminated with heavy metals. The spatial distribution of trace metals can probably be attributed to the proximity of major urban and industrial discharge points, and to the effect of tidal flushing in the harbour. In the sediment cores, the highest concentrations of trace metals were observed to have accumulated during the 1950s-1980s, corresponding with the period of rapid urban and industrial development in Hong Kong. From the late 1980s, there has been a major decline in the concentrations of trace metals, due to a reduction in industrial activities and to the enactment of wastewater pollution controls in the territory. The Pb isotopic compositions of the sediments revealed the anthropogenic inputs of Pb to the harbour. The {sup 206}Pb/{sup 207}Pb ratios varied from 1.154 to 1.190, which were lower than those of background geological materials in Hong Kong ({sup 206}Pb/{sup 207}Pb: 1.201-1.279). The data also indicated that the Pb in the harbour sediments most likely originated from mixed sources, including the leaded gasoline used in the past and other anthropogenic sources.

  14. The management of forensic patients in Victoria: the more things change, the more they remain the same

    OpenAIRE

    Ruffles, Janet

    2017-01-01

    The introduction, in 1997, of the Crimes (Menta/Impairment and Unfitness to be Tried) Act 1997 (Vic) (CMIA) marked dramatic legal and procedural changes to the common law system governing the post-acquittal detention of persons found not guilty by reason of insanity in Victoria which had endured for almost 200 years. The CMIA's express aim to restore the balance between community safety and the rights of persons found not guilty by reason of mental impairment (NGRMI) (as the ve...

  15. The Victoria and Alfred Waterfront as playground for Capetonians

    Directory of Open Access Journals (Sweden)

    Sanette Ferreira

    2014-07-01

    Full Text Available The paper contributes to the exploration and understanding of the social geographies of public space in the Victoria & Alfred Waterfront (V&AW in Cape Town. The aim is to understand Capetonians’ (visitors and employees perceptions of the V&AW as public, leisure, shopping and working spaces. The appropriate literature on waterfront developments in providing public, working and leisure space is reviewed. Two questionnaire surveys (visitors and employees as well as eight unstructured interviews with important role players in the tourism industry of Cape Town were conducted. Findings revealed the most important reasons for Capetonians to visit or use certain spaces in the V&AW, the public open spaces they liked and how they perceived the V&AW as an inclusive space. The research also sought the respondents’ views on how the certain public spaces can be improved; what new activities and retail shops can be introduced; their opinions about the affordability of restaurants and parking; and how the V&AW can improve to cater for the needs of the Waterfront’s employees. Recommendations are made for making the V&AW more functional and accessible to Capetonians.

  16. Animal models for Ebola and Marburg virus infections

    Science.gov (United States)

    Nakayama, Eri; Saijo, Masayuki

    2013-01-01

    Ebola and Marburg hemorrhagic fevers (EHF and MHF) are caused by the Filoviridae family, Ebolavirus and Marburgvirus (ebolavirus and marburgvirus), respectively. These severe diseases have high mortality rates in humans. Although EHF and MHF are endemic to sub-Saharan Africa. A novel filovirus, Lloviu virus, which is genetically distinct from ebolavirus and marburgvirus, was recently discovered in Spain where filoviral hemorrhagic fever had never been reported. The virulence of this virus has not been determined. Ebolavirus and marburgvirus are classified as biosafety level-4 (BSL-4) pathogens and Category A agents, for which the US government requires preparedness in case of bioterrorism. Therefore, preventive measures against these viral hemorrhagic fevers should be prepared, not only in disease-endemic regions, but also in disease-free countries. Diagnostics, vaccines, and therapeutics need to be developed, and therefore the establishment of animal models for EHF and MHF is invaluable. Several animal models have been developed for EHF and MHF using non-human primates (NHPs) and rodents, which are crucial to understand pathophysiology and to develop diagnostics, vaccines, and therapeutics. Rhesus and cynomolgus macaques are representative models of filovirus infection as they exhibit remarkably similar symptoms to those observed in humans. However, the NHP models have practical and ethical problems that limit their experimental use. Furthermore, there are no inbred and genetically manipulated strains of NHP. Rodent models such as mouse, guinea pig, and hamster, have also been developed. However, these rodent models require adaptation of the virus to produce lethal disease and do not mirror all symptoms of human filovirus infection. This review article provides an outline of the clinical features of EHF and MHF in animals, including humans, and discusses how the animal models have been developed to study pathophysiology, vaccines, and therapeutics. PMID:24046765

  17. Animal models for Ebola and Marburg virus infections

    Directory of Open Access Journals (Sweden)

    Eri eNakayama

    2013-09-01

    Full Text Available Ebola and Marburg hemorrhagic fevers (EHF and MHF are caused by the Filoviridae family, Ebolavirus and Marburgvirus (ebolavirus and marburgvirus, respectively. These severe diseases have high mortality rates in humans. Although EHF and MHF are endemic to sub-Saharan Africa. A novel filovirus, Lloviu virus, which is genetically distinct from ebolavirus and marburgvirus, was recently discovered in Spain where filoviral hemorrhagic fever had never been reported. The virulence of this virus has not been determined. Ebolavirus and marburgvirus are classified as biosafety level-4 (BSL-4 pathogens and Category A agents, for which the US government requires preparedness in case of bioterrorism. Therefore, preventive measures against these viral hemorrhagic fevers should be prepared, not only in disease-endemic regions, but also in disease-free countries. Diagnostics, vaccines, and therapeutics need to be developed, and therefore the establishment of animal models for EHF and MHF is invaluable. Several animal models have been developed for EHF and MHF using nonhuman primates (NHPs and rodents, which are crucial to understand pathophysiology and to develop diagnostics, vaccines, and therapeutics. Rhesus and cynomolgus macaques are representative models of filovirus infection as they exhibit remarkably similar symptoms to those observed in humans. However, the NHP models have practical and ethical problems that limit their experimental use. Furthermore, there are no inbred and genetically manipulated strains of NHP. Rodent models such as mouse, guinea pig, and hamster, have also been developed. However, these rodent models require adaptation of the virus to produce lethal disease and do not mirror all symptoms of human filovirus infection. This review article provides an outline of the clinical features of EHF and MHF in animals, including humans, and discusses how the animal models have been developed to study pathophysiology, vaccines, and therapeutics.

  18. Prantslastelt õppimas / Marve Koppel, Heli Leppik

    Index Scriptorium Estoniae

    Koppel, Marve

    2005-01-01

    Kuressaare ametikoolis järgmisel õppeaastal rakenduvast majutuskorralduse eriala õppekavast, mille koostamisel on eeskujuks võetud Prantsuse hotellikooli Lycee d'Hotellerie et de Tourisme Saint-Quentin-en-Yvelines õppekava

  19. A Paramedic-staffed Helicopter Emergency Medical Service's Response to Winch Missions in Victoria, Australia.

    Science.gov (United States)

    Meadley, Ben; Heschl, Stefan; Andrew, Emily; de Wit, Anthony; Bernard, Stephen A; Smith, Karen

    2016-01-01

    Winching emergency medical care providers from a helicopter to the scene enables treatment of patients in otherwise inaccessible locations, but is not without risks. The objective of this study was to define characteristics of winch missions undertaken by Intensive Care Flight Paramedics (ICFP) in Victoria, Australia with a focus on extraction methods and clinical care delivered at the scene. A retrospective data analysis was performed to identify all winch missions between November 2010 and March 2014. Demographic data, winch characteristics, physiological parameters, and interventions undertaken on scene by the ICFP were extracted. Out of 5,003 missions in the study period, 125 were identified as winch operations. Winter missions were significantly less frequent than those of any other season. Patients were predominantly male (78.4%) and had a mean age of 38 years (±17.6). A total of 109 (87.2%) patients were identified as experiencing trauma with a mean Revised Trauma Score of 7.5288, and isolated limb fractures were the most frequently encountered injury. Falls and vehicle-related trauma were the most common mechanisms of injury. The total median scene duration was 49 minutes (IQR 23-91). Sixty-three patients (50.4%) were extracted using a stretcher, 45 (36.0%) using a hypothermic strop, and 6 (4.8%) via normal rescue strop. Eleven patients (8.8%) were not winched to the helicopter. Vascular access (38.4%), analgesia (44.0%), and anti-emetic administration (28.8%) were the most frequent clinical interventions. Forty-nine patients (39.2%) did not receive any clinical intervention prior to winch extraction. Winch operations in Victoria, Australia consisted predominantly of patients with minor to moderate traumatic injuries. A significant proportion of patients did not require any clinical treatment prior to winching, and among those who did, analgesia was the most frequent intervention. Advanced medical procedures were rarely required prior to winch extraction.

  20. The job satisfaction of female sex workers working in licensed brothels in Victoria, Australia.

    Science.gov (United States)

    Bilardi, Jade E; Miller, Amanda; Hocking, Jane S; Keogh, Louise; Cummings, Rosey; Chen, Marcus Y; Bradshaw, Catriona S; Fairley, Christopher K

    2011-01-01

    Previous studies have examined sex workers' attitudes to work but not their levels of job satisfaction compared with other occupations. The job satisfaction levels and standards of living of sex workers in licensed brothels in Victoria were compared with Australian women. Responses to a questionnaire that included questions about sex work and their "most likely alternative job." Survey data was compared with identical questions from the Households, Income and Labour Dynamics in Australia Survey. A structured survey was undertaken with sex workers in Victoria attending a a sexual health service. Of the 112 sex workers who agreed to participate in the study, 85 (76%) completed the survey. The median years women had been working as sex workers was three (range 0.1-18). The main reasons women started sex work was because "they needed the money" (69%), were attracted to the flexible hours (44%) or had a particular goal in mind (43%). The two biggest concerns women had about sex work were their safety (65%) and the risk of sexually transmitted infections (65%). When compared with the median job satisfaction scores of Australian women working in sex workers' "most likely alternative jobs," 50% of sex workers reported a higher median satisfaction score for sex work in relation to hours worked, 47% in relation to flexibility, 43% in relation to total pay, 26% in relation to job security, 19% in relation to the work itself, and 25% in relation to overall job satisfaction. Women reported that they primarily do sex work for financial gain although a significant minority prefer it to other work they would be likely to do. These results should be interpreted in the context that the presence of personality disorders that are common among sex workers were not measured in this study. © 2010 International Society for Sexual Medicine.

  1. The population structure of Glossina fuscipes fuscipes in the Lake Victoria basin in Uganda: implications for vector control

    OpenAIRE

    Hyseni, Chaz; Kato, Agapitus B; Okedi, Loyce M; Masembe, Charles; Ouma, Johnson O; Aksoy, Serap; Caccone, Adalgisa

    2012-01-01

    Abstract Background Glossina fuscipes fuscipes is the primary vector of trypanosomiasis in humans and livestock in Uganda. The Lake Victoria basin has been targeted for tsetse eradication using a rolling carpet initiative, from west to east, with four operational blocks (3 in Uganda and 1 in Kenya), under a Pan-African Tsetse and Trypanosomiasis Eradication Campaign (PATTEC). We screened tsetse flies from the three Ugandan PATTEC blocks for genetic diversity at 15 microsatellite loci from con...

  2. Investigando a papá: un análisis del documental ‘Desobediencia debida’ de Victoria Reale (2008

    Directory of Open Access Journals (Sweden)

    Victoria Maria Torres

    2016-08-01

    Full Text Available Este artículo analiza la película Desobediencia debida realizada en el año 2008 por la directora argentina Victoria Reale teniendo en cuenta algunas de sus particularidades con respecto a los demás documentales sobre la guerra de Malvinas por un lado, y, por el otro, haciendo especial hincapié en su relación con la serie de documentales dirigidos por la generación de los hijos de detenidos-desaparecidos durante la última dictadura militar.

  3. Perceptions about interventions to control schistosomiasis among the Lake Victoria island communities of Koome, Uganda.

    Directory of Open Access Journals (Sweden)

    Richard E Sanya

    2017-10-01

    Full Text Available Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities.In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach.Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials.Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.

  4. Perceptions about interventions to control schistosomiasis among the Lake Victoria island communities of Koome, Uganda.

    Science.gov (United States)

    Sanya, Richard E; Tumwesige, Edward; Elliott, Alison M; Seeley, Janet

    2017-10-01

    Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities. In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach. Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials. Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.

  5. Modelling and short-term forecasting of daily peak power demand in Victoria using two-dimensional wavelet based SDP models

    International Nuclear Information System (INIS)

    Truong, Nguyen-Vu; Wang, Liuping; Wong, Peter K.C.

    2008-01-01

    Power demand forecasting is of vital importance to the management and planning of power system operations which include generation, transmission, distribution, as well as system's security analysis and economic pricing processes. This paper concerns the modeling and short-term forecast of daily peak power demand in the state of Victoria, Australia. In this study, a two-dimensional wavelet based state dependent parameter (SDP) modelling approach is used to produce a compact mathematical model for this complex nonlinear dynamic system. In this approach, a nonlinear system is expressed by a set of linear regressive input and output terms (state variables) multiplied by the respective state dependent parameters that carry the nonlinearities in the form of 2-D wavelet series expansions. This model is identified based on historical data, descriptively representing the relationship and interaction between various components which affect the peak power demand of a certain day. The identified model has been used to forecast daily peak power demand in the state of Victoria, Australia in the time period from the 9th of August 2007 to the 24th of August 2007. With a MAPE (mean absolute prediction error) of 1.9%, it has clearly implied the effectiveness of the identified model. (author)

  6. Was Queen Victoria depressed? 1. Natural history and differential diagnosis of presenting problem.

    Science.gov (United States)

    Powles, W E; Alexander, M G

    1987-02-01

    For some years we have speculated as to whether Queen Victoria suffered a definable psychiatric illness in her notorious and prolonged seclusion after the Prince Consort's death. We here summarize criteria for grief and depression from three authorities. Against these, we examine the natural history of the Queen's bereavement and restitution. We find that her suffering and her portrayal of the role of widow were related to her personal style and were culturally accepted. Her self-esteem, ego functions, and object relatedness were preserved. While some clinicians might favour a diagnosis of Dysthymic Disorder, we find the evidence strongly in favour of an intense, prolonged, normal human grief (Uncomplicated Bereavement of DSM III) coloured by a romantic and histrionic personal style. Intensity and duration do not, in this case, establish a diagnosis of depression.

  7. Infección por Campylobacter y Shigella como causa de Diarrea Aguda Infecciosa en niños menores de dos años en el Distrito de la Victoria, Lima-Perú

    OpenAIRE

    María Perales D; Máximo Camiña; Carmen Quiñones

    2002-01-01

    Objetivo: Determinar la frecuencia de Campylobacter y Shigella como agentes etiológicos en diarrea aguda acuosa en niños menores de dos años atendidos en 4 centros de salud del distrito de La Victoria (Lima, Perú) Materiales y métodos: en este estudio transversal analítico se realizaron coprocultivos bajo técnica microbiológica estándar a los niños menores de dos años con diarrea aguda acuosa atendidos en 4 centros de salud de La Victoria entre abril y octubre de 2001. Fueron excluidos aquell...

  8. Una sorprendente victoria: Menem y su red de apoyo en las elecciones internas del peronismo de 1988

    OpenAIRE

    Joaquín Baeza Belda

    2010-01-01

    1989 supuso para Argentina la llegada a la presidencia del justicialista Carlos Menem y el inicio de un sorprendente giro, dados los antecedentes de su partido, hacia políticas neoliberales. Como paso previo, sin embargo, Menem debió vencer en unas elecciones internas en las que partía, en principio, en clara desventaja ante el favorito Antonio Cafiero, gobernador de la provincia de Buenos Aires y líder de la llamada Renovación peronista. La sorprendente victoria de Menem en 1988 ha sido expl...

  9. Balancing the people, profit and planet dimensions in international marketing channels : a study on coordinating mechanisms in the Nile perch channel from Lake Victoria

    NARCIS (Netherlands)

    Kambewa, E.

    2007-01-01

    Keywords: people, profit, planet, marketing channels, contracts, sustainability, quality,LakeVictoria, conjointanalysis

  10. An application of neutron activation analysis to determine the pathways of underground streams using bark from eucalypt trees (ironbark) within an afforested region near Rushworth, Central Victoria

    International Nuclear Information System (INIS)

    Nelms, K.

    1999-01-01

    A group of Year 11 students from Trinity Grammar School, Kew, Victoria, together with advice from Dr David Garnett of Becquerel Laboratories, Lucas Heights, devised a program seeking evidence for the delineation of the pathways(s) of underground stream(s) within a uniform region of eucalypt (ironbark) forest in the Rushworth region of Central Victoria. Bark and soil samples from representative grid sectors within the forest region were prepared for irradiation at HIFAR by the students and onforwarded to Lucas Heights for irradiation. After removal from the reactor the samples are to be analysed for evidence of differential elemental transfer rates in bark and soil. The display presents examples of the various stages of the overall project resulting from the award to the School of the David Culley Memorial Award of the Australian Nuclear Association

  11. Intended and unintended consequences of abortion law reform: perspectives of abortion experts in Victoria, Australia.

    Science.gov (United States)

    Keogh, L A; Newton, D; Bayly, C; McNamee, K; Hardiman, A; Webster, A; Bismark, M

    2017-01-01

    In Victoria, Australia, abortion was decriminalised in October 2008, bringing the law in line with clinical practice and community attitudes. We describe how experts in abortion service provision perceived the intent and subsequent impact of the 2008 Victorian abortion law reform. Experts in abortion provision in Victoria were recruited for a qualitative semi-structured interview about the 2008 law reform and its perceived impact, until saturation was reached. Nineteen experts from a range of health care settings and geographic locations were interviewed in 2014/2015. Thematic analysis was conducted to summarise participants' views. Abortion law reform, while a positive event, was perceived to have changed little about the provision of abortion. The views of participants can be categorised into: (1) goals that law reform was intended to address and that have been achieved; (2) intent or hopes of law reform that have not been achieved; (3) unintended consequences; (4) coincidences; and (5) unfinished business. All agreed that law reform had repositioned abortion as a health rather than legal issue, had shifted the power in decision making from doctors to women, and had increased clarity and safety for doctors. However, all described outstanding concerns; limited public provision of surgical abortion; reduced access to abortion after 20 weeks; ongoing stigma; lack of a state-wide strategy for equitable abortion provision; and an unsustainable workforce. Law reform, while positive, has failed to address a number of significant issues in abortion service provision, and may have even resulted in a 'lull' in action. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  12. Estudio cap de dengue en los distritos de Cercado de Lima, La Victoria y San Luis. Lima, Perú. junio 2004

    Directory of Open Access Journals (Sweden)

    Ronal Jamanca S

    2005-03-01

    Full Text Available Objetivos: Determinar el nivel de conocimientos, actitudes y prácticas con respecto al dengue en la población de tres distritos de Lima, Perú: Lima Cercado, La Victoria y San Luis. Materiales y Métodos: Estudio descriptivo, transversal y prospectivo, basado en la población, el tamaño muestral calculado para un índice aédico de 1%, se usó un muestreo bietápico. Se usó una entrevista estructurada de 17 preguntas cerradas, aplicada por personal de saneamiento ambiental o promotores de salud capacitados, a la primera persona adulta que atendía en la vivienda seleccionada. Los datos fueron ingresados en Epi Info v.6 y analizados en SPSS v.11. Resultados: Se entrevistó a 5381 pobladores, el promedio de edad de lo participantes fue de 42±16 años, las dos terceras partes fueron mujeres y 76% tenían un nivel de educación secundaria o superior. El 69,2% manifestó conocer el dengue, sin embargo sólo 65,4% de los que declaraban conocerlo tenían un conocimiento aceptable. 121 entrevistados (2,1% refirieron picaduras matutinas en los miembros inferiores, sospechosas de Aedes aegypti. El 55,1% de los entrevistados practicaban almacenamiento de agua en sus viviendas, siendo La Victoria el lugar más frecuente con esta práctica (65,8%. En comparación con los que hicieron estudios escolares en el norte del país, los que estudiaron en la sierra tuvieron significativamente menor conocimiento del dengue (OR= 2,21; IC 95%: 1,72-2,83. Conclusiones: Es necesario implementar actividades intersectoriales de promoción, prevención y control del dengue, especialmente en la jurisdicción de la Victoria y en aquellas personas provenientes de la sierra; así como, fortalecer la vigilancia entomológica, sobretodo en aquellas viviendas donde se reporta picaduras sospechosas de Aedes aegypti.

  13. The bone microstructure of polar "hypsilophodontid" dinosaurs from Victoria, Australia.

    Science.gov (United States)

    Woodward, Holly N; Rich, Thomas H; Vickers-Rich, Patricia

    2018-01-18

    High-latitude (i.e., "polar") Mesozoic fauna endured months of twilight and relatively low mean annual temperatures. Yet non-avian dinosaurs flourished in this taxing environment. Fossils of basal ornithopod dinosaurs ("hypsilophodontids") are common in the Early Cretaceous high-latitude sediments of Victoria, Australia, and four taxa have been described; although their ontogenetic histories are largely unexplored. In the present study, eighteen tibiae and femora were utilized in the first multi-specimen ontogenetic histological analysis of Australian polar hypsilophodontids. The sample consists of eleven individuals from the Flat Rocks locality (Late Valanginian or Barremian), and five from the Dinosaur Cove locality (Albian). In both groups, growth was most rapid during the first three years, and skeletal maturity occurred between five and seven years. There is a weak asymptotic trend in a plot of growth mark count versus femur length, with considerable individual variation. Histology suggests two genera are present within the Dinosaur Cove sample, but bone microstructure alone could not distinguish genera within the Flat Rocks sample, or across the two geologically separate (~ 26 Ma) localities. Additional histologic sampling, combined with morphological analyses, may facilitate further differentiation between ontogenetic, individual, and species variation.

  14. The Green Dialysis Survey: Establishing a Baseline for Environmental Sustainability across Dialysis Facilities in Victoria, Australia.

    Science.gov (United States)

    Barraclough, Katherine A; Gleeson, Alice; Holt, Stephen G; Agar, John Wm

    2017-11-02

    The Green Dialysis Survey aimed to 1) establish a baseline for environmental sustainability (ES) across Victorian dialysis facilities, and 2) guide future initiatives to reduce the environmental impact of dialysis delivery. Nurse unit managers of all Victorian public dialysis facilities received an online link to the survey, which asked 107 questions relevant to the ES of dialysis services. Responses were received from 71/83 dialysis facilities in Victoria (86%), representing 628/660 dialysis chairs (95%). Low energy lighting was present in 13 facilities (18%), 18 (25%) recycled reverse osmosis water and 7 (10%) reported use of renewable energy. Fifty-six facilities (79%) performed comingled recycling but only 27 (38%) recycled polyvinyl chloride plastic. A minority educated staff in appropriate waste management (n=30;42%) or formally audited waste generation and segregation (n=19;27%). Forty-four (62%) provided secure bicycle parking but only 33 (46%) provided shower and changing facilities. There was limited use of tele- or video-conferencing to replace staff meetings (n=19;27%) or patient clinic visits (n=13;18%). A minority considered ES in procurement decisions (n=28;39%) and there was minimal preparedness to cope with climate change. Only 39 services (49%) confirmed an ES policy and few had ever formed a green group (n=14; 20%) or were currently undertaking a green project (n=8;11%). Only 15 facilities (21%) made formal efforts to raise awareness of ES. This survey provides a baseline for practices that potentially impact the environmental sustainability of dialysis units in Victoria, Australia. It also identifies achievable targets for attention. This article is protected by copyright. All rights reserved.

  15. CULTURAL MEMORY OF VICTORY OF LAS TUNAS CITY' LODGES FROM 1930 TO 1945 / MEMORIA CULTURAL DE LAS LOGIAS DE VICTORIA DE LAS TUNAS 1930-1945

    Directory of Open Access Journals (Sweden)

    Milena Medina Pérez

    2012-09-01

    Full Text Available The cultural memory of the lodges of Victoria de Las Tunas (1930-1945, it constitutes the topic of the present investigation. The thematic of the lodges has been approached for studious and investigating, not alone of the town but of several parts of the world. Still when these studies exist, the related with the cultural memory of the lodges of the territory, is in the pages of the documents of the time that which leaves to the light starting from this investigation, to show yesterday's Tunas, rich in histories and anecdotes. In the town during the investigated period the lodges Masonic Children of Hiram existed, Vicente García No. 27, the young AJEF, the lodge Teosófica Esperanza, the Children of East No. 54 of the Odd Independent Fellows, the lodge Cucalambé of the Odd United Fellows and the lodge Victoria de Las Tunas No. 78 of the Luz's Order Gentlemen.

  16. Linking land use changes to surface water quality variability in Lake Victoria: some insights from remote sensing

    Science.gov (United States)

    Mugo, R. M.; Limaye, A. S.; Nyaga, J. W.; Farah, H.; Wahome, A.; Flores, A.

    2016-12-01

    The water quality of inland lakes is largely influenced by land use and land cover changes within the lake's catchment. In Africa, some of the major land use changes are driven by a number of factors, which include urbanization, intensification of agricultural practices, unsustainable farm management practices, deforestation, land fragmentation and degradation. Often, the impacts of these factors are observable on changes in the land cover, and eventually in the hydrological systems. When the natural vegetation cover is reduced or changed, the surface water flow patterns, water and nutrient retention capacities are also changed. This can lead to high nutrient inputs into lakes, leading to eutrophication, siltation and infestation of floating aquatic vegetation. To assess the relationship between land use and land cover changes in part of the Lake Victoria Basin, a series of land cover maps were derived from Landsat imagery. Changes in land cover were identified through change maps and statistics. Further, the surface water chlorophyll-a concentration and turbidity were derived from MODIS-Aqua data for Lake Victoria. Chlrophyll-a and turbidity are good proxy indicators of nutrient inputs and siltation respectively. The trends in chlorophyll-a and turbidity concentrations were analyzed and compared to the land cover changes over time. Certain land cover changes related to agriculture and urban development were clearly identifiable. While these changes might not be solely responsible for variability in chlrophyll-a and turbidity concentrations in the lake, they are potentially contributing factors to this problem. This work illustrates the importance of addressing watershed degradation while seeking to solve water quality related problems.

  17. Shallow high-resolution geophysical investigation along the western segment of the Victoria Lines Fault (island of Malta)

    Science.gov (United States)

    Villani, Fabio; D'Amico, Sebastiano; Panzera, Francesco; Vassallo, Maurizio; Bozionelos, George; Farrugia, Daniela; Galea, Pauline

    2018-01-01

    The Victoria Lines Fault (island of Malta) is a >15 km-long and N260°-striking segmented normal fault-system, which is probably inactive since the late Pliocene. In the westernmost part, the Fomm Ir-Rih segment displays comparable geologic throw and escarpment height ( 150-170 m), moreover its hangingwall hosts thin patches of Middle Pleistocene clastic continental deposits (red beds), which are poorly preserved elsewhere. We acquired two seismic transects, by collecting ambient vibration recordings, processed by using horizontal-to-vertical spectral ratios, complemented by one high-resolution 2-D refraction tomography survey crossing this fault where it is locally covered by red beds and recent colluvial deposits. We found a resonance peak at 1.0 Hz in the hangingwall block, whereas clear peaks in the range 5.0-10.0 Hz appear when approaching the subsurface fault, and we relate them to the fractured bedrock within the fault zone. The best-fit tomographic model shows a relatively high-Vp shallow body (Vp 2200-2400 m/s) that we relate to the weathered top of the Miocene Upper Coralline Limestone Fm., bounded on both sides by low-Vp regions (230 m/s above the weathered top-bedrock. Our results depict a clear seismic signature of the Victoria Lines Fault, characterized by low seismic velocity and high amplification of ground motion. We hypothesize that, during the Middle Pleistocene, faulting may have affected the basal part of the red beds, so that this part of the investigated complex fault-system may be considered inactive since 0.6 Myr ago.

  18. Radium in potable waters from Central Victoria, Australia - an application of the Australian drinking water guidelines

    International Nuclear Information System (INIS)

    Tinker, R.A.; Smith, J.D.

    1998-01-01

    Determinations of 226 Ra and 228 Ra in potable mineral waters from springs located in the Daylesford-Hepburn region of Victoria, Australia are presented. Concentrations ranged from 230-810 mBq L -1 for 226 Ra and 200-800 mBq L -1 for 226 Ra. These levels approach or exceed the guideline limits recommended in the Australian Drinking Water Guidelines. The annual committed effective dose and health risks from radium in potable water is discussed. Assuming consumption of 2 L per day the average annual committed effective dose received from 226 Ra was 0.087 mSv y -1 and from 226 Ra was 0.10 mSv y -1

  19. Writing history: case study of the university of Victoria School of Nursing.

    Science.gov (United States)

    Scaia, Margaret R; Young, Lynne

    2013-04-23

    A historical examination of a nursing curriculum is a bridge between past and present from which insights to guide curriculum development can be gleaned. In this paper, we use the case study method to examine how the University of Victoria School of Nursing (UVic SON), which was heavily influenced by the ideology of second wave feminism, contributed to a change in the direction of nursing education from task-orientation to a content and process orientation. This case study, informed by a feminist lens, enabled us to critically examine the introduction of a "revolutionary" caring curriculum at the UVic SON. Our research demonstrates the fault lines and current debates within which a feminist informed curriculum continues to struggle for legitimacy and cohesion. More work is needed to illuminate the historical basis of these debates and to understand more fully the complex landscape that has constructed the social and historical position of women and nursing in Canadian society today.

  20. Suffering by comparison: Twitter users' reactions to the Victoria's Secret Fashion Show.

    Science.gov (United States)

    Chrisler, Joan C; Fung, Kaitlin T; Lopez, Alexandra M; Gorman, Jennifer A

    2013-09-01

    Social comparison theory suggests that evaluating the self in comparison with others (e.g., peers, celebrities, models) can influence body image. Experimental studies that have tested effects of viewing idealized images in the media often show that women feel worse about themselves after seeing images that illustrate the beauty ideal. Twitter presents a naturally occurring opportunity to study viewers' reactions. An analysis was conducted of 977 tweets sent immediately before and during the 2011 Victoria's Secret Fashion Show that reference the show. Although the majority were idiosyncratic remarks, many tweets contain evidence of upward social comparisons to the fashion models. There were tweets about body image, eating disorders, weight, desires for food or alcohol, and thoughts about self-harm. The results support social comparison theory, and suggest that vulnerable viewers could experience negative affect, or even engage in harmful behaviors, during or after viewing the show or others like it. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Accession of non-nitrogenous ions dissolved in rainwater to soils in Victoria

    Energy Technology Data Exchange (ETDEWEB)

    Hutton, J T; Leslie, T I

    1958-01-01

    Analyses of rainwater samples from 24 stations in Victoria have shown that with increasing distance from the coast there is a sharp decrease in the influence of the ocean on the nature of the dissolved ions. About 150 miles inland the ionic ratio of sodium to potassium falls below 10, that of sodium to chloride exceeds unity, and calcium becomes the dominant cation. This is considered to reflect the influence of terrestrial material such as the dry surface of soils. As soils also contain sodium and chloride ions, the common assumption that all the chloride in the rain is derived from the ocean is unjustified, hence calculations of the net accession of salts are unwarranted. In southern Australia, sulphate ions are present in much smaller amounts than in other countries and this may contribute to the observed deficiencies of sulphur in plant nutrition. Details are given of the method of collecting the rainwater and of its analysis.

  2. UNA PRAXIS CRISTIANA Y POPULAR EN LA POBLACIÓN LA VICTORIA DE SANTIAGO DE CHILE (1983-1988).

    OpenAIRE

    Andrés Morasso

    2010-01-01

    Este artículo presenta la relación entre residentes de la población La Victoria de Santiago deChile y la Iglesia en el contexto del gobierno militar (1973-1990), durante protestas socialescontra el régimen y relaciones de solidaridad establecidas a causa de la persecución políticadel periodo. ¿De qué forma las Comunidades cristianas de Base ayudaron a la organizaciónasistencial? ¿Qué papel tuvo la llamada “Iglesia Liberadora” en dicha población? ¿Qué roljugaron sacerdotes como líderes en La V...

  3. Modelling nitrogen transformation and removal in mara river basin wetlands upstream of lake Victoria

    Science.gov (United States)

    Mayo, Aloyce W.; Muraza, Marwa; Norbert, Joel

    2018-06-01

    Lake Victoria, the largest lake in Africa, is a resource of social-economic potential in East Africa. This lake receives water from numerous tributaries including Mara River, which contributes about 4.8% of the total Lake water inflow. Unfortunately, Mara River basin faces environmental problems because of intensive settlement, agriculture, overgrazing in the basin and mining activities, which has lead to water pollution in the river, soil erosion and degradation, decreased soil fertility, loss of vegetation cover, decreased water infiltration capacity and increased sedimentation. One of the pollutants carried by the river includes nitrogen, which has contributed to ecological degradation of the Lake Victoria. Therefore this research work was intended to determine the effectiveness of Mara River wetland for removal of nitrogen and to establish nitrogen removal mechanisms in the wetland. To predict nitrogen removal in the wetland, the dynamics of nitrogen transformation was studied using a conceptual numerical model that takes into account of various processes in the system using STELLA II version 9.0®2006 software. Samples of model input from water, plants and sediments were taken for 45 days and were analyzed for pH, temperature, and DO in situ and chemical parameters such as NH3-N, Org-N, NO2-N, and NO3-N were analyzed in the laboratory in accordance with Standard methods. For plants, the density, dominance, biomass productivity and TN were determined and for sediments TN was analyzed. Inflow into the wetland was determined using stage-discharge relationship and was found to be 734,400 m3/day and the average wetland volume was 1,113,500 m3. Data collected by this study were used for model calibration of nitrogen transformation in this wetland while data from another wetland were used for model validation. It was found that about 37.8% of total nitrogen was removed by the wetland system largely through sedimentation (26.6%), plant uptake (6.6%) and

  4. Occurance of aldehyde-fuchsin and performic acid-victoria blue positive granules in the ovarian pedicle of Dysdercus koenigii F. (Pyrrhocridae: Heteroptera).

    Science.gov (United States)

    Srivastava, R C; Srivastava, B P

    1976-10-15

    A cycle of activity of aldehyde-fuchsin and performic acid-Victoria blue positive granules was observed in the ovarian pedicle of Dysdercus koenigii during the first ovipositional cycle. The quantitative variation of these granules in the pedicle can also be correlated directly with the increase or decrease of the neurosecretory material in the A-type cells of the pars intercerebralis medialis region of the protocerebrum of the brian.

  5. Regional development via high-speed rail : A study of the Stockholm-Mälaren region and possibilities for Melbourne-regional Victoria

    OpenAIRE

    Bayley, Michael

    2012-01-01

    The purpose of this thesis is to examine, based on a study of the regional high-speed corridors in the Stockholm-Mälaren Region, the possibilities for regional high-speed rail in Melbourne-regional Victoria (Australia) to improve accessibility, and achieve regional development and balanced growth between the capital and its surrounding regions. It deals with the concept of 'regional' high-speed rail, a variant of classic high-speed rail that serves centres along regional corridors stemming fr...

  6. Characterization of Staphylococcus aureus isolates from raw milk sources in Victoria, Australia.

    Science.gov (United States)

    McMillan, Kate; Moore, Sean C; McAuley, Catherine M; Fegan, Narelle; Fox, Edward M

    2016-07-29

    Highly pathogenic strains of Staphylococcus aureus can cause disease in both humans and animals. In animal species, including ruminants, S. aureus may cause severe or sub-clinical mastitis. Dairy animals with mastitis frequently shed S. aureus into the milk supply which can lead to food poisoning in humans. The aim of this study was to use genotypic and immunological methods to characterize S. aureus isolates from milk-related samples collected from 7 dairy farms across Victoria. A total of 30 S. aureus isolates were collected from milk and milk filter samples from 3 bovine, 3 caprine and 1 ovine dairy farms across Victoria, Australia. Pulsed Field Gel Electrophoresis (PFGE) identified 11 distinct pulsotypes among isolates; all caprine and ovine isolates shared greater than 80 % similarity regardless of source. Conversely, bovine isolates showed higher diversity. Multi-Locus Sequence Typing (MLST) identified 5 different sequence types (STs) among bovine isolates, associated with human or ruminant lineages. All caprine and ovine isolates were ST133, or a single allele variant of ST133. Two new novel STs were identified among isolates in this study (ST3183 and ST3184). With the exception of these 2 new STs, eBURST analysis predicted all other STs to be founding members of their associated clonal complexes (CCs). Analysis of genetic markers revealed a diverse range of classical staphylococcal enterotoxins (SE) among isolates, with 11 different SEs identified among bovine isolates, compared with just 2 among caprine and ovine isolates. None of the isolates contained mecA, or were resistant to oxacillin. The only antibiotic resistance identified was that of a single isolate resistant to penicillin; this isolate also contained the penicillin resistance gene blaZ. Production of SE was observed at 16 °C and/or 37 °C in milk, however no SE production was detected at 12 °C. Although this study characterized a limited number of isolates, bovine-associated isolates

  7. Intestinal schistosomiasis among preschool children along the shores of Lake Victoria in Uganda

    DEFF Research Database (Denmark)

    Nalugwa, A.; Olsen, Annette; Tukahebwa, M. E.

    2015-01-01

    Schistosomiasis, a disease caused by Schistosoma trematode parasites, affects hundreds of millions of people and accounts for more than 40% of the global health burden due to neglected tropical diseases. In Uganda, intestinal schistosomiasis is endemic in 73 out of 112 districts and about 55......% of the population of 36 million individuals are at risk. There is scanty information on the status and burden of schistosomiasis in preschool children less than six years of age in Uganda. This study aimed to assess the status of Schistosoma mansoni infections in children aged 1-5 years in Uganda. S. mansoni...... prevalence and intensity of infection were examined in 3058 children from 5 districts along Lake Victoria shoreline, eastern Uganda. For each child one stool sample was collected on three consecutive days. The Kato-Katz technique was used to prepare stool smears on slides for microscopic examination. Short...

  8. Seismicity and arrival-time residuals from the Victoria Earthquake of June 9, 1980

    Energy Technology Data Exchange (ETDEWEB)

    Wong, V.; Frez, J.

    1981-01-01

    Hypocenter distribution in space and time of the aftershock activity from the Victoria Earthquake of June 9, 1980 was studied. It was concluded that the main event excited aftershocks in several pre-existing nests at the northwest end of the Cerro Prieto Fault, but no significant activity occurred at the immediate neighborhood of the main event. The depth of the aftershocks increases with the distance from the northwest end of the fault and this feature might be related with the higher temperatures and the spreading center located between the ends of the Imperial and Cerro Prieto Faults. The significance of the arrival-times residuals for local and regional stations is discussed both for P and S-waves and the importance of obtaining station corrections is emphasized. The non-uniqueness in determining a structure which minimizes the residuals is illustrated. Two different structures which satisfy the local data are presented.

  9. Effect of gap size on seedling establishment, growth and survival at three years in mountain ash (Eucalyptus regnans F. Muell.) forest in Victoria, Australia

    NARCIS (Netherlands)

    Meer, van der P.J.; Dignan, P.; Saveneh, A.G.

    1999-01-01

    Establishment, growth and survival of Eucalyptus regnans F. Muell. seedlings was studied at two sites over three years under a range of small gaps (up to 30mx30m) and large gaps (50mx50m up to clearfells) in a gap cutting experiment in mountain ash forest at Tanjil Bren, Victoria, Australia. In both

  10. Labouring Together: collaborative alliances in maternity care in Victoria, Australia—protocol of a mixed-methods study

    Science.gov (United States)

    Nagle, Cate; Kent, Bridie; Hutchinson, Alison M

    2017-01-01

    Introduction For over a decade, enquiries into adverse perinatal outcomes have led to reports that poor collaboration has been detrimental to the safety and experience of maternity care. Despite efforts to improve collaboration, investigations into maternity care at Morecambe Bay (UK) and Djerriwarrh Health Services (Australia) have revealed that poor collaboration and decision-making remain a threat to perinatal safety. The Labouring Together study will investigate how elements hypothesised to influence the effectiveness of collaboration are reflected in perceptions and experiences of clinicians and childbearing women in Victoria, Australia. The study will explore conditions that assist clinicians and women to work collaboratively to support positive maternity outcomes. Results of the study will provide a platform for consumers, clinician groups, organisations and policymakers to work together to improve the quality, safety and experience of maternity care. Methods and analysis 4 case study sites have been selected to represent a range of models of maternity care in metropolitan and regional Victoria, Australia. A mixed-methods approach including cross-sectional surveys and interviews will be used in each case study site, involving both clinicians and consumers. Quantitative data analysis will include descriptive statistics, 2-way multivariate analysis of variance for the dependent and independent variables, and χ2 analysis to identify the degree of congruence between consumer preferences and experiences. Interview data will be analysed for emerging themes and concepts. Data will then be analysed for convergent lines of enquiry supported by triangulation of data to draw conclusions. Ethics and dissemination Organisational ethics approval has been received from the case study sites and Deakin University Human Research Ethics Committee (2014–238). Dissemination of the results of the Labouring Together study will be via peer-reviewed publications and conference

  11. Homologous and Heterologous Protection of Nonhuman Primates by Ebola and Sudan Virus-Like Particles

    Science.gov (United States)

    Warfield, Kelly L.; Dye, John M.; Wells, Jay B.; Unfer, Robert C.; Holtsberg, Frederick W.; Shulenin, Sergey; Vu, Hong; Swenson, Dana L.; Bavari, Sina; Aman, M. Javad

    2015-01-01

    Filoviruses cause hemorrhagic fever resulting in significant morbidity and mortality in humans. Several vaccine platforms that include multiple virus-vectored approaches and virus-like particles (VLPs) have shown efficacy in nonhuman primates. Previous studies have shown protection of cynomolgus macaques against homologous infection for Ebola virus (EBOV) and Marburg virus (MARV) following a three-dose vaccine regimen of EBOV or MARV VLPs, as well as heterologous protection against Ravn Virus (RAVV) following vaccination with MARV VLPs. The objectives of the current studies were to determine the minimum number of vaccine doses required for protection (using EBOV as the test system) and then demonstrate protection against Sudan virus (SUDV) and Taï Forest virus (TAFV). Using the EBOV nonhuman primate model, we show that one or two doses of VLP vaccine can confer protection from lethal infection. VLPs containing the SUDV glycoprotein, nucleoprotein and VP40 matrix protein provide complete protection against lethal SUDV infection in macaques. Finally, we demonstrate protective efficacy mediated by EBOV, but not SUDV, VLPs against TAFV; this is the first demonstration of complete cross-filovirus protection using a single component heterologous vaccine within the Ebolavirus genus. Along with our previous results, this observation provides strong evidence that it will be possible to develop and administer a broad-spectrum VLP-based vaccine that will protect against multiple filoviruses by combining only three EBOV, SUDV and MARV components. PMID:25793502

  12. Homologous and heterologous protection of nonhuman primates by Ebola and Sudan virus-like particles.

    Directory of Open Access Journals (Sweden)

    Kelly L Warfield

    Full Text Available Filoviruses cause hemorrhagic fever resulting in significant morbidity and mortality in humans. Several vaccine platforms that include multiple virus-vectored approaches and virus-like particles (VLPs have shown efficacy in nonhuman primates. Previous studies have shown protection of cynomolgus macaques against homologous infection for Ebola virus (EBOV and Marburg virus (MARV following a three-dose vaccine regimen of EBOV or MARV VLPs, as well as heterologous protection against Ravn Virus (RAVV following vaccination with MARV VLPs. The objectives of the current studies were to determine the minimum number of vaccine doses required for protection (using EBOV as the test system and then demonstrate protection against Sudan virus (SUDV and Taï Forest virus (TAFV. Using the EBOV nonhuman primate model, we show that one or two doses of VLP vaccine can confer protection from lethal infection. VLPs containing the SUDV glycoprotein, nucleoprotein and VP40 matrix protein provide complete protection against lethal SUDV infection in macaques. Finally, we demonstrate protective efficacy mediated by EBOV, but not SUDV, VLPs against TAFV; this is the first demonstration of complete cross-filovirus protection using a single component heterologous vaccine within the Ebolavirus genus. Along with our previous results, this observation provides strong evidence that it will be possible to develop and administer a broad-spectrum VLP-based vaccine that will protect against multiple filoviruses by combining only three EBOV, SUDV and MARV components.

