WorldWideScience

Sample records for victoria marburgvirus marv

  1. Virus-Like Particle Vaccination Protects Nonhuman Primates from Lethal Aerosol Exposure with Marburgvirus (VLP Vaccination Protects Macaques against Aerosol Challenges).

    Science.gov (United States)

    Dye, John M; Warfield, Kelly L; Wells, Jay B; Unfer, Robert C; Shulenin, Sergey; Vu, Hong; Nichols, Donald K; Aman, M Javad; Bavari, Sina

    2016-04-08

    Marburg virus (MARV) was the first filovirus to be identified following an outbreak of viral hemorrhagic fever disease in Marburg, Germany in 1967. Due to several factors inherent to filoviruses, they are considered a potential bioweapon that could be disseminated via an aerosol route. Previous studies demonstrated that MARV virus-like particles (VLPs) containing the glycoprotein (GP), matrix protein VP40 and nucleoprotein (NP) generated using a baculovirus/insect cell expression system could protect macaques from subcutaneous (SQ) challenge with multiple species of marburgviruses. In the current study, the protective efficacy of the MARV VLPs in conjunction with two different adjuvants: QS-21, a saponin derivative, and poly I:C against homologous aerosol challenge was assessed in cynomolgus macaques. Antibody responses against the GP antigen were equivalent in all groups receiving MARV VLPs irrespective of the adjuvant; adjuvant only-vaccinated macaques did not demonstrate appreciable antibody responses. All macaques were subsequently challenged with lethal doses of MARV via aerosol or SQ as a positive control. All MARV VLP-vaccinated macaques survived either aerosol or SQ challenge while animals administered adjuvant only exhibited clinical signs and lesions consistent with MARV disease and were euthanized after meeting the predetermined criteria. Therefore, MARV VLPs induce IgG antibodies recognizing MARV GP and VP40 and protect cynomolgus macaques from an otherwise lethal aerosol exposure with MARV.

  2. Virus-Like Particle Vaccination Protects Nonhuman Primates from Lethal Aerosol Exposure with Marburgvirus (VLP Vaccination Protects Macaques against Aerosol Challenges

    Directory of Open Access Journals (Sweden)

    John M. Dye

    2016-04-01

    Full Text Available Marburg virus (MARV was the first filovirus to be identified following an outbreak of viral hemorrhagic fever disease in Marburg, Germany in 1967. Due to several factors inherent to filoviruses, they are considered a potential bioweapon that could be disseminated via an aerosol route. Previous studies demonstrated that MARV virus-like particles (VLPs containing the glycoprotein (GP, matrix protein VP40 and nucleoprotein (NP generated using a baculovirus/insect cell expression system could protect macaques from subcutaneous (SQ challenge with multiple species of marburgviruses. In the current study, the protective efficacy of the MARV VLPs in conjunction with two different adjuvants: QS-21, a saponin derivative, and poly I:C against homologous aerosol challenge was assessed in cynomolgus macaques. Antibody responses against the GP antigen were equivalent in all groups receiving MARV VLPs irrespective of the adjuvant; adjuvant only-vaccinated macaques did not demonstrate appreciable antibody responses. All macaques were subsequently challenged with lethal doses of MARV via aerosol or SQ as a positive control. All MARV VLP-vaccinated macaques survived either aerosol or SQ challenge while animals administered adjuvant only exhibited clinical signs and lesions consistent with MARV disease and were euthanized after meeting the predetermined criteria. Therefore, MARV VLPs induce IgG antibodies recognizing MARV GP and VP40 and protect cynomolgus macaques from an otherwise lethal aerosol exposure with MARV.

  3. Ebolavirus and Marburgvirus: insight the Filoviridae family.

    Science.gov (United States)

    Ascenzi, Paolo; Bocedi, Alessio; Heptonstall, Julia; Capobianchi, Maria Rosaria; Di Caro, Antonino; Mastrangelo, Eloise; Bolognesi, Martino; Ippolito, Giuseppe

    2008-06-01

    Ebolavirus and Marburgvirus (belonging to the Filoviridae family) emerged four decades ago and cause epidemics of haemorrhagic fever with high case-fatality rates. The genome of filoviruses encodes seven proteins. No significant homology is observed between filovirus proteins and any known macromolecule. Moreover, Marburgvirus and Ebolavirus show significant differences in protein homology. The natural maintenance cycle of filoviruses is unknown, the natural reservoir, the mode of transmission, the epidemic disease generation, and temporal dynamics are unclear. Lastly, Ebolavirus and Marburgvirus are considered as potential biological weapons. Vaccine appears the unique therapeutic frontier. Here, molecular and clinical aspects of filoviral haemorrhagic fevers are summarized.