  13. Lloviu virus VP24 and VP35 proteins function as innate immune antagonists in human and bat cells

    International Nuclear Information System (INIS)

    Feagins, Alicia R.; Basler, Christopher F.

    2015-01-01

    Lloviu virus (LLOV) is a new member of the filovirus family that also includes Ebola virus (EBOV) and Marburg virus (MARV). LLOV has not been cultured; however, its genomic RNA sequence indicates the coding capacity to produce homologs of the EBOV and MARV VP24, VP35, and VP40 proteins. EBOV and MARV VP35 proteins inhibit interferon (IFN)-alpha/beta production and EBOV VP35 blocks activation of the antiviral kinase PKR. The EBOV VP24 and MARV VP40 proteins inhibit IFN signaling, albeit by different mechanisms. Here we demonstrate that LLOV VP35 suppresses Sendai virus induced IFN regulatory factor 3 (IRF3) phosphorylation, IFN-α/β production, and PKR phosphorylation. Additionally, LLOV VP24 blocks tyrosine phosphorylated STAT1 binding to karyopherin alpha 5 (KPNA5), STAT1 nuclear accumulation, and IFN-induced gene expression. LLOV VP40 lacks detectable IFN antagonist function. These activities parallel EBOV IFN inhibitory functions. EBOV and LLOV VP35 and VP24 proteins also inhibit IFN responses in bat cells. These data suggest that LLOV infection will block innate immune responses in a manner similar to EBOV. - Highlights: • Lloviu virus (LLOV) is a new member of the filovirus family. • LLOV VP35 blocks IRF3 phosphorylation, IFN-α/β production and PKR phosphorylation. • LLOV VP24 inhibits IFN responses by targeting phospho-STAT1 KPNA interaction. • Infection by LLOV may block innate immune responses in a manner similar to EBOV.

  14. Lloviu virus VP24 and VP35 proteins function as innate immune antagonists in human and bat cells

    Energy Technology Data Exchange (ETDEWEB)

    Feagins, Alicia R.; Basler, Christopher F., E-mail: chris.basler@mssm.edu

    2015-11-15

    Lloviu virus (LLOV) is a new member of the filovirus family that also includes Ebola virus (EBOV) and Marburg virus (MARV). LLOV has not been cultured; however, its genomic RNA sequence indicates the coding capacity to produce homologs of the EBOV and MARV VP24, VP35, and VP40 proteins. EBOV and MARV VP35 proteins inhibit interferon (IFN)-alpha/beta production and EBOV VP35 blocks activation of the antiviral kinase PKR. The EBOV VP24 and MARV VP40 proteins inhibit IFN signaling, albeit by different mechanisms. Here we demonstrate that LLOV VP35 suppresses Sendai virus induced IFN regulatory factor 3 (IRF3) phosphorylation, IFN-α/β production, and PKR phosphorylation. Additionally, LLOV VP24 blocks tyrosine phosphorylated STAT1 binding to karyopherin alpha 5 (KPNA5), STAT1 nuclear accumulation, and IFN-induced gene expression. LLOV VP40 lacks detectable IFN antagonist function. These activities parallel EBOV IFN inhibitory functions. EBOV and LLOV VP35 and VP24 proteins also inhibit IFN responses in bat cells. These data suggest that LLOV infection will block innate immune responses in a manner similar to EBOV. - Highlights: • Lloviu virus (LLOV) is a new member of the filovirus family. • LLOV VP35 blocks IRF3 phosphorylation, IFN-α/β production and PKR phosphorylation. • LLOV VP24 inhibits IFN responses by targeting phospho-STAT1 KPNA interaction. • Infection by LLOV may block innate immune responses in a manner similar to EBOV.

  15. Exploring midwifery students' views and experiences of caseload midwifery: A cross-sectional survey conducted in Victoria, Australia.

    Science.gov (United States)

    Dawson, Kate; Newton, Michelle; Forster, Della; McLachlan, Helen

    2015-02-01

    in Australia, models of maternity care that offer women continuity of care with a known midwife have been promoted. Little is known about the intentions of the future midwifery workforce to work in such models. This study aimed to explore midwifery students' views and experiences of caseload midwifery and their work intentions in relation to the caseload model following graduation. cross-sectional survey. Victoria, Australia. 129 midwifery students representing all midwifery course pathways (Post Graduate Diploma, Bachelor of Midwifery, Bachelor of Nursing/Bachelor of Midwifery) in Victoria. midwifery students from all course pathways considered that continuity of care is important to women and indicated that exposure to continuity models during their course was very positive. Two-thirds of the students (67%) considered that the continuity experiences made them want to work in a caseload model; only 5% reported that their experiences had discouraged them from continuity of care work in the future. Most wanted a period of consolidation to gain experience as a midwife prior to commencing in the caseload model. Perceived barriers to caseload work were being on-call, and challenges in regard to work/life balance and family commitments. midwifery students in this study were very positive about caseload midwifery and most would consider working in caseload after a period of consolidation. Continuity of care experiences during students' midwifery education programmes appeared to provide students with insight and understanding of continuity of care for both women and midwives. Further research should explore what factors influence students' future midwifery work, whether or not their plans are fulfilled, and whether or not the caseload midwifery workforce can be sustained. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Distribution and origin of authigenic smectite clays in Cape Roberts Project Core 3, Victoria Land Basin, Antarctica

    Science.gov (United States)

    Priestas, A.W.; Wise, S.W.

    2007-01-01

    Of some 800 m of lower Oligocene marine sediments cored continuously from the seafloor in the Victoria Land Basin of Antarctica at Cape Roberts Site CRP-3, the lower 500 m exhibit authigenic smectite clay coats on shallow-water sandstone grains. A scanning electron microscope/EDS study of 46 fracture sections confirms that the distribution of the clay coats through the unit is not uniform or evenly distributed, but rather varies with depth, original porosity, and the kinds and abundance of source materials. Our results suggest that smectite emplacement resulted from in-situ, low-temperature burial diagenesis rather than hydrothermal or fault-focused thermobaric fluids.

  17. Microbial quality and safety of fresh and dried Rastrineobola argentea from Lake Victoria, Tanzania

    DEFF Research Database (Denmark)

    Baniga, Zebedayo; Dalsgaard, Anders; Mhongole, Ofred J

    2017-01-01

    the bacteriological quality of fresh and dried sardines from Lake Victoria. Sardine samples were randomly collected from main landing sites and retail markets in the city of Mwanza. Total viable counts (TVC) in fresh sardines were in the range of 5.18–7.90 log10 cfu/g while those dried on racks contained 3.......13–4.85 log10 cfu/g which were 0.75% of those dried on sand with 4.80–7.13 log10 cfu/g (p .../g and those dried on sand contained 1.18–3.32 log10 mpn/g, however, sardines dried on racks, did not contain any E. coli. Similar findings were found in the two types of dried sardines from the retail markets. Prevalence of Salmonella spp. in fresh R. argentea was 25% (n = 40), sand dried sardines at landing...

  18. Inhibition of Ebola and Marburg Virus Entry by G Protein-Coupled Receptor Antagonists.

    Science.gov (United States)

    Cheng, Han; Lear-Rooney, Calli M; Johansen, Lisa; Varhegyi, Elizabeth; Chen, Zheng W; Olinger, Gene G; Rong, Lijun

    2015-10-01

    Filoviruses, consisting of Ebola virus (EBOV) and Marburg virus (MARV), are among the most lethal infectious threats to mankind. Infections by these viruses can cause severe hemorrhagic fevers in humans and nonhuman primates with high mortality rates. Since there is currently no vaccine or antiviral therapy approved for humans, there is an urgent need to develop prophylactic and therapeutic options for use during filoviral outbreaks and bioterrorist attacks. One of the ideal targets against filoviral infection and diseases is at the entry step, which is mediated by the filoviral glycoprotein (GP). In this report, we screened a chemical library of small molecules and identified numerous inhibitors, which are known G protein-coupled receptor (GPCR) antagonists targeting different GPCRs, including histamine receptors, 5-HT (serotonin) receptors, muscarinic acetylcholine receptor, and adrenergic receptor. These inhibitors can effectively block replication of both infectious EBOV and MARV, indicating a broad antiviral activity of the GPCR antagonists. The time-of-addition experiment and microscopic studies suggest that GPCR antagonists block filoviral entry at a step following the initial attachment but prior to viral/cell membrane fusion. These results strongly suggest that GPCRs play a critical role in filoviral entry and GPCR antagonists can be developed as an effective anti-EBOV/MARV therapy. Infection of Ebola virus and Marburg virus can cause severe illness in humans with a high mortality rate, and currently there is no FDA-approved vaccine or therapeutic treatment available. The 2013-2015 epidemic in West Africa underscores a lack of our understanding in the infection and pathogenesis of these viruses and the urgency of drug discovery and development. In this study, we have identified numerous inhibitors that are known G protein-coupled receptor (GPCR) antagonists targeting different GPCRs. These inhibitors can effectively block replication of both infectious

  19. PODA DE RAMAS MIXTAS Y RALEO DE FRUTOS: PRÁCTICAS CULTURALES INDEPENDIENTES EN DURAZNO 'VICTORIA'

    Directory of Open Access Journals (Sweden)

    J. A. Zegbe-Domínguez

    2007-01-01

    Full Text Available El durazno requiere de la poda (en particular, el despunte de las ramas mixtas, DRM y el raleo de frutos (RF para una producción comercial de fruta. En la estación de crecimiento del 2004-05, se estudió la interacción entre DRM y RF en durazno cultivar 'Victoria' sobre el rendimiento, distribución de la fruta por tamaños, calidad del fruto, crecimiento de fruto y brote, además del peso especifico de la hoja. El experimento se llevó a cabo en el Campo Experimental Zacatecas con árboles de 20 años e injertados en patrones francos. Los factores estudiados fueron: el DRM y el RF, ambos factores con dos niveles; sin y con DRM y sin y con RF. El análisis estadístico no detectó interacción significativa (P 5.1 cm con relación a árboles testigo (sin DRM. El crecimiento del fruto y la longitud de brote fueron significativamente (P<0.05 mayores en comparación con los árboles testigo, pero tanto el rendimiento como la eficiencia productiva fueron reducidos (P<0.05 cuando se aplicó el DRM. El peso medio del fruto, el mesocarpio y el endocarpio fue significativamente mayor en frutos con DRM. Sin embargo, la firmeza, concentración de sólidos solubles totales, concentración de materia seca del fruto y el peso específico de hoja fue estadísticamente (P<0.05 igual entre frutos sin y con DRM. Los resultados sugieren que el durazno 'Victoria' puede prescindir del raleo de frutos, y por consiguiente, esto reduciría costos de producción. Ambos factores merecen ser estudiados en otros cultivares de durazno cuyas estructuras reproductivas tengan mayor habilidad en la utilización de foto asimilados.

  20. Comparison of stress in anaesthetic trainees between Hong Kong and Victoria, Australia.

    Science.gov (United States)

    Chia, A C L; Irwin, M G; Lee, P W H; Lee, T H W; Man, S E

    2008-11-01

    A postal survey was sent to anaesthetic trainees in Hong Kong and Victoria, Australia to compare work-related stress levels. Demographic data were collected. Anaesthetist-specific stressors, Maslach Burnout Inventory and Global Job Satisfaction scores were used for psychological testing. The response rates from Hong Kong and Melbourne were 64 of 133 (48.1%) and 108 of 196 (55.1%), respectively. Victorian respondents were older with greater family commitments, but more advanced in fulfilling training requirements. Hong Kong respondents, being faced with both the challenge of dual College requirements, exhibited consistently higher indices of stress (P stress scores observed in Hong Kong trainees related to service provision and a perceived lack of resources. Despite the complex nature of stress, its antecedents and manifestations, an inverse relationship between emotional exhaustion and job satisfaction was evident in correlation analysis (P stress was present in some trainees in both areas. Hong Kong trainees may benefit from local development to address mental wellbeing as being important to fulfil this highly competitive training program.

  1. Characterization of V1R receptor (ora) genes in Lake Victoria cichlids.

    Science.gov (United States)

    Ota, Tomoki; Nikaido, Masato; Suzuki, Hikoyu; Hagino-Yamagishi, Kimiko; Okada, Norihiro

    2012-05-15

    Although olfaction could play a crucial role in underwater habitats by allowing fish to sense a variety of nonvolatile chemical signals, the importance of olfaction in species-rich cichlids is still controversial. In particular, examining whether cichlids rely on olfaction for reproduction is of primary interest to understand the mechanisms of speciation. In the present study, we explored the V1R (also known as ora) genes, which are believed to encode reproductive pheromone receptors in fish, in the genomes of Lake Victoria cichlids. By screening a bacterial artificial chromosome library, we identified all six intact V1R genes (V1R1 to V1R6) that have been reported in other teleost fish. Furthermore, RT-PCR and in situ hybridization analyses showed that all of the V1R genes were expressed in the olfactory epithelium, indicating that these receptors are functional in cichlids. These observations indicate that cichlids use V1R-mediated olfaction in some ways for their social behaviors. Copyright © 2012 Elsevier B.V. All rights reserved.

  2. Morfologia da flor, fruto e plântula de Victoria amazonica (Poepp. J.C. Sowerby (Nymphaeaceae Morphology of flower, fruit and seedling of Victoria amazonica (Poepp. J.C. Sowerby (Nymphaeaceae

    Directory of Open Access Journals (Sweden)

    Sônia Maciel da Rosa-Osman

    2011-03-01

    Full Text Available Victoria amazonica (Poepp. J.C. Sowerby é uma hidrófita que ocorre nas várzeas de águas brancas e igapós da Bacia Amazônica e na Bacia do rio Paraguai. A morfologia da flor, fruto e plântula/"tirodendro" é objeto do presente trabalho. O material botânico foi coletado em Parintins e Manaus, estado do Amazonas, Brasil. A análise morfológica foi feita em material fresco e fixado em FAA 50. O desenvolvimento das plântulas foi realizado no escuro em frascos com água com teor reduzido de oxigênio. As flores possuem pedicelo longo e são hemicíclicas, diclamídeas, monoclinas e com antese vespertina. Os frutos são carnosos, indeiscentes, com pseudossincarpia. As sementes apresentam arilo que atua na dispersão pela água. As plântulas se desenvolvem em condições de hipoxia e apresentam um cotilédone exposto acicular. O "tirodendro" apresenta eofilos com heterofilia. As flores apresentam caracteres morfológicos básicos da família, a definição do tipo de fruto exige estudo ontogenético e a heterofilia é um caráter típico de plântulas/"tirodendros"de Nymphaeaceae.Victoria amazonica (Poepp. J.C. Sowerby is a hydrophyte that occurs in the white water leas and igapos of the Amazonian and Paraguay Basin. The flower, fruit and seedling/"tirodendro" morphology is the object of the present work. The botanical material was collected at Parintins and Manaus, Amazonian state, Brazil. The morphological analysis was made in both fresh and fixed material. The seedling development was accomplished in flasks with water containing little oxygen and maintained in the darkness. Flowers present long pedicel and they are hemicyclic, dichlamydeous, bisexual with vespertine anthesis. Fruits are fleshy, indehiscent with pseudo-syncarpy. Seeds present aril that acts in the water dispersion. Seedlings grow in hypoxy conditions and they present an acicular and exposed cotyledon. The "tirodendro" stage presents eophylls with heterophylly. Flowers

  3. Genetic variation and demographic history of the Haplochromis laparogramma group of Lake Victoria-An analysis based on SINEs and mitochondrial DNA.

    Science.gov (United States)

    Mzighani, Semvua I; Nikaido, Masato; Takeda, Miyuki; Seehausen, Ole; Budeba, Yohana L; Ngatunga, Benjamin P; Katunzi, Egid F B; Aibara, Mitsuto; Mizoiri, Shinji; Sato, Tetsu; Tachida, Hidenori; Okada, Norihiro

    2010-01-15

    More than 500 endemic haplochromine cichlid species inhabit Lake Victoria. This striking species diversity is a classical example of recent explosive adaptive radiation thought to have happened within the last approximately 15,000 years. In this study, we examined the population structure and historical demography of 3 pelagic haplochromine cichlid species that resemble in morphology and have similar niche, Haplochromis (Yssichromis) laparogramma, Haplochromis (Y.) pyrrhocephalus, and Haplochromis (Y.) sp. "glaucocephalus". We investigated the sequences of the mitochondrial DNA control region and the insertion patterns of short interspersed elements (SINEs) of 759 individuals. We show that sympatric forms are genetically differentiated in 4 of 6 cases, but we also found apparent weakening of the genetic differentiation in areas with turbid water. We estimated the timings of population expansion and species divergence to coincide with the refilling of the lake at the Pleistocene/Holocene boundary. We also found that estimates can be altered significantly by the choice of the shape of the molecular clock. If we employ the nonlinear clock model of evolutionary rates in which the rates are higher towards the recent, the population expansion was dated at around the event of desiccation of the lake ca. 17,000 YBP. Thus, we succeeded in clarifying the species and population structure of closely related Lake Victoria cichlids and in showing the importance of applying appropriate clock calibrations in elucidating recent evolutionary events.

  4. Potential for Introduction of Bat-Borne Zoonotic Viruses into the EU: A Review

    Directory of Open Access Journals (Sweden)

    Robin R. L. Simons

    2014-05-01

    Full Text Available Bat-borne viruses can pose a serious threat to human health, with examples including Nipah virus (NiV in Bangladesh and Malaysia, and Marburg virus (MARV in Africa. To date, significant human outbreaks of such viruses have not been reported in the European Union (EU. However, EU countries have strong historical links with many of the countries where NiV and MARV are present and a corresponding high volume of commercial trade and human travel, which poses a potential risk of introduction of these viruses into the EU. In assessing the risks of introduction of these bat-borne zoonotic viruses to the EU, it is important to consider the location and range of bat species known to be susceptible to infection, together with the virus prevalence, seasonality of viral pulses, duration of infection and titre of virus in different bat tissues. In this paper, we review the current scientific knowledge of all these factors, in relation to the introduction of NiV and MARV into the EU.

  5. Protective mAbs and Cross-Reactive mAbs Raised by Immunization with Engineered Marburg Virus GPs.

    Directory of Open Access Journals (Sweden)

    Marnie L Fusco

    2015-06-01

    Full Text Available The filoviruses, which include the marburg- and ebolaviruses, have caused multiple outbreaks among humans this decade. Antibodies against the filovirus surface glycoprotein (GP have been shown to provide life-saving therapy in nonhuman primates, but such antibodies are generally virus-specific. Many monoclonal antibodies (mAbs have been described against Ebola virus. In contrast, relatively few have been described against Marburg virus. Here we present ten mAbs elicited by immunization of mice using recombinant mucin-deleted GPs from different Marburg virus (MARV strains. Surprisingly, two of the mAbs raised against MARV GP also cross-react with the mucin-deleted GP cores of all tested ebolaviruses (Ebola, Sudan, Bundibugyo, Reston, but these epitopes are masked differently by the mucin-like domains themselves. The most efficacious mAbs in this panel were found to recognize a novel "wing" feature on the GP2 subunit that is unique to Marburg and does not exist in Ebola. Two of these anti-wing antibodies confer 90 and 100% protection, respectively, one hour post-exposure in mice challenged with MARV.

  6. A Limited Structural Modification Results in a Significantly More Efficacious Diazachrysene-Based Filovirus Inhibitor

    Directory of Open Access Journals (Sweden)

    Rekha G. Panchal

    2012-08-01

    Full Text Available Ebola (EBOV and Marburg (MARV filoviruses are highly infectious pathogens causing deadly hemorrhagic fever in humans and non-human primates. Promising vaccine candidates providing immunity against filoviruses have been reported. However, the sporadic nature and swift progression of filovirus disease underlines the need for the development of small molecule therapeutics providing immediate antiviral effects. Herein we describe a brief structural exploration of two previously reported diazachrysene (DAAC-based EBOV inhibitors. Specifically, three analogs were prepared to examine how slight substituent modifications would affect inhibitory efficacy and inhibitor-mediated toxicity during not only EBOV, but also MARV cellular infection. Of the three analogs, one was highly efficacious, providing IC50 values of 0.696 µM ± 0.13 µM and 2.76 µM ± 0.21 µM against EBOV and MARV infection, respectively, with little or no associated cellular toxicity. Overall, the structure-activity and structure-toxicity results from this study provide a framework for the future development of DAAC-based filovirus inhibitors that will be both active and non-toxic in vivo.

  7. Determination of selected antibiotics in the Victoria Harbour and the Pearl River, South China using high-performance liquid chromatography-electrospray ionization tandem mass spectrometry

    International Nuclear Information System (INIS)

    Xu Weihai; Zhang Gan; Zou Shichun; Li Xiangdong; Liu Yuchun

    2007-01-01

    Nine selected antibiotics in the Victoria Harbour of Hong Kong and the Pearl River at Guangzhou, South China, were analyzed using high-performance liquid chromatography-electrospray ionization tandem mass spectrometry. The results showed that the concentrations of antibiotics were mainly below the limit of quantification (LOQ) in the marine water of Victoria Harbour. However, except for amoxicillin, all of the antibiotics were detected in the Pearl River during high and low water seasons with the median concentrations ranging from 11 to 67 ng/L, and from 66 to 460 ng/L, respectively; and the concentrations in early spring were about 2-15 times higher than that in summer with clearer diurnal variations. It was suggested that the concentrations of antibiotics in the high water season were more affected by wastewater production cycles due to quick refreshing rate, while those in the low water season may be more sensitive to the water column dynamics controlled by tidal processes in the river. - Antibiotics were found at high concentrations in an urban reach of Pearl River in southern China with contrast diurnal variations between the high and low water seasons

  8. Rehabilitation Utilization following a Work-Related Traumatic Brain Injury: A Sex-Based Examination of Workers' Compensation Claims in Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    E Niki Guerriero

    Full Text Available To report on and examine differences in the use of four types of rehabilitation services (occupational therapy, physiotherapy, psychology, and speech therapy by men and women following a work-related traumatic brain injury in Victoria, Australia; and to examine the importance of demographic, need, work-related and geographic factors in explaining these differences.A retrospective cohort design was used to analyze 1786 work-related traumatic brain injury workers' compensation claims lodged between 2004 and 2012 in Victoria, Australia. ZINB regressions were conducted for each type of rehabilitation service to examine the relationship between sex and rehabilitation use. Covariates included demographic, need-related, work-related, and geographic factors.Out of all claims (63% male, 37% female, 13% used occupational therapy, 23% used physiotherapy, 9% used psychology, and 2% used speech therapy at least once during the first year of service utilization. After controlling for demographic, need-related, work-related, and geographic factors, women were more likely to use physiotherapy compared to men. Men and women were equally likely to use occupational therapy and psychology services. The number of visits in the first year for each type of service did not differ between male and female users.Our findings support a sex-based approach to studying rehabilitation utilization in work-related populations. Future research is needed to examine other factors associated with rehabilitation utilization and to determine the implications of different rehabilitation utilization patterns on health and return-to-work outcomes.

  9. Understanding influenza vaccine protection in the community: an assessment of the 2013 influenza season in Victoria, Australia.

    Science.gov (United States)

    Carville, Kylie S; Grant, Kristina A; Sullivan, Sheena G; Fielding, James E; Lane, Courtney R; Franklin, Lucinda; Druce, Julian; Kelly, Heath A

    2015-01-03

    The influenza virus undergoes frequent antigenic drift, necessitating annual review of the composition of the influenza vaccine. Vaccination is an important strategy for reducing the impact and burden of influenza, and estimating vaccine effectiveness (VE) each year informs surveillance and preventative measures. We aimed to describe the influenza season and to estimate the effectiveness of the influenza vaccine in Victoria, Australia, in 2013. Routine laboratory notifications, general practitioner sentinel surveillance (including a medical deputising service) data, and sentinel hospital admission surveillance data for the influenza season (29 April to 27 October 2013) were collated in Victoria, Australia, to describe influenza-like illness or confirmed influenza during the season. General practitioner sentinel surveillance data were used to estimate VE against medically-attended laboratory confirmed influenza. VE was estimated using the case test negative design as 1-adjusted odds ratio (odds of vaccination in cases compared with controls) × 100%. Cases tested positive for influenza while non-cases (controls) tested negative. Estimates were adjusted for age group, week of onset, time to swabbing and co-morbidities. The 2013 influenza season was characterised by relatively low activity with a late peak. Influenza B circulation preceded that of influenza A(H1)pdm09, with very little influenza A(H3) circulation. Adjusted VE for all influenza was 55% (95%CI: -11, 82), for influenza A(H1)pdm09 was 43% (95%CI: -132, 86), and for influenza B was 56% (95%CI: -51, 87) Imputation of missing data raised the influenza VE point estimate to 64% (95%CI: 13, 85). Clinicians can continue to promote a positive approach to influenza vaccination, understanding that inactivated influenza vaccines prevent at least 50% of laboratory-confirmed outcomes in hospitals and the community. Copyright © 2014 Elsevier Ltd. All rights reserved.

  10. Regions With Low Rates of Bystander Cardiopulmonary Resuscitation (CPR) Have Lower Rates of CPR Training in Victoria, Australia.

    Science.gov (United States)

    Bray, Janet E; Straney, Lahn; Smith, Karen; Cartledge, Susie; Case, Rosalind; Bernard, Stephen; Finn, Judith

    2017-06-05

    Bystander cardiopulmonary resuscitation (CPR) more than doubles the chance of surviving an out-of-hospital cardiac arrest. Recent data have shown considerable regional variation in bystander CPR rates across the Australian state of Victoria. This study aims to determine whether there is associated regional variation in rates of CPR training and willingness to perform CPR in these communities. We categorized each Victorian postcode as either a low or high bystander CPR region using data on adult, bystander-witnessed, out-of-hospital cardiac arrests of presumed cardiac etiology (n=7175) from the Victorian Ambulance Cardiac Arrest Registry. We then surveyed adult Victorians (n=404) and compared CPR training data of the respondents from low and high bystander CPR regions. Of the 404 adults surveyed, 223 (55%) resided in regions with low bystander CPR. Compared with respondents from high bystander CPR regions, respondents residing in regions with low bystander CPR had lower rates of CPR training (62% versus 75%, P =0.009) and lower self-ratings for their overall knowledge of CPR (76% versus 84%, P =0.04). There were no differences between the regions in their reasons for not having undergone CPR training or in their willingness to perform CPR. Rates of survival for bystander-witnessed, out-of-hospital cardiac arrests were significantly lower in low bystander CPR regions (15.7% versus 17.0%, P CPR training and lower survival in regions with lower rates of bystander CPR in Victoria, Australia. Targeting these regions with CPR training programs may improve bystander CPR rates and out-of-hospital cardiac arrest outcomes. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley.

  11. The Impact of School Tobacco Policies on Student Smoking in Washington State, United States and Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Richard F. Catalano

    2010-02-01

    Full Text Available This paper measures tobacco polices in statewide representative samples of secondary and mixed schools in Victoria, Australia and Washington, US (N = 3,466 students from 285 schools and tests their association with student smoking. Results from confounder-adjusted random effects (multi-level regression models revealed that the odds of student perception of peer smoking on school grounds are decreased in schools that have strict enforcement of policy (odds ratio (OR = 0.45; 95% CI: 0.25 to 0.82; p = 0.009. There was no clear evidence in this study that a comprehensive smoking ban, harsh penalties, remedial penalties, harm minimization policy or abstinence policy impact on any of the smoking outcomes.

  12. Integrating remote sensing approach with pollution monitoring tools for aquatic ecosystem risk assessment and management: a case study of Lake Victoria (Uganda).

    Science.gov (United States)

    Focardi, Silvia; Corsi, Ilaria; Mazzuoli, Stefania; Vignoli, Leonardo; Loiselle, Steven A; Focardi, Silvano

    2006-11-01

    Aquatic ecosystems around the world, lake, estuaries and coastal areas are increasingly impacted by anthropogenic pollutants through different sources such as agricultural, industrial and urban discharges, atmospheric deposition and terrestrial drainage. Lake Victoria is the second largest lake in the world and the largest tropical lake. Bordered by Tanzania, Uganda, and Kenya, it provides a livelihood for millions of Africans in the region. However, the lake is under threat from eutrophication, a huge decline in the number of native fish species caused by several factors including loss of biodiversity, over fishing and pollution has been recently documented. Increasing usage of pesticides and insecticides in the adjacent agricultural areas as well as mercury contamination from processing of gold ore on the southern shores are currently considered among the most emergent phenomena of chemical contamination in the lake. By the application of globally consistent and comprehensive geospatial data-sets based on remote sensing integrated with information on heavy metals accumulation and insecticides exposure in native and alien fish populations, the present study aims at assessing the environmental risk associated to the contamination of the Lake Victoria water body on fish health, land cover distribution, biodiversity and the agricultural area surrounding the lake. By the elaboration of Landsat 7 TM data of November 2002 and Landsat 7 TM 1986 we have calculated the agriculture area which borders the Lake Victoria bay, which is an upland plain. The resulting enhanced nutrient loading to the soil is subsequently transported to the lake by rain or as dry fall. The data has been inserted in a Geographical information System (ARCGIS) to be upgraded and consulted. Heavy metals in fish fillets showed concentrations rather low except for mercury being higher than others as already described in previous investigations. In the same tissue, cholinesterases activity (ChE) as an

  13. The use of a mobile laboratory unit in support of patient management and epidemiological surveillance during the 2005 Marburg Outbreak in Angola.

    Directory of Open Access Journals (Sweden)

    Allen Grolla

    2011-05-01

    Full Text Available BACKGROUND: Marburg virus (MARV, a zoonotic pathogen causing severe hemorrhagic fever in man, has emerged in Angola resulting in the largest outbreak of Marburg hemorrhagic fever (MHF with the highest case fatality rate to date. METHODOLOGY/PRINCIPAL FINDINGS: A mobile laboratory unit (MLU was deployed as part of the World Health Organization outbreak response. Utilizing quantitative real-time PCR assays, this laboratory provided specific MARV diagnostics in Uige, the epicentre of the outbreak. The MLU operated over a period of 88 days and tested 620 specimens from 388 individuals. Specimens included mainly oral swabs and EDTA blood. Following establishing on site, the MLU operation allowed a diagnostic response in <4 hours from sample receiving. Most cases were found among females in the child-bearing age and in children less than five years of age. The outbreak had a high number of paediatric cases and breastfeeding may have been a factor in MARV transmission as indicated by the epidemiology and MARV positive breast milk specimens. Oral swabs were a useful alternative specimen source to whole blood/serum allowing testing of patients in circumstances of resistance to invasive procedures but limited diagnostic testing to molecular approaches. There was a high concordance in test results between the MLU and the reference laboratory in Luanda operated by the US Centers for Disease Control and Prevention. CONCLUSIONS/SIGNIFICANCE: The MLU was an important outbreak response asset providing support in patient management and epidemiological surveillance. Field laboratory capacity should be expanded and made an essential part of any future outbreak investigation.

  14. Índices de calidad del agua en la microcuenca de la quebrada Victoria, Guanacaste, Costa Rica (2007-2008)

    OpenAIRE

    Zhen-Wu, Bi Yun

    2010-01-01

    Se evaluó, durante el año hidrológico 2007-2008, la calidad del agua de la quebrada Victoria, Costa Rica, mediante la aplicación de los índices de calidad del agua del Reglamento costarricense para la evaluación y clasificación de la calidad de cuerpos de agua superficiales (IHCA-CR) y el de la Fundación Nacional de Sanidad de los Estados Unidos (ICA-U.S.NSF), para establecer una línea base para los programas de seguimiento de su calidad y de los efectos del desarrollo geotérmico. La red de m...

  15. Triumphs Show: What Makes Art History? Year 7 Exploit the Resources of the Victoria and Albert Museum's Medieval Gallery to Create and Curate Their Own Answer

    Science.gov (United States)

    Copsey, Sarah

    2014-01-01

    What do 14 Year 7 students, an art teacher, a history teacher and the Victoria and Albert Museum have in common? They are all part of the "Stronger Together" Museum Champion project run by The Langley Academy and the River & Rowing Museum and supported by Arts Council England, designed to engage students, teachers and museum staff…

  16. Innate Immune Responses of Bat and Human Cells to Filoviruses: Commonalities and Distinctions.

    Science.gov (United States)

    Kuzmin, Ivan V; Schwarz, Toni M; Ilinykh, Philipp A; Jordan, Ingo; Ksiazek, Thomas G; Sachidanandam, Ravi; Basler, Christopher F; Bukreyev, Alexander

    2017-04-15

    Marburg (MARV) and Ebola (EBOV) viruses are zoonotic pathogens that cause severe hemorrhagic fever in humans. The natural reservoir of MARV is the Egyptian rousette bat ( Rousettus aegyptiacus ); that of EBOV is unknown but believed to be another bat species. The Egyptian rousette develops subclinical productive infection with MARV but is refractory to EBOV. Interaction of filoviruses with hosts is greatly affected by the viral interferon (IFN)-inhibiting domains (IID). Our study was aimed at characterization of innate immune responses to filoviruses and the role of filovirus IID in bat and human cells. The study demonstrated that EBOV and MARV replicate to similar levels in all tested cell lines, indicating that permissiveness for EBOV at cell and organism levels do not necessarily correlate. Filoviruses, particularly MARV, induced a potent innate immune response in rousette cells, which was generally stronger than that in human cells. Both EBOV VP35 and VP24 IID were found to suppress the innate immune response in rousette cells, but only VP35 IID appeared to promote virus replication. Along with IFN-α and IFN-β, IFN-γ was demonstrated to control filovirus infection in bat cells but not in human cells, suggesting host species specificity of the antiviral effect. The antiviral effects of bat IFNs appeared not to correlate with induction of IFN-stimulated genes 54 and 56, which were detected in human cells ectopically expressing bat IFN-α and IFN-β. As bat IFN-γ induced the type I IFN pathway, its antiviral effect is likely to be partially induced via cross talk. IMPORTANCE Bats serve as reservoirs for multiple emerging viruses, including filoviruses, henipaviruses, lyssaviruses, and zoonotic coronaviruses. Although there is no evidence for symptomatic disease caused by either Marburg or Ebola viruses in bats, spillover of these viruses into human populations causes deadly outbreaks. The reason for the lack of symptomatic disease in bats infected with

  17. Stroke Incidence in Victoria, Australia—Emerging Improvements

    Directory of Open Access Journals (Sweden)

    Benjamin B. Clissold

    2017-05-01

    Full Text Available BackgroundEvidence of a decline in the incidence of stroke has emerged from population-based studies. These have included retrospective and prospective cohorts. However, in Australia and other countries, government bodies and stroke foundations predict a rise in the prevalence of stroke that is anticipated to increase the burden of stroke across the entire domain of care. This increase in prevalence must be viewed as different from the decline in incidence being observed, a measure of new stroke cases. In Victoria, all public emergency department visits and public and private hospital admissions are reported to the Department of Health and Human Services and include demographic, diagnostic, and procedural/treatment information.MethodsWe obtained data from financial years 1997/1998 to 2007/2008 inclusive, for all cases with a primary stroke diagnosis (ICD-10-AM categories with associated data fields. Incident cases were established by using a 5-year clearance period.ResultsFrom 2003/2004 to 2007/2008 inclusive, there were 53,425 patients with a primary stroke or TIA diagnosis. The crude incident stroke rate for first ever stroke was 211 per 100,000 per year (95% CI 205–217 [females—205 per 100,000 per year (95% CI 196–214 and males—217 per 100,000 per year (95% CI 210–224]. The overall stroke rates were seen to significantly decline over the period [males (per 100,000 per year 227 in 2003/2004 to 202 in 2007/2008 (p = 0.0157 and females (per 100,000 per year 214 in 2003/2004 to 188 in 2007/2008 (p = 0.0482]. Ischemic stroke rates also appeared to decline; however, this change was not significant.ConclusionThese results demonstrate a significant decline in stroke incidence during the study period and may suggest evidence for effectiveness of primary and secondary prevention strategies in cerebrovascular risk factor management.

  18. La Victoria de Pedro Aguirre Cerda: ideas para una renovación urbana sin gentrificación para Santiago./ La Victoria of Pedro Aguirre Cerda: ideas for an urban renewal without gentrification in Santiago.

    Directory of Open Access Journals (Sweden)

    Ernesto López

    2012-12-01

    Full Text Available El modelo de renovación urbana en altura de Santiago, en expansión hacia áreas populares del pericentro, es una forma de acumulación de renta de suelo, con efectos de desplazamiento social, es decir, gentrificación. Sin embargo, el pericentro de Santiago es un espacio donde coexisten amplias necesidades y capacidades de densificación urbana sin desplazamiento. Tomando como caso de estudio el desarrollo urbano histórico y actual de la población La Victoria, en Pedro Aguirre Cerda (PAC, se plantea una investigación enfocada en dos perspectivas: histórica, definiendo este espacio desde la dialéctica entre movimientos sociales urbanos y producción espacial específica; y normativa, como una propuesta espacial que combina aspectos claves de mejoramiento barrial y densificación inclusiva y autosustentable. Se evidencia de esta forma la alta complejidad espacial del pericentro de Santiago de Chile, así como la existencia de alternativas de renovación residencial pericentral que sean social y políticamente inclusivas y de bajo impacto en términos de expulsión./ The model of high-rise urban renewal sprawls towards Santiago de Chile’s inner city. This model can be understood as a form of gentrification based on considerable accumulation of the rent gap, while its externalities generate social displacement and physical dilapidation. Notwithstanding, Santiago’s inner city is also a lived space where both needs and capacities of urban regeneration (without displacement coexist. Focusing on the case of La Victoria población, located in the southern municipality of Pedro Aguirre Cerda (PAC, this article seeks to address the following two topics: historically, the inner city responds to a dialectic of urban social movements and specific spatial production; normatively, as an ongoing research project shows, it is feasible to combine neighbourhood regeneration, urban density increase, and citizen participation. The article substantiates the

  19. Sensitive voltammetric detection of yeast RNA based on its interaction with Victoria Blue B

    Directory of Open Access Journals (Sweden)

    WEI SUN

    2009-12-01

    Full Text Available Voltammetric studies of the interaction of yeast RNA (y-RNA with Victoria Blue B (VBB are described in this paper. Furthermore, a linear sweep voltammetric method for the detection of y-RNA was established. The reaction conditions, such as acidity and amount of buffer solution, the concentration of VBB, the reaction time and temperature, etc., were carefully investigated by second order derivative linear sweep voltammetry. Under the optimal conditions, the reduction peak current of VBB at –0.75 V decreased greatly after the addition of y-RNA to the solution without any shift of the reduction peak potential. Based on the decrease of the peak current, a new quantitative method for the determination of y-RNA was developed. The effects of co-existing substances on the determination were carefully investigated and three synthetic samples were determined with satisfactory results. The stoichiometry of the VBB–y-RNA complex was calculated by linear sweep voltammetry and the interaction mechanism is discussed.

  20. Potential immediate hypersensitivity reactions following immunization in preschool aged children in Victoria, Australia.

    Science.gov (United States)

    Baxter, C-M; Clothier, H J; Perrett, K P

    2018-04-06

    Immediate hypersensitivity reactions (IHR) are rare but potentially serious adverse events following immunization (AEFI). Surveillance of Adverse Events following Vaccination in the Community (SAEFVIC) is an enhanced passive surveillance system that collects, analyses and reports information about AEFI in Victoria, Australia. We describe the incidence, timing and type of potential IHR following vaccination in preschool children reported over an 8-year period. A total of 2110 AEFI were reported in 1620 children, of which 23.5% (496) were classified as potential IHR. Of these, 37.1% (184) were suspected to be IgE-mediated, (including anaphylaxis, angioedema and/or urticaria) and 83.5% (414) occurred within 15 minutes of vaccination. The incidence of potential IHR was 5.4 per 100,000 doses, with that of suspected IgE-mediated IHR being 2.0 per 100,000 doses. The incidence of anaphylaxis was extremely low (0.13 per 100,000 doses) and is consistent with other published studies. Potential IHR following immunization should be reported to appropriate local pharmacovigilance systems and patients reviewed by specialists able to evaluate, investigate and manage future vaccinations.