  4. Recommendations relative to the scientific missions of a Mars Automated Roving Vehicle (MARV)

    Science.gov (United States)

    Spencer, R. L. (Editor)

    1973-01-01

    Scientific objectives of the MARV mission are outlined and specific science systems requirements and experimental payloads defined. All aspects of the Martian surface relative to biotic and geologic elements and those relating to geophysical and geochemical properties are explored.

  5. Ebolavirus Δ-Peptide Immunoadhesins Inhibit Marburgvirus and Ebolavirus Cell Entry▿

    Science.gov (United States)

    Radoshitzky, Sheli R.; Warfield, Kelly L.; Chi, Xiaoli; Dong, Lian; Kota, Krishna; Bradfute, Steven B.; Gearhart, Jacqueline D.; Retterer, Cary; Kranzusch, Philip J.; Misasi, John N.; Hogenbirk, Marc A.; Wahl-Jensen, Victoria; Volchkov, Viktor E.; Cunningham, James M.; Jahrling, Peter B.; Aman, M. Javad; Bavari, Sina; Farzan, Michael; Kuhn, Jens H.

    2011-01-01

    With the exception of Reston and Lloviu viruses, filoviruses (marburgviruses, ebolaviruses, and “cuevaviruses”) cause severe viral hemorrhagic fevers in humans. Filoviruses use a class I fusion protein, GP1,2, to bind to an unknown, but shared, cell surface receptor to initiate virus-cell fusion. In addition to GP1,2, ebolaviruses and cuevaviruses, but not marburgviruses, express two secreted glycoproteins, soluble GP (sGP) and small soluble GP (ssGP). All three glycoproteins have identical N termini that include the receptor-binding region (RBR) but differ in their C termini. We evaluated the effect of the secreted ebolavirus glycoproteins on marburgvirus and ebolavirus cell entry, using Fc-tagged recombinant proteins. Neither sGP-Fc nor ssGP-Fc bound to filovirus-permissive cells or inhibited GP1,2-mediated cell entry of pseudotyped retroviruses. Surprisingly, several Fc-tagged Δ-peptides, which are small C-terminal cleavage products of sGP secreted by ebolavirus-infected cells, inhibited entry of retroviruses pseudotyped with Marburg virus GP1,2, as well as Marburg virus and Ebola virus infection in a dose-dependent manner and at low molarity despite absence of sequence similarity to filovirus RBRs. Fc-tagged Δ-peptides from three ebolaviruses (Ebola virus, Sudan virus, and Taï Forest virus) inhibited GP1,2-mediated entry and infection of viruses comparably to or better than the Fc-tagged RBRs, whereas the Δ-peptide-Fc of an ebolavirus nonpathogenic for humans (Reston virus) and that of an ebolavirus with lower lethality for humans (Bundibugyo virus) had little effect. These data indicate that Δ-peptides are functional components of ebolavirus proteomes. They join cathepsins and integrins as novel modulators of filovirus cell entry, might play important roles in pathogenesis, and could be exploited for the synthesis of powerful new antivirals. PMID:21697477

  6. Ebolavirus delta-peptide immunoadhesins inhibit marburgvirus and ebolavirus cell entry.

    Science.gov (United States)

    Radoshitzky, Sheli R; Warfield, Kelly L; Chi, Xiaoli; Dong, Lian; Kota, Krishna; Bradfute, Steven B; Gearhart, Jacqueline D; Retterer, Cary; Kranzusch, Philip J; Misasi, John N; Hogenbirk, Marc A; Wahl-Jensen, Victoria; Volchkov, Viktor E; Cunningham, James M; Jahrling, Peter B; Aman, M Javad; Bavari, Sina; Farzan, Michael; Kuhn, Jens H

    2011-09-01

    With the exception of Reston and Lloviu viruses, filoviruses (marburgviruses, ebolaviruses, and "cuevaviruses") cause severe viral hemorrhagic fevers in humans. Filoviruses use a class I fusion protein, GP(1,2), to bind to an unknown, but shared, cell surface receptor to initiate virus-cell fusion. In addition to GP(1,2), ebolaviruses and cuevaviruses, but not marburgviruses, express two secreted glycoproteins, soluble GP (sGP) and small soluble GP (ssGP). All three glycoproteins have identical N termini that include the receptor-binding region (RBR) but differ in their C termini. We evaluated the effect of the secreted ebolavirus glycoproteins on marburgvirus and ebolavirus cell entry, using Fc-tagged recombinant proteins. Neither sGP-Fc nor ssGP-Fc bound to filovirus-permissive cells or inhibited GP(1,2)-mediated cell entry of pseudotyped retroviruses. Surprisingly, several Fc-tagged Δ-peptides, which are small C-terminal cleavage products of sGP secreted by ebolavirus-infected cells, inhibited entry of retroviruses pseudotyped with Marburg virus GP(1,2), as well as Marburg virus and Ebola virus infection in a dose-dependent manner and at low molarity despite absence of sequence similarity to filovirus RBRs. Fc-tagged Δ-peptides from three ebolaviruses (Ebola virus, Sudan virus, and Taï Forest virus) inhibited GP(1,2)-mediated entry and infection of viruses comparably to or better than the Fc-tagged RBRs, whereas the Δ-peptide-Fc of an ebolavirus nonpathogenic for humans (Reston virus) and that of an ebolavirus with lower lethality for humans (Bundibugyo virus) had little effect. These data indicate that Δ-peptides are functional components of ebolavirus proteomes. They join cathepsins and integrins as novel modulators of filovirus cell entry, might play important roles in pathogenesis, and could be exploited for the synthesis of powerful new antivirals.

  7. Experimental Inoculation of Egyptian Rousette Bats (Rousettus aegyptiacus with Viruses of the Ebolavirus and Marburgvirus Genera

    Directory of Open Access Journals (Sweden)

    Megan E.B. Jones

    2015-06-01

    Full Text Available The Egyptian rousette bat (Rousettus aegyptiacus is a natural reservoir for marburgviruses and a consistent source of virus spillover to humans. Cumulative evidence suggests various bat species may also transmit ebolaviruses. We investigated the susceptibility of Egyptian rousettes to each of the five known ebolaviruses (Sudan, Ebola, Bundibugyo, Taï Forest, and Reston, and compared findings with Marburg virus. In a pilot study, groups of four juvenile bats were inoculated with one of the ebolaviruses or Marburg virus. In ebolavirus groups, viral RNA tissue distribution was limited, and no bat became viremic. Sudan viral RNA was slightly more widespread, spurring a second, 15-day Sudan virus serial euthanasia study. Low levels of Sudan viral RNA disseminated to multiple tissues at early time points, but there was no viremia or shedding. In contrast, Marburg virus RNA was widely disseminated, with viremia, oral and rectal shedding, and antigen in spleen and liver. This is the first experimental infection study comparing tissue tropism, viral shedding, and clinical and pathologic effects of six different filoviruses in the Egyptian rousette, a known marburgvirus reservoir. Our results suggest Egyptian rousettes are unlikely sources for ebolaviruses in nature, and support a possible single filovirus—single reservoir host relationship.

  8. Comprehensive Profiling of Immune Responses in MARV Survivors Demonstrates Robust Th1-Skewing with Short Lived Neutralizing Antibody Responses

    Science.gov (United States)

    2017-03-29

    unprecedented scale, spanning two years and infecting more than 28,000 individuals. Previously, the largest filovirus outbreaks had numbered in the tens to...virus (BDBV) have all caused outbreaks that numbered over 100 cases – twice, in the cases of MARV and SUDV. EBOV may garner much of the attention , but

  9. Monovalent Virus-Like Particle Vaccine Protects Guinea Pigs and Nonhuman Primates Against Infection with Multiple Marburg Viruses

    National Research Council Canada - National Science Library

    Swenson, Dana L; Warfield, Kelly L; Larsen, Tom; Alves, D. A; Coberley, Sadie S; Bavari, Sina

    2008-01-01

    .... Guinea pigs vaccinated with marburgvirus (m)VLPs or inactivated MARV (iMARV) develop homologous humoral and T cell responses and are completely protected from a lethal homologous MARV challenge...

  10. A Prophylactic Multivalent Vaccine Against Different Filovirus Species is Immunogenic and Provides Protection from Lethal Infections of Ebolavirus and Marburgvirus Species in Non-Human Primates

    Science.gov (United States)

    2016-12-22

    1985;54(1): 30-37. Coltart CE, Johnson AM, Whitty CJ. Role of healthcare workers in early epidemic spread of Ebola: policy implications of...Lethal Infections of Ebolavirus and Marburgvirus Species in Non-human Primates Short title 70 characters Immunogenicity and Protection of a...filovirus species has been prompted by sporadic but large outbreaks of Ebolavirus and Marburgvirus infections . A good prophylactic vaccine should be able