  1. Composition and Genetic Diversity of Mosquitoes (Diptera: Culicidae) on Islands and Mainland Shores of Kenya’s Lakes Victoria and Baringo

    Science.gov (United States)

    Ajamma, Yvonne Ukamaka; Villinger, Jandouwe; Omondi, David; Salifu, Daisy; Onchuru, Thomas Ogao; Njoroge, Laban; Muigai, Anne W. T.; Masiga, Daniel K.

    2016-01-01

    The Lake Baringo and Lake Victoria regions of Kenya are associated with high seroprevalence of mosquito-transmitted arboviruses. However, molecular identification of potential mosquito vector species, including morphologically identified ones, remains scarce. To estimate the diversity, abundance, and distribution of mosquito vectors on the mainland shores and adjacent inhabited islands in these regions, we collected and morphologically identified adult and immature mosquitoes and obtained the corresponding sequence variation at cytochrome c oxidase 1 (COI) and internal transcribed spacer region 2 (ITS2) gene regions. A total of 63 species (including five subspecies) were collected from both study areas, 47 of which have previously been implicated as disease vectors. Fourteen species were found only on island sites, which are rarely included in mosquito diversity surveys. We collected more mosquitoes, yet with lower species composition, at Lake Baringo (40,229 mosquitoes, 32 species) than at Lake Victoria (22,393 mosquitoes, 54 species). Phylogenetic analysis of COI gene sequences revealed Culex perexiguus and Cx. tenagius that could not be distinguished morphologically. Most Culex species clustered into a heterogeneous clade with closely related sequences, while Culex pipiens clustered into two distinct COI and ITS2 clades. These data suggest limitations in current morphological identification keys. This is the first DNA barcode report of Kenyan mosquitoes. To improve mosquito species identification, morphological identifications should be supported by their molecular data, while diversity surveys should target both adults and immatures. The diversity of native mosquito disease vectors identified in this study impacts disease transmission risks to humans and livestock. PMID:27402888

  2. Maternal region of birth and stillbirth in Victoria, Australia 2000-2011: A retrospective cohort study of Victorian perinatal data.

    Science.gov (United States)

    Davies-Tuck, Miranda L; Davey, Mary-Ann; Wallace, Euan M

    2017-01-01

    There is growing evidence from high-income countries that maternal country of birth is a risk factor for stillbirth. We aimed to examine the association between maternal region of birth and stillbirth between 2000 and 2011 inclusive in Victoria, Australia. Retrospective population based cohort study of all singleton births at 24 or more weeks gestational age from 2000-2011 in Victoria, Australia. Stillbirths due to termination of pregnancy, babies with congenital anomalies and Indigenous mothers were excluded. Main Outcome Measure: Stillbirth. Over the 12-year period there were 685,869 singleton births and 2299 stillbirths, giving an overall stillbirth rate of 3·4 per 1000 births. After adjustment for risk factors, compared to women born in Australia/New Zealand, women born in South Asia (aOR 1.27, 95% CI 1.01-1.53, p = 0.01), were more likely to have a stillbirth whereas women born in South East and East Asia were (aOR 0.60, (95% CI 0.49-0.72, pAsian compared to Australian/New Zealand born women. The following risk factors were also significantly associated with an increased odds of stillbirth in multivariate analyses: maternal age <20 and 35 years and more, nulliparity, low socio-economic status, previous stillbirth, no ultrasound reported in 1st trimester, pre-existing hypertension, antepartum haemorrhage and failure to detect growth restriction antenatally. Maternal region of birth is an independent risk factor for stillbirth. Improvements in the rate of stillbirth, particularly late pregnancy stillbirth, are likely to be gained in high-income settings where clinical care is informed by maternal region of birth.

  3. Stability and change in adult personality over 6 years: findings from the Victoria Longitudinal Study.

    Science.gov (United States)

    Small, Brent J; Hertzog, Christopher; Hultsch, David F; Dixon, Roger A

    2003-05-01

    Data from the Victoria Longitudinal Study were used to examine the 6-year longitudinal stability of personality in older adults. Personality was measured with the NEO Personality Inventory. The longitudinal sample consisted of 223 adults initially ranging from 55 to 85 years of age. Longitudinal confirmatory factor analyses were used to examine the stability of individual differences in change over time, and the stability of the longitudinal factor structure. The results indicated both substantial stability at the level of individual differences in change, as well as significant individual differences in change that were related to age and gender. Finally, the factor structure of personality was invariant over time but did not approximate simple structure for the five dimensions of personality. Our study of 6-year personality development provided both (a). a confirmation of early significant stability findings and (b). unique evidence for significant individual differences in late adulthood.

  4. Prospective evaluation of patient-reported quality of life outcomes after external beam radiation treatment for prostate cancer in Victoria: A cohort study by the Victorian Prostate Cancer Registry

    International Nuclear Information System (INIS)

    Bandarage, V.R.K. Patabendi; Billah, Baki; Evans, Sue; Millar, Jeremy L.

    2016-01-01

    External beam radiation treatment (EBRT) for prostate cancer (CaP) can cause adverse effects on bowel, bladder and sexual function. We aimed to use CaP clinical registry data to evaluate variation in patient adverse effects after EBRT in Victoria. Study subjects were men diagnosed with primary CaP between 2009 and 2014, treated with EBRT in metropolitan Melbourne, or in one of three regional integrated cancer service (ICS) regions. Information on change in general and disease-specific health outcome 12 and 24 months after the initial diagnosis were obtained using a modified Expanded CaP index composite (EPIC)-26 survey and there was no variation of follow up between ICSs. The proportion of men with ‘big bother’ (the most troublesome category) was compared between the ICS regions in Victoria (n = 1,825). There was no difference in big bother in urinary and sexual function across the regions at 24 months. However, patients treated in one regional cancer service had a higher proportion with ‘big bother’ (11.1%) compared with the rest of the Victoria (4.8%); (χ2 = 4.85; P = 0.02). The only significant factor for this was the location of EBRT (odds ratio = 2.6; 95% confidence interval: 1.12–6.04; P = 0.02). There was no association over time in that region with change in EBRT technique from 3-D conformal radiation therapy to intensity-modulated radiation therapy (z-test for proportion: 0.77; P: 0.44). A comprehensive clinical cancer registry system, can be used to benchmark outcomes for men diagnosed with CaP and may detect clinically relevant variations that require further detailed evaluation and response.

  5. Paediatric slow-speed non-traffic fatalities: Victoria, Australia, 1985-1995.

    Science.gov (United States)

    Robinson, P; Nolan, T

    1997-11-01

    An important group of fatal incidents are slow-speed pedestrian non-traffic incidents to children, which account for 14% of accidental deaths from all causes in Victorian children under 5 years of age between 1985 and 1995, and 12% of pedestrian deaths of all ages. In Victoria, Australia, the database of the state Consultative Council on Obstetric and Paediatric Morbidity and Mortality was utilised to identify paediatric slow-speed pedestrian non-traffic-accident deaths in the local population. Additional data relating to the car and its driver, the child, and the circumstances of the incident were abstracted from records kept by the State Coroner and the Victorian compulsory third party traffic injury insurance organisation. Twenty eight Victorian children were identified who had died in one of three types of incident (driverless cars, child interacting with the vehicle and driver, and drivers who were unaware of the child's proximity). These incidents were more common in rural areas compared with urban, usually occurring at the child's home. The child was with or near an adult on all occasions. The vehicle was usually being driven by a relative, and was reversing in a higher proportion of 'unaware' incidents compared with the 'interactive' type. The association of 'off-road' family vehicles and trucks with these incidents appears to be increasing, especially in recent years. These findings suggest some countermeasures, including the separation of vehicle driveways from children's play areas, and object vicinity ultrasonic warning devices for vehicles.

  6. Hydroclimatology of Lake Victoria region using hydrologic model and satellite remote sensing data

    Directory of Open Access Journals (Sweden)

    S. I. Khan

    2011-01-01

    Full Text Available Study of hydro-climatology at a range of temporal scales is important in understanding and ultimately mitigating the potential severe impacts of hydrological extreme events such as floods and droughts. Using daily in-situ data over the last two decades combined with the recently available multiple-years satellite remote sensing data, we analyzed and simulated, with a distributed hydrologic model, the hydro-climatology in Nzoia, one of the major contributing sub-basins of Lake Victoria in the East African highlands. The basin, with a semi arid climate, has no sustained base flow contribution to Lake Victoria. The short spell of high discharge showed that rain is the prime cause of floods in the basin. There is only a marginal increase in annual mean discharge over the last 21 years. The 2-, 5- and 10- year peak discharges, for the entire study period showed that more years since the mid 1990's have had high peak discharges despite having relatively less annual rain. The study also presents the hydrologic model calibration and validation results over the Nzoia basin. The spatiotemporal variability of the water cycle components were quantified using a hydrologic model, with in-situ and multi-satellite remote sensing datasets. The model is calibrated using daily observed discharge data for the period between 1985 and 1999, for which model performance is estimated with a Nash Sutcliffe Efficiency (NSCE of 0.87 and 0.23% bias. The model validation showed an error metrics with NSCE of 0.65 and 1.04% bias. Moreover, the hydrologic capability of satellite precipitation (TRMM-3B42 V6 is evaluated. In terms of reconstruction of the water cycle components the spatial distribution and time series of modeling results for precipitation and runoff showed considerable agreement with the monthly model runoff estimates and gauge observations. Runoff values responded to precipitation events that occurred across the catchment during the wet season from March to

  7. Gastropod diversity, distribution and abundance in habitats with and without anthropogenic disturbances in Lake Victoria, Kenya

    DEFF Research Database (Denmark)

    Lange, C. N.; Kristensen, Thomas K.; Madsen, Henry

    2013-01-01

    We investigated freshwater gastropod diversity, abundance and distribution in habitats with and without anthropogenic disturbance in two localities, Ndere in the Winam Gulf and Mbita Point, Lake Victoria, Kenya, from May 2002 to January 2004. A total of 133 984 gastropod specimens belonging to 15...... species were recorded, 14 from Mbita and 12 from Ndere. Two species, Ferrissia kavirondica and Cleopatra cridlandi, which were recorded only from undisturbed habitats, could be indicators of least disturbed habitats. Water chemistry did differ between fish landing sites and undisturbed habitats at some......, while other species may not tolerate these changes. In order to protect gastropod diversity and avoid dominance of intermediate hosts, such as B. choanomphala, a management plan for the use of these fish landing sites should be developed. This could include rules on how to dispose of fish remnants...

  8. Maternal region of birth and stillbirth in Victoria, Australia 2000-2011: A retrospective cohort study of Victorian perinatal data.

    Directory of Open Access Journals (Sweden)

    Miranda L Davies-Tuck

    Full Text Available There is growing evidence from high-income countries that maternal country of birth is a risk factor for stillbirth. We aimed to examine the association between maternal region of birth and stillbirth between 2000 and 2011 inclusive in Victoria, Australia.Retrospective population based cohort study of all singleton births at 24 or more weeks gestational age from 2000-2011 in Victoria, Australia. Stillbirths due to termination of pregnancy, babies with congenital anomalies and Indigenous mothers were excluded. Main Outcome Measure: Stillbirth.Over the 12-year period there were 685,869 singleton births and 2299 stillbirths, giving an overall stillbirth rate of 3·4 per 1000 births. After adjustment for risk factors, compared to women born in Australia/New Zealand, women born in South Asia (aOR 1.27, 95% CI 1.01-1.53, p = 0.01, were more likely to have a stillbirth whereas women born in South East and East Asia were (aOR 0.60, (95% CI 0.49-0.72, p<0.001 less likely to have a stillbirth. Additionally, the increasing rate of stillbirth as gestation length progressed began to rise earlier and more steeply in the South Asian compared to Australian/New Zealand born women. The following risk factors were also significantly associated with an increased odds of stillbirth in multivariate analyses: maternal age <20 and 35 years and more, nulliparity, low socio-economic status, previous stillbirth, no ultrasound reported in 1st trimester, pre-existing hypertension, antepartum haemorrhage and failure to detect growth restriction antenatally.Maternal region of birth is an independent risk factor for stillbirth. Improvements in the rate of stillbirth, particularly late pregnancy stillbirth, are likely to be gained in high-income settings where clinical care is informed by maternal region of birth.

  9. Reconstructed plutonium fallout in the GV7 firn core from Northern Victoria Land, East Antarctica

    Science.gov (United States)

    Hwang, H.; Han, Y.; Kang, J.; Lee, K.; Hong, S.; Hur, S. D.; Narcisi, B.; Frezzotti, M.

    2017-12-01

    Atmospheric nuclear explosions during the period from the 1940s to the 1980s are the major anthropogenic source of plutonium (Pu) in the environment. In this work, we analyzed fg g-1 levels of artificial Pu, released predominantly by atmospheric nuclear weapons tests. We measured 351 samples which collected a 78 m-depth fire core at the site of GV7 (S 70°41'17.1", E 158°51'48.9", 1950 m a.s.l.), Northern Victoria Land, East Antarctica. To determine the Pu concentration in the samples, we used an inductively coupled plasma sector field mass spectrometry coupled with an Apex high-efficiency sample introduction system, which has the advantages of small sample consumption and simple sample preparation. We reconstructed the firn core Pu fallout record for the period after 1954 CE shows a significant fluctuation in agreement with past atmospheric nuclear testing. These data will contribute to ice core research by providing depth-age information.

  10. Assessment of deep electrical conductivity features of Northern Victoria Land (Antarctica under other geophysical constraints

    Directory of Open Access Journals (Sweden)

    A. Caneva

    2000-06-01

    Full Text Available The lithospheric and crustal structure of the Victoria Land continental block (Antarctica has been studied by geological and geophysical surveys. Among them magnetovariational investigations (MV have been addressed to highlight the deep electrical conductivity patterns which contribute to the understanding of continental rifting and tectonic setting of the region. The hypothetical event map for H linearly polarized perpendicular to the coast indicates a possible broad coast parallel conductivity anomaly zone. Despite the coast effect, this feature could be related to the deep upper mantle thermal anomaly leading to Cenozoic uplift of the Transantarctic Mountains rift flank. However, both the hypothetic event map polarized parallel to the coast and the induction arrows suggest that the area of enhanced conductivity may be confined to the Deep Freeze Range crustal block along the western flank of the Mesozoic Rennick Graben. We also discuss the possible association between increased conductivity over the Southern Cross block and extensive Cenozoic alkaline plutonism.

  11. Reality check of laboratory service effectiveness during pandemic (H1N1) 2009, Victoria, Australia.

    Science.gov (United States)

    Catton, Michael; Druce, Julian; Papadakis, Goergina; Tran, Thomas; Birch, Christopher

    2011-06-01

    In Australia, the outbreak of pandemic (H1N1) 2009 began in Melbourne, Victoria; in the first 17 days, the Victorian Infectious Diseases Reference Laboratory detected 977 cases. Although the laboratory had a pandemic plan in place, a retrospective evaluation found 3 major variations from plan assumptions: 1) higher peak demand not limited by a case definition, 2) prolonged peak demand because containment attempts continued despite widespread influenza, and 3) unexpected influence of negative test results on public health actions. Although implementation of the plan was generally successful, the greatest challenges were limited availability of skilled staff and test reagents. Despite peak demand of 1,401 tests per day, results were provided within the usual 24 hours of specimen receipt; however, turnaround time seemed slower because of slow transport times (>3 days for 45% of specimens). Hence, effective laboratory capability might be enhanced by speeding transport of specimens and improving transmission of clinical data.

  12. “Todo lo que sigue es sencillamente estupendo”. Escritoras en las cartas de Ezequiel Martínez Estrada a Victoria Ocampo

    Directory of Open Access Journals (Sweden)

    Tania Diz

    2016-11-01

    Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.

  13. Preventing childhood obesity: the sentinel site for obesity prevention in Victoria, Australia.

    Science.gov (United States)

    Bell, A Colin; Simmons, Anne; Sanigorski, Andrea M; Kremer, Peter J; Swinburn, Boyd A

    2008-12-01

    In spite of greater awareness of the need for action to reduce obesity, the evidence on sustainable community approaches to prevent childhood and adolescent obesity is surprisingly sparse. This paper describes the design and methodological components of the Sentinel Site for Obesity Prevention, a demonstration site in the Barwon-South West region of Victoria, Australia, that aims to build the programs, skills and evidence necessary to attenuate and eventually reverse the obesity epidemic in children and adolescents. The Sentinel Site for Obesity Prevention is based on a partnership between the region's university (Deakin University) and its health, education and local government agencies. The three basic foundations of the Sentinel Site are: multi-strategy, multi-setting interventions; building community capacity; and undertaking program evaluations and population monitoring. Three intervention projects have been supported that cover different age groups (preschool: 2-5 years, primary school: 5-12 years, secondary school: 13-17 years), but that have many characteristics in common including: community participation and ownership of the project; an intervention duration of at least 3 years; and full evaluations with impact (behaviours) and outcome measures (anthropometry) compared with regionally representative comparison populations. We recommend the Sentinel Site approach to others for successfully building evidence for childhood obesity prevention and stimulating action on reducing the epidemic.

  14. Newborn transport in South Australia, 1978-80: experience of the Queen Victoria Hospital, Adelaide.

    Science.gov (United States)

    Davies, A G; Fitzgerald, A M; Dahlenburg, G W

    1982-01-23

    389 infants were transported to the Queen Victoria Hospital, Adelaide between 1978 and 1980. Twenty-three percent (99) of the infants were ventilated, and 49% (189) received intravenous or intra-arterial therapy. Fifty-six percent (217) of the infants required transport because of prematurity; 11% (46) because of perinatal asphyxia in babies weighing more than 2,500 g. Only one baby died during transport, while 14% of the babies died subsequently. A core temperature of less than 36 degrees C in either hospital is important; a cold baby is 3.5 times more likely to die (X2=25.46, P less than 0.001). The transport of babies over distances greater than 300 kilometres is peculiar to Australia. Significantly more of these babies were cold than those retrieved from hospitals near Adelaide (X2=4.7, P less than 0.05), and significantly more died. Difficulty in transferring mothers in preterm labour may be another reason these babies did relatively badly. Better education and facilities will be important if we are to improve their survival chances.

  15. "They Didn't Even Let Me Say Goodbye": A Study of Imprisoned Primary Carer Fathers' Care Planning for Children at the Point of Arrest in Victoria, Australia

    Science.gov (United States)

    Bartlett, Tess S.; Flynn, Catherine A.; Trotter, Christopher J.

    2018-01-01

    In Victoria, data indicates that in 2013-2014 there were 74,992 adult male arrests, yet little formal attention has been paid to the parenting status of these men, despite knowledge of the impact of parental arrest and incarceration on children being well established. This article addresses a gap in the literature by providing new insights into…

  16. Uso de redes neuronales artificiales para identificación de personas mediante el reconocimiento de rostros de la Municipalidad de la Victoria - Lima - 2015

    OpenAIRE

    Arriola Ramírez, Franklin

    2015-01-01

    En el presente proyecto se aplicará reconocimiento de imágenes mediante redes neuronales para la identificación de rostros, lo cual será utilizado para el diseño de un prototipo que permita verificar que las personas que participen de las actividades organizadas por la Municipalidad de La Victoria-Lima sean solamente los beneficiarios debidamente registrados en los Programas Sociales. La identificación de rostros de personas será captada en tiempo real con una cámara ...

  17. Distribution of Marburg virus in Africa: An evolutionary approach.

    Science.gov (United States)

    Zehender, Gianguglielmo; Sorrentino, Chiara; Veo, Carla; Fiaschi, Lisa; Gioffrè, Sonia; Ebranati, Erika; Tanzi, Elisabetta; Ciccozzi, Massimo; Lai, Alessia; Galli, Massimo

    2016-10-01

    The aim of this study was to investigate the origin and geographical dispersion of Marburg virus, the first member of the Filoviridae family to be discovered. Seventy-three complete genome sequences of Marburg virus isolated from animals and humans were retrieved from public databases and analysed using a Bayesian phylogeographical framework. The phylogenetic tree of the Marburg virus data set showed two significant evolutionary lineages: Ravn virus (RAVV) and Marburg virus (MARV). MARV divided into two main clades; clade A included isolates from Uganda (five from the European epidemic in 1967), Kenya (1980) and Angola (from the epidemic of 2004-2005); clade B included most of the isolates obtained during the 1999-2000 epidemic in the Democratic Republic of the Congo (DRC) and a group of Ugandan isolates obtained in 2007-2009. The estimated mean evolutionary rate of the whole genome was 3.3×10(-4) substitutions/site/year (credibility interval 2.0-4.8). The MARV strain had a mean root time of the most recent common ancestor of 177.9years ago (YA) (95% highest posterior density 87-284), thus indicating that it probably originated in the mid-XIX century, whereas the RAVV strain had a later origin dating back to a mean 33.8 YA. The most probable location of the MARV ancestor was Uganda (state posterior probability, spp=0.41), whereas that of the RAVV ancestor was Kenya (spp=0.71). There were significant migration rates from Uganda to the DRC (Bayes Factor, BF=42.0) and in the opposite direction (BF=5.7). Our data suggest that Uganda may have been the cradle of Marburg virus in Africa. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Impact of cruise ship emissions in Victoria, BC, Canada

    Science.gov (United States)

    Poplawski, Karla; Setton, Eleanor; McEwen, Bryan; Hrebenyk, Dan; Graham, Mark; Keller, Peter

    2011-02-01

    Characterization of the effects of cruise ship emissions on local air quality is scarce. Our objective was to investigate community level concentrations of fine particulate matter (PM 2.5), nitrogen dioxide (NO 2) and sulphur dioxide (SO 2) associated with cruise ships in James Bay, Victoria, British Columbia (BC), Canada. Data obtained over four years (2005-2008) at the nearest air quality network site located 3.5 km from the study area, a CALPUFF modeling exercise (2007), and continuous measurements taken in the James Bay community over a three-month period during the 2009 cruise ship season were examined. Concentrations of PM 2.5 and nitrogen oxide (NO) were elevated on weekends with ships present with winds from the direction of the terminal to the monitoring station. SO 2 displayed the greatest impact from the presence of cruise ships in the area. Network data showed peaks in hourly SO 2 when ships were in port during all years. The CALPUFF modeling analysis found predicted 24-hour SO 2 levels to exceed World Health Organization (WHO) guidelines of 20 μg m -3 for approximately 3% of 24-hour periods, with a maximum 24-hour concentration in the community of 41 μg m -3; however, the CALPUFF model underestimated concentrations when predicted and measured concentrations were compared at the network site. Continuous monitoring at the location in the community predicted to experience highest SO 2 concentrations measured a maximum 24-hour concentration of 122 μg m -3 and 16% of 24-hour periods were above the WHO standard. The 10-minute concentrations of SO 2 reached up to 599 μg m -3 and exceeded the WHO 10-minute SO 2 guideline (500 μg m -3) for 0.03% of 10-minute periods. No exceedences of BC Provincial or Canadian guidelines or standards were observed.

  19. The epidemiology of hip fractures across western Victoria, Australia.

    Science.gov (United States)

    Holloway, Kara L; Sajjad, Muhammad A; Mohebbi, Mohammadreza; Kotowicz, Mark A; Livingston, Patricia M; Khasraw, Mustafa; Hakkennes, Sharon; Dunning, Trisha L; Brumby, Susan; Page, Richard S; Pedler, Daryl; Sutherland, Alasdair; Venkatesh, Svetha; Brennan-Olsen, Sharon L; Williams, Lana J; Pasco, Julie A

    2018-03-01

    Hip fractures are associated with considerable morbidity and mortality. Hip fracture incidence varies across different levels of accessibility/remoteness and socioeconomic status (SES). As part of the Ageing, Chronic Disease and Injury Study, we aimed to map the pattern of hip fractures across the western region of the Australian state of Victoria, which contains a range of remoteness levels and SES. Data on hip fractures resulting in hospital admission were extracted from the Victorian Admitted Episodes Dataset (VAED) for men and women aged 40+years during 2010-2013 inclusive. An age-adjusted incidence rate (per 10,000population/year) was calculated for the entire region. Crude incidence rates and length of acute care hospital stay (excluding rehabilitation) were calculated for each Local Government Area (LGA). The impact of aggregated age, accessibility/remoteness index of Australia (ARIA) and SES on hip fracture rates aggregated across LGAs was determined using Poisson regression. For men, the age-standardised rate of hospitalisations for hip fracture across the whole region was 19.2 per 10,000population/year (95%CI 18.0-20.4) and for women, 40.0 (95%CI 38.3-41.7). The highest incidence rates for both sexes occurred in the less accessible LGAs of Yarriambiack and Hindmarsh, as well as the LGA with the lowest SES, Central Goldfields. In both sexes, approximately two thirds of individuals were discharged from acute hospital care within 14days. Increasing age, higher remoteness and lower SES were all associated with higher hip fracture rates. Crude incidence rates varied by location. Given that a high proportion of patients had acute hospital care of ≤14days, and accessibility and SES were associated with hip fracture rates, these results can inform policy and provide a model for other groups to conduct similar research in their local environment. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. A statewide review of postnatal care in private hospitals in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Forster Della A

    2010-05-01

    Full Text Available Abstract Background Concerns have been raised in Australia and internationally regarding the quality and effectiveness of hospital postnatal care, although Australian women receiving postnatal care in the private maternity sector rate their satisfaction with care more highly than women receiving public maternity care. In Victoria, Australia, two-thirds of women receive their maternity care in the public sector and the remainder in private health care sector. A statewide review of public hospital postnatal care in Victoria from the perspective of care providers found many barriers to care provision including the busyness of postnatal wards, inadequate staffing and priority being given to other episodes of care; however the study did not include private hospitals. The aim of this study was replicate the review in the private sector, to explore the structure and organisation of postnatal care in private hospitals and identify those aspects of care potentially impacting on women's experiences and maternal and infant care. This provides a more complete overview of the organisational structures and processes in postnatal care in all Victorian hospitals from the perspective of care providers. Methods A mixed method design was used. A structured postal survey was sent to all Victorian private hospitals (n = 19 and key informant interviews were undertaken with selected clinical midwives, maternity unit managers and obstetricians (n = 11. Survey data were analysed using descriptive statistics and interview data analysed thematically. Results Private hospital care providers report that postnatal care is provided in very busy environments, and that meeting the aims of postnatal care (breastfeeding support, education of parents and facilitating rest and recovery for women following birth was difficult in the context of increased acuity of postnatal care; prioritising of other areas over postnatal care; high midwife-to-woman ratios; and the number and

  1. Short-term droughts forecast using Markov chain model in Victoria, Australia

    Science.gov (United States)

    Rahmat, Siti Nazahiyah; Jayasuriya, Niranjali; Bhuiyan, Muhammed A.

    2017-07-01

    A comprehensive risk management strategy for dealing with drought should include both short-term and long-term planning. The objective of this paper is to present an early warning method to forecast drought using the Standardised Precipitation Index (SPI) and a non-homogeneous Markov chain model. A model such as this is useful for short-term planning. The developed method has been used to forecast droughts at a number of meteorological monitoring stations that have been regionalised into six (6) homogenous clusters with similar drought characteristics based on SPI. The non-homogeneous Markov chain model was used to estimate drought probabilities and drought predictions up to 3 months ahead. The drought severity classes defined using the SPI were computed at a 12-month time scale. The drought probabilities and the predictions were computed for six clusters that depict similar drought characteristics in Victoria, Australia. Overall, the drought severity class predicted was quite similar for all the clusters, with the non-drought class probabilities ranging from 49 to 57 %. For all clusters, the near normal class had a probability of occurrence varying from 27 to 38 %. For the more moderate and severe classes, the probabilities ranged from 2 to 13 % and 3 to 1 %, respectively. The developed model predicted drought situations 1 month ahead reasonably well. However, 2 and 3 months ahead predictions should be used with caution until the models are developed further.

  2. Oceanographic profile plankton, Temperature Salinity and other measurements collected using bottle from VICTORIA 1 FISHING BOAT), ALEJERO HUMBOLDT and other platforms in the South Pacific, Coastal S Pacific and other locations from 1980 to 1982 (NODC Accession 0002083)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity and other measurements found in dataset OSD taken from the VICTORIA 1(FISHING BOAT), ALEJERO HUMBOLDT and other platforms in the South...

  3. Family Violence in Domestic Homicides: A Case Study of Women Who Killed Intimate Partners Post-Legislative Reform in Victoria, Australia.

    Science.gov (United States)

    Tyson, Danielle; Kirkwood, Deborah; Mckenzie, Mandy

    2016-05-18

    This article examines the impact of legislative reforms enacted in 2005 in Victoria, Australia, on legal responses to women charged with murder for killing their intimate partner. The reforms provided for a broader understanding of the context of family violence to be considered in such cases, but we found little evidence of this in practice. This is partly attributable to persistent misconceptions among the legal profession about family violence and why women may believe it necessary to kill a partner. We recommend specialized training for legal professionals and increased use of family violence evidence to help ensure women's claims of self-defense receive appropriate responses from Victorian courts. © The Author(s) 2016.

  4. Activation of Triggering Receptor Expressed on Myeloid Cells-1 on Human Neutrophils by Marburg and Ebola Viruses

    National Research Council Canada - National Science Library

    Mohamadzadeh, Mansour; Coberley, Sadie S; Olinger, Gene G; Kalina, Warren V; Ruthel, Gordon; Fullter, Claudette L; Swenson, Dana L; Pratt, William D; Kuhns, Douglas B; Schmaljohn, Alan L

    2006-01-01

    .... Here, we report that MARV and EBOV activate TREM-1 on human neutrophils, resulting in DAP12 phosphorylation, TREM-1 shedding, mobilization of intracellular calcium, secretion of proinflammatory...

  5. Structuring the Environmental Experience Design Research Framework through Selected Aged Care Facility Data Analyses in Victoria

    Directory of Open Access Journals (Sweden)

    Nan Ma

    2017-11-01

    Full Text Available Humans relate to the living environment physically and psychologically. Environmental psychology has a rich developed history while experience design emerged recently in the industrial design domain. Nonetheless, these approaches have barely been merged, understood or implemented in architectural design practices. This study explored the correlation between experience design and environmental psychology. Moreover, it conducted literature reviews on theories about emotion, user experience design, experience design and environmental psychology, followed by the analyses of spatial settings and environmental quality data of a selected aged care facility in Victoria, Australia, as a case study. Accordingly, this study led to proposing a research framework on environmental experience design (EXD. It can be defined as a deliberate attempt that affiliates experience design and environmental psychology with creation of the built environment that should accommodate user needs and demands. The EXD research framework proposed in this study was tailored for transforming related design functions into the solutions that contribute to improving the built environment for user health and wellbeing.

  6. Microbiological Safety and Food Handling Practices of Seed Sprout Products in the Australian State of Victoria.

    Science.gov (United States)

    Symes, Sally; Goldsmith, Paul; Haines, Heather

    2015-07-01

    Seed sprouts have been implicated as vehicles for numerous foodborne outbreaks worldwide. Seed sprouts pose a unique food safety concern because of the ease of microbiological seed contamination, the inherent ability of the sprouting process to support microbial growth, and their consumption either raw or lightly cooked. To examine seed sprout safety in the Australian state of Victoria, a survey was conducted to detect specific microbes in seed sprout samples and to investigate food handling practices relating to seed sprouts. A total of 298 seed sprout samples were collected from across 33 local council areas. Escherichia coli was detected in 14.8%, Listeria spp. in 12.3%, and Listeria monocytogenes in 1.3% of samples analyzed. Salmonella spp. were not detected in any of the samples. A range of seed sprout handling practices were identified as potential food safety issues in some food businesses, including temperature control, washing practices, length of storage, and storage in proximity to unpackaged ready-to-eat potentially hazardous foods.

  7. Economic outcome for intensive care of infants of birthweight 500-999 g born in Victoria in the post surfactant era. The Victorian Infant Collaborative Study Group.

    Science.gov (United States)

    1997-06-01

    To determine the incremental cost of improving the outcome for extremely low birthweight (ELBW, birthweight 500-999 g) infants born in Victoria after the introduction of exogenous surfactant (the post surfactant era). This was a geographically determined cohort study of ELBW children in Victoria, Australia of consecutive livebirths born in three distinct eras: (i) 1979-80 (n = 351); (ii) 1985-87 (n = 560); and (iii) 1991-92 (n = 429). Exogenous surfactant was first used in Victoria in March, 1991. The consumption of nursery resources per livebirth, and the survival and sensorineural disability rates at 2 years of age for each era were investigated. Utilities were assigned as follows: 0 for dead, 0.4 for severe disability, 0.6 for moderate disability, 0.8 for mild disability, and 1 for no disability. Utilities were multiplied for more than one disability. Dollar costs were assumed to be $1470 ($A 1992) per day of assisted ventilation, and one dose of exogenous surfactant was assumed to be equivalent to one third of a day of assisted ventilation. Cost-effectiveness (additional costs per additional survivor or life-year gained) and cost-utility (additional costs per additional quality-adjusted survivor or life-year gained) ratios were calculated for the pre-surfactant era (1985-87 vs 1979-80), and for the post surfactant era (1991-92 vs 1985-87). Considering only the costs incurred during the primary hospitalization, cost-effectiveness and cost-utility ratios were lower (i.e. economically better) in the post surfactant era than in the pre-surfactant era (pre-surfactant vs post surfactant; $7040 vs $4040 per life year gained; $6700 vs $5360 per quality-adjusted life year gained). Both ratios fell with increasing birthweight. In contrast with the pre-surfactant era, cost-utility ratios were less favourable than cost-effectiveness ratios in the post surfactant era. With costs for long-term care of severely disabled children added, both cost ratios were higher in the post

  8. Predominance of influenza A(H1N1)pdm09 virus genetic subclade 6B.1 and influenza B/Victoria lineage viruses at the start of the 2015/16 influenza season in Europe

    DEFF Research Database (Denmark)

    Broberg, Eeva; Melidou, Angeliki; Prosenc, Katarina

    2016-01-01

    Influenza A(H1N1)pdm09 viruses predominated in the European influenza 2015/16 season. Most analysed viruses clustered in a new genetic subclade 6B.1, antigenically similar to the northern hemisphere vaccine component A/California/7/2009. The predominant influenza B lineage was Victoria compared...

  9. Influenza C infections in Western Australia and Victoria from 2008 to 2014.

    Science.gov (United States)

    Jelley, Lauren; Levy, Avram; Deng, Yi-Mo; Spirason, Natalie; Lang, Jurissa; Buettner, Iwona; Druce, Julian; Blyth, Chris; Effler, Paul; Smith, David; Barr, Ian G

    2016-11-01

    Influenza C is usually considered a minor cause of respiratory illness in humans with many infections being asymptomatic or clinically mild. Large outbreaks can occur periodically resulting in significant morbidity. This study aimed at analyzing the available influenza C clinical samples from two widely separated states of Australia, collected over a 7-year period and to compare them with influenza C viruses detected in other parts of the world in recent years. Between 2008 and 2014, 86 respiratory samples that were influenza C positive were collected from subjects with influenza-like illness living in the states of Victoria and Western Australia. A battery of other respiratory viruses were also tested for in these influenza C-positive samples. Virus isolation was attempted on all of these clinical samples, and gene sequencing was performed on all influenza C-positive cultures. Detections of influenza C in respiratory samples were sporadic in most years studied, but higher rates of infection occurred in 2012 and 2014. Many of the patients with influenza C had coinfections with other respiratory pathogens. Phylogenetic analysis of the full-length hemagglutinin-esterase-fusion (HE) gene found that most of the viruses grouped in the C/Sao Paulo/378/82 clade with the remainder grouping in the C/Kanagawa/1/76 clade. © 2016 The Authors. Influenza and Other Respiratory Viruses Published by John Wiley & Sons Ltd.

  10. Corporatization as a means of improving water quality: the experience in Victoria, Australia.

    Science.gov (United States)

    Martin, Narelle

    Factors including fragmentation, a lack of direction, poor accountability, poor water quality, and a sizable state government subsidy contributed to the rural water industry in Victoria, Australia, in 1993. In 1993 the state government set out parameters for reform to change the size, structure, performance, and culture of the water industry. The path taken was not privatization, but corporatization. Tools used included amalgamation of organizations; separating water provisions from local government; changing the composition and reporting mechanisms of the boards; establishing clear benchmarks and performance criteria; making information publicly available; and providing a commercial orientation. The outcomes of the reforms were to be a focus on water quality and effluent management. In 2001, 15 water authorities were in place. There were significant improvements in accountability, finances, and performance. The authorities provided information on performance to both the state and the public. Reductions of operating costs have been in the range of 20-35%, with savings put back into new infrastructure. Water quality has significantly improved in a number of parameters and effluent management has also improved. This paper describes the challenges faced before the reform process, the reforms initiated, and the outcomes. It argues that privatization is not the only path to improvement: Developing a corporate structure and accountability can also deliver substantial improvements.

  11. Liturgy and Music in Hereford Cathedral in the Time of Queen Victoria and Beyond

    Directory of Open Access Journals (Sweden)

    Tessa Murdoch

    2017-04-01

    Full Text Available The Victorian Gothic Revival and its focus on liturgical neo-medievalism inspired the 1860s restoration of the medieval Hereford Cathedral. In this restoration, the new screen played a central part. Designed by George Gilbert Scott and manufactured by the firm of Francis Skidmore in Coventry, the screen was commissioned in order to re-unite the choir with the nave. The symbolism and colours decorating the screen harmonized with the medieval and later features of the cathedral, including the high altar reredos, organ pipes, and floor tiles. Hereford Cathedral Library preserves historical accounts of the interior and original music manuscripts by Edward Elgar and Frederick Ouseley that illustrate, with the musical inserts provided, the rich tradition of choral music and liturgy which continues to this day with key liturgies and the annual Three Choirs Festival linking Gloucester, Hereford, and Worcester. Memorials and stained-glass windows dedicated to successive precentors embellish the musical vocabulary of the interior. In focusing on the musical culture connected with Hereford Cathedral, this essay seeks to enrich the interpretation of the restored Hereford Screen in its secular setting at the Victoria and Albert Museum, London.

  12. Identification and Pathological Characterization of Persistent Asymptomatic Ebola Virus infection in Rhesus Monkeys

    Science.gov (United States)

    2017-05-12

    2454 (2015). 412 16. Blackley, D.J., et al. Reduced evolutionary rate in reemerged Ebola virus 413 transmission chains. Sci Adv 2, e1600378 (2016). 414...and Marburgvirus Infections. in Harrison’s Principles of 456 Internal Medicine , Vol. 2 (eds. Kasper, D.L., et al.) 1323-1329 (McGraw-Hill 457

  13. CULTURAL MEMORY OF VICTORY OF LAS TUNAS CITY' LODGES FROM 1930 TO 1945 / MEMORIA CULTURAL DE LAS LOGIAS DE VICTORIA DE LAS TUNAS 1930-1945

    OpenAIRE

    Milena Medina Pérez

    2012-01-01

    The cultural memory of the lodges of Victoria de Las Tunas (1930-1945), it constitutes the topic of the present investigation. The thematic of the lodges has been approached for studious and investigating, not alone of the town but of several parts of the world. Still when these studies exist, the related with the cultural memory of the lodges of the territory, is in the pages of the documents of the time that which leaves to the light starting from this investigation, to show yesterday's Tun...

  14. Cross-Protection against Marburg Virus Strains by Using a Live, Attenuated Recombinant Vaccine

    National Research Council Canada - National Science Library

    Daddario-DiCaprio, Kathleen M; Geisbert, Thomas W; Geisbert, Joan B; Stroeher, Ute; Hensley, Lisa E; Grolla, Allen; Fritz, Elizabeth A; Feldmann, Friederike; Feldmann, Heinz; Jones, Steven M

    2006-01-01

    Marburg virus (MARV) has been associated with sporadic episodes of hemorrhagic fever, including a recent highly publicized outbreak in Angola that produced severe disease and significant mortality in infected patients...

  15. Live Attenuated Recombinant Vaccine Protects Nonhuman Primates Against Ebola and Marburg Viruses

    National Research Council Canada - National Science Library

    Jones, Steven M; Feldmann, Heinz; Stroher, Ute; Geisbert, Joan B; Fernando, Lisa; Grolla, Allen; Klenk, Hans-Dieter; Sullivan, Nancy J; Volchkov, Viktor E; Fritz, Elizabeth A; Daddario, Kathleen M; Hensley, Lisa E; Jahrling, Peter B; Geisbert, Thomas W

    2005-01-01

    Vaccines and therapies are urgently needed to address public health needs stemming from emerging pathogens and biological threat agents such as the filoviruses Ebola virus (EBOV) and Marburg virus (MARV...

  16. Granitoids of the Dry Valleys area, southern Victoria Land : geochemistry and evolution along the early Paleozoic Antarctic Craton margin

    International Nuclear Information System (INIS)

    Allibone, A.H.; Cox, S.C.; Smillie, R.W.

    1993-01-01

    Field relationships and geochemistry indicate granitoid plutons of the Dry Valleys area comprise at least three petrogenetically distinct suites. The older Dry Valleys 1a (DV1a) suite, comprising the Bonney, Catspaw, Denton, Cavendish, and Wheeler Plutons and hornblende-biotite orthogneisses, and Dry Valleys 1b (DV1b) suite, comprising the Hedley, Valhalla, St Johns, Dun, Calkin, and Suess Plutons, biotite granitoid dikes and biotite orthogneisses, were emplaced before prominent swarms of Vanda mafic and felsic dikes. Both the DV1a and DV1b suites are time transgressive, with older intrusions in each suite being emplaced during the later stages of deformation of the Koettlitz Group. Younger granitoids that postdate the majority of the Vanda dikes include: the Dry Valleys 2 (DV2) suite, comprising the Pearse and Nibelungen Plutons plus several smaller, unnamed plugs; and the Harker, Swinford, Orestes, and Brownworth Plutons with identical field relationships and enclaves but distinct chemistries. Chemical characteristics and limited Rb-Sr isotopic dating indicate plutonism before c. 500 Ma was dominated by the Cordilleran I-type DV1a suite, inferred to have developed during melting above a west-dipping subduction zone along the Antarctic Craton margin. The chemical characteristics of the DV1b suite indicate large-scale melting of a quartzo-feldspathic protolith lacking residual plagioclase, but containing refractory garnet. Potential DV1b suite source rocks include metamorphosed immature sediments, possibly underplated along the subduction zone associated with DV1a magmatism, or older granitoid orthogneisses. Major DV1b plutonism at 490 Ma marks the end of subduction-related plutonism in southern Victoria Land. Younger DV2 alkali-calcic, Caledonian I-type plutonism is inferred to have formed in response to uplift and extension between 480 and 455 Ma. Lack of DV2 suite correlatives and Vanda mafic and felsic dikes in northern Victoria Land suggests significantly

  17. Do religion and religiosity have anything to do with alcohol consumption patterns? Evidence from two fish landing sites on Lake Victoria Uganda.

    Science.gov (United States)

    Tumwesigye, Nazarius M; Atuyambe, Lynn; Kibira, Simon P S; Wabwire-Mangen, Fred; Tushemerirwe, Florence; Wagner, Glenn J

    2013-09-01

    Fish landing sites have high levels of harmful use of alcohol. This paper examines the role of religion and religiosity on alcohol consumption at two fish landing sites on Lake Victoria in Uganda. Questionnaires were administered to randomly selected people at the sites. Dependent variables included alcohol consumption during the previous 30 days, whereas the key independent variables were religion and religiosity. Bivariate and multivariate analysis techniques were applied. People reporting low religiosity were five times more likely to have consumed alcohol (95% confidence interval: 2.45-10.04) compared with those reporting low/average religiosity. Religion and religiosity are potential channels for controlling alcohol use.

  18. Three-dimensional structure and stoichiometry of Helmintosporium victoriae190S totivirus

    International Nuclear Information System (INIS)

    Caston, Jose R.; Luque, Daniel; Trus, Benes L.; Rivas, German; Alfonso, Carlos; Gonzalez, Jose M.; Carrascosa, Jose L.; Annamalai, Padmanaban; Ghabrial, Said A.

    2006-01-01

    Most double-stranded RNA viruses have a characteristic capsid consisting of 60 asymmetric coat protein dimers in a so-called T = 2 organization, a feature probably related to their unique life cycle. These capsids organize the replicative complex(es) that is actively involved in genome transcription and replication. Available structural data indicate that their RNA-dependent RNA polymerase (RDRP) is packaged as an integral capsid component, either as a replicative complex at the pentameric vertex (as in reovirus capsids) or as a fusion protein with the coat protein (as in some totivirus). In contrast with members of the family Reoviridae, there are two well-established capsid arrangements for dsRNA fungal viruses, exemplified by the totiviruses L-A and UmV and the chrysovirus PcV. Whereas L-A and UmV have a canonical T = 2 capsid, the PcV capsid is based on a T = 1 lattice composed of 60 capsid proteins. We used cryo-electron microscopy combined with three-dimensional reconstruction techniques and hydrodynamic analysis to determine the structure at 13.8 A resolution of Helminthosporium victoriae 190S virus (Hv190SV), a totivirus isolated from a filamentous fungus. The Hv190SV capsid has a smooth surface and is based on a T = 2 lattice with 60 equivalent dimers. Unlike the RDRP of some other totiviruses, which are expressed as a capsid protein-RDRP fusion protein, the Hv190SV RDRP is incorporated into the capsid as a separate, nonfused protein, free or non-covalently associated to the capsid interior

  19. Nuclear forensic analysis of uranium oxide powders interdicted in Victoria, Australia

    Energy Technology Data Exchange (ETDEWEB)

    Kristo, Michael Joseph [Lawrence Livermore National Laboratory, Livermore, CA (United States); Keegan, Elizabeth; Colella, Michael [Australian Nuclear Science and Technology Organisation, Kirrawee, NSW (Australia); and others

    2015-07-01

    Nuclear forensic analysis was conducted on two uranium samples confiscated during a police investigation in Victoria, Australia. The first sample, designated NSR-F-270409-1, was a depleted uranium powder of moderate purity (∝ 1000 μg/g total elemental impurities). The chemical form of the uranium was a compound similar to K{sub 2}(UO{sub 2}){sub 3}O{sub 4} . 4H{sub 2}O. While aliquoting NSR-F-270409-1 for analysis, the body and head of a Tineid moth was discovered in the sample. The second sample, designated NSR-F-270409-2, was also a depleted uranium powder. It was of reasonably high purity (∝ 380 μg/g total elemental impurities). The chemical form of the uranium was primarily UO{sub 3} . 2H{sub 2}O, with minor phases of U{sub 3}O{sub 8} and UO{sub 2}. While aliquoting NSR-F-270409-2 for analysis, a metal staple of unknown origin was discovered in the sample. The presence of {sup 236}U and {sup 232}U in both samples indicates that the uranium feed stocks for these samples experienced a neutron flux at some point in their history. The reactor burn-up calculated from the isotopic composition of the uranium is consistent with that of spent fuel from natural uranium (NU) fueled Pu production. These nuclear forensic conclusions allow us to categorically exclude Australia as the origin of the material and greatly reduce the number of candidate sources.

  20. Staffing in postnatal units: is it adequate for the provision of quality care? Staff perspectives from a state-wide review of postnatal care in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Lumley Judith

    2006-07-01

    Full Text Available Abstract Background State-wide surveys of recent mothers conducted over the past decade in Victoria, one state of Australia, have identified that women are consistently less satisfied with the care they received in hospital following birth compared with other aspects of maternity care. Little is known of caregivers' perspectives on the provision ofhospital postnatal care: how care is organised and provided in different hospitals; what constrains the provision of postnatal care (apart from funding and what initiatives are being undertaken to improve service delivery. A state-widereview of organisational structures and processes in relation to the provision of hospital postnatal care in Victoria was undertaken. This paper focuses on the impact of staffing issues on the provision of quality postnatal care from the perspective of care providers. Methods A study of care providers from Victorian public hospitals that provide maternity services was undertaken. Datawere collected in two stages. Stage one: a structured questionnaire was sent to all public hospitals in Victoria that provided postnatal care (n = 73, exploring the structure and organisation of care (e.g. staffing, routine observations, policy framework and discharge planning. Stage two: 14 maternity units were selected and invited to participate in a more in-depth exploration of postnatal care. Thirty-eight key informant interviews were undertaken with midwives (including unit managers, associate unit managers and clinical midwives and a medical practitioner from eachselected hospital. Results Staffing was highlighted as a major factor impacting on the provision of quality postnatal care. There were significant issues associated with inadequate staff/patient ratios; staffing mix; patient mix; prioritisation of birth suites over postnatal units; and the use of non-permanent staff. Forty-three percent of hospitals reported having only midwives (i.e. no non-midwives providing postnatal care

  1. Attitudes, Knowledge and Factors Associated with Human Papillomavirus (HPV) Vaccine Uptake in Adolescent Girls and Young Women in Victoria, Australia

    Science.gov (United States)

    Tung, Iris L. Y.; Machalek, Dorothy A.; Garland, Suzanne M.

    2016-01-01

    Background Human papillomavirus (HPV) vaccination targets high-risk HPV16/18 that cause 70% of all cancers of the cervix. In Australia there is a fully-funded, school-based National HPV Vaccination Program which has achieved vaccine initiation rate of 82% among age-eligible females. Improving HPV vaccination rates is important in the prevention of morbidity and mortality associated with HPV-related disease. This study aimed to identify factors and barriers associated with uptake of the HPV vaccine in the Australian Program. Methods Between 2011 and 2014, females aged 18–25 years, living in Victoria, Australia who were offered HPV vaccination between 2007 and 2009 as part of the National HPV Vaccination Program, living in Victoria, Australia were recruited into a a young women’s study examining effectiveness of the Australian National HPV Vaccination Program. Overall, 668 participants completed the recruitment survey, which collected data of participants’ demographics and HPV knowledge. In 2015 these participants were invited to complete an additional supplementary survey on parental demographics and attitudes towards vaccinations. Results In 2015, 417 participants completed the supplementary survey (62% response rate). Overall, 19% of participants were unvaccinated. In multivariate analyses, HPV vaccination was significantly associated with their being born in Australia (pvaccinations (pparents being main decision-makers for participants’ HPV vaccination (pHPV non-vaccination was parental concern about vaccine safety (43%). Compared with HPV-vaccinated participants, those unvaccinated were significantly more likely to be opposed to all vaccines, including HPV vaccines (pvaccinating their own children with all vaccines (p = 0.033), including HPV vaccines (pHPV vaccine acceptance. Conclusions Attitudes towards general health, vaccinations in general, as well as HPV vaccines are important in HPV vaccine uptake. Long-term monitoring of the knowledge, attitude

  2. Impact of improved laboratory compliance on notification of genital Chlamydia trachomatis infection in Victoria.

    Science.gov (United States)

    Thompson, S C; MacEachern, A; Stevenson, E

    1997-02-01

    Although regulations in Victoria require notification of chlamydia infection by both clinician and laboratory, review found many reports that were notified only by one source (i.e., were unmatched). To identify problems with the notification system and to improve the quality of surveillance for this disease. All notified cases of chlamydia diagnosed in January or February 1995 were followed up by contacting diagnosing doctors. Identified noncompliant laboratories were asked to provide a list of all diagnoses for the period and institute ongoing reporting. Notification data were reviewed for timeliness and completeness. Clinicians never notified without laboratory confirmation. Soliciting laboratory reports increased total notifications by 30%, and there was a highly significant improvement in reporting by both clinicians and laboratories. Reasons for failure to notify by clinicians included an assumption by some clinicians that laboratories would notify and ignorance that notification was required. Notified cases generally are now accompanied by a laboratory report, and although nonnotification by clinicians continues, notification has improved. Further improvements in clinician notification may depend on doctors knowing that public health action results from reporting. An alternative to requiring doctors' time to be spent in duplicate notification would be to strengthen laboratory reporting and then check that adequate treatment and partner notification has occurred through contact with the diagnosing doctor.

  3. Highly Heterogeneous Soil Bacterial Communities around Terra Nova Bay of Northern Victoria Land, Antarctica

    Science.gov (United States)

    Lim, Hyoun Soo; Hong, Soon Gyu; Kim, Ji Hee; Lee, Joohan; Choi, Taejin; Ahn, Tae Seok; Kim, Ok-Sun

    2015-01-01

    Given the diminished role of biotic interactions in soils of continental Antarctica, abiotic factors are believed to play a dominant role in structuring of microbial communities. However, many ice-free regions remain unexplored, and it is unclear which environmental gradients are primarily responsible for the variations among bacterial communities. In this study, we investigated the soil bacterial community around Terra Nova Bay of Victoria Land by pyrosequencing and determined which environmental variables govern the bacterial community structure at the local scale. Six bacterial phyla, Actinobacteria, Proteobacteria, Acidobacteria, Chloroflexi, Cyanobacteria, and Bacteroidetes, were dominant, but their relative abundance varied greatly across locations. Bacterial community structures were affected little by spatial distance, but structured more strongly by site, which was in accordance with the soil physicochemical compositions. At both the phylum and species levels, bacterial community structure was explained primarily by pH and water content, while certain earth elements and trace metals also played important roles in shaping community variation. The higher heterogeneity of the bacterial community structure found at this site indicates how soil bacterial communities have adapted to different compositions of edaphic variables under extreme environmental conditions. Taken together, these findings greatly advance our understanding of the adaption of soil bacterial populations to this harsh environment. PMID:25799273

  4. Nota biobibliográfica + poética + creaciones («Uves migratorias», «Fronteras del hambre», «Puntos de sutura», «Paisaje urbano 2», «El intruso» y «Mirada rota» + cuestionario (Victoria Pineda

    Directory of Open Access Journals (Sweden)

    Julián Alonso

    2014-03-01

    Full Text Available Nota biobibliográfica + poética + creaciones («Uves migratorias», «Fronteras del hambre», «Puntos de sutura», «Paisaje urbano 2», «El intruso» y «Mirada rota» + cuestionario (Victoria Pineda

  5. Stable Isotopic signatures of Adélie penguin remains provide long-term paleodietary records in Northern Victoria Land (Ross Sea, Antarctica)

    Science.gov (United States)

    Lorenzini, Sandra; Baroni, Carlo; Fallick, Anthony Edward; Baneschi, Ilaria; Salvatore, Maria Cristina; Zanchetta, Giovanni; Dallai, Luigi

    2010-05-01

    The stable isotopes geochemistry of carbon and nitrogen provides a powerful tools for investigating in animal dietary patterns and shifts during the past. The signature of C and N isotopes provide direct information about the diet of an individual and its dietary patterns, especially when the dietary sources consist of prey from different trophic levels (i.e. different C and N isotopic composition) (DeNiro and Epstein 1978, Minawaga and Wada 1984, Koch et al. 1994, Hobson 1995). By analyzing the isotopic composition of penguin remains, we present a new detailed Adélie penguin (Pygoscelis adeliae) paleodietary record for the area of Terra Nova Bay (Victoria Land, Ross Sea). Adélie penguins primarily feed on fish (mainly the silverfish Pleuragramma antarcticum) and krill (Euphausia superba, Euphausia cristallorophias) (Ainley 2002, Lorenzini et al. 2009) that belonging to two different trophic levels. Consequently, they are characterized by different isotopic signatures. Specifically, we analyzed 13C/12C and 15N/14N ratios of more than one thousand of modern and fossil Adélie penguin eggshell and guano samples collected from ornithogenic soils (penguin guano-formed) dated back to ≈7,200 years BP (Baroni and Orombelli 1994, Lambert et al. 2002, Baroni and Hall 2004, Hall et al. 2006). The expanded database of stable isotope values obtained from Adélie penguin remains define a detailed paleodietary record with an excellent temporal continuity over all the investigated time period. Our data indicate a significant dietary shift between fish and krill, with a gradual decrease from past to present time in the proportion of fish compared to krill in Adélie penguin diet. From 7200 yrs BP to 2000 yrs BP, δ13C and δ15N values indicate fish as the most eaten prey. The dietary contribution of lower-trophic prey in penguin diet started becoming evident not earlier than 2000 yrs BP, when the δ13C values reveal a mixed diet based on fish and krill consumption. Modern

  6. Application of Satellite Observations to Manage Natural Disasters in the Lake Victoria Basin

    Science.gov (United States)

    Habib, Shahid; Policelli, F.; Irwin, D.; Korme, Tesfaye; Adler, Bob; Hong, Yang

    2010-01-01

    Lake Victoria, the second largest fresh water lake in the Eastern part of Africa is a vital natural resource for the economic well being and prosperity of over 30 million people located in riparian regions of Uganda, Kenya and Tanzania. It covers a large area of about 68,870 km2 and produces a GDP of about US $30 billion per year. The region is also very much prone to natural disasters such as severe floods during heavy precipitation periods in the Eastern part of Africa. In addition to floods, the precipitation also produces large infestations of mosquito larvae due to the standing water in many areas. This further causes multiple vector borne diseases such as Malaria, Rift Valley Fever and more. These problems are of serious concern and require active and aggressive surveillance and management to minimize the loss of human and animal lives and property damage. Satellite imagery and observations along with the in situ measurements provide a great tool to analyze and study this area and inform the policy makers to make calculated policy decisions which are more beneficial to the environment. Recently, NASA and USAID have joined forces with the Regional Center for Mapping of Resources for Development (RCMRD) located in Nairobi, Kenya to utilize multiple NASA sensors such as TRMM, SRTM and MODIS to develop flood potential maps for the Lake Victoria Basin. The idea is to generate a flood forecasts and "nowcasts" that can be sent to the disaster management organizations of Uganda, Kenya, and Tanzania. Post flood event satellite imagery is becoming a common tool to assess the areas inundated by flooding. However, this work is unique undertaking by utilizing land imaging and atmospheric satellites to build credible flood potential maps. At same time, we are also studying the potential occurrence and spread of Rift Valley Fever disease based on the short term climate records and precipitation data. These activities require multi-nation coordination and agreements and

  7. Procedural skills practice and training needs of doctors, nurses, midwives and paramedics in rural Victoria

    Science.gov (United States)

    Campbell, David; Shepherd, Irwyn; McGrail, Matthew; Kassell, Lisa; Connolly, Marnie; Williams, Brett; Nestel, Debra

    2015-01-01

    Introduction Procedural skills are a significant component of clinical practice. Doctors, nurses, midwives and paramedics are trained to use a variety of procedural skills. Rural clinicians in particular are often required to maintain competence in some procedural skills that are used infrequently, and which may require regular and repeated rehearsal. This paper reports on a research project conducted in Gippsland, Victoria, to ascertain the frequency of use, and relevance to clinical practice, of a range of skills in the fields of medicine, nursing, midwifery, and paramedic practice. The project also gathered data on the attitudes of clinicians regarding how frequently and by what means they thought they needed to practice these skills with a particular focus on the use of simulation as an educational method. Methods The research was conducted following identification of a specific set of procedural skills for each professional group. Skills were identified by an expert steering committee. We developed online questionnaires that consisted of two parts: 1) demographic and professional characteristics, and 2) experience of procedural skills and perceived training needs. We sought to invite all practicing clinicians (doctors, nurses, midwives, paramedics) working in Gippsland. Online surveys were distributed between November 2011 and April 2012 with three follow-up attempts. The Monash University Human Research Ethics Committee approved the study. Results Valid responses were received from 58 doctors, 94 nurses, 46 midwives, and 30 paramedics, whom we estimate to represent not more than 20% of current clinicians within these professions. This response rate reflected some of the difficulties experienced in the conduct of the research. Results were tabulated for each professional group across the range of skills. There was significant correlation between the frequency of certain skills and confidence with maintenance of these skills. This did not necessarily correlate

  8. Procedural skills practice and training needs of doctors, nurses, midwives and paramedics in rural Victoria.

    Science.gov (United States)

    Campbell, David; Shepherd, Irwyn; McGrail, Matthew; Kassell, Lisa; Connolly, Marnie; Williams, Brett; Nestel, Debra

    2015-01-01

    Procedural skills are a significant component of clinical practice. Doctors, nurses, midwives and paramedics are trained to use a variety of procedural skills. Rural clinicians in particular are often required to maintain competence in some procedural skills that are used infrequently, and which may require regular and repeated rehearsal. This paper reports on a research project conducted in Gippsland, Victoria, to ascertain the frequency of use, and relevance to clinical practice, of a range of skills in the fields of medicine, nursing, midwifery, and paramedic practice. The project also gathered data on the attitudes of clinicians regarding how frequently and by what means they thought they needed to practice these skills with a particular focus on the use of simulation as an educational method. The research was conducted following identification of a specific set of procedural skills for each professional group. Skills were identified by an expert steering committee. We developed online questionnaires that consisted of two parts: 1) demographic and professional characteristics, and 2) experience of procedural skills and perceived training needs. We sought to invite all practicing clinicians (doctors, nurses, midwives, paramedics) working in Gippsland. Online surveys were distributed between November 2011 and April 2012 with three follow-up attempts. The Monash University Human Research Ethics Committee approved the study. Valid responses were received from 58 doctors, 94 nurses, 46 midwives, and 30 paramedics, whom we estimate to represent not more than 20% of current clinicians within these professions. This response rate reflected some of the difficulties experienced in the conduct of the research. Results were tabulated for each professional group across the range of skills. There was significant correlation between the frequency of certain skills and confidence with maintenance of these skills. This did not necessarily correlate with perceptions of

  9. 40Ar/39Ar chronology of the McMurdo Volcanic Group at The Pleiades, Northern Victoria Land, Antarctica

    International Nuclear Information System (INIS)

    Esser, R.P.; Kyle, P.R.

    2002-01-01

    Fifteen samples from The Pleiades volcanic centre in northern Victoria Land, Antarctica, were dated using the 40 Ar/ 39 Ar furnace step-heating method. Ages range from 847 to 6 ka. Eight samples are <100 ka, showing that The Pleiades are very young. Three trachyte samples suggest eruptive activity started at c. 830 ka. An apparent increase in volcanic activity began at c. 100 ka, and at c. 65 ka a significant phase of cone building occurred at Mt Atlas, the largest volcanic cone at The Pleiades. At c. 45 ka, lava flows were erupted on the western flank of Mt Pleiones adjacent to Mt Atlas and near the summit of Alcyone Cone. The youngest activity (6 ± 6 ka) occurred at Taygete Cone, an endogenous dome of trachyte. The near-zero age for Taygete Cone is consistent with evidence of recent volcanism, including fresh hydrothermal activity and compositionally similar pumice lapilli scattered over parts of The Pleiades. (author). 6 refs., 3 figs., 1 tab

  10. Scenario-based water resources planning for utilities in the Lake Victoria region

    Science.gov (United States)

    Mehta, Vishal K.; Aslam, Omar; Dale, Larry; Miller, Norman; Purkey, David R.

    Urban areas in the Lake Victoria (LV) region are experiencing the highest growth rates in Africa. As efforts to meet increasing demand accelerate, integrated water resources management (IWRM) tools provide opportunities for utilities and other stakeholders to develop a planning framework comprehensive enough to include short term (e.g. landuse change), as well as longer term (e.g. climate change) scenarios. This paper presents IWRM models built using the Water Evaluation And Planning (WEAP) decision support system, for three towns in the LV region - Bukoba (Tanzania), Masaka (Uganda), and Kisii (Kenya). Each model was calibrated under current system performance based on site visits, utility reporting and interviews. Projected water supply, demand, revenues and costs were then evaluated against a combination of climate, demographic and infrastructure scenarios up to 2050. Our results show that water supply in all three towns is currently infrastructure limited; achieving existing design capacity could meet most projected demand until 2020s in Masaka beyond which new supply and conservation strategies would be needed. In Bukoba, reducing leakages would provide little performance improvement in the short-term, but doubling capacity would meet all demands until 2050. In Kisii, major infrastructure investment is urgently needed. In Masaka, streamflow simulations show that wetland sources could satisfy all demand until 2050, but at the cost of almost no water downstream of the intake. These models demonstrate the value of IWRM tools for developing water management plans that integrate hydroclimatology-driven supply to demand projections on a single platform.

  11. Victoria Symptom Validity Test performance in children and adolescents with neurological disorders.

    Science.gov (United States)

    Brooks, Brian L

    2012-12-01

    It is becoming increasingly more important to study, use, and promote the utility of measures that are designed to detect non-compliance with testing (i.e., poor effort, symptom non-validity, response bias) as part of neuropsychological assessments with children and adolescents. Several measures have evidence for use in pediatrics, but there is a paucity of published support for the Victoria Symptom Validity Test (VSVT) in this population. The purpose of this study was to examine the performance on the VSVT in a sample of pediatric patients with known neurological disorders. The sample consisted of 100 consecutively referred children and adolescents between the ages of 6 and 19 years (mean = 14.0, SD = 3.1) with various neurological diagnoses. On the VSVT total items, 95% of the sample had performance in the "valid" range, with 5% being deemed "questionable" and 0% deemed "invalid". On easy items, 97% were "valid", 2% were "questionable", and 1% was "invalid." For difficult items, 84% were "valid," 16% were "questionable," and 0% was "invalid." For those patients given two effort measures (i.e., VSVT and Test of Memory Malingering; n = 65), none was identified as having poor test-taking compliance on both measures. VSVT scores were significantly correlated with age, intelligence, processing speed, and functional ratings of daily abilities (attention, executive functioning, and adaptive functioning), but not objective performance on the measure of sustained attention, verbal memory, or visual memory. The VSVT has potential to be used in neuropsychological assessments with pediatric patients.

  12. Comparison of the Protective Efficacy of DNA and Baculovirus-Derived Protein Vaccines for EBOLA Virus in Guinea Pigs

    National Research Council Canada - National Science Library

    Mellquist-Riemenschneider, Jenny L; Garrison, Aura R; Geisbert, Joan B; Saikh, Kamal U; Heidebrink, Kelli D

    2003-01-01

    .... Previously, a priming dose of a DNA vaccine expressing the glycoprotein (GP) gene of MARV followed by boosting with recombinant baculovirus-derived GP protein was found to confer protective immunity to guinea pigs (Hevey et al., 2001...

  13. Victoria's secret ja no defineix la bellesa : evolució dels trets físics femenins en les campanyes publicitàries online del sector de la llenceria.

    OpenAIRE

    Sistaré Toldrà, Laia

    2015-01-01

    Aquest treball d'investigació analitza el trets físics de les dones que quatre marques del sector de la llenceria mostren en les fotografies de les campanyes online que publiquen als seus perfils oficials de Facebook. S'ha estudiat les característiques de les dones mostrades en les fotografies que Agent Provocateur, Dear Kate, Lane Bryant i Victoria's Secret han publicat durant els anys 2013, 2014 i 2015. Els trets físics estudiats han estat el grau de primesa, el color de la pell i l'alçada....

  14. Economic, social and resource management factors influencing groundwater trade: Evidence from Victoria, Australia

    Science.gov (United States)

    Gill, Bruce; Webb, John; Stott, Kerry; Cheng, Xiang; Wilkinson, Roger; Cossens, Brendan

    2017-07-01

    In Victoria, Australia, most groundwater resources are now fully allocated and opportunities for new groundwater development can only occur through trading of license entitlements. Groundwater usage has rarely exceeded 50% of the available licensed volume, even in the 2008/9 drought year, and 50 to 70% of individual license holders use less than 5% of their allocation each year. However, little groundwater trading is occurring at present. Interviews were conducted with groundwater license holders and water brokers to investigate why the Victorian groundwater trade market is underdeveloped. Responses show there is a complex mix of social, economic, institutional and technical reasons. Barriers to trade are influenced by the circumstances of each groundwater user, administrative process and resource management rules. Water brokers deal with few trades at low margins and noted unrealistic selling prices and administrative difficulties. Irrigators who have successfully traded identify that there are few participants in trading, technical appraisals are expensive and administrative requirements and fees are burdensome, especially when compared to surface water trading. Opportunities to facilitate trade include groundwater management plan refinement and improved information provision. Simplifying transaction processes and costs, demonstrating good resource stewardship and preventing third party impacts from trade could address some concerns raised by market participants. There are, however, numerous individual circumstances that inhibit groundwater trading, so it is unlikely that policy and process changes alone could increase usage rates without greater demand for groundwater or more favourable farming economic circumstances.

  15. Patient characteristics associated with hospitalisations for ambulatory care sensitive conditions in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Ansari Zahid

    2012-12-01

    Full Text Available Abstract Background Ambulatory Care Sensitive Conditions (ACSCs are those for which hospitalisation is thought to be avoidable with the application of preventive care and early disease management, usually delivered in a primary care setting. ACSCs are used extensively as indicators of accessibility and effectiveness of primary health care. We examined the association between patient characteristics and hospitalisation for ACSCs in the adult and paediatric population in Victoria, Australia, 2003/04. Methods Hospital admissions data were merged with two area-level socioeconomic indexes: Index of Socio-Economic Disadvantage (IRSED and Accessibility/Remoteness Index of Australia (ARIA. Univariate and multiple logistic regressions were performed for both adult (age 18+ years and paediatric (age Results Predictors were much more strongly associated with ACSCs admissions compared to non-ACSCs admissions in the adult group than for the paediatric group with the exception of rurality. Significant adjusted ORs in the adult group were 1.06, 1.15, 1.13, 1.06 and 1.11 for sex, rurality, age, IRSED and ARIA variables, and 1.34, 1.04 and 1.09 in the paediatric group for rurality, IRSED and ARIA, respectively. Conclusions Disadvantaged paediatric and adult population experience more need of hospital care for ACSCs. Access barriers to primary care are plausible causes for the observed disparities. Understanding the characteristics of individuals experiencing access barriers to primary care will be useful for developing targeted interventions meeting the unique ambulatory needs of the population.

  16. The master potter and the rejected pots: eugenic legislation in Victoria, 1918-1939.

    Science.gov (United States)

    Jones, R L

    1999-01-01

    In the period since Carol Bacchi introduced eugenics into Australian historiography in 1980, much has been written that has increased our understanding of the role eugenics played in the development of Australian society in the first half of this century. It is now generally recognised that eugenics developed after the first world war from a relatively simplistic scientific justification of racist and class-biased social Darwinism into a movement concerned with using environmental reforms to help a wide range of Australians reach their full potential. In the interwar years the reform eugenicists (as they have been named) were active in a wide range of environmental movements including health reforms, slum clearance and educational improvements. The corollary of reform eugenics was based on the belief that heredity was an impassable obstacle for some: mental deficients were not considered to be racially 'fit' or 'efficient' enough to benefit from the reforms. Whilst this side of reform eugenics is well known in other countries (sterilisation programmes in Germany, the United States and Scandinavia being examples), it is yet to receive much attention so far in the discussion about Australia in the interwar years. This article argues that the attempt of a group of influential reform eugenicists in Victoria in the interwar years to institute legislation aimed at denying a significant proportion of the population the most basic rights of citizenship (including the right to reproduce) redresses the imbalance in our understanding of reform eugenics in the interwar years.

  17. DISSOLVED OXYGEN MODELLING USING ARTIFICIAL NEURAL NETWORK: A CASE OF RIVER NZOIA, LAKE VICTORIA BASIN, KENYA

    Directory of Open Access Journals (Sweden)

    Edwin Kimutai Kanda

    2016-11-01

    Full Text Available River Nzoia in Kenya, due to its role in transporting industrial and municipal wastes in addition to agricultural runoff to Lake Victoria, is vulnerable to pollution. Dissolved oxygen is one of the most important indicators of water pollution. Artificial neural network (ANN has gained popularity in water quality forecasting. This study aimed at assessing the ability of ANN to predict dissolved oxygen using four input variables of temperature, turbidity, pH and electrical conductivity. Multilayer perceptron network architecture was used in this study. The data consisted of 113 monthly values for the input variables and output variable from 2009–2013 which were split into training and testing datasets. The results obtained during training and testing were satisfactory with R2 varying from 0.79 to 0.94 and RMSE values ranging from 0.34 to 0.64 mg/l which imply that ANN can be used as a monitoring tool in the prediction of dissolved oxygen for River Nzoia considering the non-correlational relationship of the input and output variables. The dissolved oxygen values follow seasonal trend with low values during dry periods.

  18. Some antarctic lacustrine sediments from northern Victoria Land investigation by Moessbauer spectroscopy, INNA and XRD

    International Nuclear Information System (INIS)

    Stievano, L.; Bertelle, M.; Leotta, G.; Calogero, S.; Constantinescu, S.; Oddone, M.

    1999-01-01

    Fifteen lacustrine sediments, sampled during the 1994-1995 Austral summer in Northern Victoria Land (Antarctica), were characterised by 57 Fe Moessbauer spectroscopy, instrumental neutron activation analysis and X-ray diffraction. These sediments are related to the intrusive rocks from Granite Harbour, to the metamorphic rocks of the Complex of Wilson Terrane and the volcanic rocks from Mc Murdo. The samples contain quartz, alkaline feldspars, plagioclases, amphiboles, biotite, chlorite and muscovite except for the sediments of volcanic origin that contain alkaline feldspars, plagioclases and pyroxenes. The paramagnetic components of the Moessbauer spectra were assigned mainly to the iron sides in biotites except for those displayed from the sediments of volcanic origin assigned mainly to pyroxenes. Moessbauer spectra at room temperature do not display magnetic ordering except for those of the sediments of volcanic origin containing bulk magnetite, hematite and goethite. Moessbauer spectra collected at the liquid helium temperature always exhibit magnetic ordering. This spectral difference has been attributed to the different dimensions of the iron oxide particles in the sediments. The scarce weathering involves a partial transformation of magnetite in hematite and goethite in the sediment of volcanic origin. In the remaining sediments a partial hydrolysis of biotite together with a partial oxidation of iron (II) retained in silicates is present. (authors)

  19. The incidence and burden of hospital-treated sports-related injury in people aged 15+ years in Victoria, Australia, 2004-2010: a future epidemic of osteoarthritis?

    Science.gov (United States)

    Finch, C F; Kemp, J L; Clapperton, A J

    2015-07-01

    Previous sports injury is a known risk factor for subsequent osteoarthritis (OA), but population-based rates of sports injury are unknown. The aims of this study were to: (1) describe the trends in the population incidence and burden of all hospital-treated sports injury in Victoria, Australia in adults aged 15+ years; (2) determine the incidence of lower limb and knee injuries; and (3) quantify their population health burden as average direct hospital costs per injury and lengths of stay. Health sector data relating to adults aged 15+ years, for 2004-2010 inclusive, was extracted from the Victorian Admitted Episodes Dataset (VAED) and Victorian Emergency Minimum Dataset (VEMD). Data relating to sports injuries were identified using activity codes in each dataset Trends in injury frequency and rates were determined, and economic burden was calculated. The overall annual rate of hospital treated sports injuries increased by 24% (P = 0.001), and lower limb injuries by 26% (P = 0.001) over the 7 years. The associated accumulated economic burden was $265 million for all sports injuries and $110 million for lower limb injuries over the 7-years. The findings of this study show a significant increase in sports injuries in the state of Victoria, Australia over a 7-year period. As previous sports injury is a risk factor for the development of OA, the future incidence of OA will escalate, placing an even greater burden on health care systems. Population-wide preventative strategies that reduce the risk of sports injury are urgently required in order to reduce the future burden of OA. Copyright © 2015 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  20. Spartial and seasonal variations in concentrations of polycyclic aromatic hydrocarbons in water and sediment of Kisumu City bay of Winam Gulf, Lake Victoria-Kenya.

    Science.gov (United States)

    Kwach, Bowa O; Lalah, Joseph O; Shem, Wandiga O

    2009-11-01

    Seasonal and offshore concentration variations for selected sixteen priority pollutant polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water of Car Wash and Kisat areas of Winam Gulf, Lake Victoria, have been investigated. PAHs concentrations in sediments and water range from 0.4 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively. Statistical analysis of the PAHs concentrations showed that the most contaminated samples are found during rainy season (April, 2006), 5 m offshore for sediments and 10 m offshore for water. Dry season (October, 2005) generally recorded lower concentrations. The variations showed significant difference (p < or = 0.05) with season and distance of sampling from the shore.

  1. HIV-1 transmission networks in high risk fishing communities on the shores of Lake Victoria in Uganda: A phylogenetic and epidemiological approach.

    Directory of Open Access Journals (Sweden)

    Sylvia Kiwuwa-Muyingo

    Full Text Available Fishing communities around Lake Victoria in sub-Saharan Africa have been characterised as a population at high risk of HIV-infection.Using data from a cohort of HIV-positive individuals aged 13-49 years, enrolled from 5 fishing communities on Lake Victoria between 2009-2011, we sought to identify factors contributing to the epidemic and to understand the underlying structure of HIV transmission networks. Clinical and socio-demographic data were combined with HIV-1 phylogenetic analyses. HIV-1 gag-p24 and env-gp-41 sub-genomic fragments were amplified and sequenced from 283 HIV-1-infected participants. Phylogenetic clusters with ≥2 highly related sequences were defined as transmission clusters. Logistic regression models were used to determine factors associated with clustering.Altogether, 24% (n = 67/283 of HIV positive individuals with sequences fell within 34 phylogenetically distinct clusters in at least one gene region (either gag or env. Of these, 83% occurred either within households or within community; 8/34 (24% occurred within household partnerships, and 20/34 (59% within community. 7/12 couples (58% within households clustered together. Individuals in clusters with potential recent transmission (11/34 were more likely to be younger 71% (15/21 versus 46% (21/46 in un-clustered individuals and had recently become resident in the community 67% (14/21 vs 48% (22/46. Four of 11 (36% potential transmission clusters included incident-incident transmissions. Independently, clustering was less likely in HIV subtype D (adjusted Odds Ratio, aOR = 0.51 [95% CI 0.26-1.00] than A and more likely in those living with an HIV-infected individual in the household (aOR = 6.30 [95% CI 3.40-11.68].A large proportion of HIV sexual transmissions occur within house-holds and within communities even in this key mobile population. The findings suggest localized HIV transmissions and hence a potential benefit for the test and treat approach even at a community

  2. Linking Land Use Changes to Surface Water Quality Variability in Lake Victoria: Some Insights From Remote Sensing (GC41B-1101)

    Science.gov (United States)

    Limaye, Ashutosh; Mugo, Robinson; Wanjohi, James; Farah, Hussein; Wahome, Anastasia; Flores, Africa; Irwin, Dan

    2016-01-01

    Various land use changes driven by urbanization, conversion of grasslands and woodlands into farmlands, intensification of agricultural practices, deforestation, land fragmentation and degradation are taking place in Africa. In Kenya, agriculture is the main driver of land use conversions. The impacts of these land use changes are observable in land cover maps, and eventually in the hydrological systems. Reduction or change of natural vegetation cover types increases the speed of surface runoff and reduces water and nutrient retention capacities. This can lead to high nutrient inputs into lakes, resulting in eutrophication, siltation and infestation of floating aquatic vegetation. To assess if changes in land use could be contributing to increased phytoplankton blooms and sediment loads into Lake Victoria, we analyzed land use land cover data from Landsat, as well as surface chlorophyll-a and total suspended matter from MODIS-Aqua sensor.

  3. Clima social escolar y déficit de atención en estudiantes de primer grado de secundaria de una I.E. de la Victoria, Lima , 2016

    OpenAIRE

    Cuadros Huamán, Lelis Milagros

    2016-01-01

    La presente investigación tuvo como objetivo general, determinar la relación entre el clima social escolar y el déficit de atención en los estudiantes de primer grado de secundaria en la Institución Educativa Isabel La Católica, distrito de La Victoria - 2016, la población es de 150 estudiantes, el muestreo es no probabilístico, el tamaño de la muestra fue de 150 estudiantes, en los cuales se han empleado la variable: Clima social escolar y déficit de atención. El método emp...

  4. Origins of igneous microgranular enclaves in granites: the example of Central Victoria, Australia

    Science.gov (United States)

    Clemens, J. D.; Elburg, M. A.; Harris, C.

    2017-10-01

    To investigate their genesis and relations with their host rocks, we study igneous microgranular enclaves (IMEs) in the c. 370 Ma, post-orogenic, high-level, felsic plutons and volcanic rocks of Central Victoria, Australia. The IMEs are thermally quenched magma globules but are not autoliths, and they do not form mixing series with their host magmas. These IMEs generally represent hybrids between mantle-derived magmas and very high- T crust-derived melts, modified by fractionation, ingestion of host-derived crystals and, to a lesser extent, by chemical interactions with their hosts. Isotopic and elemental evidence suggests that their likely mafic progenitors formed by partial melting of subcontinental mantle, but that the IME suites from different felsic host bodies did not share a common initial composition. We infer that melts of heterogeneous mantle underwent high- T hybridisation with melts from a variety of crustal rocks, which led to a high degree of primary variability in the IME magmas. Our model for the formation of the Central Victorian IMEs is likely to be applicable to other occurrences, especially in suites of postorogenic granitic magmas emplaced in the shallow crust. However, there are many different origins for the mingled magma globules that we call IMEs, and different phenomena seem to occur in differing tectonic settings. The complexity of IME formation means that it is difficult to unravel the petrogenesis of these products of chaotic magma processes. Nevertheless, the survival of fine-grained, non-equilibrium mineralogy and texture in the IMEs suggests that their tenure in the host magmas must have been geologically brief.

  5. La victoria de Décimo Junio Bruto sobre los galaicos y la retirada de Emilio Lépido de Pallantia: algunas consideraciones sobre su cronología

    OpenAIRE

    San Vicente González de Aspuru, José Ignacio

    2013-01-01

    El trabajo propone una revisión cronológica de una serle de hechos relacionados con la campaña de Lépido contra Pallantia: la victoria de Décimo Bruto sobre los galaicos; el sitio de Pallantia por Lépido y Bruto; la entrega de Mancino a los numantinos y el abandono del cerco, que Adolf Schulten fechó el 1 de abril del año 136 a. C.El articulo adelanta la cronología tradicional en un año y, siguiendo la teoría de Schulten de que los pallantinos se retiraron por un eclipse lunar, plantea que el...

  6. Abstracts to be Delivered at the 2014 Annual Conference of the Association of Medical Microbiology and Infectious Disease Canada, April 3 to 5, Victoria, British Columbia, Alphabetized According to the Surname of the First Author. Full-text Abstracts Can be Accessed at www.pulsus.com

    Directory of Open Access Journals (Sweden)

    2014-01-01

    Full Text Available This document presents the titles of the abstracts to be presented at the 2014 Annual Conference of the Association of Medical Microbiology and Infectious Disease Canada (April 3 to 5, Victoria, British Columbia. The full-text abstracts are available online.

  7. Nd-Sr isotopic and geochemical systematics in Cambrian boninites and tholeiites from Victoria, Australia

    Science.gov (United States)

    Nelson, D. R.; Crawford, A. J.; McCulloch, M. T.

    1984-11-01

    Rocks with boninitic affinities have been recognised in a number of “ophiolites”, including the Cambrian Heathcote and Mt Wellington Greenstone Belts of Victoria. Boninites and high-Mg andesites from the Heathcote Greenstone Belt show a restricted range of initial ɛ Nd values of between +3.3 to +5.8. Extremely refractory boninites from the Mt Wellington Greenstone Belt have ɛ Nd ranging from +1.3 to -9. Ti/Zr is positively correlated with Sm/Nd with the Heathcote lavas generally possessing greater depletion of Ti and enrichment of Zr relative to the middle and heavy REE with increasing LREE/HREE. These data are consistent with the generation of boninites by partial melting of refractory peridotite following invasion by LREE- and Zr-enriched, low ɛ Nd fluids. Tholeiites overlying the boninites in both greenstone belts have flat REE patterns and ɛ Nd˜+5, lower than that anticipated for lavas derived from depleted MORB source reservoirs in the Cambrian, suggesting that their source was also contaminated by a LREE-enriched, low ɛ Nd component similar to that involved in the generation of the Howqua boninites. The added components have characteristics compatible with their derivation from subducted altered oceanic crust and/or from wet subducted sediments. The identification of boninites and other low-Ti lavas in the Victorian greenstone belts is strong evidence for island arc development in southeastern Australia during the Lower Cambrian and provides further support for a subduction-related origin for many ophiolites.