  11. Virus-Like Particle Vaccination Protects Nonhuman Primates from Lethal Aerosol Exposure with Marburgvirus (VLP Vaccination Protects Macaques against Aerosol Challenges)

    OpenAIRE

    John M. Dye; Warfield, Kelly L; Jay B. Wells; Unfer, Robert C.; Sergey Shulenin; Hong Vu; Donald K. Nichols; M Javad Aman; Sina Bavari

    2016-01-01

    Marburg virus (MARV) was the first filovirus to be identified following an outbreak of viral hemorrhagic fever disease in Marburg, Germany in 1967. Due to several factors inherent to filoviruses, they are considered a potential bioweapon that could be disseminated via an aerosol route. Previous studies demonstrated that MARV virus-like particles (VLPs) containing the glycoprotein (GP), matrix protein VP40 and nucleoprotein (NP) generated using a baculovirus/insect cell expression system could...

  12. Dicty_cDB: Contig-U04401-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , 3' end ... 46 1.6 1 ( DQ447660 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447659 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447658 ) Lake Victoria marburgvirus - An...gola2005 strain An... 44 6.3 1 ( DQ447657 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447656 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447655 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447654 ) Lake Victoria marburgvirus -

  13. victoria cross awards warrants concerning the victoria cross (1920)

    African Journals Online (AJOL)

    INTRODUCTION. In the military history of both the British Empire and of the Western World, the highest British military decoration, namely the Victoria Cross, has attained con- siderable renown. The Victoria Cross was introduced in terms of the Royal Warrant of 29 January,. 1856 and by 1957 a total of 1346 had been ...

  14. MARATHON Verification (MARV)

    Science.gov (United States)

    2017-08-01

    1 and MARATHON 2 output. Due to a limitation of MARATHON 2, specifically the inability to extend or otherwise address limitations in ProModel, MAJ ...2010-2012 rewrite of the initial limited 2010 VBA port of MARATHON 2 by (then) MAJ Alex MacCalman. M3 was developed and used in studies from the time

  15. [The epilepsy of Guadalupe Victoria].

    Science.gov (United States)

    Soto-Pérez-de-Celis, Enrique

    2008-01-01

    Guadalupe Victoria, the first President of Mexico, passed away in 1843 uictim of an ailment that, at the time, was diagnosed as epilepsy. The clinical data and the pathologic findings, however, suggest the possibility that Victoria had an underlying disease that was responsible for the seizures that affected him. In this article I propose that Guadalupe Victoria had in fact Chagas Disease, and that he was infected with this parasitic malady while he lived in the tropical jungles of Veracruz, in eastern Mexico. Even though there aren't many published works regarding seizures secondary to chronic Chagas Disease, there are good descriptions of epileptic syndromes in patients with this infection. At the same time, the cardiac findings in Victoria's autopsy support the idea that he had some kind of cardiac pathology; in this case Chagasic dilated cardiomyopathy, which ultimately led to his death.

  16. VICTORIA'S SECRET Prepares for Growth

    National Research Council Canada - National Science Library

    Jordan K Speer

    2007-01-01

      After the upcoming holiday season, Victoria's Secret will take the first steps toward launching its e-commerce business on a cross-channel on-demand platform from partner n2N Commerce, a company...

  17. Special Issue on Lake Victoria

    African Journals Online (AJOL)

    The diversity of benthic mollusks of Lake Victoria and Lake Burigi · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JA Mwambungu, 21-32. http://dx.doi.org/10.4314/tjs.v30i1.18384 ...

  18. The Victoria Project, Sri Lanka. Hydrological analysis for Victoria Dam

    Energy Technology Data Exchange (ETDEWEB)

    Piper, B.S. [GU Projects (United Kingdom); Sutcliffe, J.V. [Gibb (Sir Alexander) and Partners (United Kingdom); Parks, Y.P. [Institute of Hydrology (United Kingdom)

    1994-03-01

    The hydrological analyses described in this paper formed an important part of the studies for the Victoria Project of which the Victoria Dam is the major component. The purpose of the hydrological studies was to provide consistent sets of river flow and climate data at the sites of the major components of the project, and to provide flood estimates for sizing the spillway and river diversion works. This paper outlines the approach used in the overall study, and then concentrates on aspects of specific relevance to the Victoria Dam. The main hydrological characteristics of the upper Mahaweli basin are presented as an introduction to the overall water balance; the humid climate made the appraisal of flow records relatively simple. Time series modelling was used to fill gaps in the observed flow records used for reservoir operation studies. The spillway design flood was based on the probable maximum precipitation (PMP) derived by maximizing a historic storm in which rainfall approaching the PMP covered most of the basin. Construction floods of moderate return period were estimated from a dimensionless analysis of regional flood records. The main lessons to be drawn are that water balance methods are of particular value in these humid monsoon conditions, while the ratio of the PMP to the maximum recorded storm is lower than would be the case in more arid regions. (author)