  8. 'A problem shared is a problem halved': success of a statewide collaborative approach to fetal therapy. Outcomes of fetoscopic laser photocoagulation for twin-twin transfusion syndrome in Victoria.

    Science.gov (United States)

    Teoh, Mark; Walker, Sue; Cole, Stephen; Edwards, Andrew

    2013-04-01

    To evaluate the performance of a collaborative fetal therapy service for treatment for twin-twin transfusion syndrome (TTTS). The Victorian Fetal Therapy Service (VFTS) was developed in 2006. It is a state-based three-centre collaborative service comprising a surgical team and clinical leadership group, designed to optimise access to, and performance of, fetoscopic procedures in Victoria. This is a prospective cohort study of VFTS patients referred for fetoscopic laser photocoagulation (FLP) for TTTS since 2006. Forty-nine consecutive women with advanced (stage 2-4) TTTS between 2006 and 2011 were included in this study. Overall survival was 67 of 98 (68%), and survival of ≥1 twin was seen in 42 of 49 pregnancies (86%). There was no difference in survival by disease stage at diagnosis (≥1 survivor: 66% (stage 2 or 3 TTTS) vs 77% (stage 4 TTTS), P = 0.44), nor by surgical era (≥1 survivor: 60% (2006-2008) vs 74% of cases (2009-2011), P = 0.21). The median gestation gained post-FLP was 10.5 weeks. These results are consistent with published series and confirm the success of a novel service delivery model for fetal therapy in Victoria. We suggest that collaborative models such as ours should be considered for fetal conditions where treatment is complex and the total number of cases is small to ensure a consistent approach to assessment, management and follow-up of patients and to optimise training and research opportunities. © 2013 The Authors ANZJOG © 2013 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.

  9. Validation of the Filovirus Plaque Assay for Use in Preclinical Studies

    Directory of Open Access Journals (Sweden)

    Amy C. Shurtleff

    2016-04-01

    Full Text Available A plaque assay for quantitating filoviruses in virus stocks, prepared viral challenge inocula and samples from research animals has recently been fully characterized and standardized for use across multiple institutions performing Biosafety Level 4 (BSL-4 studies. After standardization studies were completed, Good Laboratory Practices (GLP-compliant plaque assay method validation studies to demonstrate suitability for reliable and reproducible measurement of the Marburg Virus Angola (MARV variant and Ebola Virus Kikwit (EBOV variant commenced at the United States Army Medical Research Institute of Infectious Diseases (USAMRIID. The validation parameters tested included accuracy, precision, linearity, robustness, stability of the virus stocks and system suitability. The MARV and EBOV assays were confirmed to be accurate to ±0.5 log10 PFU/mL. Repeatability precision, intermediate precision and reproducibility precision were sufficient to return viral titers with a coefficient of variation (%CV of ≤30%, deemed acceptable variation for a cell-based bioassay. Intraclass correlation statistical techniques for the evaluation of the assay’s precision when the same plaques were quantitated by two analysts returned values passing the acceptance criteria, indicating high agreement between analysts. The assay was shown to be accurate and specific when run on Nonhuman Primates (NHP serum and plasma samples diluted in plaque assay medium, with negligible matrix effects. Virus stocks demonstrated stability for freeze-thaw cycles typical of normal usage during assay retests. The results demonstrated that the EBOV and MARV plaque assays are accurate, precise and robust for filovirus titration in samples associated with the performance of GLP animal model studies.

  10. Distinct patterns of IFITM-mediated restriction of filoviruses, SARS coronavirus, and influenza A virus.

    Directory of Open Access Journals (Sweden)

    I-Chueh Huang

    2011-01-01

    Full Text Available Interferon-inducible transmembrane proteins 1, 2, and 3 (IFITM1, 2, and 3 are recently identified viral restriction factors that inhibit infection mediated by the influenza A virus (IAV hemagglutinin (HA protein. Here we show that IFITM proteins restricted infection mediated by the entry glycoproteins (GP(1,2 of Marburg and Ebola filoviruses (MARV, EBOV. Consistent with these observations, interferon-β specifically restricted filovirus and IAV entry processes. IFITM proteins also inhibited replication of infectious MARV and EBOV. We observed distinct patterns of IFITM-mediated restriction: compared with IAV, the entry processes of MARV and EBOV were less restricted by IFITM3, but more restricted by IFITM1. Moreover, murine Ifitm5 and 6 did not restrict IAV, but efficiently inhibited filovirus entry. We further demonstrate that replication of infectious SARS coronavirus (SARS-CoV and entry mediated by the SARS-CoV spike (S protein are restricted by IFITM proteins. The profile of IFITM-mediated restriction of SARS-CoV was more similar to that of filoviruses than to IAV. Trypsin treatment of receptor-associated SARS-CoV pseudovirions, which bypasses their dependence on lysosomal cathepsin L, also bypassed IFITM-mediated restriction. However, IFITM proteins did not reduce cellular cathepsin activity or limit access of virions to acidic intracellular compartments. Our data indicate that IFITM-mediated restriction is localized to a late stage in the endocytic pathway. They further show that IFITM proteins differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression.

  11. Selection of electrogenic bacteria for microbial fuel cell in removing Victoria blue R from wastewater.

    Science.gov (United States)

    Chen, Chih-Yu; Tsai, Teh-Hua; Wu, Pei-Ssu; Tsao, Shuo-En; Huang, Yu-Shan; Chung, Ying-Chien

    2018-01-28

    This study was conducted to select electrogenic bacteria from wastewater sludge. Phylogenetic analysis revealed that Proteobacteria was the dominant phylum in the microbial fuel cell (MFC) during the decomposition process of organic pollutants. Five culturable bacteria strains - namely, Bacillus subtilis, Flavobacterium sp., Aeromonas hydrophila, Citrobacter freundii, and Stenotrophomonas sp. - have a double potential in dye removal and electricity generation. We inoculated the mixed electrogenic bacteria at a specific ratio and treated them with a triphenylmethane dye, Victoria blue R (VBR), to evaluate their electricity generation ability for the artificial and real wastewater. The results of the VBR shock-loading experiment indicated that the inoculated MFC could adapt to shock loading in 1-2 days and exhibited high removal efficiency (95-100%) for 100-800 mg L -1 VBR with a power density of 8.62 ± 0.10 to 34.81 ± 0.25 mW m -2 . The selected electrogenic bacteria in the MFC could use VBR as only electron donor for power generation. The matrix effects of the real wastewater on VBR removal and electricity generation of MFC were insignificant. VBR degradation by the electrogenic bacteria involves a stepwise demethylation process to yield partially dealkylated VBR species. In addition, these results demonstrate the feasibility of inoculating culturable bacteria strains to develop an efficient MFC for purifying wastewater.

  12. Fast food restaurant locations according to socioeconomic disadvantage, urban-regional locality, and schools within Victoria, Australia.

    Science.gov (United States)

    Thornton, Lukar E; Lamb, Karen E; Ball, Kylie

    2016-12-01

    Features of the built environment provide opportunities to engage in both healthy and unhealthy behaviours. Access to a high number of fast food restaurants may encourage greater consumption of fast food products. The distribution of fast food restaurants at a state-level has not previously been reported in Australia. Using the location of 537 fast food restaurants from four major chains (McDonald׳s, KFC, Hungry Jacks, and Red Rooster), this study examined fast food restaurant locations across the state of Victoria relative to area-level disadvantage, urban-regional locality (classified as Major Cities, Inner Regional, or Outer Regional), and around schools. Findings revealed greater locational access to fast food restaurants in more socioeconomically disadvantaged areas (compared to areas with lower levels of disadvantage), nearby to secondary schools (compared to primary schools), and nearby to primary and secondary schools within the most disadvantaged areas of the major city region (compared to primary and secondary schools in areas with lower levels of disadvantage). Adjusted models showed no significant difference in location according to urban-regional locality. Knowledge of the distribution of fast food restaurants in Australia will assist local authorities to target potential policy mechanisms, such as planning regulations, where they are most needed.

  13. Identifying Water Insecurity Hotspots in the Lake Victoria Basin of Eastern Africa

    Science.gov (United States)

    Pricope, N. G.; Shukla, S.; Linard, C.; Gaughan, A.

    2014-12-01

    The Lake Victoria Basin (LVB), one of Africa's most populated transboundary watersheds and home to more than 30 million inhabitants, is increasingly challenged by both water quality problems and water quantity shortages against a backdrop of climate variability and change; and other environmental challenges. As a result of pollution, droughts, more erratic rainfall, heightened demand for water for both consumption and agricultural needs as well as differences in water allocation among the riverine countries of Uganda, Tanzania, Kenya, Rwanda and Burundi, many parts of this region are already experiencing water scarcity on a recurrent basis. Furthermore, given projected annual population growth rates of 2.5 to 3.5% for the next 20 years, water shortages are likely to be exacerbated in the future. Analyzing historical changes in the water resources of this region is hence important to identify "hot spots" that might be most sensitive to future changes in climate and demography. In this presentation, we report the findings of a comprehensive analysis performed to (i) examine changes in water resources of LVB in recent decades and (ii) identify overlap between regions of significant changes in water resources with land cover changes and high population centers that are also projected to grow the fastest over the coming decades. We first utilize several satellite, stations and model(s) based climatic and hydrologic datasets to assess changes in water resources in this region. We then use a quality-controlled Moderate Resolution Imaging Spectroradiometer (MODIS) land cover product to identify areas of significant land cover changes. Simultaneously we use projections of gridded population density based on differential growth rates for rural and urban population to estimate fastest projected human population growth for 2030 and 2050 relative to 2010 data. Using the outcomes of these change analysis we identify water insecurity hotspots in the LVB.

  14. Complete mitochondrial DNA sequences of the Victoria tilapia (Oreochromis variabilis) and Redbelly Tilapia (Tilapia zilli): genome characterization and phylogeny analysis.

    Science.gov (United States)

    Kinaro, Zachary Omambia; Xue, Liangyi; Volatiana, Josies Ancella

    2016-07-01

    The Cichlid fishes have played an important role in evolutionary biology, population studies and aquaculture industry with East African species representing a model suited for studying adaptive radiation and speciation for cichlid genome projects in which closely related genomes are fast emerging presenting questions on phenotype-genotype relations. The complete mitochondrial genomes presented here are for two closely related but eco-morphologically distinct Lake Victoria basin cichlids, Oreochromis variabilis, an endangered native species and Tilapia zilli, an invasive species, both of which are important economic fishes in local areas. The complete mitochondrial genomes determined for O. variabilis and T. zilli are 16 626 and 16,619 bp, respectively. Both the mitogenomes contain 13 protein-coding genes, 22 tRNAs, 2 rRNAs and a non-coding control region, which are typical of vertebrate mitogenomes. Phylogenetic analyses of the two species revealed that though both lie within family Cichlidae, they are remotely related.

  15. An isotopic study of nitrate pollution of groundwater in Victoria, Australia

    International Nuclear Information System (INIS)

    Changkakoti, A.; Lawrence, C.R.; Cherstnova, L.; Chalk, P.; Krouse, H.R.

    1997-01-01

    Nitrate in groundwater can be a hard to human and animal health and contribute to the development of algal blooms and subsequent eutrophication of wetlands. Its presence is widespread throughout Australia and its levels overall appear to be increasing. A variety of sources of nitrate contamination of groundwater are known. These include nitrogen fixing plants, termites, animal wastes, industrial wastes, domestic wastes, sewage and fertilizers. In Victoria, nitrate-rich groundwaters have been reported from a number of localities, some of which include Colac, Nepean Peninsula, Shepparton, Deer Park, Benalla and Winchelsea. A multi-isotope method was developed to determine the probable source of pollution in these localities. Changes in the natural abundance ratio of the stable isotopes of nitrogen, 14 N and 15 N, and the differences in the isotopic ratios ( 15 N/ 14 N) of nitrate from various sources, form the basis of the N-isotope technique for source identification. Differences in the isotopic ratios of oxygen ( 18 O/ 16 O) and hydrogen (D/H) of polluted and unpolluted waters form the basis for the oxygen and hydrogen isotope technique to investigate pollution problems of groundwater. Sites which included clover, industrial wastes, animal and human wastes and fertilized sources, were selected after reviewing existing databases on nitrate concentration, earlier reports and access to a suitable network of bores for collecting reliable samples. The nitrate concentration ranged from less than 1 mg/L to in excess of 22.0 mg/L, whilst ammonium levels in most samples were less than 1 mg/L. The δ 15 N values of the various source types ranged from 8.8 to 19.0 per mill (pastures). The δ 18 O and δD data indicate seawater incursion in the coastal areas of the Nepean Peninsular. The results agree with published data on similar sources from elsewhere in the world, and indicate the potential use of this methodology in groundwater pollution studies in Australia

  16. Quality of care achievements of the Prostate Cancer Outcomes Registry-Victoria.

    Science.gov (United States)

    Sampurno, Fanny; Earnest, Arul; Kumari, Patabendi B; Millar, Jeremy L; Davis, Ian D; Murphy, Declan G; Frydenberg, Mark; Kearns, Paul A; Evans, Sue M

    2016-05-02

    To analyse the performance of the quality of prostate cancer (CaP) care over a 5-year period with reference to three quality indicators (QIs) reported by the Prostate Cancer Outcomes Registry-Victoria (PCOR-Vic):QI-1: Alignment with the modified Prostate Cancer Research International Active Surveillance (PRIAS) protocol guideline;QI-2: Timeliness of CaP care for men with high risk and locally advanced disease;QI-3: Positive surgical margins (PSMs) for organ-confined pathological T2 disease. Between 1 January 2009 and 31 December 2013, 4708 men diagnosed with CaP who met the QI-1, QI-2 or QI-3 inclusion criteria were recruited from Victorian hospitals.Outcome measures and statistical analysis: Trend analysis was conducted to monitor performance according to QI-1, QI-2 and QI-3. We used the autoregressive integrated moving average (ARIMA) model to account for any inherent autocorrelation in the data when analysing the monthly incidence of each indicator. Differences in the annual figures for the indicators across years were also analysed by aggregating data by year and applying the ARIMA model. There was a downward trend over the 5 years in the percentage of men with low risk disease who underwent active treatment (45% to 34%; P = 0.024), an upward trend in the percentage of those with high risk and locally advanced disease who received active treatment within 12 months of diagnosis (88% to 93%; P = 0.181), and a decline in PSM rate in men with pathological T2 disease after radical prostatectomy (21% to 12%; P = 0.036). Limitations of the study include the fact that the improvement in the QIs was detected using PCOR-Vic as a single population, but there may be institutional variations in quality improvement. Over 2009-2013, the performance of the Victorian health system improved according to the three processes of care indicators reported by the PCOR-Vic.

  17. Waterparks are high risk for cryptosporidiosis: A case-control study in Victoria, 2015.

    Science.gov (United States)

    de Gooyer, Tanyth E; Gregory, Joy; Easton, Marion; Stephens, Nicola; Fearnley, Emily; Kirk, Martyn

    2017-06-30

    An increase in notifications of cryptosporidiosis was observed in Victoria between March and April 2015. Cases mostly resided in one metropolitan region and hypothesis-generating interviews identified common exposures to aquatic facilities. We conducted a case-control study to determine exposure source(s) and facilitate control measures. Laboratory-confirmed cases of cryptosporidiosis from the region of interest notified between 1 March and 23 April 2015 were included. Controls residing in the same region were recruited from participants in a population health survey and frequency matched (2 per case) by age group. Details of exposure to potential risk factors were collected using a standardised telephone questionnaire for the 14-days prior to illness for cases, and an analogous exposure period for controls. Univariable and multivariable logistic regression were used to determine risk factors associated with illness using STATA SE 13.1. Thirty cases and 66 controls were included in the study. Half the cases were less than 12 years of age and 62% were female. Illness was most strongly associated with recreational water exposure at any waterpark (adjusted odds ratio (aOR)=73.5; 95% confidence interval (CI):6.74-802), and specifically at Victorian waterparks (aOR=45.6; 95% CI:5.20-399). Cases were linked with attendance at either a waterpark in the region or an adjacent region. As a result of this investigation, hyperchlorination was completed at identified facilities and swim hygiene information distributed. This study reinforces the potential for recreational water facilities, particularly waterparks, to act as a transmission source of Cryptosporidium infections. Continued communication to patrons is required to ensure healthy swimming practice in Victorian aquatic facilities.

  18. Regional geology mapping using satellite-based remote sensing approach in Northern Victoria Land, Antarctica

    Science.gov (United States)

    Pour, Amin Beiranvand; Park, Yongcheol; Park, Tae-Yoon S.; Hong, Jong Kuk; Hashim, Mazlan; Woo, Jusun; Ayoobi, Iman

    2018-06-01

    Satellite remote sensing imagery is especially useful for geological investigations in Antarctica because of its remoteness and extreme environmental conditions that constrain direct geological survey. The highest percentage of exposed rocks and soils in Antarctica occurs in Northern Victoria Land (NVL). Exposed Rocks in NVL were part of the paleo-Pacific margin of East Gondwana during the Paleozoic time. This investigation provides a satellite-based remote sensing approach for regional geological mapping in the NVL, Antarctica. Landsat-8 and the Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) datasets were used to extract lithological-structural and mineralogical information. Several spectral-band ratio indices were developed using Landsat-8 and ASTER bands and proposed for Antarctic environments to map spectral signatures of snow/ice, iron oxide/hydroxide minerals, Al-OH-bearing and Fe, Mg-OH and CO3 mineral zones, and quartz-rich felsic and mafic-to-ultramafic lithological units. The spectral-band ratio indices were tested and implemented to Level 1 terrain-corrected (L1T) products of Landsat-8 and ASTER datasets covering the NVL. The surface distribution of the mineral assemblages was mapped using the spectral-band ratio indices and verified by geological expeditions and laboratory analysis. Resultant image maps derived from spectral-band ratio indices that developed in this study are fairly accurate and correspond well with existing geological maps of the NVL. The spectral-band ratio indices developed in this study are especially useful for geological investigations in inaccessible locations and poorly exposed lithological units in Antarctica environments.

  19. Autoestima y agresividad en estudiantes de quinto grado de educación primaria de la institución educativa estatal "Pedro Adolfo Labarthe", distrito La Victoria, UGEL 03 San Miguel 2015.

    OpenAIRE

    Pariona Martínez, Magaly

    2015-01-01

    Este estudio responde al objeto determinar si existe relación significativa de la autoestima con la agresividad en estudiantes de quinto grado de educación primaria de la Institución Educativa estatal “Pedro Adolfo Labarthe”, distrito la Victoria, UGEL 03 San Miguel, 2015. El interés de la presente investigación es establecer la relación entre los factores emocionales – particularmente la autoestima- y la agresividad en estudiantes de quinto grado de educación primaria, describir cómo ha sido...

  20. Residual stress characterization of a fabrication weld from the VICTORIA-Class submarine pressure hull: revealing the unseen

    International Nuclear Information System (INIS)

    McGregor, R.J.; Rogge, R.B.

    2010-01-01

    Explicit understanding of the residual-stress character of primary submarine pressure hull weldments will improve the fidelity of numerical analysis and experimentation supporting operational envelope and design life. A length of circumferential-seam closure weld was contained within a section of hull plate removed from the HMCS VICTORIA during the extended docking work period (EDWP) refit operations. This has provided a rare opportunity for detailed characterization of the as-received condition of this common weld-type from original vessel assembly. In collaboration with the Canadian Neutron Beam Centre of the National Research Council (NRC), a program was conducted to study this weld using neutron diffraction. Neutron diffraction is able to survey nondestructively through the section thickness, providing a three-dimensional characterization, while leaving the specimen intact for complementary study by other methods. Results indicate tensile stress peaks of up to 80% of the base-material yield stress. Understanding the three-dimensional behaviour of residual stress in this type of weld provides a valuable resource to the numerical modelling community. The results can also support fatigue and fracture experimental work and serve to confirm and improve the interpretation of the existing body of 'surface-only' work conducted on similar welds. (author)

  1. Barriers and facilitators to childhood obesity prevention among culturally and linguistically diverse (CALD) communities in Victoria, Australia.

    Science.gov (United States)

    Cyril, Sheila; Nicholson, Jan M; Agho, Kingsley; Polonsky, Michael; Renzaho, Andre M

    2017-06-01

    Childhood obesity is rising among culturally and linguistically diverse (CALD) groups who show poor engagement in obesity prevention initiatives. We examined the barriers and facilitators to the engagement of CALD communities in obesity prevention initiatives. We used the nominal group technique to collect data from 39 participants from Vietnamese, Burmese, African, Afghani and Indian origins living in disadvantaged areas of Victoria, Australia. Data analysis revealed ranked priorities for barriers and facilitators for CALD community engagement in obesity prevention initiatives. CALD parents identified key barriers as being: competing priorities in the post-migration settlement phase; language, cultural and program accessibility barriers; low levels of food and health literacy; junk food advertisement targeting children; and lack of mandatory weight checks for schoolchildren. Key facilitators emerged as: bicultural playgroup leaders; ethnic community groups; and school-based healthy lunch box initiatives. This study has identified several policy recommendations including: the implementation of robust food taxation policies; consistent control of food advertising targeting children; improving CALD health literacy using bicultural workers; and matching health promotional materials with CALD community literacy levels. Implications for Public Health: These recommendations can directly influence public health policy to improve the engagement of CALD communities in obesity prevention services and ultimately reduce the widening obesity disparities in Australia. © 2017 The Authors.

  2. Public values for integration in natural disaster management and planning: A case study from Victoria, Australia.

    Science.gov (United States)

    Rawluk, Andrea; Ford, Rebecca M; Neolaka, Fendi L; Williams, Kathryn J

    2017-01-01

    Values can be useful for identifying what is important to individuals and communities, yet there is currently not a coherent way to conceptualize, identify, and organize the breadth of values that can be affected by a natural disaster. This research proposes a conceptual framework for how to conceptualize, identify, and organize values, and proposes a concrete, tangible value called the valued entity. The framework is applied in two studies of bushfire in Victoria, Australia: 112 submissions from individuals to the 2009 Victorian Bushfires Royal Commission and interviews with 30 members of the public in bushfire risk landscapes. Our findings suggest that: what people value ranges from abstract to concrete; prevalent abstract values include benevolence and universalism; prevalent mid-level valued attributes include natural attributes of landscapes and human life and welfare; prevalent valued entities are people and properties close to the person. Comparison between the two studies suggests people with more recent experience with bushfire refer less to the importance of natural places and natural attributes. The conceptual framework can act as a boundary object to facilitate researchers and policy-makers understanding the breadth of values affected by natural disaster events and management actions and how governance can better consider values at different scales. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  3. Fast food restaurant locations according to socioeconomic disadvantage, urban–regional locality, and schools within Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Lukar E. Thornton

    2016-12-01

    Full Text Available Features of the built environment provide opportunities to engage in both healthy and unhealthy behaviours. Access to a high number of fast food restaurants may encourage greater consumption of fast food products. The distribution of fast food restaurants at a state-level has not previously been reported in Australia. Using the location of 537 fast food restaurants from four major chains (McDonald׳s, KFC, Hungry Jacks, and Red Rooster, this study examined fast food restaurant locations across the state of Victoria relative to area-level disadvantage, urban–regional locality (classified as Major Cities, Inner Regional, or Outer Regional, and around schools. Findings revealed greater locational access to fast food restaurants in more socioeconomically disadvantaged areas (compared to areas with lower levels of disadvantage, nearby to secondary schools (compared to primary schools, and nearby to primary and secondary schools within the most disadvantaged areas of the major city region (compared to primary and secondary schools in areas with lower levels of disadvantage. Adjusted models showed no significant difference in location according to urban–regional locality. Knowledge of the distribution of fast food restaurants in Australia will assist local authorities to target potential policy mechanisms, such as planning regulations, where they are most needed. Keywords: Australia, Fast food, Socioeconomic inequalities, Urbanicity, Schools, Land-use planning

  4. Marburg haemorrhagic fever: recent advances | AdegborO | African ...

    African Journals Online (AJOL)

    With the exception of a vaccine for yellow fever and ribavirin, which is used for treatment of some arenaviral infections, no specific chemotherapy for viral hemorrhagic fever exists. Only supportive treatment is possible The filoviruses, Marburg virus (MARV) and Ebola virus (EBOV), have been associated with hemorrhagic ...

  5. Infección por Campylobacter y Shigella como causa de Diarrea Aguda Infecciosa en niños menores de dos años en el Distrito de la Victoria, Lima-Perú

    Directory of Open Access Journals (Sweden)

    María Perales D

    2002-10-01

    Full Text Available Objetivo: Determinar la frecuencia de Campylobacter y Shigella como agentes etiológicos en diarrea aguda acuosa en niños menores de dos años atendidos en 4 centros de salud del distrito de La Victoria (Lima, Perú Materiales y métodos: en este estudio transversal analítico se realizaron coprocultivos bajo técnica microbiológica estándar a los niños menores de dos años con diarrea aguda acuosa atendidos en 4 centros de salud de La Victoria entre abril y octubre de 2001. Fueron excluidos aquellos niños con disentería y aquellos que habían recibido tratamiento antibiótico previo a la atención. Resultados: se estudiaron un total de 248 casos, de los cuales 48 (19,4% coprocultivos fueron positivos: 33 (13.3% a Campylobacter, 12 (4,8% a Shigella y 3 (1,2% a Salmonella. No se identificaron otros patógenos. Las especies de Shigella identificadas fueron: Shigella flexneri en 9 (75,0% casos y Shigella sonnei en 3 (25,0% La única especie de Campylobacter identificada fue Campylobacter jejuni siendo el biotipo I el más frecuente (84,6% Conclusiones: Campylobacter y Shigella juegan un importante papel como agentes etiológicos causantes de diarrea aguda acuosa en niños menores de dos años.

  6. Dimerization Controls Marburg Virus VP24-dependent Modulation of Host Antioxidative Stress Responses

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Britney; Li, Jing; Adhikari, Jagat; Edwards, Megan R.; Zhang, Hao; Schwarz, Toni; Leung, Daisy W.; Basler, Christopher F.; Gross, Michael L.; Amarasinghe, Gaya K.

    2016-08-04

    Marburg virus (MARV), a member of the Filoviridae family that also includes Ebola virus (EBOV), causes lethal hemorrhagic fever with case fatality rates that have exceeded 50% in some outbreaks. Within an infected cell, there are numerous host-viral interactions that contribute to the outcome of infection. Recent studies identified MARV protein 24 (mVP24) as a modulator of the host antioxidative responses, but the molecular mechanism remains unclear. Using a combination of biochemical and mass spectrometry studies, we show that mVP24 is a dimer in solution that directly binds to the Kelch domain of Kelch-like ECH-associated protein 1 (Keap1) to regulate nuclear factor (erythroid-derived 2)-like 2 (Nrf2). This interaction between Keap1 and mVP24 occurs through the Kelch interaction loop (K-Loop) of mVP24 leading to upregulation of antioxidant response element transcription, which is distinct from other Kelch binders that regulate Nrf2 activity. N-terminal truncations disrupt mVP24 dimerization, allowing monomeric mVP24 to bind Kelch with higher affinity and stimulate higher antioxidative stress response element (ARE) reporter activity. Mass spectrometry-based mapping of the interface revealed overlapping binding sites on Kelch for mVP24 and the Nrf2 proteins. Substitution of conserved cysteines, C209 and C210, to alanine in the mVP24 K-Loop abrogates Kelch binding and ARE activation. Our studies identify a shift in the monomer-dimer equilibrium of MARV VP24, driven by its interaction with Keap1 Kelch domain, as a critical determinant that modulates host responses to pathogenic Marburg viral infections.

  7. Influence of voluntary standards and design modifications on trampoline injury in Victoria, Australia.

    Science.gov (United States)

    Ashby, Karen; Eager, David; D'Elia, Angelo; Day, Lesley

    2015-10-01

    To examine the influence of the voluntary Australian trampoline standard (AS 4989-2006) and market-driven design modifications on relevant trampoline injuries. Trend and intervention analysis on frequencies and proportions of hospital-treated trampoline-related injury in Victoria, Australia, extracted from the Victorian Emergency Minimum Dataset from 1 July 1999 to 30 June 2013. The injuries relevant to the AS were contact with spring and frame, and multiple-user injury. Falls from trampolines were relevant for netted trampolines, a market-driven modification. Frequency of all trampoline injuries increased by 11.4% (95% CI 10.0% to 11.7%) on average each year. Spring and frame, and fall injuries increased to a lesser extent (8.7%, 95% CI 6.9% to 9.8% and 7.3%, 95% CI 5.8% to 8.3%, respectively). Multiple-user injuries increased by 21.0% (95% CI 16.3% to 21.9%). As a proportion of all trampoline injuries, spring and frame injury and falls injury decreased, while multiple-user injuries increased. The intervention analysis showed no significant change in spring and frame injuries associated with the AS (p=0.17). A significant increase was found for multiple-user injuries (p=0.01), in particular for the 0-year to 4-year age group (ptrampolines appear to be associated with a decrease in falls from trampolines but an increase in injuries to multiple users. A mandated trampoline safety standard and a safety campaign including warnings about multiple users is recommended. Continued monitoring of injury data will be required. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  8. Chemodenitrification in the cryoecosystem of Lake Vida, Victoria Valley, Antarctica.

    Science.gov (United States)

    Ostrom, N E; Gandhi, H; Trubl, G; Murray, A E

    2016-11-01

    Lake Vida, in the Victoria Valley of East Antarctica, is frozen, yet harbors liquid brine (~20% salt, >6 times seawater) intercalated in the ice below 16 m. The brine has been isolated from the surface for several thousand years. The brine conditions (permanently dark, -13.4 °C, lack of O 2 , and pH of 6.2) and geochemistry are highly unusual. For example, nitrous oxide (N 2 O) is present at a concentration among the highest reported for an aquatic environment. Only a minor 17 O anomaly was observed in N 2 O, indicating that this gas was predominantly formed in the lake. In contrast, the 17 O anomaly in nitrate (NO3-) in Lake Vida brine indicates that approximately half or more of the NO3- present is derived from atmospheric deposition. Lake Vida brine was incubated in the presence of 15 N-enriched substrates for 40 days. We did not detect microbial nitrification, dissimilatory reduction of NO3- to ammonium (NH4+), anaerobic ammonium oxidation, or denitrification of N 2 O under the conditions tested. In the presence of 15 N-enriched nitrite (NO2-), both N 2 and N 2 O exhibited substantial 15 N enrichments; however, isotopic enrichment declined with time, which is unexpected. Additions of 15 N-NO2- alone and in the presence of HgCl 2 and ZnCl 2 to aged brine at -13 °C resulted in linear increases in the δ 15 N of N 2 O with time. As HgCl 2 and ZnCl 2 are effective biocides, we interpret N 2 O production in the aged brine to be the result of chemodenitrification. With this understanding, we interpret our results from the field incubations as the result of chemodenitrification stimulated by the addition of 15 N-enriched NO2- and ZnCl 2 and determined rates of N 2 O and N 2 production of 4.11-41.18 and 0.55-1.75 nmol L -1  day -1 , respectively. If these rates are representative of natural production, the current concentration of N 2 O in Lake Vida could have been reached between 6 and 465 years. Thus, chemodenitrification alone is sufficient to explain the

  9. THE HUMAN OCCUPATIONS OF EL MIRÓN CAVE (RAMALES DE LA VICTORIA, CANTABRIA, SPAIN DURING THE LAST GLACIAL MAXIMUM/SOLUTREAN PERIOD

    Directory of Open Access Journals (Sweden)

    Lawrence Guy Straus

    2013-11-01

    Full Text Available El Mirón Cave (Ramales de la Victoria, Cantabria, Spain has evidence of brief visits (by hunting parties to the montane zone of the upper Asón valley in easternmost Cantabria during the Last Glacial Maximum with 14C dates ranging between 19.2-18.4 kya uncal BP. Landscapes were largely treeless (scattered pines, with varying degrees of humidity and some amelioration at the end of the sequence of seven levels. Armed with a variety of Solutrean foliate, concave base and shouldered stone points and antler sagaies, decorated with beads of shell, tooth, bone and stone, the visitors camped repeatedly at the rear of the cave vestibule, made informal hearths, hunted red deer and ibex and caught fish, and did some stone knapping of both local and high-quality non-local raw materials. This is one of relatively few montane Solutrean sites known in the Cantabrian region, where, in fact, all major Solutrean base camps are in the coastal zone.La cueva del Mirón (Ramales de la Victoria, Cantabria, España conserva el testimonio de breves visitas de grupos de cazadores al alto valle del Asón, en la zona más oriental de Cantabria, durante el Último Máximo Glacial, con fechas de radiocarbono que oscilan entre los 19200 y 18400 uncal BP. Durante este tiempo, el paisaje carecía casi por completo de árboles (acaso pinos dispersos, con diversos grados de humedad y una leve mejora climática al final de la secuencia de los siete niveles solutrenses. Armados con una variedad de puntas foliáceas, puntas de base cóncava y de muesca, azagayas de asta, y adornados con cuentas de concha, diente, hueso e incluso piedra, los visitantes acamparon repetidas veces al fondo del vestíbulo de la cueva, hicieron varias hogueras ocasionales, cazaron ciervos y cabras, pescaron salmones y realizaron actividades de talla con materias primas locales y con otras no locales de alta calidad. Este yacimiento es uno de los pocos yacimientos solutrenses de la región cant

  10. Coverage of the Test of Memory Malingering, Victoria Symptom Validity Test, and Word Memory Test on the Internet: is test security threatened?

    Science.gov (United States)

    Bauer, Lyndsey; McCaffrey, Robert J

    2006-01-01

    In forensic neuropsychological settings, maintaining test security has become critically important, especially in regard to symptom validity tests (SVTs). Coaching, which can entail providing patients or litigants with information about the cognitive sequelae of head injury, or teaching them test-taking strategies to avoid detection of symptom dissimulation has been examined experimentally in many research studies. Emerging evidence supports that coaching strategies affect psychological and neuropsychological test performance to differing degrees depending on the coaching paradigm and the tests administered. The present study sought to examine Internet coverage of SVTs because it is potentially another source of coaching, or information that is readily available. Google searches were performed on the Test of Memory Malingering, the Victoria Symptom Validity Test, and the Word Memory Test. Results indicated that there is a variable amount of information available about each test that could threaten test security and validity should inappropriately interested parties find it. Steps that could be taken to improve this situation and limitations to this exploration are discussed.

  11. Mini-FLOTAC and Kato-Katz: helminth eggs watching on the shore of Lake Victoria.

    Science.gov (United States)

    Barda, Beatrice; Zepherine, Henry; Rinaldi, Laura; Cringoli, Giuseppe; Burioni, Roberto; Clementi, Massimo; Albonico, Marco

    2013-07-31

    One of the challenges for monitoring helminth control programmes based on preventive chemotherapy is the lack of a copro-parasitological gold-standard method that combines good sensitivity with quantitative performance, low cost, and easy-to-learn technique.The aim of our study was to evaluate and compare, the WHO recommended quantitative diagnostic technique (Kato-Katz) and the Mini-FLOTAC. Mini-FLOTAC is an innovative method based on floatation of helminths eggs with two different solutions (FS2 and FS7) using a close system (Fill-FLOTAC) with 5% fixative. Kato-Katz was performed following WHO recommendation. The study was carried out in a rural part of Tanzania, close to Lake Victoria, where the laboratory facilities are fairly scarce, and the basic technique used in the local laboratory (direct smear) was taken as reference standard. 201 children were screened for intestinal helminths and 91% of them were found to be positive. The agreement among the three techniques was calculated with k Cohen coefficient and was fairly good (k = 0.4), although the Mini-FLOTAC results were more sensitive for hookworm (98%) with FS2, and for S.mansoni (90%) with FS7 followed by Kato-Katz (91% and 60% respectively) and direct smear (30% and 10% respectively). A good agreement was found between Mini-FLOTAC and Kato-Katz (k = 0.81) with FS7 (k = 0.76) for hookworm diagnosis and a fairly good one for S.mansoni diagnosis (k = 0.5). For both infections we had a poor agreement between the two quantitative techniques and the direct smear (kMcMaster) and in different settings where other soil-transmitted helminths are also endemic.

  12. Travel Destinations and Sexual Behavior as Indicators of Antibiotic Resistant Shigella Strains--Victoria, Australia.

    Science.gov (United States)

    Lane, Courtney R; Sutton, Brett; Valcanis, Mary; Kirk, Martyn; Walker, Cathryn; Lalor, Karin; Stephens, Nicola

    2016-03-15

    Knowledge of relationships between antibiotic susceptibility of Shigella isolates and travel destination or other risk factors can assist clinicians in determining appropriate antibiotic therapy prior to susceptibility testing. We describe relationships between resistance patterns and risk factors for acquisition in Shigella isolates using routinely collected data for notified cases of shigellosis between 2008 and 2012 in Victoria, Australia. We included all shigellosis patients notified during the study period, where Shigella isolates were tested for antimicrobial sensitivity using Clinical and Laboratory Standards Institute breakpoints. Cases were interviewed to collect data on risk factors, including recent travel. Data were analyzed using Stata 13.1 to examine associations between risk factors and resistant strains. Of the 500 cases of shigellosis, 249 were associated with overseas travel and 210 were locally acquired. Forty-six of 51 isolates of Indian origin displayed decreased susceptibility or resistance to ciprofloxacin. All isolates of Indonesian origin were susceptible to ciprofloxacin. Twenty-six travel-related isolates were resistant to all tested oral antimicrobials. Male-to-male sexual contact was the primary risk factor for 80% (120/150) of locally acquired infections among adult males, characterized by distinct periodic Shigella sonnei outbreaks. Clinicians should consider travel destination as a marker for resistance to common antimicrobials in returning travelers, where severe disease requires empirical treatment prior to receipt of individual sensitivity testing results. Repeated outbreaks of locally acquired shigellosis among men who have sex with men highlight the importance of prevention and control measures in this high-risk group. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.

  13. Nota biobibliográfica + poética + creaciones («Fantasia», «Per a prendre mesures», «Constel·lació de la fam», «Ora pro nobis», «Línia quasi eròtica» y «Beatus ille» + cuestionario (Victoria Pineda

    Directory of Open Access Journals (Sweden)

    Josep Sou

    2014-03-01

    Full Text Available Nota biobibliográfica + poética + creaciones («Fantasia», «Per a prendre mesures», «Constel·lació de la fam», «Ora pro nobis», «Línia quasi eròtica» y «Beatus ille» + cuestionario (Victoria Pineda

  14. High concentrations of polycyclic aromatic hydrocarbons found in water and sediments of car wash and Kisat areas of Winam Gulf, Lake Victoria-Kenya.

    Science.gov (United States)

    Kwach, B O; Lalah, J O

    2009-11-01

    Mean concentrations of selected USEPA priority polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water samples from Car Wash and Kisat areas of Winam Gulf, Lake Victoria in Kenya have been determined using GC-FID and GC-MS. Sampling was done during the rainy season in April 2006. The PAH concentrations in sediment and water ranged from 0.04 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively, depending upon the sampling location. The total concentration levels of PAHs in both the sediment and water phase in this study were found to be much higher compared with those reported from other regions worldwide, revealing significant PAH pollution of Car Wash and Kisat areas of Kisumu city bay as a consequent of anthropogenic activities as described in the text. The GC-detected PAHs were confirmed by GC-MS.

  15. Public reaction to Victoria's "2 Fruit 'n' 5 Veg Every Day" campaign and reported consumption of fruit and vegetables.

    Science.gov (United States)

    Dixon, H; Borland, R; Segan, C; Stafford, H; Sindall, C

    1998-01-01

    The Victorian "2 Fruit 'n' 5 Veg Every Day" campaign was aimed at increasing awareness of the need to eat more fruit and vegetables and encouraging increased consumption of these foods in the Australian state of Victoria. The demand-side component of the campaign, which had television advertising as a centerpiece, ran from 1992 to 1995. Annual postcampaign telephone surveys of approximately 500 Victorians ages 20 and over were conducted with the aim of examining public awareness of the campaign, beliefs about desirable eating habits for fruit and vegetables, and reported consumption of these foods. Over the years, patterns in the level of public awareness, reported consumption, and beliefs about appropriate levels of consumption have tended to parallel changes in the level of mass media investment. During the campaign's most intense period of promotional activity, significant increases in all of these variables occurred. The results suggest that significant achievements can be made with relatively small-budget mass media promotion of dietary recommendations, especially when part of a more comprehensive program. However, campaigns may need to be adequately resourced for several years if sustained change is to be achieved.

  16. Service utilisation and costs of language impairment in children: The early language in Victoria Australian population-based study.

    Science.gov (United States)

    Le, Ha N D; Gold, Lisa; Mensah, Fiona; Eadie, Patricia; Bavin, Edith L; Bretherton, Lesley; Reilly, Sheena

    2017-08-01

    To examine (1) the patterns of service use and costs associated with language impairment in a community cohort of children from ages 4-9 years and (2) the relationship between language impairment and health service utilisation. Participants were children and caregivers of six local government areas in Melbourne participating in the community-based Early Language in Victoria Study (ELVS). Health service use was reported by parents. Costs were valued in Australian dollars in 2014, from the government and family perspectives. Depending on age, the Australian adapted Clinical Evaluation of Language Fundamentals - Pre-school, 2nd Edition (CELF-P2) or the CELF, 4th Edition (CELF4) was used to assess expressive and receptive language. At 5, 7 and 9 years respectively 21%, 11% and 8% of families reported using services for speech and/or language concerns. The annual costs associated with using services averaged A$612 (A$255 to government, A$357 to family) at 5 years and A$992 (A$317 to government, A$675 to family) at 7 years. Children with persistent language impairment had significantly higher service costs than those with typical language. Language impairment in 4-9-year-old children is associated with higher use of services and costs to both families and government compared to typical language.

  17. Pharmaceuticals and Personal Care Products in Municipal Wastewater and the Marine Receiving Environment Near Victoria Canada

    Directory of Open Access Journals (Sweden)

    Jeremy Krogh

    2017-12-01

    Full Text Available Concerns over the fate of pharmaceuticals and personal care products (PPCP within the environment have been growing with the advent of more precise analytical methods. The discharge of municipal wastewater has been identified as a significant source of these contaminants, particularly where wastewater treatment is minimal. Here we present results from a comprehensive monitoring regime located around Victoria, BC, Canada. Samples were collected between 2009 and 2016 from a variety of sources including marine water, sediment and biota adjacent to two major untreated sewage outfalls, as well as the sewage itself. PPCP concentrations within the untreated sewage were high, and the sediment surrounding the outfalls showed corresponding contamination. However, this contamination dropped quickly with distance from the outfall such that by 800 m distance most PPCPs were below detection limits. Tissue samples of resident Northern Horse mussels (Modiolus modiolus collected adjacent to one of the major sewage outfalls showed high single sample concentrations of the antimicrobial triclosan (317 ng g−1 dry weight, the antibiotic ciprofloxacin (176 ng g−1 dry weight, as well as the antidepressant sertraline (84.1 ng g−1 dry weight. Reference stations from around the region showed very low concentrations of contamination with almost all PPCP concentrations being below detection limits. Within the sewage, concentrations were largely stable overtime, with the exception of triclosan and triclocarban which both showed declines over the study period.

  18. Environmental monitoring near the Macaulay Point and Clover Point marine sewage outfalls at Victoria, British Columbia in 1989 and 1990. Regional data report No. DR 92-14

    Energy Technology Data Exchange (ETDEWEB)

    Colodey, A G; Salmon, R A; Lim, P G

    1992-01-01

    The marine environment surrounding the Capital Region district (CRD) of British Columbia that includes the City of Victoria has been monitored by municipal, provincial, and federal authorities over the past 20 years to determine the impact of wastewater discharges. This report presents data from limited sampling conducted near the main CRD deep-water outfalls at Clover and Macaulay Points, the Canadian Department of National Defence septic tank outfall off Belmont and Esquimault Lagoon, and reference locations on Constance Bank and Discovery Island. Samples for this study were collected in April and October 1989, and April 1990. Parameters investigated were sediment and biota trace metals, sediment particle size, sediment volatile residues, visual descriptions of sediment, bacterial counts, water conductivity, temperature, salinity, and dissolved oxygen.

  19. A retrospective assessment of gold mining in the Reedy Creek sub-catchment, northeast Victoria, Australia: residual mercury contamination 100 years later

    International Nuclear Information System (INIS)

    Churchill, R.C.; Meathrel, C.E.; Suter, P.J.

    2004-01-01

    The mining of gold can lead to toxic metals such as mercury (Hg) contaminating watercourses as by-products. The Reedy Creek sub-catchment, in northeast Victoria, Australia, was mined for gold in the 1850s. In 1998, samples were taken from six watercourses to measure any remaining toxic metal contamination in sediments and surface waters from two creeks with no previous gold mining (controls) and four that were mined. Although mean concentrations of Hg (measured using an ICP-OES) in sediments were below worldwide background levels, individual sites along Reedy Creek had slightly elevated Hg concentrations. In contrast, the Hg concentrations in the surface waters were above background levels. Temporal fluxes of very high Hg concentrations in the surface waters during periods of first flow and flood events revealed that Hg concentrations in the surface waters may, at certain times of the year, exceed all Australian and New Zealand Environment and Conservation Council (National Water Quality Management Strategy. Australian Water Quality Guidelines for Fresh and Marine Waters, ANZECC, 2000) guidelines for water use and the protection of the aquatic ecosystem

  20. Detection of lipid-induced structural changes of the Marburg virus matrix protein VP40 using hydrogen/deuterium exchange-mass spectrometry.

    Science.gov (United States)

    Wijesinghe, Kaveesha J; Urata, Sarah; Bhattarai, Nisha; Kooijman, Edgar E; Gerstman, Bernard S; Chapagain, Prem P; Li, Sheng; Stahelin, Robert V

    2017-04-14

    Marburg virus (MARV) is a lipid-enveloped virus from the Filoviridae family containing a negative sense RNA genome. One of the seven MARV genes encodes the matrix protein VP40, which forms a matrix layer beneath the plasma membrane inner leaflet to facilitate budding from the host cell. MARV VP40 (mVP40) has been shown to be a dimeric peripheral protein with a broad and flat basic surface that can associate with anionic phospholipids such as phosphatidylserine. Although a number of mVP40 cationic residues have been shown to facilitate binding to membranes containing anionic lipids, much less is known on how mVP40 assembles to form the matrix layer following membrane binding. Here we have used hydrogen/deuterium exchange (HDX) mass spectrometry to determine the solvent accessibility of mVP40 residues in the absence and presence of phosphatidylserine and phosphatidylinositol 4,5-bisphosphate. HDX analysis demonstrates that two basic loops in the mVP40 C-terminal domain make important contributions to anionic membrane binding and also reveals a potential oligomerization interface in the C-terminal domain as well as a conserved oligomerization interface in the mVP40 N-terminal domain. Lipid binding assays confirm the role of the two basic patches elucidated with HD/X measurements, whereas molecular dynamics simulations and membrane insertion measurements complement these studies to demonstrate that mVP40 does not appreciably insert into the hydrocarbon region of anionic membranes in contrast to the matrix protein from Ebola virus. Taken together, we propose a model by which association of the mVP40 dimer with the anionic plasma membrane facilitates assembly of mVP40 oligomers. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  1. Evasion of the Interferon-Mediated Antiviral Response by Filoviruses

    Directory of Open Access Journals (Sweden)

    Washington B. Cárdenas

    2010-01-01

    Full Text Available The members of the filoviruses are recognized as some of the most lethal viruses affecting human and non-human primates. The only two genera of the Filoviridae family, Marburg virus (MARV and Ebola virus (EBOV, comprise the main etiologic agents of severe hemorrhagic fever outbreaks in central Africa, with case fatality rates ranging from 25 to 90%. Fatal outcomes have been associated with a late and dysregulated immune response to infection, very likely due to the virus targeting key host immune cells, such as macrophages and dendritic cells (DCs that are necessary to mediate effective innate and adaptive immune responses. Despite major progress in the development of vaccine candidates for filovirus infections, a licensed vaccine or therapy for human use is still not available. During the last ten years, important progress has been made in understanding the molecular mechanisms of filovirus pathogenesis. Several lines of evidence implicate the impairment of the host interferon (IFN antiviral innate immune response by MARV or EBOV as an important determinant of virulence. In vitro and in vivo experimental infections with recombinant Zaire Ebola virus (ZEBOV, the best characterized filovirus, demonstrated that the viral protein VP35 plays a key role in inhibiting the production of IFN-α/β. Further, the action of VP35 is synergized by the inhibition of cellular responses to IFN-α/β by the minor matrix viral protein VP24. The dual action of these viral proteins may contribute to an efficient initial virus replication and dissemination in the host. Noticeably, the analogous function of these viral proteins in MARV has not been reported. Because the IFN response is a major component of the innate immune response to virus infection, this chapter reviews recent findings on the molecular mechanisms of IFN-mediated antiviral evasion by filovirus infection.

  2. Social determinants and lifestyle risk factors only partially explain the higher prevalence of food insecurity among Aboriginal and Torres Strait Islanders in the Australian state of Victoria: a cross-sectional study

    Science.gov (United States)

    2014-01-01

    Background The prevalence of food insecurity is substantially higher among Australians of Aboriginal or Torres Strait Islander descent. The purpose of this study is to explain the relationship between food insecurity and Aboriginal and Torres Islander status in the state of Victoria. Methods Data were obtained from the 2008 Victorian Population Health Survey; a cross-sectional landline computer-assisted telephone interview survey of 34,168 randomly selected Victorians aged 18 years and older; including 339 Aboriginal and Torres Strait Islanders. We categorised a respondent as food insecure, if in the previous 12 months, they reported having run out of food and not being able to afford to buy more. We used multivariable logistic regression to adjust for age, sex, socioeconomic status (household income), lifestyle risk factors (smoking, alcohol consumption and obesity), social support (ability to get help from family, friends or neighbours), household composition (lone parent status, household with a child, and household size), and geographic location (rurality). Results Aboriginal and Torres Strait Islanders (20.3%) were more likely than their non-Aboriginal and Torres Strait Islander counterparts (5.4%) to have experienced food insecurity; odds ratio (OR) = 4.5 (95% CI; 2.7-7.4). Controlling for age, SES, smoking, obesity and inability to get help from family or friends reduced the odds ratio by 38%; ORadjusted = 2.8 (1.6-5.0). Conclusions Social determinants and lifestyle risk factors only partially explained the higher prevalence of food insecurity among Aboriginal and Torres Strait Islanders in Victoria. Further research is needed to explain the disparity in food insecurity between the two populations in order to inform and guide corrective action. PMID:24924598

  3. Parental knowledge, beliefs and behaviours for oral health of toddlers residing in rural Victoria.

    Science.gov (United States)

    Gussy, M G; Waters, E B; Riggs, E M; Lo, S K; Kilpatrick, N M

    2008-03-01

    Little is known about the oral health of children under the age of four years. The determinants of early childhood caries (ECC) in this young age group are also not well understood despite a growing recognition that early interventions may deliver the greatest benefits. The aim of this study was to examine the oral health-related knowledge, attitudes and reported behaviours of parents of children aged 12-24 months living in rural areas of Victoria, Australia. A robust theoretical model was utilized to identify oral health-related behaviours and their antecedent and reinforcing conditions within the context of this specific population group. Two hundred and ninety-four parent/child dyads were recruited through their maternal and child health nurses as part of a larger intervention trial. Parents completed a self-report questionnaire. Knowledge regarding risk and protective factors amongst parents was variable and sometimes at odds with contemporary evidence. Knowledge of the role of early infection with S. mutans was very low, with high levels of behaviours that may promote early transmission reported. Tooth cleaning was reported by most parents at least sometimes, however a large proportion lacked confidence and this was significantly related to the frequency of the cleaning. Parents were confused about the fluoride status of their water supplies. Most parents believed fluoride toothpaste reduced the risk of ECC but did not know whether it should be used with toddlers. The results of this study have implications for efforts to prevent dental decay in this very young age group. Health care professionals other than dentists need support to provide information and promote confidence with regard to optimal fluoride exposure. Attention should also be given to the contribution of early contact with particular bacteria in oral health education and promotion programmes.

  4. The role of thermogenesis in the pollination biology of the Amazon waterlily Victoria amazonica.

    Science.gov (United States)

    Seymour, Roger S; Matthews, Philip G D

    2006-12-01

    Several families of tropical plants have thermogenic flowers that show a 2-d protogynous sequence. Most are pollinated by large beetles that remain for the entire period in the flowers, where they compete for mates and feed. Active beetles require high body temperatures that they can achieve endogenously at great energy expense or attain passively and cheaply in a warm environment. Floral heating is therefore hypothesized to be a direct energy reward to endothermic beetles, in addition to its accepted role in enhancing scent production. This study measures the pattern of floral heat production (as temperature in 20 flowers and respiration rates in five flowers) in Victoria amazonica at field sites in Guyana and correlates floral temperatures with body temperatures necessary for activity in visiting Cyclocephala hardyi beetles. Thermogenesis occurred in a bimodal pattern, with peaks associated with the arrival and departure of beetles near sunset. Peak CO(2) production rates averaged 2.9 micromol s(-1), equivalent to a heat production of 1.4 W. Heat was generated mainly in the floral chamber on the first evening and by the stamen complex on the second. Mean chamber temperature remained between 29.3 and 34.7 degrees C during the first night, when ambient temperature was 23.5-25.2 degrees C. Beetles actively competed for mates and consumed stylar processes in the floral chamber, where their mean thoracic temperature was 33.2 degrees C. At the lower ambient temperatures outside of the flower, beetles capable of sustained flight had a similar mean temperature of 32.0 degrees C. Floral heating is not only associated with attraction, but continues throughout the night when beetles are active inside the flower and increases again when they leave. Floral chamber temperatures similar to activity temperatures of actively endothermic beetles imply that thermogenesis is an energy reward.

  5. Family Presence During Resuscitation (FPDR): Observational case studies of emergency personnel in Victoria, Australia.

    Science.gov (United States)

    Porter, Joanne E; Miller, Nareeda; Giannis, Anita; Coombs, Nicole

    2017-07-01

    Family Presence During Resuscitation (FPDR), although not a new concept, remains inconsistently implemented by emergency personnel. Many larger metropolitan emergency departments (ED) have instigated a care coordinator role, however these personnel are often from a non-nursing background and have therefore limited knowledge about the clinical aspects of the resuscitation. In rural emergency departments there are simply not enough staff to allocate an independent role. A separate care coordinator role, who is assigned to care for the family and not take part in the resuscitation has been well documented as essential to the successful implementation of FPDR. One rural and one metropolitan emergency department in the state of Victoria, Australia were observed and data was collected on FPDR events. The participants consisted of resuscitation team members, including; emergency trained nurses, senior medical officers, general nurses and doctors. The participants were not told that the data would be recorded around interactions with family members or team discussions regarding family involvement in the resuscitation, following ethical approval involving limited disclosure of the aims of the study. Seventeen adult presentations (Metro n=9, Rural n=8) were included in this study and will be presented as resuscitation case studies. The key themes identified included ambiguity around resuscitation status, keeping the family informed, family isolation and inter-professional communication. During 17 adult resuscitation cases, staff were witnessed communicating with family, which was often limited and isolation resulted. Family were often uninformed or separated from their family member, however when a family liaison person was available it was found to be beneficial. This research indicated that staff could benefit from a designated family liaison role, formal policy and further education. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Petrography, geochemistry, and geochronology of the Cenozoic Cape Crossfire, Cape King, and No Ridge igneous complexes (northern Victoria Land, Antarctica)

    International Nuclear Information System (INIS)

    Rocchi, S.; Fioretti, A.M.; Cavazzini, G.

    2002-01-01

    The Meander Intrusive Group is the plutonic-subvolcanic counterpart of the McMurdo Volcanic Group, and extends along 200 km of the Ross Sea coast of Northern Victoria Land. The three largest occurrences of the Meander Intrusive Group between the Icebreaker and Borchgrevink glaciers are the Cape Crossfire, the No Ridge, and the Cape King igneous complexes. These have an area of 40-80 square km and are composed of dominant monzogabbros and monzodiorites along with minor syenites and alkali feldspar microgranites. A significant compositional gap exists between mafic and felsic facies, which show geometrical relationships varying from subhorizontal alternating layers to complex pillowing and fragmentation of the mafic into the felsic facies. Two whole rock biotite Rb-Sr internal isochrons constrain the cooling age of Cape Crossfire Igneous Complex at 31 Ma, a few million years older than No Ridge and Cape King igneous complexes. Thus, the ages of these complexes (≤ 31 Ma) are younger than the plutons and dikes (≥ 35 Ma) cropping out in the southernmost area between the Campbell and Icebreaker glaciers. (author). 28 refs., 8 figs., 3 tabs

  7. Medical review licensing outcomes in drivers with visual field loss in Victoria, Australia

    Science.gov (United States)

    Muir, Carlyn; Charlton, Judith L; Odell, Morris; Keeffe, Jill; Wood, Joanne; Bohensky, Megan; Fildes, Brian; Oxley, Jennifer; Bentley, Sharon; Rizzo, Matthew

    2017-01-01

    Background Good vision is essential for safe driving and studies have associated visual impairment with an increased crash risk. Currently, there is little information about the medical review of drivers with visual field loss. This study examines the prevalence of visual field loss among drivers referred for medical review in one Australian jurisdiction and investigates factors associated with licence outcome in this group. Methods A random sample of 10,000 (31.25 per cent) medical review cases was extracted for analysis from the Victorian licensing authority. Files were screened for the presence of six visual field-related medical conditions. Data were captured on a range of variables, including referral source, age, gender, health status, crash history and licence outcome. Prevalence analyses were univariate and descriptive. Logistic regression was used to assess factors associated with licence outcomes in the visual field loss group. Results Approximately 1.9 per cent of the 10,000 medical review cases screened had a visual field loss condition identified (n=194). Among the visual field loss group, 57.2 per cent were permitted to continue driving (conditional/unconditional licence). Primary referral sources were the police, self-referrals and general medical practitioners. Key factors associated with licence test outcomes were visual field condition, age group, crash involvement and referral to the Driver Licensing Authority’s Medical Advisors. Those who were younger had a crash involvement triggering referral and those who were referred to the Medical Advisors were more likely to have a positive licensing outcome. Conclusion The evidence base for making licensing decisions is complicated by the variable causes, patterns, progressions and measuring technologies for visual field loss. This study highlighted that the involvement of an expert medical advisory service in Victoria resulted in an increased likelihood that drivers with visual field loss will be

  8. Eestimaised rõivabrändid / Kristiina Viiron

    Index Scriptorium Estoniae

    Viiron, Kristiina, 1971-

    2011-01-01

    Tallinna Kaubamaja loovjuhi Kristina Herodes sõnul oli 2010. a. kümne eelistatud kaubamärgi hulgas viis kodumaist. Pikemalt kaubamärkidest Bastion (disainerid Merike Pääro, Monika Randloo), Bastioni noortele suunatud kaubamärgist Beself (disainer Triin Jõhve), ISC - Ilves Sportwear Company, MasCara ja Herold (disainer Marve Rull), Lenne (kunstnik Merike Hiibus), Linette

  9. Evaluating the effects of moving to a low maintenance ARD control strategy at the Victoria Junction coal tailings site

    Energy Technology Data Exchange (ETDEWEB)

    Ziemkiewicz, P.F. [Morgantown, WV (United States); Peckham, D.; Kehoe, A. [Enterprise Cape Breton Corp., Sydney, NS (Canada)

    2010-07-01

    The Victoria Junction Coal Preparation site located near Sydney, Nova Scotia has been a major source of acid rock drainage (ARD) to waterways and surrounding wetlands. A polymer cap placed on the pile in 2005 resulted in a rapid improvement in waterway and wetland health. An earlier water treatment system (WTS) remained in operation until an evaluation was conducted to determine if the WTS was needed to maintain water quality in the region. This paper described the acid base loading model used to develop a close-out plan for the WTS. A mass balance model was used to isolate and compare the effects of the WTS and the capping system. The effect of shutting down the WTS was monitored for 8 moths. The model used flow and net acidity rates to calculate loadings. Net acidity represented the mass of pure base expressed as a calcium carbonate equivalent needed to neutralize acid loads. Acidity was calculated base on pH and metal concentrations. Alkalinity was determined by titration. A comparison with analytical studies of collected water samples showed that the mass balance model underestimated the alkalinity produced at the site. Results of the study showed that the site is now a net alkalinity generator. 5 refs., 1 tab., 1 fig.

  10. Pre- and syn-Ross orogenic granitoids at Drake Head and Kartografov Island, Oates Coast, northern Victoria Land, East Antarctica

    International Nuclear Information System (INIS)

    Adams, C.J.; Roland, N.W.

    2002-01-01

    The majority of the Oates Coast, northern Victoria Land granitoids, typified by those at Drake Head and Kartografov Island (Harald Bay), are monzogranites with lesser granodiorites and minor quartz-monzodiorite and syenogranite. All are plagioclase-K-feldspar-biotite granitoids with additional muscovite, garnet and/or hornblende, and are subalkaline and peraluminous. Berg Granite typifies the early Ordovician, Granite Harbour Instrusive (GHI) suite of the Ross Orogen at the Oates Coast. Granitoids from Kartografov Island have higher amounts of Fe+Mg+Ti and an ambiguous Rb-Sr geochronology: they could be either pre-Ross Orogeny in age, or syn-Ross Orogeny and representing a lower structural level of GHI. The Drake Head granite gneiss has a fractionated leuco-granite composition similar to Berg Granite, and is intruded by granite and granodiorite. Rb-Sr ages indicate that all are Neoproterozoic, although the granite gneiss result is probably an errorchron age, reflecting its less uniform nature (granodiorite:649 ± 30 Ma, initial ratio 0.7065 +/- 6; granite gneiss: 682 ± 140 Ma, initial ratio 0.7107 ± 50). These late Neoproterozoic granitoids provide a source for distinctive detrital zircon age components in extensive early Paleozoic turbidites of Australia-New Zealand-Antarctica. (author). 24 refs., 5 figs., 1 tab

  11. ‘A token of their love’: Queen Victoria Memorials in New Zealand

    Directory of Open Access Journals (Sweden)

    Mark Stocker

    2016-06-01

    Full Text Available This article provides an overview of the four metropolitan sculptural memorials to Queen Victoria in late-colonial New Zealand, which all immediately precede the colony’s Dominion status (1907. In chronological order, they were erected in Auckland, Christchurch, Wellington, and Dunedin. While the Auckland memorial was unveiled within the Queen’s lifetime, her death in 1901 catalysed the commission of more ambitious counterparts in Wellington and Dunedin, and a degree of intercity rivalry was consciously articulated in advocacy for them. The memorials reflect a Pākeha (European New Zealand sense of identity as a loyal, pro-monarchical, and imperial colony, but also as a ‘Better Britain’, with a proud sense of prosperity and achievement. Local content features prominently in two of them, notably the signing with Māori of the Treaty of Waitangi (1840 in one of the reliefs for the capital city memorial (Wellington, and an ambitious celebration of fifty years of provincial achievement in the pedestal sculpture for the Christchurch counterpart. Due to a dearth of home-grown talent, together with the belief in the artistic superiority of Britain (often known at the time as ‘Home’, British sculptors were invariably commissioned for these memorials. Cost-effectiveness, prestige, and the ability to render a realistic likeness were all criteria behind the choice of artists, with Francis John Williamson commissioned for two of them (Auckland and Christchurch. In researching this article, extensive use has been made of primary newspaper sources to document the political context of the memorials. In all of them, particularly that of Christchurch, New Zealand’s loyalty to Britain in the South African War (1899–1902 was a leading issue. Artistic and aesthetic issues and analysis were less prominent, although there was a widespread belief that the Queen should be honoured for purely symbolic and not utilitarian causes. While emphasis is given

  12. A Record of Holocene Paleoclimate Evolution from Robertson Bay, Victoria Land, Antarctica

    Science.gov (United States)

    Riesselman, C. R.; Truax, O.; Wilson, G. S.; Parker, R. L.; Yoo, K. C.; Lee, J. I.; Levy, R. H.; Mckay, R. M.

    2017-12-01

    Regionally representative records of how Antarctica responded to the transition from the Last Glacial Maximum into the Holocene are an essential component of understanding the processes by which the Antarctic cryosphere responds to a changing climate. Here, we present a high-resolution record of Holocene Antarctic paleoclimate evolution from a previously unstudied section of the Victoria Land margin. In 2015 the Korea Polar Research Institute collected a 571 cm sediment core, GC57, from Robertson Bay, a protected embayment west of Cape Adare and adjacent to the outlet glaciers of the Transantarctic Mountains. Using diatom assemblages, bulk sediment geochemistry, and the magnetic properties of GC57, we aim to reconstruct the response of the East Antarctic Ice Sheet to warming associated with deglaciation and the Holocene climatic optima at the interface between the Ross Sea and the Southern Ocean. Our multiproxy approach allows us to study sea ice extent, seasonality, ocean stratification and circulation, and primary productivity from the mid-Holocene (7,400 14C year BP) to the present. A sea-ice associated diatom assemblage indicative of summer sea surface temperatures below 0˚C dominates the basal section of GC57. Although diatoms are well preserved, the unit is characterized by low wt% biogenic silica (average 9%) and a high concentration of magnetic minerals, indicating that biogenic production persisted despite substantial terrigenous input into the bay. A rapid transition at 4708 14C yr BP is identified by a steep increase in wt% BSi (average 13%), a decrease in magnetic minerals, and a subtle assemblage change towards sea-ice associated diatoms with slightly warmer temperature tolerances. The novel ramped pyrolosis 14C dating methodology allows us to date the carbon fixed concurrent with deposition and generate a robust age model for GC57 with an accuracy previously difficult to achieve given the uncertainties associated with dating bulk acid insoluble

  13. Indigenous Young People Transitioning from Out-of-Home Care (OOHC in Victoria, Australia: The Perspectives of Workers in Indigenous-Specific and Non-Indigenous Non-Government Services

    Directory of Open Access Journals (Sweden)

    Philip Mendes

    2016-08-01

    Full Text Available Indigenous children and young people are overrepresented in the Australian out-of-home care (OOHC system. To date, specific research has not been undertaken on workers' perspectives regarding the Indigenous-specific and non-Indigenous supports and services available to Indigenous young people exiting the system. This exploratory research involved focus group consultations with workers from seven child and family welfare agencies to examine the current support services available to Indigenous young people who are in or will be leaving out-of-home care in the State of Victoria. Findings suggest that Aboriginal Community Controlled Organisations (ACCOs play a positive role in working with non-Indigenous agencies to assist Indigenous care leavers. Participants identified some key strategies to improve outcomes, such as facilitating stronger relationships between Indigenous and non-Indigenous services, and improving the resourcing of ACCOs.

  14. Time series analysis of satellite multi-sensors imagery to study the recursive abnormal grow of floating macrophyte in the lake victoria (central Africa)

    Science.gov (United States)

    Fusilli, Lorenzo; Cavalli, Rosa Maria; Laneve, Giovanni; Pignatti, Stefano; Santilli, Giancarlo; Santini, Federico

    2010-05-01

    Remote sensing allows multi-temporal mapping and monitoring of large water bodies. The importance of remote sensing for wetland and inland water inventory and monitoring at all scales was emphasized several times by the Ramsar Convention on Wetlands and from EU projects like SALMON and ROSALMA, e.g. by (Finlayson et al., 1999) and (Lowry and Finlayson, 2004). This paper aims at assessing the capability of time series of satellite imagery to provide information suitable for enhancing the understanding of the temporal cycles shown by the macrophytes growing in order to support the monitor and management of the lake Victoria water resources. The lake Victoria coastal areas are facing a number of challenges related to water resource management which include growing population, water scarcity, climate variability and water resource degradation, invasive species, water pollution. The proliferation of invasive plants and aquatic weeds, is of growing concern. In particular, let us recall some of the problems caused by the aquatic weeds growing: Ø interference with human activities such as fishing, and boating; Ø inhibition or interference with a balanced fish population; Ø fish killing due to removal of too much oxygen from the water; Ø production of quiet water areas that are ideal for mosquito breeding. In this context, an integrated use of medium/high resolution images from sensors like MODIS, ASTER, LANDSAT/TM and whenever available CHRIS offers the possibility of creating a congruent time series allowing the analysis of the floating vegetation dynamic on an extended temporal basis. Although MODIS imagery is acquired daily, cloudiness and other sources of noise can greatly reduce the effective temporal resolution, further its spatial resolution can results not always adequate to map the extension of floating plants. Therefore, the integrated use of sensors with different spatial resolution, were used to map across seasons the evolution of the phenomena. The

  15. The patterns and trends of marketing and consumption of the fish of Lake Victoria (Kenya waters). Paper presented at FISA 95: Inaugural Congress of the Fisheries Society for Africa (FISA '95),UNEP Nairobi, Kenya, 31 July - 5th August, 1995.

    OpenAIRE

    Abila, R.

    1995-01-01

    Lake Victoria, producing over 90% of Kenya's fish, is the principle source of fish for domestic consumption and for export in the country. The three fish species of most economic importance are Lates niloticus, Rastrineobola argentea and Oreochromis species. These constitute 50%, 37% and 6% respectively of the lakes's tonnage. The structure and performance of the marketing system for each of these species differ, depending on certain market features. Among these are the marketing history and ...

  16. Dry calving processes at the ice cliff of an antarctic local glacier: the study case of Strandline Glacier (Northern Victoria Land, Antarctica)

    Science.gov (United States)

    Smiraglia, C.; Motta, M.; Vassena, G.; Diolaiuti, G.

    2003-04-01

    In Antartic coastal area, where the ice sheet and the large outlet glaciers do not reach the sea and where some rugged mountain chains are often present, many small glaciers can be found. They are the so called local or alpine type glaciers, which have their terminus ground-based such as the real alpine glaciers and rarely reach the main valley floors. They are practically isolated and independent from the supply flowing down from the plateau and their mass balance is mainly controlled by sublimation and aeolic erosion and accumulation. The glaciers closer to the coast are submitted to the melting as well, and when the terminus is cliff-shaped they are also affected by dry calving. The most known and studied Antarctic local glaciers are placed in the Dry Valleys region (Chinn, 1985), but this kind of glaciers is also diffused all along the Northern Victoria Land coastal region (Chinn and others, 1989). Since the first Italian Antarctic expedition (1985), many studies have been carried out on this type of glaciers, which can be usefull for detailed mass balance evaluations and for obtaining information about the effects of the present climatic dynamics on the Antarctic coastal environment (Baroni and Orombelli, 1987; Baroni and others, 1995; Meneghel, 1999; Vassena and others., 2001). The Strandline Glacier (74 41 S; 164 07 E), in particular is a small alpine glacier (0,79 kmq) on the coast of Terra Nova Bay, Northern Victoria Land; it is a cold glacier where accumulation and ablation basins are mainly controlled by wind processes. Its terminus forms in the central part a grounded ice cliff about 30 m high, about 130 m far from the sea. On that glacier mass balance, surface velocity and calving rate were measured. During the southern summer season 2000-2001 many topographycal profiles of the ice cliff were surveyed by using both classical topographical and glaciological methods (total station and stakes) and GPS technique. It was so possible to detect the short term

  17. Nota biobibliográfica + poética + creaciones («angel fieramente humano», «antología del bienestar», «el sueño de una nación», «La flecha del amor», «el comienzo de la soledad» y «comunicacion» + cuestionario (Victoria Pineda

    Directory of Open Access Journals (Sweden)

    Pablo del Barco

    2014-03-01

    Full Text Available Nota biobibliográfica + poética + creaciones («angel fieramente humano», «antología del bienestar», «el sueño de una nación», «La flecha del amor», «el comienzo de la soledad» y «comunicacion» + cuestionario (Victoria Pineda

  18. Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya

    Directory of Open Access Journals (Sweden)

    David Omondi

    2017-06-01

    Full Text Available Although diverse tick-borne pathogens (TBPs are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April–May; October–December of 2012–2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma, and Hyalomma tick species, ticks were pooled (≤8 individuals by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium, 9.06% Ehrlichia canis, anaplasmosis (6.32% Anaplasma ovis, 14.36% Anaplasma platys, and 3.08% Anaplasma bovis,, and rickettsiosis (6.15% Rickettsia africae, 2.22% Rickettsia aeschlimannii, 4.27% Rickettsia rhipicephali, and 4.95% Rickettsia spp., as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi, and 1.37% Babesia caballi among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7% and Amblyomma nuttalli (100

  19. Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya.

    Science.gov (United States)

    Omondi, David; Masiga, Daniel K; Fielding, Burtram C; Kariuki, Edward; Ajamma, Yvonne Ukamaka; Mwamuye, Micky M; Ouso, Daniel O; Villinger, Jandouwe

    2017-01-01

    Although diverse tick-borne pathogens (TBPs) are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April-May; October-December) of 2012-2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma , and Hyalomma tick species, ticks were pooled (≤8 individuals) by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium , 9.06% Ehrlichia canis ), anaplasmosis (6.32% Anaplasma ovis , 14.36% Anaplasma platys , and 3.08% Anaplasma bovis ,), and rickettsiosis (6.15% Rickettsia africae , 2.22% Rickettsia aeschlimannii , 4.27% Rickettsia rhipicephali , and 4.95% Rickettsia spp.), as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi , and 1.37% Babesia caballi ) among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7%) and Amblyomma nuttalli (100%) sampled

  20. Exploring Service Providers' Perspectives in Improving Childhood Obesity Prevention among CALD Communities in Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    Sheila Cyril

    Full Text Available Childhood obesity rates have been increasing disproportionately among disadvantaged communities including culturally and linguistically diverse (CALD migrant groups in Australia due to their poor participation in the available obesity prevention initiatives. We sought to explore service providers' perceptions of the key factors influencing the participation of CALD communities in the existing obesity prevention services and the service requirements needed to improve CALD communities' participation in these services.We conducted a qualitative study using focus group discussions involving fifty-nine service providers from a range of services, who are involved in the health and wellbeing of children from CALD groups living in four socioeconomically disadvantaged areas in Victoria, Australia.Thematic analysis of the data showed three major themes including community-level barriers to CALD engagement in childhood obesity prevention services; service-level barriers to the delivery of these services; and proposed changes to current childhood obesity prevention approaches. Integrating obesity prevention messages within existing programs, better coordination between prevention and treatment services and the establishment of a childhood obesity surveillance system, were some of the important changes suggested by service providers.This study has found that low CALD health literacy, lack of knowledge of cultural barriers among service providers and co-existing deficiencies in the structure and delivery of obesity prevention services negatively impacted the participation of CALD communities in obesity prevention services. Cultural competency training of service providers would improve their understanding of the cultural influences of childhood obesity and incorporate them into the design and development of obesity prevention initiatives. Service providers need to be educated on the pre-migratory health service experiences and health conditions of CALD

  1. Exploring Service Providers' Perspectives in Improving Childhood Obesity Prevention among CALD Communities in Victoria, Australia

    Science.gov (United States)

    Cyril, Sheila; Green, Julie; Nicholson, Jan M.; Agho, Kingsley; Renzaho, Andre M. N.

    2016-01-01

    Background Childhood obesity rates have been increasing disproportionately among disadvantaged communities including culturally and linguistically diverse (CALD) migrant groups in Australia due to their poor participation in the available obesity prevention initiatives. We sought to explore service providers’ perceptions of the key factors influencing the participation of CALD communities in the existing obesity prevention services and the service requirements needed to improve CALD communities’ participation in these services. Methods We conducted a qualitative study using focus group discussions involving fifty-nine service providers from a range of services, who are involved in the health and wellbeing of children from CALD groups living in four socioeconomically disadvantaged areas in Victoria, Australia. Results Thematic analysis of the data showed three major themes including community-level barriers to CALD engagement in childhood obesity prevention services; service-level barriers to the delivery of these services; and proposed changes to current childhood obesity prevention approaches. Integrating obesity prevention messages within existing programs, better coordination between prevention and treatment services and the establishment of a childhood obesity surveillance system, were some of the important changes suggested by service providers. Conclusion This study has found that low CALD health literacy, lack of knowledge of cultural barriers among service providers and co-existing deficiencies in the structure and delivery of obesity prevention services negatively impacted the participation of CALD communities in obesity prevention services. Cultural competency training of service providers would improve their understanding of the cultural influences of childhood obesity and incorporate them into the design and development of obesity prevention initiatives. Service providers need to be educated on the pre-migratory health service experiences and health

  2. Exploring Service Providers' Perspectives in Improving Childhood Obesity Prevention among CALD Communities in Victoria, Australia.

    Science.gov (United States)

    Cyril, Sheila; Green, Julie; Nicholson, Jan M; Agho, Kingsley; Renzaho, Andre M N

    2016-01-01

    Childhood obesity rates have been increasing disproportionately among disadvantaged communities including culturally and linguistically diverse (CALD) migrant groups in Australia due to their poor participation in the available obesity prevention initiatives. We sought to explore service providers' perceptions of the key factors influencing the participation of CALD communities in the existing obesity prevention services and the service requirements needed to improve CALD communities' participation in these services. We conducted a qualitative study using focus group discussions involving fifty-nine service providers from a range of services, who are involved in the health and wellbeing of children from CALD groups living in four socioeconomically disadvantaged areas in Victoria, Australia. Thematic analysis of the data showed three major themes including community-level barriers to CALD engagement in childhood obesity prevention services; service-level barriers to the delivery of these services; and proposed changes to current childhood obesity prevention approaches. Integrating obesity prevention messages within existing programs, better coordination between prevention and treatment services and the establishment of a childhood obesity surveillance system, were some of the important changes suggested by service providers. This study has found that low CALD health literacy, lack of knowledge of cultural barriers among service providers and co-existing deficiencies in the structure and delivery of obesity prevention services negatively impacted the participation of CALD communities in obesity prevention services. Cultural competency training of service providers would improve their understanding of the cultural influences of childhood obesity and incorporate them into the design and development of obesity prevention initiatives. Service providers need to be educated on the pre-migratory health service experiences and health conditions of CALD communities to ensure

  3. The Development of a Customization Framework for the WRF Model over the Lake Victoria Basin, Eastern Africa on Seasonal Timescales

    Directory of Open Access Journals (Sweden)

    R. Argent

    2015-01-01

    Full Text Available Lake Victoria, Africa, supports millions of people. To produce reliable climate projections, it is desirable to successfully model the rainfall over the lake accurately. An initial step is taken here with customization of the Weather, Research, and Forecast (WRF model. Of particular interest is an asymmetrical rainfall pattern across the lake basin, due to a diurnal land-lake breeze. The main aim is to present a customization framework for use over the lake. This framework is developed by conducting several series of model runs to investigate aspects of the customization. The runs are analyzed using Tropical Rainfall Measuring Mission rainfall data and Climatic Research Unit temperature data. The study shows that the choice of parameters and lake surface temperature initialization can significantly alter the results. Also, the optimal physics combinations for the climatology may not necessarily be suitable for all circumstances, such as extreme years. The study concludes that WRF is unable to reproduce the pattern across the lake. The temperature of the lake is too cold and this prevents the diurnal land-lake breeze reversal. Overall, this study highlights the importance of customizing a model to the region of research and presents a framework through which this may be achieved.

  4. A health-promoting community dental service in Melbourne, Victoria, Australia: protocol for the North Richmond model of oral health care.

    Science.gov (United States)

    Hall, Martin; Christian, Bradley

    2017-10-01

    Despite the best efforts and commitment of oral health programs, there is no evidence that the current surgical output-based model of oral health care is delivering better oral health outcomes to the community. In fact, Australian evidence indicates the oral health of the community could be getting worse. It is now well-understood that this traditional surgical model of oral health care will never successfully manage the disease itself. It is proposed that a health-promoting, minimally invasive oral disease management model of care may lead to a sustainable benefit to the oral health status of the individual and community groups. The aim of this paper is to describe such a model of oral health care (MoC) currently being implemented by the North Richmond Community Health Oral Health (NRCH-OH) program in Melbourne, Victoria, Australia; this model may serve as a template for other services to re-orient their healthcare delivery towards health promotion and prevention. The paper describes the guiding principles and theories for the model and also its operational components, which are: pre-engagement while on the waitlist; client engagement at the reception area; the assessment phase; oral health education (high-risk clients only); disease management; and reviews and recall.

  5. Continued dominance of pandemic A(H1N1 2009 influenza in Victoria, Australia in 2010

    Directory of Open Access Journals (Sweden)

    James E. Fielding

    2011-08-01

    Full Text Available The 2010 Victorian influenza season was characterized by normal seasonal influenza activity and the dominance of the pandemic A(H1N1 2009 strain. General Practice Sentinel Surveillance rates peaked at 9.4 ILI cases per 1000 consultations in week 36 for metropolitan practices, and at 10.5 ILI cases per 1000 in the following week for rural practices. Of the 678 ILI cases, 23% were vaccinated, a significantly higher percentage than in previous years. A significantly higher percentage of ILI patients were swabbed in 2010 compared to 2003–2008, but similar to 2009, with a similar percentage being positive for influenza as in previous years. Vaccination rates increased with patient age. Melbourne Medical Deputising Service rates peaked in week 35 at 19.1 ILI cases per 1000 consultations. Of the 1914 cases of influenza notified to the Department of Health, Victoria, 1812 (95% were influenza A infections - 1001 (55% pandemic A(H1N1 2009, 4 (<1% A(H3N2 and 807 (45% not subtyped; 88 (5% were influenza B; and 14 (< 1% were influenza A and B co-infections. The World Health Organization Collaborating Centre for Reference and Research on Influenza tested 403 isolates of which 261 were positive for influenza, 250 of which were influenza A and 11 were influenza B. Ninety-two per cent of the influenza A viruses were pandemic A(H1N1 2009, and following antigenic analysis all of these were found to be similar to the current vaccine strain. Three viruses (0.9% were found to be oseltamivir resistant due to an H275Y mutation in the neuraminidase gene.

  6. Exploring the Reproductive Decision-making Process of HIV-positive Women in County Victoria, Trinidad and Tobago

    Directory of Open Access Journals (Sweden)

    E Joseph

    2015-07-01

    Full Text Available Objective: The community-based Prevention of Mother to Child Transmission (PMTCT programme in Trinidad and Tobago offers care and support to HIV-positive (HIV+ pregnant women and their families for their lifetime. This study explored the factors influencing repeat childbearing by PMTCT enrolees. Method: In-depth qualitative interviews were conducted with purposively selected and consenting HIV+ women who enrolled in the PMTCT programme (n = 10 in County Victoria and four healthcare workers (HCWs. Transcribed interviews were analysed and coded using thematic content analysis. Results: Though women desired children and motherhood, some did not intend to conceive fearing HIV, age-related ill-health and vertical transmission. Others had not considered pregnancy and conceived through accident and partners’ disregard for the women’s HIV status, particularly if such partners were inebriated. Partners’ desire for children, especially in new relationships, led to planned pregnancies. Nine of the 10 HIV+ women did not seek family planning advice; the one that did was advised about partner infection but not risk reduction, vertical transmission or reinfection. Though HCWs supported HIV+ women’s reproductive rights, they agreed that HCWs stigmatized and discriminated against HIV+ mothers. Both parties saw the PMTCT programme as an effective programme in vastly reducing HIV transmission from mother to child. Conclusion: The PMTCT programme and family planning services should be integrated with tailored services toward HIV+ women and their partners to help them safely achieve their reproductive goals. Healthcare workers should be given training and skillsets to address stigma and discrimination against persons infected with HIV/AIDS within Trinidad and Tobago’s health workforce.