  19. Projecting the future levels of Lake Victoria

    Science.gov (United States)

    Vanderkelen, Inne; van Lipzig, Nicole; Thiery, Wim

    2017-04-01

    Lake Victoria directly sustains 30 million people living in its basin and 200 000 fishermen operating from its shores. As the one of the two sources of the Nile River, it also supports natural resources that impact the livelihood of over 300 million people living in the Nile basin. The outlet to the Nile is controlled by two hydropower dams. The water balance of Lake Victoria is controlled both by climatic conditions (precipitation and evaporation) and human management (dam outflow). Future climate simulations with a high resolution coupled lake-land-atmosphere model project decreasing mean precipitation and increasing evaporation over Lake Victoria. As these two are important factors in the water balance of Lake Victoria, these projected changes may induce a drop in future levels of Lake Victoria. Moreover, as Lake Victoria is also a relatively shallow lake, lake surface area may decrease as well. Here we present a water balance model for Lake Victoria that provides lake level and extent as output. We first force our model with observational input (new satellite products providing high quality precipitation and evaporation data) and evaluate it using measured lake levels. The skill of the model is subsequently assessed by forcing it with present-day regional climate simulations (CORDEX evaluation simulations). In a third step the future lake levels and surface area changes of Lake Victoria are simulated by forcing the model with CORDEX projections under RCP4.5 and 8.5. Finally, the role of human decisions regarding future dam outflow are investigated.

  20. Spiraal : uus Victoria & Alberti muuseum Londonis

    Index Scriptorium Estoniae

    1998-01-01

    Daniel Libeskindi projekt Victoria & Alberti Muuseumi laiendamiseks on põhjustanud konservatiivsete londonlaste pahameele, kuid kutsunud esile ka hulgaliselt toetusavaldusi. Muuseumi uus osa (kokkuvarisemise piiril näiva ehitisena) peaks külastajaile avatama 2004. a.

  1. The Victoria Project, Sri Lanka: Victoria Power-Station. [Hydroelectric power

    Energy Technology Data Exchange (ETDEWEB)

    Creber, B. (Sir Alexander Gibb and Partners (GB))

    1991-04-01

    The Victoria Hydroelectric Power-Station forms part of the Victoria Project on the Mahaweli Ganga in Sri Lanka and it provides the country's largest single power source. The Paper describes the planning, design and construction of the civil engineering works, including problems encountered, and also describes, in outline, the electrical and mechanical works. (Author).

  2. total mercury concentration in common fish species of lake victoria ...

    African Journals Online (AJOL)

    Total mercury (THg) concentration was analysed in muscles of common fish species of Lake. Victoria in the eastern and southern parts of the lake using cold vapour Atomic Absorption. Spectrophotometric ... INTRODUCTION. The Lake Victoria ...

  3. Seabed surveys of Victoria harbour, Mahe, Seychelles

    Digital Repository Service at National Institute of Oceanography (India)

    Hashimi, N.H.; Wagle, B.G.

    The seabed surveys in the Victoria Harbour, Mahe, Seychelles shows that the prominent feature is the navigational channel aligned in the northeast-southwest direction with a width varying from 300 to 450m. The depth in the channel ranges from 14...

  4. Geography and Geographical Education in Victoria

    Science.gov (United States)

    Kriewaldt, Jeana

    2006-01-01

    Victoria has just emerged from 10 years where Geography has been one of three strands in the key learning area of Studies of Society and Environment (SOSE). The overarching framework emerged from an attempt to develop a national curriculum. Whilst the national curriculum was rejected by Australian state and territories who each hold legislative…

  5. within the lake victoria basin, tanzania

    African Journals Online (AJOL)

    ABSTRACT. Levels of nitrates (NOg-N) and phosphates (PO4~P) in some satellite lakes within the Lake. Victoria basin were determined in Kagera (Lake Burigt), in Mara (River Mara) and in Mwanza region (Lake Malimbe) during August/September 2002 (dry season) and January/February 2003. (wet season).

  6. D Digital Cadastre Journey in Victoria, Australia

    Science.gov (United States)

    Shojaei, D.; Olfat, H.; Briffa, M.; Rajabifard, A.