  7. Late Miocene volcanic sequences in northern Victoria Land, Antarctica: products of glaciovolcanic eruptions under different thermal regimes

    Science.gov (United States)

    Smellie, J. L.; Rocchi, S.; Armienti, P.

    2011-01-01

    Late Miocene (c. 13-5 Ma) volcanic sequences of the Hallett Volcanic Province (HVP) crop out along >250 km of western Ross Sea coast in northern Victoria Land. Eight primary volcanic and six sedimentary lithofacies have been identified, and they are organised into at least five different sequence architectures as a consequence of different combinations of eruptive and/or depositional conditions. The volcanoes were erupted in association with a Miocene glacial cover and the sequences are overwhelmingly glaciovolcanic. The commonest and most representative are products of mafic aa lava-fed deltas, a type of glaciovolcanic sequence that has not been described before. It is distinguished by (1) a subaerially emplaced relatively thin caprock of aa lavas lying on and passing down-dip into (2) a thicker association of chaotic to crudely bedded hyaloclastite breccias, water-chilled lava sheets and irregular lava masses, collectively called lobe-hyaloclastite. A second distinctive sequence type present is characterised by water-cooled lavas and associated sedimentary lithofacies (diamictite (probably glacigenic) and fluvial sands and gravels) similar to some mafic glaciovolcanic sheet-like sequences (see Smellie, Earth-Science Reviews, 74, 241-268, 2008), but including (for the first time) examples of likely sheet-like sequences with felsic compositions. Other sequence types in the HVP are minor and include tuff cones, cinder cones and a single ice-marginal lacustrine sequence. The glacial thermal regime varied from polar, characterised by sequences lacking glacial erosion, glacigenic sediments or evidence for free water, to temperate or sub-polar for sequences in which all of these features are conspicuously developed.

  8. A problem-oriented approach to understanding adaptation: lessons learnt from Alpine Shire, Victoria Australia.

    Science.gov (United States)

    Roman, Carolina

    2010-05-01

    Climate change is gaining attention as a significant strategic issue for localities that rely on their business sectors for economic viability. For businesses in the tourism sector, considerable research effort has sought to characterise the vulnerability to the likely impacts of future climate change through scenarios or ‘end-point' approaches (Kelly & Adger, 2000). Whilst useful, there are few demonstrable case studies that complement such work with a ‘start-point' approach that seeks to explore contextual vulnerability (O'Brien et al., 2007). This broader approach is inclusive of climate change as a process operating within a biophysical system and allows recognition of the complex interactions that occur in the coupled human-environmental system. A problem-oriented and interdisciplinary approach was employed at Alpine Shire, in northeast Victoria Australia, to explore the concept of contextual vulnerability and adaptability to stressors that include, but are not limited to climatic change. Using a policy sciences approach, the objective was to identify factors that influence existing vulnerabilities and that might consequently act as barriers to effective adaptation for the Shire's business community involved in the tourism sector. Analyses of results suggest that many threats, including the effects climate change, compete for the resources, strategy and direction of local tourism management bodies. Further analysis of conditioning factors revealed that many complex and interacting factors define the vulnerability and adaptive capacity of the Shire's tourism sector to the challenges of global change, which collectively have more immediate implications for policy and planning than long-term future climate change scenarios. An approximation of the common interest, i.e. enhancing capacity in business acumen amongst tourism operators, would facilitate adaptability and sustainability through the enhancement of social capital in this business community. Kelly, P

  9. Comparative analysis of the Cancer Council of Victoria and the online Commonwealth Scientific and Industrial Research Organisation FFQ.

    Science.gov (United States)

    Gardener, Samantha L; Rainey-Smith, Stephanie R; Macaulay, S Lance; Taddei, Kevin; Rembach, Alan; Maruff, Paul; Ellis, Kathryn A; Masters, Colin L; Rowe, Christopher C; Ames, David; Keogh, Jennifer B; Martins, Ralph N

    2015-11-28

    FFQ are commonly used to examine the association between diet and disease. They are the most practical method for usual dietary data collection as they are relatively inexpensive and easy to administer. In Australia, the Cancer Council of Victoria FFQ (CCVFFQ) version 2 and the online Commonwealth Scientific and Industrial Research Organisation FFQ (CSIROFFQ) are used. The aim of our study was to establish the level of agreement between nutrient intakes captured using the online CSIROFFQ and the paper-based CCVFFQ. The CCVFFQ and the online CSIROFFQ were completed by 136 healthy participants. FFQ responses were analysed to give g per d intake of a range of nutrients. Agreement between twenty-six nutrient intakes common to both FFQ was measured by a variety of methods. Nutrient intake levels that were significantly correlated between the two FFQ were carbohydrates, total fat, Na and MUFA. When assessing ranking of nutrients into quintiles, on average, 56 % of the participants (for all nutrients) were classified into the same or adjacent quintiles in both FFQ, with the highest percentage agreement for sugar. On average, 21 % of participants were grossly misclassified by three or four quintiles, with the highest percentage misclassification for fibre and Fe. Quintile agreement was similar to that reported by other studies, and we concluded that both FFQ are suitable tools for dividing participants' nutrient intake levels into high- and low-consumption groups. Use of either FFQ was not appropriate for obtaining accurate estimates of absolute nutrient intakes.

  10. Evaluating Regional Scale Deforestation in the University of Victoria Earth System Climate Model

    Science.gov (United States)

    Longobardi, P.; Montenegro, A.; Beltrami, H.; Eby, M.

    2011-12-01

    Forests play a key role in influencing the Earths climate and at the same time are affected by changing climates. At this point it is estimated that 15-30% of Earths natural forests have already been converted to pasture or cropland. With such large amounts of forest being converted to cropland and grassland, it is important to determine the climatic effects of these actions. To date, most modelling efforts towards understanding the climatic effects of deforestation have simulated global deforestation or have been based on experiments where trees were removed from large areas, i.e. the entire Amazon or all forests above 50 N. Here we use the University of Victoria Earth System Climate model which contains a fully coupled carbon cycle, to evaluate the response to deforestation of 10%, 25%, 50% and 100% of the forested areas in three latitude bands: high (above 50°N), mid (above ± 30°) and low (between ± 30°). All simulations were transient simulations, allowing for changes to atmospheric forcings following the A2 emissions scenario. High latitude deforestation lead to cooling (-.05 °C to -0.45 °C) and increase in soil carbon (0.5 to 3 x 1014 kg) for all fractions of deforestation. Due in part to the increase in soil carbon, there was a decrease in atmospheric CO2 in the 50% (-20 ppm) and 100% (-60 ppm) high-latitude deforestation simulations. Low-latitude deforestation initially produced warming in all scenarios (0.1 to 0.25 °C), although all were colder (-0.05 to -0.1 °C) than the control by the end of the simulation. Atmospheric CO2 increased in all simulations (40 to 80 ppm), as well as soil carbon (2 to 16 x 1013 kg). Mid-latitude deforestation also lead to initial warming (0.01 to 0.1 °C) followed by cooling (-0.01 to -0.1 °C). Mid latitude deforestation also produced an increase in soil carbon (2 to 10 x 1013 kg), and atmospheric CO2 (0 to 25ppm). In all three latitude bands forest dieback was observed. Results range from 7% to 37% for high

  11. One more piece in the VACV ecological puzzle: could peridomestic rodents be the link between wildlife and bovine vaccinia outbreaks in Brazil?

    Science.gov (United States)

    Abrahão, Jônatas S; Guedes, Maria Isabel M; Trindade, Giliane S; Fonseca, Flávio G; Campos, Rafael K; Mota, Bruno F; Lobato, Zélia I P; Silva-Fernandes, André T; Rodrigues, Gisele O L; Lima, Larissa S; Ferreira, Paulo C P; Bonjardim, Cláudio A; Kroon, Erna G

    2009-10-19

    Despite the fact that smallpox eradication was declared by the World Health Organization (WHO) in 1980, other poxviruses have emerged and re-emerged, with significant public health and economic impacts. Vaccinia virus (VACV), a poxvirus used during the WHO smallpox vaccination campaign, has been involved in zoonotic infections in Brazilian rural areas (Bovine Vaccinia outbreaks - BV), affecting dairy cattle and milkers. Little is known about VACV's natural hosts and its epidemiological and ecological characteristics. Although VACV was isolated and/or serologically detected in Brazilian wild animals, the link between wildlife and farms has not yet been elucidated. In this study, we describe for the first time, to our knowledge, the isolation of a VACV (Mariana virus - MARV) from a mouse during a BV outbreak. Genetic data, in association with biological assays, showed that this isolate was the same etiological agent causing exanthematic lesions observed in the cattle and human inhabitants of a particular BV-affected area. Phylogenetic analysis grouped MARV with other VACV isolated during BV outbreaks. These data provide new biological and epidemiological information on VACV and lead to an interesting question: could peridomestic rodents be the link between wildlife and BV outbreaks?

  12. Depressed trajectory SLBMs: A technical evaluation and arms control possibilities

    International Nuclear Information System (INIS)

    Gronlund, L.; Wright, D.C.

    1992-01-01

    SLBMs (sea-launched ballistic missiles) flown on depressed trajectories would have short flight times, comparable to escape times of bombers and launch times of ICBMs, thus raising the possibility of short time-of-flight (STOF) nuclear attacks. We assess the depressed trajectory (DT) capability of existing SLBMs by calculating the flight times, atmospheric loading on the booster, reentry heating on the reentry vehicle (RV), and degradation of accuracy for a DT SLBM. We find that current US and CIS SLBMs flown on depressed trajectories would have the capability to attack bomber bases at ranges of up to about 2,000 kilometers, and possibly at ranges up to 3,000 kilometers. To target bombers based furthest inland, a new high-velocity booster might be required, and attacking hardened targets would require a maneuvering RV (MaRV). We conclude that DT capabilities could be effectively controlled by the combination of an apogee restriction on the flight testing of existing SLBMs and bans on the development of high-velocity boosters and MaRVs, and that, in view of their inherent STOF capabilities, deep cuts in the number of SLBMs or their elimination might be desirable for an optimal minimum-deterrent force structure

  13. Fatty Acid Composition and Levels of Selected Polyunsaturated Fatty Acids in Four Commercial Important Freshwater Fish Species from Lake Victoria, Tanzania

    Directory of Open Access Journals (Sweden)

    Agnes Robert

    2014-01-01

    Full Text Available Fatty acids (FAs particularly ω3 and ω6 polyunsaturated fatty acids (PUFAs play important role in human health. This study aimed to investigate the composition and levels of selected ω3 PUFAs in four commercial fish species, Nile perch (Lates niloticus, Nile tilapia (Oreochromis niloticus, Tilapia zillii, and dagaa (Rastrineobola argentea from Mwanza Gulf in Lake Victoria. The results indicated that 36 types of FAs with different saturation levels were detected. These FAs were dominated by docosahexaenoic (DHA, eicosapentaenoic (EPA, docosapentaenoic (DPA, and eicosatetraenoic acids. O. niloticus had the highest composition of FAs (34 compared to L. niloticus (27, T. zillii (26, and R. argentea (21. The levels of EPA differed significantly among the four commercial fish species (F=6.19,  P=0.001. The highest EPA levels were found in R. argentea followed by L. niloticus and O. niloticus and the lowest in T. zillii. The DPA levels showed no significant difference among the four fish species studied (F=0.652,  P=0.583. The study concluded that all four commercial species collected from Mwanza Gulf are good for human health, but R. argentea is the best for consumption because it contains higher levels of ω3 FAs, mainly EPA.

  14. Assessing stream bank condition using airborne LiDAR and high spatial resolution image data in temperate semirural areas in Victoria, Australia

    Science.gov (United States)

    Johansen, Kasper; Grove, James; Denham, Robert; Phinn, Stuart

    2013-01-01

    Stream bank condition is an important physical form indicator for streams related to the environmental condition of riparian corridors. This research developed and applied an approach for mapping bank condition from airborne light detection and ranging (LiDAR) and high-spatial resolution optical image data in a temperate forest/woodland/urban environment. Field observations of bank condition were related to LiDAR and optical image-derived variables, including bank slope, plant projective cover, bank-full width, valley confinement, bank height, bank top crenulation, and ground vegetation cover. Image-based variables, showing correlation with the field measurements of stream bank condition, were used as input to a cumulative logistic regression model to estimate and map bank condition. The highest correlation was achieved between field-assessed bank condition and image-derived average bank slope (R2=0.60, n=41), ground vegetation cover (R=0.43, n=41), bank width/height ratio (R=0.41, n=41), and valley confinement (producer's accuracy=100%, n=9). Cross-validation showed an average misclassification error of 0.95 from an ordinal scale from 0 to 4 using the developed model. This approach was developed to support the remotely sensed mapping of stream bank condition for 26,000 km of streams in Victoria, Australia, from 2010 to 2012.

  15. Fish as bioindicators in aquatic environmental pollution assessment: A case study in Lake Victoria wetlands, Uganda

    Science.gov (United States)

    Naigaga, I.; Kaiser, H.; Muller, W. J.; Ojok, L.; Mbabazi, D.; Magezi, G.; Muhumuza, E.

    Growing human population and industrialization have led to the pollution of most aquatic ecosystems and consequent deterioration in environmental water quality. Indicator organisms are needed to improve assessment programmes on the ecological impacts of anthropogenic activities on the aquatic environment. Fish have been widely documented as useful indicators of environmental water quality because of their differential sensitivity to pollution. This study investigated the environmental water quality of selected wetland ecosystems using fish as biological indicators. Fish community structure in relation to water quality was assessed in five wetlands along the shoreline of Lake Victoria from August 2006 to June 2008. Four urban wetlands were variedly impacted by anthropogenic activities while one rural wetland was less impacted, and served as a reference site. Fish species diversity, abundance and richness were assessed, and canonical correspondence analysis (CCA) was used to evaluate the relationship between the fish communities and environmental variables. Results revealed that urban effluent impacted negatively on water quality and consequently the fish community structure. A total of 29 fish species were recorded throughout the study with the lowest number of 15 species recorded in the most impacted site. Shannon diversity and Margalef species richness indices were highest at the references site and lowest at the most impacted site. Wetland haplochromis species dominated the reference site, while oreochromis species dominated the most impacted site. The inshore locations registered higher species diversity and low species richness than the offshore locations. Low dissolved oxygen, pH, secchi depth and high electrical conductivity, total phosphorous, and total nitrogen were strongly associated with the effluent-impacted sites and greatly influenced the fish community structure. This study recommends the use of fish as valuable biological indicators in aquatic

  16. Making medicine; producing pleasure: A critical examination of medicinal cannabis policy and law in Victoria, Australia.

    Science.gov (United States)

    Lancaster, Kari; Seear, Kate; Ritter, Alison

    2017-11-01

    Several jurisdictions around the world have introduced policies and laws allowing for the legal use of cannabis for therapeutic purposes. However, there has been little critical discussion of how the object of 'medicinal cannabis' is enacted in policy and practice. Informed by Carol Bacchi's poststructuralist approach to policy analysis and the work of science and technology studies scholars, this paper seeks to problematise the object of 'medicinal cannabis' and examine how it is constituted through governing practices. In particular, we consider how the making of the object of 'medicinal cannabis' might constrain or enact discourses of pleasure. As a case example, we take the Victorian Law Reform Commission's review of law reform options to allow people in the Australian state of Victoria to be treated with medicinal cannabis. Through analysis of this case example, we find that although 'medicinal cannabis' is constituted as a thoroughly medical object, it is also constituted as unique. We argue that medicinal cannabis is enacted in part through the production of another object (so-called 'recreational cannabis') and the social and political meanings attached to both. Although both 'substances' are constituted as distinct, 'medicinal cannabis' relies on the 'absent presence' of 'recreational cannabis' to define and shape what it is. However, we find that contained within this rendering of 'medicinal cannabis' are complex enactments of health and wellbeing, which open up discourses of pleasure. 'Medicinal cannabis' appears to challenge the idea that the effects of 'medicine' cannot be understood in terms of pleasure. As such, the making of 'medicinal cannabis' as a medical object, and its invocation of broad notions of health and wellbeing, expand the ways in which drug effects can be acknowledged, including pleasurable and desirable effects, helping us to think differently about both medicine and other forms of drug use. Copyright © 2017 Elsevier B.V. All rights

  17. Parasitic infections on the shore of Lake Victoria (East Africa) detected by Mini-FLOTAC and standard techniques.

    Science.gov (United States)

    Barda, Beatrice; Ianniello, Davide; Zepheryne, Henry; Rinaldi, Laura; Cringoli, Giuseppe; Burioni, Roberto; Albonico, Marco

    2014-09-01

    Helminths and protozoa infections pose a great burden especially in developing countries, due to morbidity caused by both acute and chronic infection. The aim of our survey was to analyze the intestinal parasitic burden in communities from Mwanza region, Tanzania. Subjects (n=251) from four villages on the South of Lake Victoria have been analyzed for intestinal parasites with direct smear (DS), formol-ether concentration method (FECM) and the newly developed Mini-FLOTAC technique; urinary schistosomiasis was also assessed in a subsample (n=151); symptoms were registered and correlation between clinic and infections was calculated by chi-squared test and logistical regression. Out of the subjects screened for intestinal and for urinary parasites, 87% (218/251) were found positive for any infection, 69% (174/251) carried a helminthic and 67% (167/251) a protozoan infection, almost half of them had a double or triple infection. The most common helminths were hookworms, followed by Schistosoma mansoni and Schistosoma haematobium. Among protozoa, the most common was Entamoeba coli followed by Entamoeba histolytica/dispar and Giardia intestinalis. Mini-FLOTAC detected a number of helminth infections (61.7%) higher than FECM (38.6%) and DS (17.9%). Some positive associations with abdominal symptoms were found and previous treatment was negatively correlated with infection. Despite the limited size of the examined population the current study indicates a high prevalence of intestinal parasitic infection in Bukumbi area, Tanzania, and Mini-FLOTAC showed to be a promising diagnostic tool for helminth infections. This high parasitic burden calls for starting a regular deworming programme and other preventive interventions in schools and in the community. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. The rise and fall of water hyacinth in Lake Victoria and the Kagera River basin, 1989-2001

    Science.gov (United States)

    Albright, Thomas P.; Moorhouse, T.G.; McNabb, T.J.

    2004-01-01

    Water hyacinth (Eichhornia crassipes (Mart.) Solms) is an invasive aquatic macrophyte associated with major negative economic and ecological impacts to the Lake Victoria region since the plant's establishment in Uganda in the 1980s. Reliable estimates of water hyacinth distribution and extent are required to gauge the severity of the problem through time, relate water hyacinth abundance to environmental factors, identify areas requiring management action, and assess the efficacy of management actions. To provide such estimates and demonstrate the utility of remote sensing for this application, we processed and analyzed remotely sensed imagery to determine the distribution and extent of water hyacinth. Maps were produced and coverage was quantified using a hybrid unsupervised image classification approach with manual editing for each of the riparian countries of Kenya, Tanzania, and Uganda, as well as for numerous gulfs and bays. A similar procedure was carried out for selected lakes in the Rwanda-Tanzania borderlands lakes region in the Kagera River basin. Results confirm the severity of the water hyacinth infestation, especially in the northern parts of the lake. A maximum lake-wide extent of at least 17,374 ha was attained in 1998. Following this, a combination of factors, including conditions associated with the 1997 to 1998 El Nin??o and biocontrol with water hyacinth weevils, appear to have contributed to a major decline in water hyacinth in the most affected parts of the lake. Some lakes in the Kagera basin, such as Lake Mihindi, Rwanda, were severely infested in the late 1990s, but the level of infestation in most of these decreased markedly by the early 2000s.

  19. The adoption of children from out-of-home care: The understandings of key decision makers in Victoria, Australia.

    Science.gov (United States)

    Butlinski, Anna; Rowe, Heather; Goddard, Christopher; Freezer, Nicholas

    2017-10-01

    Adoption is one of a range of options that can provide children in out-of-home care with permanency when they are unable to be reunified with their birth parents. This paper reports on how the adoption of children from out-of-home care is understood by professionals involved in making decisions about the permanent placement of children in out-of-home care in Victoria, Australia, where adoption is rarely used. Data were collected through a single, face-to-face semi-structured interview with 21 professionals; eight child welfare specialists, eight adoption and permanent care specialists and five judicial officers. The adoption of children from out-of-home care was primarily understood as a child-centered practice that can afford children stability and a sense of belonging. Adoption was largely viewed as a voluntary process dependent upon the consent of a child's birth parents. Adoption and permanent care specialists were the only group to refer to the dispensation of parental consent as a means of obtaining an adoption order. Most decision makers understood that contact between children and their birth parents is possible following adoption, but this was not understood by all judicial officers or all child welfare specialists. Children's connection to their cultural heritage was viewed as important to the consideration of adoption for children in out-of-home care. This research provides insight into the foundations upon which decision makers may appraise adoption, within a hierarchy of options, as a potential outcome for children in need of permanency. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Impacts of reclaimed water irrigation on soil antibiotic resistome in urban parks of Victoria, Australia.

    Science.gov (United States)

    Han, Xue-Mei; Hu, Hang-Wei; Shi, Xiu-Zhen; Wang, Jun-Tao; Han, Li-Li; Chen, Deli; He, Ji-Zheng

    2016-04-01

    The effluents from wastewater treatment plants have been recognized as a significant environmental reservoir of antibiotics and antibiotic resistance genes (ARGs). Reclaimed water irrigation (RWI) is increasingly used as a practical solution for combating water scarcity in arid and semiarid regions, however, impacts of RWI on the patterns of ARGs and the soil bacterial community remain unclear. Here, we used high-throughput quantitative PCR and terminal restriction fragment length polymorphism techniques to compare the diversity, abundance and composition of a broad-spectrum of ARGs and total bacteria in 12 urban parks with and without RWI in Victoria, Australia. A total of 40 unique ARGs were detected across all park soils, with genes conferring resistance to β-lactam being the most prevalent ARG type. The total numbers and the fold changes of the detected ARGs were significantly increased by RWI, and marked shifts in ARG patterns were also observed in urban parks with RWI compared to those without RWI. The changes in ARG patterns were paralleled by a significant effect of RWI on the bacterial community structure and a co-occurrence pattern of the detected ARG types. There were significant and positive correlations between the fold changes of the integrase intI1 gene and two β-lactam resistance genes (KPC and IMP-2 groups), but no significant impacts of RWI on the abundances of intI1 and the transposase tnpA gene were found, indicating that RWI did not improve the potential for horizontal gene transfer of soil ARGs. Taken together, our findings suggested that irrigation of urban parks with reclaimed water could influence the abundance, diversity, and compositions of a wide variety of soil ARGs of clinical relevance. Irrigation of urban parks with treated wastewater significantly increased the abundance and diversity of various antibiotic resistance genes, but did not significantly enhance their potential for horizontal gene transfer. Copyright © 2015 Elsevier

  1. A geochemical study of lithospheric mantle beneath Northern Victoria Land (Antarctica): main evidences from volatile content in ultramafic xenoliths

    Science.gov (United States)

    Correale, Alessandra; Pelorosso, Beatrice; Rizzo, Andrea Luca; Coltorti, Massimo; Italiano, Francesco; Bonadiman, Costanza

    2017-04-01

    A geochemical study of ultramafic xenoliths from Northern Victoria Land (Green Point, GP and Handler Ridge, HR), is carried out in order to investigate the features of the lithosphere mantle beneath the Western Antarctic Ridge System (WARS). The majority of samples is spinel anhydrous lherzolite with rare presence of secondary phases (secondary cpx and glass). Geothermobarometric calculations, based on the Fe/Mg distribution among the peridotite minerals reveal that Sub Continental Lithospheric Mantle (SCLM) beneath Handler Ridge records temperatures and redox conditions higher then Greene Point (P fixed at 15 Kbar). Moreover, geochemical models evidence that, GP mantle domain represents a residuum after ˜7 to 21 % of partial melting in the spinel stability field, which was variably affected by interaction with infiltrating melts, acting in different times, from at least Jurassic to Cenozoic (Pelorosso et al., 2016). Fluid inclusions (FI) entrapped in olivine and pyroxene crystals were investigated for elemental and isotopic contents of both, noble gases (He, Ne, Ar) and CO2. He, Ar and Ne concentrations range from 1.52×10-14 to 1.07×10-12, from 4.09×10-13 to 3.47×10-11and from 2.84×10-16 to 7.57×10-14 mol/g, respectively, while the CO2amounts are between 7.08×10-10 and 8.12×10-7 mol/g. The 3He/4He varies between 5.95 and 20.18 Ra (where Ra is the 3He/4He ratio of air), being the lowest and the highest values measured in the He-poorer samples. Post-eruptive input of cosmogenic 3He and radiogenic 4He seems to influence mainly the samples associated to a lower He concentrations, increasing and decreasing respectively their primordial 3He/4He values, that for all the other samples range between 6.76 and 7.45 Ra. This range reasonably reflects the isotope signature of mantle beneath the investigated areas. The 4He/40Ar* ratio corrected for atmospheric-derived contamination ranges between 0.004 and 0.39. The lowest 4He/40Ar* values (4He/40Ar*correspondence of

  2. Comparison through fission-track analysis of portions of Australia and Antarctica adjacent prior to continental drift

    International Nuclear Information System (INIS)

    Stump, E.; Fitzgerald, P.G.

    1990-01-01

    Australia and Antarctica have been reconstructed by the matching of three terranes in western Victoria with three terranes in northern Victoria Land. Apparent fission-track ages from granitic rocks of these matched regions are compared. In western Victoria, Australia, data reflect a history of slow cooling following intrusion in early to middle Paleozoic time. In northern Victoria Land, Antarctica, a complex history of cooling and uplift is indicated, with uplift of the present-day mountains commencing approximately 50 Ma. Fission tracks in apatites from most samples from northern Victoria Land were completely re-set to zero by the thermal effects of Jurassic tholeiitic magmatism. Apatite in three samples however, predate the Jurassic and were only partially re-set by this event. Apparent sphene fission-track ages indicate that the three terranes in northern Victoria Land have shared a common thermal history since the Devonian. With the exception of one small area in western Victoria, neither western Victoria nor northern Victoria Land data show a clear influence of rifting and breakup in the late Cretaceous. Overall, the data indicate that once the breakup of Australia and Antarctica had occurred, their thermal and tectonic histories evolved independently along differing paths. (author)

  3. Presentations to general practice before a cancer diagnosis in Victoria: a cross-sectional survey.

    Science.gov (United States)

    Lacey, Karen; Bishop, James F; Cross, Hannah L; Chondros, Patty; Lyratzopoulos, Georgios; Emery, Jon D

    2016-07-18

    To assess variations in the number of general practitioner visits preceding a cancer diagnosis, and in the length of the interval between the patient first suspecting a problem and their seeing a hospital specialist. Analysis of data provided to the Cancer Patient Experience Survey (CPES; survey response rate, 37.7%) by 1552 patients with one of 19 cancer types and treated in one of five Victorian Comprehensive Cancer Centre hospitals, 1 October 2012 - 30 April 2013. The primary outcome was the proportion of patients who had had three or more GP consultations about cancer-related health problems before being referred to hospital. The secondary outcome was the interval between the patient first suspecting a problem and their seeing a hospital specialist. 34% of the patients included in the final analyses (426 of 1248) had visited a GP at least three times before referral to a hospital doctor. The odds ratios (reference: rectal cancer; adjusted for age, sex, language spoken at home, and socio-economic disadvantage index score) varied according to cancer type, being highest for pancreatic cancer (3.2; 95% CI, 1.02-9.9), thyroid cancer (2.5; 95% CI, 0.9-6.6), vulval cancer (2.5; 95% CI, 0.7-8.7) and multiple myeloma (2.4; 95% CI, 1.1-5.5), and lowest for patients with breast cancer (0.4; 95% CI, 0.2-0.8), cervical cancer (0.5; 95% CI, 0.1-2.1), endometrial cancer (0.5; 95% CI, 0.2-1.4) or melanoma (0.7; 95% CI, 0.3-1.5). Cancer type also affected the duration of the interval from symptom onset to seeing a hospital doctor; it took at least 3 months for more than one-third of patients with prostate or colon cancer to see a hospital doctor. Certain cancer types were more frequently associated with multiple GP visits, suggesting they are more challenging to recognise early. In Victoria, longer intervals from the first symptoms to seeing a hospital doctor for colon or prostate cancer may reflect poorer community symptom awareness, later GP referral, or limited access to

  4. Effects of different P-sources in soil on increasing growth and mineral uptake of mycorrhizal Vitis vinifera L. (cv Victoria vines

    Directory of Open Access Journals (Sweden)

    Nikolaos Nikolaou

    2002-12-01

    Full Text Available The effect of different P-sources on growth, leaf chemical composition, and fruit soluble solids and acid content was evaluated in mycorrhizal Victoria grapevine variety gralted onto the rootstocks 3309C or 11 OR. Mycorrhizal and non mycorrhizal plants were grown in 20 L pots containing 20 kg soil supplemented with different P-forms: (Calcium bis-dihydrogen-phosphate, tri-calcium phosphate, aluminium phosphate, iron (III phosphate with different solubility, equivalent to 90 kg P.ha-1. The percent of mycorrhizal root colonization was higher in insoluble P-form treatments compared to control or to soluble P-form treatment (CaDP, ranging from 66 to 84 % in treatments receiving insoluble P, from 36.67 to 38.33 % in control and from 25.33 to 27.33 % in soluble P-form treatments. The roots of 110R rootstock showed higher colonization rate compared to the 3309C. Mycorrhizal colonization increased both the pruning weight and number of nodes of the vines, up to 9 and 1.9 times respectively, according to the rootstock- P form combination. Mycorrhizal vines showed increased leaf concentrations in N, P, K, Ca. Fruit total soluble solids of mycorrhizal vines were about 30 % lower compared with those of the non mycorrhizal vines. Both factors, mycorrhizal colonization and P-forms had no significant effect in fruit titratable acidity.

  5. Perceptions of HIV and Safe Male Circumcision in High HIV Prevalence Fishing Communities on Lake Victoria, Uganda.

    Directory of Open Access Journals (Sweden)

    Paul E Nevin

    Full Text Available In 2010, the Uganda Ministry of Health introduced its Safe Male Circumcision (SMC strategy for HIV prevention with the goal of providing 4.2 million voluntary medical male circumcisions by 2015. Fishing communities, where HIV prevalence is approximately 3-5 times higher than the national average, have been identified as a key population needing targeted HIV prevention services by the National HIV Prevention Strategy. This study aimed to understand perceptions of HIV and identify potential barriers and facilitators to SMC in fishing communities along Lake Victoria.We conducted 8 focus group discussions, stratified by sex and age, with 67 purposefully sampled participants in 4 communities in Kalangala District, Uganda.There was universal knowledge of the availability of SMC services, but males reported high uptake in the community while females indicated that it is low. Improved hygiene, disease prevention, and improved sexual performance and desirability were reported facilitators. Barriers included a perceived increase in SMC recipients' physiological libido, post-surgical abstinence, lost income during convalescence, and lengthier recovery due to occupational hazards. Both males and females reported concerns about spousal fidelity during post-SMC abstinence. Reported misconceptions and community-held cultural beliefs include fear that foreskins are sold after their removal, the belief that a SMC recipient's first sexual partner after the procedure should not be his spouse, and the belief that vaginal fluids aid circumcision wound healing.Previous outreach efforts have effectively reached these remote communities, where availability and health benefits of SMC are widely understood. However, community-specific intervention strategies are needed to address the barriers identified in this study. We recommend the development of targeted counseling, outreach, and communication strategies to address barriers, misconceptions, and community-held beliefs

  6. Comparing insecticide-treated bed net use to Plasmodium falciparum infection among schoolchildren living near Lake Victoria, Kenya.

    Science.gov (United States)

    Okoyo, Collins; Mwandawiro, Charles; Kihara, Jimmy; Simiyu, Elses; Gitonga, Caroline W; Noor, Abdisalan M; Njenga, Sammy M; Snow, Robert W

    2015-12-22

    Under trial conditions insecticide-treated nets have been shown to provide significant clinical and mortality protection under a range of malaria transmission intensity conditions. There are, however, few operational impact data, notably in very intense transmission conditions. This study, reports on malaria infection among Kenyan schoolchildren living in areas of intense malaria transmission and their reported use of insecticide-treated bed nets. 5188 children in 54 schools were randomly sampled from seven counties surrounding Lake Victoria between May and June 2014. A questionnaire was administered to schoolchildren in classes 2-6 on the use of a long-lasting, insecticide-treated net (LLIN) the night before the survey and provided a single blood sample for a rapid diagnostic test for malaria infection. Analysis of the impact of insecticide-treated net use on malaria prevalence was undertaken using a multivariable, mixed effects, logistic regression at 95% confidence interval (CI), taking into account hierarchical nature of the data and results adjusted for school clusters. The overall prevalence of malaria infection was 48.7%, two-thirds (67.9%) of the children reported using LLIN, 91.3% of the children reported that their households own at least one LLIN and the household LLIN coverage was 2.5 persons per one LLIN. The prevalence of infection showed variation across the counties, with prevalence being highest in Busia (66.9%) and Homabay (51.8%) counties, and lowest in Migori County (29.6%). Generally, malaria parasite prevalence differed between age groups and gender with the highest prevalence occurring in children below 7 years (50.6%) and males (52.2%). Adjusting for county and school, there was a significant reduction in odds of malaria infection among the schoolchildren who reported LLIN use the previous night by 14 % (aOR 0.86, 95% CI 0.74-0.98, P provide protection against infection among school-aged children.

  7. Utilisation of Rep-PCR to track microbes in aerosols collected adjacent to their source, a saline lake in Victoria, Australia.

    Science.gov (United States)

    Munday, Chris I; O'Loingsigh, Tadhg; Tapper, Nigel J; De Deckker, Patrick; Allison, Gwen E

    2013-04-15

    Dust storms are a major source of aerosolized bacteria, especially in the drought conditions experienced in Australia in the decade to 2009. The major aims of this project were to identify the culturable bacteria in environmental samples and to genetically fingerprint all isolates using repetitive element PCR (Rep-PCR) to investigate the possibility of tracking isolates from their source into the atmosphere. Four field trips were conducted to a dry lake in western Victoria, Australia to sample aerosols and sediments. Aerosols were collected at heights up to 150 m using vacuum pumps with filters attached to a tethered helium balloon, while corresponding sediments were collected in sterile polypropylene tubes. Isolates were cultivated on Tryptic Soy Agar, R2 Agar and Marine Agar, and grown in dark conditions at ambient temperature. By sequencing the 16S rRNA gene of 270 isolates, fifteen different bacterial families were identified, with both the aerosols and sediments dominated by the Bacillaceae family. Four sets of Rep-PCR primers were tested, with the ERIC and (GTG)5 primers proving to be the most suitable for fingerprinting the cultured taxa. Rep-PCR revealed very high strain diversity in the samples collected, however some strains were still able to be tracked from sediments up to 150 m in height. This shows the potential of Rep-PCR, however very large reference databases would be required for the technique to be more useful. Copyright © 2013 Elsevier B.V. All rights reserved.

  8. Assessment of potentially toxic metal contamination in the soils of a legacy mine site in Central Victoria, Australia.

    Science.gov (United States)

    Abraham, Joji; Dowling, Kim; Florentine, Singarayer

    2018-02-01

    The environmental impact of toxic metal contamination from legacy mining activities, many of which had operated and were closed prior to the enforcement of robust environmental legislation, is of growing concern to modern society. We have carried out analysis of As and potentially toxic metals (Cd, Co, Cr, Cu, Hg, Mn, Ni, Pb, and Zn) in the surface soil of a legacy gold mining site in Maldon, Victoria, Australia, to reveal the status of the current metal concentration. The results revealed the median concentrations of metals from highest to lowest, in the order: Mn > Zn > As > Cr > Cu > Pb > Ni > Co > Hg > Cd. The status of site was assessed directly by comparing the metal concentrations in the study area with known Australian and Victorian average top soil levels and the health investigation levels set by the National Environmental Protection Measures (NEPM) and the Department of Environment and Conservation (DEC) of the State of Western Australia. Although, median concentrations of As, Hg, Pb, Cu and Zn exceeded the average Australian and Victorian top soil concentrations, only As and Hg exceeded the ecological investigation levels (EIL) set by DEC and thus these metals are considered as risk to the human and aquatic ecosystems health due to their increase in concentration and toxicity. In an environment of climate fluctuation with increased storm events and forest fires may mobilize these toxic metals contaminants, pose a real threat to the environment and the community. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. The structure and organisation of home-based postnatal care in public hospitals in Victoria, Australia: A cross-sectional survey.

    Science.gov (United States)

    Forster, Della A; McKay, Heather; Powell, Rhonda; Wahlstedt, Emma; Farrell, Tanya; Ford, Rachel; McLachlan, Helen L

    2016-04-01

    There is limited evidence regarding the provision of home-based postnatal care, resulting in a weak evidence-base for policy formulation and the further development of home-based postnatal care services. To explore the structure and organisation of public hospital home-based postnatal care in Victoria, Australia. An online survey including mostly closed-ended questions was sent to representatives of all public maternity providers in July 2011. The response rate of 87% (67/77) included rural (70%; n=47), regional (15%; n=10) and metropolitan (15%; n=10) services. The majority (96%, 64/67) provided home-based postnatal care. The median number of visits for primiparous women was two and for multiparous women, one. The main reason for no visit was the woman declining. Two-thirds of services attempted to provide some continuity of carer for home-based postnatal care. Routine maternal and infant observations were broadly consistent across the services, and various systems were in place to protect the safety of staff members during home visits. Few services had a dedicated home-based postnatal care coordinator. This study demonstrates that the majority of women receive at least one home-based postnatal visit, and that service provision on the whole is similar across the state. Further work should explore the optimum number and timing of visits, what components of care are most valued by women, and what model best ensures the timely detection and prevention of postpartum complications, be they psychological or physiological. Copyright © 2015 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  10. The petrology, geochronology and significance of Granite Harbour Intrusive Complex xenoliths and outcrop sampled in western McMurdo Sound, Southern Victoria Land, Antarctica

    International Nuclear Information System (INIS)

    Martin, A.P.; Cooper, A.F.; Price, R.C.; Turnbull, R.E.; Roberts, N.M.W.

    2015-01-01

    Granite Harbour Intrusive Complex xenoliths in McMurdo Volcanic Group rocks and in situ outcrops have been studied from Mount Morning, western McMurdo Sound, Antarctica. Calc-alkalic samples have whole rock signatures and normative compositions similar to the Dry Valleys 1b suite, and zircon grains in one specimen yield a 545.2 ± 4.4 Ma crystallisation age. This supports subduction-related magmatism initiating in Southern Victoria Land by 545 Ma. A second group of xenoliths is alkalic, with titanite grains in one xenolith from this group dated at 538 ± 8 Ma. Whole rock chemistry, normative compositions and geochronology of the alkalic group are comparable to the Koettlitz Glacier Alkaline Suite (KGAS). The position of a proposed lower crustal discontinuity that may form a significant basement suture in the McMurdo Sound region is newly constrained to the east of Mount Morning, perhaps along the trace of the Discovery Glacier. The boundary between East and West Antarctica may also pass along the trace of the Discovery Glacier if, as previously hypothesised, its location is controlled by the basement suture. A significant basement suture may also have provided the necessary egress for the (regionally) early and sustained magmatic activity observed at Mount Morning over the last 24 million years. (author).

  11. Differences in the population structure of Neisseria meningitidis in two Australian states: Victoria and Western Australia.

    Directory of Open Access Journals (Sweden)

    Shakeel Mowlaboccus

    Full Text Available Neisseria meningitidis is the causative agent of invasive meningococcal disease (IMD. A recombinant vaccine called Bexsero® incorporates four subcapsular antigens (fHbp, NHBA, NadA and PorA which are used to assign a Bexsero® antigen sequence type (BAST to each meningococcal strain. The vaccine elicits an immune response against combinations of variants of these antigens which have been grouped into specific BAST profiles that have been shown to have different distributions within geographical locations thus potentially affecting the efficacy of the vaccine. In this study, invasive meningococcal disease isolates from the western seaboard of Australia (Western Australia; WA were compared to those from the south-eastern seaboard (Victoria; VIC from 2008 to 2012. Whole-genome sequencing (WGS of 131 meningococci from VIC and 70 meningococci from WA were analysed for MLST, FetA and BAST profiling. Serogroup B predominated in both jurisdictions and a total of 10 MLST clonal complexes (cc were shared by both states. Isolates belonging to cc22, cc103 and cc1157 were unique to VIC whilst isolates from cc60 and cc212 were unique to WA. Clonal complex 41/44 represented one-third of the meningococcal population in each state but the predominant ST was locally different: ST-6058 in VIC and ST-146 in WA. Of the 108 BAST profiles identified in this collection, only 9 BASTs were simultaneously observed in both states. A significantly larger proportion of isolates in VIC harboured alleles for the NHBA-2 peptide and fHbp-1, antigenic variants predicted to be covered by the Bexsero® vaccine. The estimate for vaccine coverage in WA (47.1% [95% CI: 41.1-53.1%] was significantly lower than that in VIC (66.4% [95% CI: 62.3-70.5%]. In conclusion, the antigenic structure of meningococci causing invasive disease in two geographically distinct states of Australia differed significantly during the study period which may affect vaccine effectiveness and highlights the

  12. Student and school factors associated with school suspension: A multilevel analysis of students in Victoria, Australia and Washington State, United States

    Science.gov (United States)

    Sheryl, A. Hemphill; Stephanie, M. Plenty; Herrenkohl, Todd I.; Toumbourou, John W.; Catalano, Richard F.

    2014-01-01

    One of the common issues schools face is how best to handle challenging student behaviors such as violent behavior, antisocial behavior, bullying, school rule violations, and interrupting other students’ learning. School suspension may be used to remove students engaging in challenging behaviors from the school for a period of time. However, the act of suspending students from school may worsen rather than improve their behavior. Research shows that suspensions predict a range of student outcomes, including crime, delinquency, and drug use. It is therefore crucial to understand the factors associated with the use of school suspension, particularly in sites with different policy approaches to problem behaviors. This paper draws on data from state-representative samples of 3,129 Grade 7 and 9 students in Washington State, United States and Victoria, Australia sampled in 2002. Multilevel modeling examined student and school level factors associated with student-reported school suspension. Results showed that both student (being male, previous student antisocial and violent behavior, rebelliousness, academic failure) and school (socioeconomic status of the school, aggregate measures of low school commitment) level factors were associated with school suspension and that the factors related to suspension were similar in the two states. The implications of the findings for effective school behavior management policy are that, rather than focusing only on the student, both student and school level factors need to be addressed to reduce the rates of school suspension. PMID:24860205

  13. Traumatic orodental injuries and the development of an orodental injury surveillance system: a pilot study in Victoria, Australia.

    Science.gov (United States)

    Tham, Rachel Catherine Anne; Cassell, Erin; Calache, Hanny

    2009-02-01

    Traumatic orodental injuries are common dental public health problems that have complex aetiology and significant impact on those affected. It is important to understand the frequency, pattern and causes of traumatic orodental injuries so that appropriate and effective treatment services are made available and injury prevention interventions are designed and implemented. The aims of this study were to measure the frequency, causes and patterns of traumatic orodental injuries in patients of all ages treated at the Royal Dental Hospital of Melbourne in Victoria, Australia, over a 12-month period and to investigate the feasibility of establishing an orodental injury surveillance system. For which, a retrospective audit of 304 patient records was undertaken and injury surveillance data were extracted and analysed. Males represented 67% of cases. Three-quarters of all cases were aged less than 24 years. The most frequent cause of orodental injury was falls from less than 1 m or being struck by or colliding with a person or object. Injuries occurred most commonly around the home, on the road, street or footpath, the sports ground and places for recreation and were most often associated with leisure and sports activities. Orodental injuries sustained in one traumatic incident were often multiple and serious. Many severe orodental trauma injury cases present at this public dental hospital are expensive to treat, require long-term management and may be preventable. The findings from this study have led to the development and planned implementation of an enhanced electronic orodental injury structured history form that incorporates the collection of key injury surveillance data. These prospective data are to be combined with injury surveillance data that are routinely collected by all Victorian public hospital emergency departments in order to improve understanding of the nature of orodental injuries impacting Victorian communities and assist with appropriate service

  14. Uptake of a government-funded pertussis-containing booster vaccination program for parents of new babies in Victoria, Australia.

    Science.gov (United States)

    Rowe, Stacey L; Cunningham, Helen M; Franklin, Lucinda J; Lester, Rosemary A

    2015-04-08

    An epidemic of Bordetella pertussis in Victoria, Australia, led to the implementation of a Government-funded vaccination program for parents of new babies. The rationale was to protect unimmunised infants from infection by vaccinating parents with a pertussis-containing vaccine. This is known as cocooning. To estimate uptake of the vaccine among parents of new babies, two-and-a-half years after the program was implemented. A state-wide cross-sectional survey of parents was conducted to ascertain vaccine uptake, and to identify where and when the vaccination took place. Surveys were administered between 15 February and 14 March 2012, inclusive. Of 6308 surveys distributed, 2510 completed surveys were returned (response rate 40%). Ninety-five surveys completed outside the study period were excluded, leaving 2415 available for analysis. Overall, 1937 (80%) mothers and 1385 (70%) fathers were vaccinated in relation to the birth of their most recent child. A majority of mothers were vaccinated in hospital (62%). Most fathers were vaccinated by a general practitioner (72%). The most common point at which mothers were vaccinated was before their child turned two weeks of age (65%). Fathers' vaccination time-point varied more widely: during pregnancy (25%); before their child turned two weeks of age (29%); and when their child was between two and eight weeks of age (28%). Results of this survey indicated excellent uptake of the vaccine among both mothers and fathers under the Government-funded cocooning program. The findings are suggestive of an effective communications program designed to raise awareness of the risks of pertussis, and to promote availability of the funded vaccination program. The results may contribute to policy implementation of adult immunisation programs such as cocooning. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Reports of child sexual abuse of boys and girls: Longitudinal trends over a 20-year period in Victoria, Australia.

    Science.gov (United States)

    Mathews, Ben; Bromfield, Leah; Walsh, Kerryann; Cheng, Qinglu; Norman, Rosana E

    2017-04-01

    Although prevalence studies show girls are more frequently sexually abused than boys, a significant proportion of boys also experience child sexual abuse (CSA). The challenges for public policy are amplified for boys due to less developed public and professional sensitisation to boys' experiences, conceptions of masculinity, and less research on boys including into reporting trends and outcomes. We conducted a 20-year longitudinal time-trend analysis of government data to identify reporting trends and report outcomes for CSA in Victoria, Australia from 1993 to 2012. We stratified by child gender and reporter status. Results indicate a new sensitisation to CSA, especially for boys, although this trend was not stable. Marked change occurred in the last five years, likely influenced by major social and political events. Comparison over time revealed that from 1993 to 2012, the rate of reporting of boys increased 2.6-fold whereas there was a 1.5-fold increase for girls. Comparing genders, with regards to rate of reporting, in 1993, the sex ratio of girls to boys was 2:1, while by 2012 this ratio changed to 1.14:1. Reports by police and other mandated reporters accounted for the majority of the increase in reports over the 20-year period, suggesting unequal sensitisation. Positive report outcomes (i.e. substantiations, findings of harm, and referral to services) increased twelve-fold for boys, and nearly five-fold for girls, indicating the increased levels of reports were based in actual clinical need. Most of this increase occurred from 2009 to 2012, influenced by a compound of social, political and agency-related factors. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. A General Explanation-Based Learning Mechanism and Its Application to Narrative Understanding.

    Science.gov (United States)

    1987-12-01

    Forbus. and Alan Frisch for also serving on my inal committee and providing helpful comments. . .- Woo- Kyoung Ahn for being a great cognitive science...up the Michelin guide and got in her car. When the system processes the action that Willa has picked up the Michelin guide. it considers that tae next...following is the new Kveah narrative written by one subject in the instance group. Bill. Kim . John and Marv were all business associates. Bill wanted

  17. Prevalence and natural history of ALK positive non-small-cell lung cancer and the clinical impact of targeted therapy with ALK inhibitors

    OpenAIRE

    Chia, Puey Ling; John,Thomas; Dobrovic,Alex; Mitchell,Paul

    2014-01-01

    Puey Ling Chia,1 Paul Mitchell,1 Alexander Dobrovic,2–4 Thomas John1,2,4 1Department of Medical Oncology, Olivia-Newton John Cancer and Wellness Centre, Victoria, Australia; 2Ludwig Institute for Cancer Research, Austin Health, Victoria, Australia; 3Department of Pathology, University of Melbourne, Victoria, Australia; 4School of Cancer Medicine, La Trobe University, Victoria, Australia Abstract: Improved understanding of molecular drivers of carcinogenesis has led to significant p...

  18. Cryogenic brines as diagenetic fluids: Reconstructing the diagenetic history of the Victoria Land Basin using clumped isotopes

    Science.gov (United States)

    Staudigel, Philip T.; Murray, Sean; Dunham, Daniel P.; Frank, Tracy D.; Fielding, Christopher R.; Swart, Peter K.

    2018-03-01

    The isotopic analyses (δ13C, δ18O, and Δ47) of carbonate phases recovered from a core in McMurdo Sound by ANtarctic geologic DRILLing (ANDRILL-2A) indicate that the majority of secondary carbonate mineral formation occurred at cooler temperatures than the modern burial temperature, and in the presence of fluids with δ18Owater values ranging between -11 and -6‰ VSMOW. These fluids are interpreted as being derived from a cryogenic brine formed during the freezing of seawater. The Δ47 values were converted to temperature using an in-house calibration presented in this paper. Measurements of the Δ47 values in the cements indicate increasingly warmer crystallization temperatures with depth and, while roughly parallel to the observed geothermal gradient, consistently translate to temperatures that are cooler than the current burial temperature. The difference in temperature suggests that cements formed when they were ∼260 ± 100 m shallower than at the present day. This depth range corresponds to a period of minimal sediment accumulation from 3 to 11 Myr; it is therefore interpreted that the majority of cements formed during this time. This behavior is also predicted by time-integrated modeling of cementation at this site. If this cementation had occurred in the presence of these fluids, then the cryogenic brines have been a longstanding feature in the Victoria Land Basin. Brines such as those found at this site have been described in numerous modern high-latitude settings, and analogous fluids could have played a role in the diagenetic history of other ice-proximal sediments and basins during glacial intervals throughout geologic history. The agreement between the calculated δ18Owater value and the measured values in the pore fluids shows how the Δ47 proxy can be used to identify the origin of negative δ18O values in carbonate rocks and that extremely negative values do not necessarily need to be a result of the influence of meteoric fluids or reaction at

  19. Contrasting sodic and mildly potassic magma differentiation lineages at The Pleaides volcanic complex, northern Victoria Land, Antarctica

    Science.gov (United States)

    Kim, J.; Park, J. W.; Lee, J.; Kyle, P. R.; Lee, M. J.

    2017-12-01

    The magma evolution of The Pleiades, a Quaternary alkaline volcanic complex in northern Victoria Land, Antarctica, is investigated using major and trace elements, and Sr, Nd and Pb isotopic data. The volcanic rocks can be subdivided into two distinct magmatic lineages based on petrography and whole-rock compositions: (1) a sodic silica-undersaturated alkaline lineage with abundant kaersutite phenocrysts, and (2) a mildly-potassic and mildly-alkaline, nearly silica-saturated lineage containing olivine but not kaersutite. The basanite and trachybasalt of both lineages exhibit similar degrees of negative K anomalies, moderately steep rare earth element patterns, and elevated trace element ratios such as Ce/Pb (> 20) and Nb/U (> 38), suggesting their primary magmas were generated by low degree (≤3%) of partial melting of amphibole and garnet-bearing mantle sources. The sodic lineage is characterized by elevated 206Pb/204Pb (>19.5) ratios and narrow ranges of 87Sr/86Sr (0.70313-0.70327) and 143Nd/144Nd (0.51289-0.51290) ratios consistent with a significant HIMU component typical of Neogene volcanic rocks in Antarctica. The mafic rocks of the potassic lineage have isotopic compositions similar to those of the sodic lineage, however the evolved lavas in the lineage have higher 87Sr/86Sr (> 0.7035) and lower 143Nd/144Nd (< 0.51285) and 206Pb/204Pb (< 19.3) ratios than the mafic rocks, suggesting significant amounts of crustal contamination. The pressure-temperature paths estimated by clinopyroxene-liquid thermobarometry are similar in each lineage. The mafic magmas were emplaced at Moho depths ( 1.2 GPa) and the evolved magmas pooled at middle-crustal depths ( 0.7 GPa). Mass-balance calculations based on whole-rock and mineral compositions show that kaersutite fractionation has played a major role in magma differentiation of the sodic lineage whereas the compositional variations of the potassic lineage can be ascribed to fractionation of a kaersutite-free mineral

  20. The Role of Cytokines and Chemokines in Filovirus Infection

    Directory of Open Access Journals (Sweden)

    Sandra L. Bixler

    2015-10-01

    Full Text Available Ebola- and marburgviruses are highly pathogenic filoviruses and causative agents of viral hemorrhagic fever. Filovirus disease is characterized by a dysregulated immune response, severe organ damage, and coagulation abnormalities. This includes modulation of cytokines, signaling mediators that regulate various components of the immune system as well as other biological processes. Here we examine the role of cytokines in filovirus infection, with an emphasis on understanding how these molecules affect development of the antiviral immune response and influence pathology. These proteins may present targets for immune modulation by therapeutic agents and vaccines in an effort to boost the natural immune response to infection and/or reduce immunopathology.

  1. The Role of Cytokines and Chemokines in Filovirus Infection.

    Science.gov (United States)

    Bixler, Sandra L; Goff, Arthur J

    2015-10-23

    Ebola- and marburgviruses are highly pathogenic filoviruses and causative agents of viral hemorrhagic fever. Filovirus disease is characterized by a dysregulated immune response, severe organ damage, and coagulation abnormalities. This includes modulation of cytokines, signaling mediators that regulate various components of the immune system as well as other biological processes. Here we examine the role of cytokines in filovirus infection, with an emphasis on understanding how these molecules affect development of the antiviral immune response and influence pathology. These proteins may present targets for immune modulation by therapeutic agents and vaccines in an effort to boost the natural immune response to infection and/or reduce immunopathology.

  2. Retention efficiencies of halogenated and non-halogenated hydrocarbons in selected wetland ecosystem in Lake Victoria Basin

    Directory of Open Access Journals (Sweden)

    Shadrack Mule

    2015-06-01

    Full Text Available The determination of retention efficiencies of halogenated and non-halogenated hydrocarbon in selected wetland ecosystems in Lake Victoria basin was carried out. Qualitative and quantitative determination of the presence of residual hydrocarbons in Kigwal/Kimondi, Nyando and Nzoia wetland ecosystems using Gas Chromatography - Mass Spectrometer (GC-MS instrument indicated the presence of residual organochlorines, organophosphorus, carbamates and synthetic pyrethroid hydrocarbons in water, sediment and plant materials. In order to compare the retention efficiencies of the wetlands, the wetland ecosystems were divided into three different sections, namely: inlet, mid and outlet. Calculations of mass balances of residual halogenated and non-halogenated hydrocarbons at the respective sections was done taking into account the partition of the studied compounds in samples of water, sediments and papyrus reed plant materials and analyzed using validated Gas Chromatography - Mass Spectrometer (GC-MS method. From the analysis, several residual hydrocarbons namely: bendiocarb, benzene hexachloride (BHC, carbaryl, cypermethrin, decis, deltamethrin, diazinon, dieldrin, DDT, DDD, DDE, malathion, propoxur, sumithion, 5-phenylrhodanine, 1,3,5-trichlorobenzene, 1-(2-phenoxybenzylhydrazine were detected and quantified. The levels of the selected residual hydrocarbons in water samples were used to calculate the retention efficiencies of a specific hydrocarbon and the values recorded. Generally, River Nyando wetland recorded mean percentage retention efficiencies of 76 and 94% for dry and rainy seasons respectively; Kigwal/Kimondi wetland had seasonal mean percentage retention efficiencies of 63 to 78%. River Nzoia also had calculated seasonal mean percentage retention efficiencies of between 56 to 88%. Dry season had lower mean percentages retention efficiencies as compared to rainy season in the three wetlands of interest during the period of study. The study

  3. Adapting the botanical landscape of Melbourne Gardens (Royal Botanic Gardens Victoria in response to climate change

    Directory of Open Access Journals (Sweden)

    Timothy J. Entwisle

    2017-12-01

    Full Text Available Botanic gardens around the world maintain collections of living plants for science, conservation, education, beauty and more. These collections change over time – in scope and content – but the predicted impacts of climate change will require a more strategic approach to the succession of plant species and their landscapes. Royal Botanic Gardens Victoria has recently published a ‘Landscape Succession Strategy’ for its Melbourne Gardens, a spectacular botanical landscape established in 1846. The strategy recognizes that with 1.6 million visitors each year, responsibility for a heritage-listed landscape and the need to care for a collection of 8500 plant species of conservation and scientific importance, planting and planning must take into account anticipated changes to rainfall and temperature. The trees we plant today must be suitable for the climate of the twenty-second century. Specifically, the Strategy sets out the steps needed over the next twenty years to transition the botanic garden to one resilient to the climate modelled for 2090. The document includes a range of practical measures and achievable (and at times somewhat aspirational targets. Climate analogues will be used to identify places in Australia and elsewhere with conditions today similar to those predicted for Melbourne in 2090, to help select new species for the collection. Modelling of the natural and cultivated distribution of species will be used to help select suitable growth forms to replace existing species of high value or interest. Improved understanding of temperature gradients within the botanic garden, water holding capacity of soils and plant water use behaviour is already resulting in better targeted planting and irrigation. The goal is to retain a similar diversity of species but transition the collection so that by 2036 at least 75% of the species are suitable for the climate in 2090. Over the next few years we hope to provide 100% of irrigation water

  4. Integrated prevalence mapping of schistosomiasis, soil-transmitted helminthiasis and malaria in lakeside and island communities in Lake Victoria, Uganda

    Science.gov (United States)

    2011-01-01

    Background It is widely advocated that integrated strategies for the control of neglected tropical diseases (NTDs) are cost-effective in comparison to vertical disease-specific programmes. A prerequisite for implementation of control interventions is the availability of baseline data of prevalence, including the population at risk and disease overlap. Despite extensive literature on the distribution of schistosomiasis on the mainland in Uganda, there has been a knowledge gap for the prevalence of co-infections with malaria, particularly for island communities in Lake Victoria. In this study, nine lakeshore and island districts were surveyed for the prevalence of NTDs and malaria, as well as educational and health infrastructure. Results A total of 203 communities were surveyed, including over 5000 school-age children. Varying levels of existing health infrastructure were observed between districts, with only Jinja District regularly treating people for NTDs. Community medicine distributors (CMD) were identified and trained in drug delivery to strengthen capacity. Prevalence levels of intestinal schistosomiasis and soil-transmitted helminthiasis were assessed via Kato-Katz thick smears of stool and malaria prevalence determined by microscopy of fingerprick blood samples. Prevalence levels were 40.8%, 26.04% and 46.4%, respectively, while the prevalence of co-infection by Schistosoma mansoni and Plasmodium spp. was 23.5%. Socio-economic status was strongly associated as a risk factor for positive infection status with one or more of these diseases. Conclusions These results emphasise the challenges of providing wide-scale coverage of health infrastructure and drug distribution in remote lakeshore communities. The data further indicate that co-infections with malaria and NTDs are common, implying that integrated interventions for NTDs and malaria are likely to maximize cost-effectiveness and sustainability of disease control efforts. PMID:22166365

  5. Integrated prevalence mapping of schistosomiasis, soil-transmitted helminthiasis and malaria in lakeside and island communities in Lake Victoria, Uganda.

    Science.gov (United States)

    Kabatereine, Narcis B; Standley, Claire J; Sousa-Figueiredo, Jose C; Fleming, Fiona M; Stothard, J Russell; Talisuna, Ambrose; Fenwick, Alan

    2011-12-13

    It is widely advocated that integrated strategies for the control of neglected tropical diseases (NTDs) are cost-effective in comparison to vertical disease-specific programmes. A prerequisite for implementation of control interventions is the availability of baseline data of prevalence, including the population at risk and disease overlap. Despite extensive literature on the distribution of schistosomiasis on the mainland in Uganda, there has been a knowledge gap for the prevalence of co-infections with malaria, particularly for island communities in Lake Victoria. In this study, nine lakeshore and island districts were surveyed for the prevalence of NTDs and malaria, as well as educational and health infrastructure. A total of 203 communities were surveyed, including over 5000 school-age children. Varying levels of existing health infrastructure were observed between districts, with only Jinja District regularly treating people for NTDs. Community medicine distributors (CMD) were identified and trained in drug delivery to strengthen capacity. Prevalence levels of intestinal schistosomiasis and soil-transmitted helminthiasis were assessed via Kato-Katz thick smears of stool and malaria prevalence determined by microscopy of fingerprick blood samples. Prevalence levels were 40.8%, 26.04% and 46.4%, respectively, while the prevalence of co-infection by Schistosoma mansoni and Plasmodium spp. was 23.5%. Socio-economic status was strongly associated as a risk factor for positive infection status with one or more of these diseases. These results emphasise the challenges of providing wide-scale coverage of health infrastructure and drug distribution in remote lakeshore communities. The data further indicate that co-infections with malaria and NTDs are common, implying that integrated interventions for NTDs and malaria are likely to maximize cost-effectiveness and sustainability of disease control efforts.

  6. Impacts of population growth and economic development on water quality of a lake: case study of Lake Victoria Kenya water.

    Science.gov (United States)

    Juma, Dauglas Wafula; Wang, Hongtao; Li, Fengting

    2014-04-01

    Anthropogenic-induced water quality pollution is a major environmental problem in freshwater ecosystems today. As a result of this, eutrophication of lakes occurs. Population and economic development are key drivers of water resource pollution. To evaluate how growth in the riparian population and in the gross domestic product (GDP) with unplanned development affects the water quality of the lake, this paper evaluates Lake Victoria Kenyan waters basin. Waters quality data between 1990 and 2012 were analyzed along with reviews of published literature, papers, and reports. The nitrate-nitrogen (NO3-N), soluble phosphorus (PO4-P), chlorophyll a, and Secchi transparencies were evaluated as they are key water quality indicators. The NO3-N increased from 10 μg l(-1) in 1990 to 98 μg 1(-1) in 2008, while PO4-P increased from 4 μg l(-1) in 1990 to 57 μg l(-1) in 2008. The population and economic growth of Kenya are increasing with both having minimums in 1990 of 24.143 million people and 12.18 billion US dollars, to maximums in 2010 of 39.742 million people and 32.163 billion US dollars, respectively. A Secchi transparency is reducing with time, indicating an increasing pollution. This was confirmed by an increase in aquatic vegetation using an analysis of moderate resolution imaging spectroradiometer (MODIS) images of 2000 and 2012 of Kenyan waters. This study found that increasing population and GDP increases pollution discharge thus polluting lakes. One of major factors causing lake water pollution is the unplanned or poor waste management policy and service.

  7. Change of School in Early Adolescence and Adverse Obesity-Related Dietary Behavior: A Longitudinal Cohort Study, Victoria, Australia, 2013-2014.

    Science.gov (United States)

    Marks, Jennifer; Barnett, Lisa M; Allender, Steven

    2015-09-10

    Environments that facilitate energy-dense, nutrient-poor diets are associated with childhood obesity. We examined the effect of a change of school environment on the prevalence of obesity and related dietary behavior in early adolescence. Fifteen schools in Victoria, Australia, were recruited at random from the bottom 2 strata of a 5-level socioeconomic scale. In 9 schools, students in grade 6 primary school transitioned to different schools for grade 7 secondary school, whereas in 6 schools, students remained in the same school from grade 6 to grade 7. Time 1 measures were collected from students (N = 245) in grade 6 (aged 11-13 y). Time 2 data were collected from 243 (99%) of the original cohort in grade 7. Data collected were dietary recall self-reported by students via questionnaire, measured height and weight of students, and aspects of the school food environment via school staff survey. Comparative and mixed model regression analyses were conducted. Of 243 students, 63% (n = 152) changed schools from time 1 to time 2, with no significant difference in weight status. Students who changed schools reported an increase in purchases of after-school snack food, greater sweetened beverage intake, fewer fruit-and-vegetable classroom breaks, and less encouragement for healthy eating compared with students who remained in the same school. School staff surveys showed that more primary than secondary schools had written healthy canteen policies and fewer days of canteen or food services operation. A change of school environment has negative effects on children's obesity-related dietary behavior. Consistent policy is needed across school types to support healthy eating in school environments.

  8. Prevalence, seasonality, and growth of enterococci in raw and pasteurized milk in Victoria, Australia.

    Science.gov (United States)

    McAuley, Catherine M; Britz, Margaret L; Gobius, Kari S; Craven, Heather M

    2015-12-01

    This study investigated the prevalence, seasonality, and species variety of enterococci present in raw milk factory silos and pasteurized milk in 3 dairying regions in Victoria, Australia, over a 1-yr period. Additionally, the growth ability of thermoduric enterococci isolated in this study (Enterococcus faecalis, E. faecium, E. hirae, and E. durans) was determined in milk at temperatures likely to occur during storage, transport, and distribution, and before domestic consumption (4 and 7°C). Enterococci were detected in 96% of 211 raw milk samples, with an average count of 2.48 log10 cfu/mL. Counts were significantly lower in winter than summer (average 1.84 log10 cfu/mL) and were different between factories but not regions. Enterococcus faecalis was the most prevalent species isolated from raw milk in every factory, comprising between 61.5 and 83.5% of enterococcal species across each season. Enterococci were detected in lower numbers in pasteurized milk than in raw milk and were below the limit of detection on spread plates (pasteurization. Residual viable cells were only detected following enrichment using 100-mL samples of milk, with 20.8% of the samples testing positive; this equated to a decrease in the average raw milk enterococci count of >4 log10 cfu/mL following pasteurization. Although E. faecalis predominated in raw milk and E. durans was found in only 2.9% of raw milk samples, E. durans was the most prevalent species detected in pasteurized milk. The detection of enterococci in the pasteurized milk did not correlate with higher enterococci counts in the raw milk. This suggested that the main enterococci populations in raw milk were heat-sensitive and that thermoduric enterococci survived pasteurization in a small numbers of instances. All of the thermoduric enterococci that were assessed for growth at likely refrigeration temperatures were able to grow at both 4 and 7°C in sterile milk, with generation times of 35 to 41h and 16 to 22h, respectively

  9. Impacts of reclaimed water irrigation on soil antibiotic resistome in urban parks of Victoria, Australia

    International Nuclear Information System (INIS)

    Han, Xue-Mei; Hu, Hang-Wei; Shi, Xiu-Zhen; Wang, Jun-Tao; Han, Li-Li; Chen, Deli; He, Ji-Zheng

    2016-01-01

    The effluents from wastewater treatment plants have been recognized as a significant environmental reservoir of antibiotics and antibiotic resistance genes (ARGs). Reclaimed water irrigation (RWI) is increasingly used as a practical solution for combating water scarcity in arid and semiarid regions, however, impacts of RWI on the patterns of ARGs and the soil bacterial community remain unclear. Here, we used high-throughput quantitative PCR and terminal restriction fragment length polymorphism techniques to compare the diversity, abundance and composition of a broad-spectrum of ARGs and total bacteria in 12 urban parks with and without RWI in Victoria, Australia. A total of 40 unique ARGs were detected across all park soils, with genes conferring resistance to β-lactam being the most prevalent ARG type. The total numbers and the fold changes of the detected ARGs were significantly increased by RWI, and marked shifts in ARG patterns were also observed in urban parks with RWI compared to those without RWI. The changes in ARG patterns were paralleled by a significant effect of RWI on the bacterial community structure and a co-occurrence pattern of the detected ARG types. There were significant and positive correlations between the fold changes of the integrase intI1 gene and two β-lactam resistance genes (KPC and IMP-2 groups), but no significant impacts of RWI on the abundances of intI1 and the transposase tnpA gene were found, indicating that RWI did not improve the potential for horizontal gene transfer of soil ARGs. Taken together, our findings suggested that irrigation of urban parks with reclaimed water could influence the abundance, diversity, and compositions of a wide variety of soil ARGs of clinical relevance. One-sentence summary: Irrigation of urban parks with treated wastewater significantly increased the abundance and diversity of various antibiotic resistance genes, but did not significantly enhance their potential for horizontal gene transfer

  10. The application of soil-gas geochemistry to precisely locate La Victoria fault near Paracotos (Venezuela)

    International Nuclear Information System (INIS)

    LaBrecque, J.J.; Rosales, P.A.; Cordoves, P.R.

    1999-01-01

    Full text: Measurements of radon (total radon, Radon-222 and Radon-220) and other soil-gases (CO 2 , O 2 and H 2 ) were performed routinely during 1998 and 1999 across a narrow valley near Paracotos, Venezuela in an attempt to precisely locate the La Victoria fault. The transect was about 300 meters long with eleven sampling points. The soil-gas probes were inserted to a depth of 45 cm in the beginning and later on completely to a depth of 63 cm. The radon sampling and measurements were accomplished with a Pylon AB-5 radiation monitor and Lucas scintillation cells. The other soil-gases were directly determined with an Anagas, CD95 monitor and an Infra-red Gas Analyzer (MKIIC) both coupled with a Hydrogen pod. The radon values for more than twenty different sampling periods over a two year period resulted with anomalous values between 75 and 150 meters along the transect. There were three consecutive anomalous values each time. But strangely, the anomalies of the radon values were in the form of a doublet at 116 and 141 meters rather than a simple single peak in the middle and the gas flow was similar for the sampling points between 75 and 150 meters. The graph of the relative CO 2 values were usually similar to the radon graphs but in some cases, the anomalous values were seen as a simple single peak and corresponded to the 141 meter sampling point. While the anomalous values of Hydrogen were usually in a form of a single peak that corresponded with 141 meter sampling point. Only a few times were values for Hydrogen higher than 100 ppm and detected at most of the sampling points, usually only one or two points resulted with small values near the 141 meter sampling point. Based on the radon values alone, we would have to conclude that the fault probably lies near or between the 116 and 141 meter sampling points, but with the additional data of the CO 2 and H 2 soil-gases one could say that the fault is probably near the 141 meter sampling point. Thus, we have

  11. Külaline kunstiilma tipust / Mark Jones ; intervjueerinud Tanel Veenre

    Index Scriptorium Estoniae

    Jones, Mark

    2010-01-01

    Kumu Kunstimuuseumis on 23. jaanuarini 2011 avatud näitus "John Constable. Victoria & Alberti muuseumi kogudest". Tallinnas viibinud muuseumi direktori söör Mark Jonesiga John Costable'i loomingust, Tallinna näitusest, Constable'i kollektsioonist Victoria & Alberti muuseumis, Victoria & Alberti muuseumist ja selle näitustest

  12. Effects of prescribed fire and post-fire rainfall on mercury mobilization and subsequent contamination assessment in a legacy mine site in Victoria, Australia.

    Science.gov (United States)

    Abraham, Joji; Dowling, Kim; Florentine, Singarayer

    2018-01-01

    Prescribed fire conducted in fire-prone areas is a cost-effective choice for forest management, but it also affects many of the physicochemical and bio-geological properties of the forest soil, in a similar manner to wild fires. The aim of this study is to investigate the nature of the mercury mobilization after a prescribed fire and the subsequent temporal changes in concentration. A prescribed fire was conducted in a legacy mine site in Central Victoria, Australia, in late August 2015 and soil sample collection and analyses were carried out two days before and two days after the fire, followed by collection at the end of each season and after an intense rainfall event in September 2016. Results revealed the occurrence of mercury volatilization (8.3-97%) during the fire, and the mercury concentration displayed a significant difference (p fire. Integrated assessment with number of pollution indices has shown that the study site is extremely contaminated with mercury during all the sampling events, and this poses a serious ecological risk due to the health impacts of mercury on human and ecosystems. In times of climate fluctuation with concomitant increase in forest fire (including prescribed fire), and subsequent precipitation and runoff, the potential for an increased amount of mercury being mobilized is of heighted significance. Therefore, it is recommended that prescribed fire should be cautiously considered as a forest management strategy in any mercury affected landscapes. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Quantifying diffuse pathways for overland flow between the roads and streams of the mountain ash forests of central Victoria Australia

    Science.gov (United States)

    Lane, Patrick N. J.; Hairsine, Peter B.; Croke, Jacky C.; Takken, Ingrid

    2006-06-01

    Limiting connectivity between road runoff sources and stream networks is crucial for preservation of water quality in forested environments. Where flow is non-eroding, the length of hillslope available to accommodate volumes of discharged water is the key to restricting connectivity. Hairsine et al. ([2002], Hydrological Processes 16: 2311-2327) proposed a probabilistic model of diffuse overland flow that predicted the hillslope lengths required to infiltrate road discharge, based on the concept of volume to breakthrough (Vbt). This paper extends this analysis to a different forest environment with the aim of testing the portability of the Hairsine et al. ([2002]) model. The volume of flow required to travel overland to a distance of 5 and 10 m (Vbt5 and Vbt10) from drainage outlets was measured in deep, highly conductive mountain soils in the Upper Tyers catchment, Victoria, Australia. Rainfall, hydraulic conductivity and soil depths contrasted markedly with those in the Hairsine et al. ([2002]) study, and represent an extreme in Australian forests. Statistical analyses revealed the population of Vbt5 to be indistinguishable from that observed by Hairsine et al. ([2002]), indicating the model is valid for a range of forest soils. There was no significant correlation of sediment plume length with site characteristics such as slope, width of flow, or existence of incised pathways. It is suggested there are universal properties of pathways draining tracks and roads, with bioturbation acting to restore available pore spaces filled by antecedent plumes. Drain discharge design criteria may be developed for local conditions using the Hairsine et al. ([2002]) model, providing a robust tool for protection of water quality in the siting of new forest roads, and maintenance of exiting roads and tracks.

  14. Who consults chiropractors in Victoria, Australia?: Reasons for attending, general health and lifestyle habits of chiropractic patients.

    Science.gov (United States)

    Charity, Melanie J; Britt, Helena C; Walker, Bruce F; Gunn, Jane M; Forsdike-Young, Kirsty; Polus, Barbara I; French, Simon D

    2016-01-01

    COAST (Chiropractic Observational and Analysis STudy) reported the clinical practices of chiropractors. The aims of this study were to: 1) describe the chiropractic patient demographic and health characteristics; 2) describe patient-stated reasons for visiting a chiropractor; 3) describe chiropractic patient lifestyle characteristics; 4) compare, where possible, chiropractic patient characteristics to the general Australian population. Fifty-two chiropractors in Victoria, Australia, provided information for up to 100 consecutive encounters. If patients attended more than once during the 100 encounters, only data from their first encounter were included in this study. Where possible patient characteristics were compared with the general Australian population. Data were collected from December 2010 to September 2012. Data were provided for 4464 encounters, representing 3287 unique individuals. The majority of chiropractic encounters were for musculoskeletal conditions or for wellness/maintenance. The majority of patient comorbidities were musculoskeletal, circulatory or endocrine/metabolic in nature. Eight hundred chiropractic patients (57 %, 95 % CI: 53-61) described their self-reported health as excellent or very good and 138 patients (10 %, 95 % CI: 8-12) as fair or poor. Seventy-one percent of adult male patients (18 years and older), and 53 % of adult female patients, were overweight or obese. Fourteen percent (n = 188, 95 % CI: 12-16) were current smokers and 27 % (n = 359, 95 % CI: 24-31) did not meet Australian alcohol consumption guidelines. Less than half of the chiropractic patients participated in vigorous exercise at least twice per week. Approximately 20 % ate one serving of vegetables or less each day, and approximately 50 % ate one serve of fruit or less each day. Compared to the general Australian population, chiropractic patients were less likely to smoke, less likely to be obese and more likely to describe their health in positive terms

  15. Creating a sustainable and effective mental health workforce for Gippsland, Victoria: solutions and directions for strategic planning.

    Science.gov (United States)

    Sutton, Keith P; Maybery, Darryl; Moore, Terry

    2011-01-01

    The Gippsland region of Victoria, in common with other Australian rural and regional areas, is experiencing a shortage of qualified mental health professionals. Attracting mental health professionals to work in such areas is a major concern for service providers, policy-makers and rural/regional communities. Previous studies have focused on identifying factors contributing to the maldistribution of the health workforce, principally medical practitioners. Recent reviews have highlighted the strengths and weaknesses of evidence for the effectiveness of initiatives designed to address workforce shortages in underserved locations. The reported study sought the views of mental health organisation leaders from Gippsland to identify current approaches and potential solutions to the challenges of workforce recruitment, retention and training. A key goal of the study was to inform a strategic regional approach to the development of a more sustainable and effective mental health workforce. Investigators conducted semi-structured individual interviews with 26 administrators, managers and senior clinicians from public and private sector mental health organisations throughout Gippsland. Thematic content analysis of the transcribed interviews identified current approaches and potential solutions to the recruiting, retaining and training problems in the region. The study categorised solutions as focusing on factors external or internal to organisations. Solutions external to organisations included efforts to enhance the pool of available workers, improve intra-sectoral collaboration and cross-sectoral linkages, make funding more flexible, and to institute a contemporary curriculum and take innovative pedagogical approaches to training. Internal solutions included the need for strong leadership and quality organisational culture, flexible and adaptable approaches to meeting individual worker and community needs, promoting the organisation and local area and adopting models of care

  16. Las elecciones generales del 9 de marzo de 2008 en España: ¿Qué factores determinaron la victoria del partido socialista obrero español en Cataluña?

    Directory of Open Access Journals (Sweden)

    Gema Sánchez

    2009-01-01

    Full Text Available En este artículo analizamos en qué factores se ha cimentado la victoria del Partido Socialista Obrero Español (PSOE en Cataluña, comunidad autonómica que ha sido clave para el triunfo de este partido en las elecciones generales de 9 de marzo de 2008. Para ello, hemos centrado nuestro estudio en la abstención, la transferencia de votos entre partidos, el descenso electoral de las demás fuerzas políticas con representación en Cataluña, y el aumento de votos que ha experimentado el partido socialista. Tomando como base para realizar este análisis los resultados electorales de las distintas elecciones generales al Congreso de los Diputados que facilita en su web el Ministerio de Interior de España. De esta manera, podemos concluir si ha existido algún factor que haya sido determinante para explicar el triunfo socialistas, o si éste ha respondido a varios factores, como sostenemos en nuestra hipótesis de partida.

  17. The relationship between electronic gaming machine accessibility and police-recorded domestic violence: A spatio-temporal analysis of 654 postcodes in Victoria, Australia, 2005-2014.

    Science.gov (United States)

    Markham, Francis; Doran, Bruce; Young, Martin

    2016-08-01

    An emerging body of research has documented an association between problem gambling and domestic violence in a range of study populations and locations. Yet little research has analysed this relationship at ecological scales. This study investigates the proposition that gambling accessibility and the incidence of domestic violence might be linked. The association between police-recorded domestic violence and electronic gaming machine accessibility is described at the postcode level. Police recorded family incidents per 10,000 and domestic-violence related physical assault offenses per 10,000 were used as outcome variables. Electronic gaming machine accessibility was measured as electronic gaming machines per 10,000 and gambling venues per 100,000. Bayesian spatio-temporal mixed-effects models were used to estimate the associations between gambling accessibility and domestic violence, using annual postcode-level data in Victoria, Australia between 2005 and 2014, adjusting for a range of covariates. Significant associations of policy-relevant magnitudes were found between all domestic violence and EGM accessibility variables. Postcodes with no electronic gaming machines were associated with 20% (95% credibility interval [C.I.]: 15%, 24%) fewer family incidents per 10,000 and 30% (95% C.I.: 24%, 35%) fewer domestic-violence assaults per 10,000, when compared with postcodes with 75 electronic gaming machine per 10,000. The causal relations underlying these associations are unclear. Quasi-experimental research is required to determine if reducing gambling accessibility is likely to reduce the incidence of domestic violence. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. The impact of socio-economic disadvantage on rates of hospital separations for diabetes-related foot disease in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Colman Peter G

    2011-06-01

    Full Text Available Abstract Background Information describing variation in health outcomes for individuals with diabetes related foot disease, across socioeconomic strata is lacking. The aim of this study was to investigate variation in rates of hospital separations for diabetes related foot disease and the relationship with levels of social advantage and disadvantage. Methods Using the Index of Relative Socioeconomic Disadvantage (IRSD each local government area (LGA across Victoria was ranked from most to least disadvantaged. Those LGAs ranked at the lowest end of the scale and therefore at greater disadvantage (Group D were compared with those at the highest end of the scale (Group A, in terms of total and per capita hospital separations for peripheral neuropathy, peripheral vascular disease, foot ulceration, cellulitis and osteomyelitis and amputation. Hospital separations data were compiled from the Victorian Admitted Episodes Database. Results Total and per capita separations were 2,268 (75.3/1,000 with diabetes and 2,734 (62.3/1,000 with diabetes for Group D and Group A respectively. Most notable variation was for foot ulceration (Group D, 18.1/1,000 versus Group A, 12.7/1,000, rate ratio 1.4, 95% CI 1.3, 1.6 and below knee amputation (Group D 7.4/1,000 versus Group A 4.1/1,000, rate ratio 1.8, 95% CI 1.5, 2.2. Males recorded a greater overall number of hospital separations across both socioeconomic strata with 66.2% of all separations for Group D and 81.0% of all separations for Group A recorded by males. However, when comparing mean age, males from Group D tended to be younger compared with males from Group A (mean age; 53.0 years versus 68.7 years. Conclusion Variation appears to exist for hospital separations for diabetes related foot disease across socioeconomic strata. Specific strategies should be incorporated into health policy and planning to combat disparities between health outcomes and social status.

  19. Grain Boundary Engineering of Lithium-Ion-Conducting Lithium Lanthanum Titanate for Lithium-Air Batteries

    Science.gov (United States)

    2016-01-01

    Titanate for Lithium-Air Batteries by Victoria L Blair, Claire V Weiss Brennan, and Joseph M Marsico Approved for public...Air Batteries by Victoria L Blair and Claire V Weiss Brennan Weapons and Materials Research Directorate, ARL Joseph M Marsico Rochester...Titanate for Lithium-Air Batteries 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Victoria L Blair, Claire V

  20. RNA sequence determinants of a coupled termination-reinitiation strategy for downstream open reading frame translation in Helminthosporium victoriae virus 190S and other victoriviruses (Family Totiviridae).

    Science.gov (United States)

    Li, Hua; Havens, Wendy M; Nibert, Max L; Ghabrial, Said A

    2011-07-01

    The genome-length, dicistronic mRNA of the double-stranded RNA fungal virus Helminthosporium victoriae virus 190S (genus Victorivirus, family Totiviridae) contains two long open reading frames (ORFs) that overlap in the tetranucleotide AUGA. Translation of the downstream ORF, which encodes the RNA-dependent RNA polymerase (RdRp), has been proposed to depend on ribosomal reinitiation following termination of the upstream ORF, which encodes the capsid protein. In the current study, we examined the RNA sequence determinants for RdRp translation in this virus and demonstrated that a coupled termination-reinitiation (stop-restart) strategy is indeed used. Signals for termination-reinitiation are found within a 32-nucleotide stretch of RNA immediately upstream of the AUGA motif, including a predicted pseudoknot structure. The close proximity in which this predicted structure is followed by the upstream ORF's stop codon appears to be especially important for promoting translation of the downstream ORF. The normal strong preferences for an AUG start codon and the canonical sequence context to favor translation initiation appear somewhat relaxed for the downstream ORF. Similar sequence motifs and predicted RNA structures in other victoriviruses suggest that they all share a related stop-restart strategy for RdRp translation. Members of the genus Victorivirus thus provide new and unique opportunities for exploring the molecular mechanisms of translational coupling, which remain only partly understood in this and other systems.