    2017-10-01

    Land development processes today have an increasing demand to access three-dimensional (3D) spatial information. Complex land development may need to have a 3D model and require some functions which are only possible using 3D data. Accordingly, the Intergovernmental Committee on Surveying and Mapping (ICSM), as a national body in Australia provides leadership, coordination and standards for surveying, mapping and national datasets has developed the Cadastre 2034 strategy in 2014. This strategy has a vision to develop a cadastral system that enables people to readily and confidently identify the location and extent of all rights, restrictions and responsibilities related to land and real property. In 2014, the land authority in the state of Victoria, Australia, namely Land Use Victoria (LUV), has entered the challenging area of designing and implementing a 3D digital cadastre focused on providing more efficient and effective services to the land and property industry. LUV has been following the ICSM 2034 strategy which requires developing various policies, standards, infrastructures, and tools. Over the past three years, LUV has mainly focused on investigating the technical aspect of a 3D digital cadastre. This paper provides an overview of the 3D digital cadastre investigation progress in Victoria and discusses the challenges that the team faced during this journey. It also addresses the future path to develop an integrated 3D digital cadastre in Victoria.

  7. CLARIIDAE) FROM THE MWANZA GULF, LAKE VICTORIA

    African Journals Online (AJOL)

    ABSTRACT. Seventeen species of parasites were recovered from 107 I Clarias gariepinus examined flom the. Mwanza Gulf of Lake Victoria. The parasite fauna comprised of four ectoparasites, a. Monogenea, Hirudinea, crustacean and a Digenea,' and fourteen endoparasites, five nematodes,. five trematodes and three ...

  8. Mathematical Problems in Biology : Victoria Conference

    CERN Document Server

    1974-01-01

    A conference on "Some Mathematical Problems in Biology" was held at the University of Victoria, Victoria, B. C. , Canada, from May 7 - 10, 1973. The participants and invited speakers were mathematicians interested in problems of a biological nature, and scientists actively engaged in developing mathematical models in biological fields. One aim of the conference was to attempt to assess what the recent rapid growth of mathematical interaction with the biosciences has accomplished and may accomplish in the near future. The conference also aimed to expose the problems of communication bet~",een mathematicians and biological scientists, and in doing so to stimulate the interchange of ideas. It was recognised that the topic spans an enormous breadth, and little attempt was made to balance the very diverse areas. Widespread active interest was shown in the conference, and just over one hundred people registered. The varied departments and institutions across North America from which the participants came made it bo...

  9. AcEST: BP913599 [AcEST

    Lifescience Database Archive (English)

    Full Text Available VGP_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) ...s) Value sp|Q6UY66|VGP_MABVO Envelope glycoprotein OS=Lake Victoria marbu... 31 2...P_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) GN

  10. Pancam Peek into 'Victoria Crater' (Stereo)

    Science.gov (United States)

    2006-01-01

    [figure removed for brevity, see original site] Left-eye view of a stereo pair for PIA08776 [figure removed for brevity, see original site] Right-eye view of a stereo pair for PIA08776 A drive of about 60 meters (about 200 feet) on the 943rd Martian day, or sol, of Opportunity's exploration of Mars' Meridiani Planum region (Sept. 18, 2006) brought the NASA rover to within about 50 meters (about 160 feet) of the rim of 'Victoria Crater.' This crater has been the mission's long-term destination for the past 21 Earth months. Opportunity reached a location from which the cameras on top of the rover's mast could begin to see into the interior of Victoria. This stereo anaglyph was made from frames taken on sol 943 by the panoramic camera (Pancam) to offer a three-dimensional view when seen through red-blue glasses. It shows the upper portion of interior crater walls facing toward Opportunity from up to about 850 meters (half a mile) away. The amount of vertical relief visible at the top of the interior walls from this angle is about 15 meters (about 50 feet). The exposures were taken through a Pancam filter selecting wavelengths centered on 750 nanometers. Victoria Crater is about five times wider than 'Endurance Crater,' which Opportunity spent six months examining in 2004, and about 40 times wider than 'Eagle Crater,' where Opportunity first landed. The great lure of Victoria is the expectation that a thick stack of geological layers will be exposed in the crater walls, potentially several times the thickness that was previously studied at Endurance and therefore, potentially preserving several times the historical record.

  11. Implementation of the victoria bowel performance scale.

    Science.gov (United States)

    Hawley, Philippa; Barwich, Doris; Kirk, Lisa

    2011-12-01

    There is a lack of evidence to guide constipation management in patients receiving palliative care. Data collection requires the systematic use of validated assessment tools. The objective of this study was to assess the usefulness of the Victoria Bowel Performance Scale (BPS) as an audit tool. Charts were reviewed before and after the implementation of a program to monitor constipation through repeated use of the Victoria Bowel Scale. The program was initiated at three oncology pain and symptom management clinics, four palliative care units, and four residential hospices. An additional "control" palliative care unit introduced new nursing assessment tools without the new scale. The Victoria BPS was recorded at 86% of 192 postimplementation outpatient clinic visits and was easy to use in this setting. Documentation of bowel performance at comparable visits improved from 44% to 66% (Passessment tool, uniquely incorporating the patient's usual bowel function. Modifications to the scale have been made to improve clarity and allow for the expected drop in bowel activity seen in end-of-life care. Considerable educational effort and appropriate organization of the charts are required for optimal implementation. The proportion of revised BPS scores ranging from -1 to +1 is proposed as an indicator of satisfactory bowel management for clinical, audit, and research purposes. Copyright © 2011 U.S. Cancer Pain Relief Committee. Published by Elsevier Inc. All rights reserved.

  12. DISTRIBUTION IN NON-TRAWLABLE AREAS OF LAKE VICTORIA ...

    African Journals Online (AJOL)

    Victoria. Netherlands Journal of. Zoology 42'. 214 -232. Witte F, Goldschmidt PC and Wanink JH. 1995. Dynamics of the haplochromine cichlid fauna and other ecological changes in the. Mwanza gmlf of Lake Victoria. In: Pitcher TH and Hart PJB (eds):. Impact of species change in fiican lakes. Chapman & Hall, London, pp.

  13. Adaptive responses to environmental changes in Lake Victoria cichlids

    NARCIS (Netherlands)

    Rijssel, Jacobus Cornelis van (Jacco)

    2014-01-01

    Lake Victoria cichlids show the fastest vertebrate adaptive radiation known which is why they function as a model organism to study evolution. In the past 40 years, Lake Victoria experienced severe environmental changes including the boom of the introduced, predatory Nile perch and eutrophication.

  14. Gender Integration in the Management of the Lake Victoria Fisheries ...

    African Journals Online (AJOL)

    The riparian governments of Lake Victoria have adopted co-management approach in fisheries management. This paper discusses gender mainstreaming in fisheries management of Lake Victoria, user rights, successes and challenges of the process. This paper has used gender-disaggregated data from several studies ...

  15. Degradation of Victoria Crater, Meridiani Planum, Mars

    Science.gov (United States)

    Grant, J. A.; Wilson, S. A.; Cohen, B. A.; Golombek, M. P.; Geissler, P. E.; Sullivan, R. J.

    2007-12-01

    Victoria crater (2.05N, 354.51E) is ~750 m in diameter and the largest crater on Mars observed in situ. The Mars Exploration Rover Opportunity traversed NW to SE across a broad annulus dominated by dark sand that at least partially surrounds the crater before navigating the northern crater rim. Rover observations of the crater and ejecta deposits are complemented by images with 26-52 cm/pixel scales from the High Resolution Imaging Science Experiment (HiRISE) on Mars Reconnaissance Orbiter and enable assessment of degradation state. The present depth/diameter ratio for Victoria is 0.1, less than the 0.2 expected for a pristine primary impact structure. Together with the eroded, serrated rim, this implies an originally smaller crater diameter and/or considerable infilling consistent with occurrence of a large dune field and few exposed rocks on the crater floor. The height and width of the raised rim is generally 4-5 m and 150-225 m, respectively, less than the 30 m and 500-600 m, respectively, expected for a pristine 750 m diameter crater. Ejecta thicknesses around the rim were derived using rover-based and HiRISE images and yield consistent estimates averaging ~3 m. The serrated rim plan creates a series of promontories extending up to 50 m into the crater and generally fronted by 30-60 degree slopes that are locally vertical and are separated by bays whose floors typically slope 15-25 degrees. A crater originally on order of 600-650 m in diameter and subsequently enlarged by mass wasting and aeolian erosion may yield a structure resembling Victoria today. The steep expression of the promontories and local outcroppings of rocks in the ejecta blanket points to some ongoing mass wasting, but the relative paucity of associated flanking talus indicates derived blocks of sulfate sandstone are not resistant to saltating sand and are rapidly broken down by the wind or are completely covered/filled in by aeolian drift. At Cape St. Vincent, the promontory appears undercut

  16. The Bands Culture in Victoria, Australia: Live Music Benefits Career Paths, Employment and Community

    Science.gov (United States)

    Watson, Amanda; Forrest, David

    2012-01-01

    This study explores the career paths, employment, business opportunities and community contributions made available through the provision and development of the contemporary performance bands' culture in the State of Victoria. It is framed with the support given to live music performers by Arts Victoria, Small Business Victoria and Music Victoria.…

  17. Accounting for Violence at the Victoria Industrial School

    National Research Council Canada - National Science Library

    Bryan Hogeveen

    2009-01-01

    Boys who were inmates at the Victoria Industrial School (VIS) from its opening in 1887 to its closure in 1934 often suffered extreme, violent, and capricious penalties and encountered calculated psychological manipulation...

  18. Ecological Biogeography of the Terrestrial Nematodes of Victoria Land, Antarctica

    Science.gov (United States)

    Adams, Byron J.; Wall, Diana H.; Virginia, Ross A.; Broos, Emma; Knox, Matthew A.

    2014-01-01

    Abstract The terrestrial ecosystems of Victoria Land, Antarctica are characteristically simple in terms of biological diversity and ecological functioning. Nematodes are the most commonly encountered and abundant metazoans of Victoria Land soils, yet little is known of their diversity and distribution. Herein we present a summary of the geographic distribution, habitats and ecology of the terrestrial nematodes of Victoria Land from published and unpublished sources. All Victoria Land nematodes are endemic to Antarctica, and many are common and widely distributed at landscape scales. However, at smaller spatial scales, populations can have patchy distributions, with the presence or absence of each species strongly influenced by specific habitat requirements. As the frequency of nematode introductions to Antarctica increases, and soil habitats are altered in response to climate change, our current understanding of the environmental parameters associated with the biogeography of Antarctic nematofauna will be crucial to monitoring and possibly mitigating changes to these unique soil ecosystems. PMID:25061360

  19. Recombinant vesicular stomatitis virus vaccine vectors expressing filovirus glycoproteins lack neurovirulence in nonhuman primates.

    Directory of Open Access Journals (Sweden)

    Chad E Mire

    Full Text Available The filoviruses, Marburg virus and Ebola virus, cause severe hemorrhagic fever with high mortality in humans and nonhuman primates. Among the most promising filovirus vaccines under development is a system based on recombinant vesicular stomatitis virus (rVSV that expresses an individual filovirus glycoprotein (GP in place of the VSV glycoprotein (G. The main concern with all replication-competent vaccines, including the rVSV filovirus GP vectors, is their safety. To address this concern, we performed a neurovirulence study using 21 cynomolgus macaques where the vaccines were administered intrathalamically. Seven animals received a rVSV vector expressing the Zaire ebolavirus (ZEBOV GP; seven animals received a rVSV vector expressing the Lake Victoria marburgvirus (MARV GP; three animals received rVSV-wild type (wt vector, and four animals received vehicle control. Two of three animals given rVSV-wt showed severe neurological symptoms whereas animals receiving vehicle control, rVSV-ZEBOV-GP, or rVSV-MARV-GP did not develop these symptoms. Histological analysis revealed major lesions in neural tissues of all three rVSV-wt animals; however, no significant lesions were observed in any animals from the filovirus vaccine or vehicle control groups. These data strongly suggest that rVSV filovirus GP vaccine vectors lack the neurovirulence properties associated with the rVSV-wt parent vector and support their further development as a vaccine platform for human use.

  20. Victoria Land, Ross Sea, and Ross Ice Shelf, Antarctica

    Science.gov (United States)

    2002-01-01

    On December 19, 2001, MODIS acquired data that produced this image of Antarctica's Victoria Land, Ross Ice Shelf, and the Ross Sea. The coastline that runs up and down along the left side of the image denotes where Victoria Land (left) meets the Ross Ice Shelf (right). The Ross Ice Shelf is the world's largest floating body of ice, approximately the same size as France. Credit: Jacques Descloitres, MODIS Land Rapid Response Team, NASA/GSFC

  1. Prantslastelt õppimas / Marve Koppel, Heli Leppik

    Index Scriptorium Estoniae

    Koppel, Marve

    2005-01-01

    Kuressaare ametikoolis järgmisel õppeaastal rakenduvast majutuskorralduse eriala õppekavast, mille koostamisel on eeskujuks võetud Prantsuse hotellikooli Lycee d'Hotellerie et de Tourisme Saint-Quentin-en-Yvelines õppekava

  2. The Early (Feminist Essays of Victoria Ocampo

    Directory of Open Access Journals (Sweden)

    Doris Meyer

    1996-01-01

    Full Text Available This study examines the essays written by Ocampo between 1920 and 1934, prior to the time when she publicly voiced her adhesion to feminism and the rights of women in Argentine society. In these works from her Testimonios in which Ocampo struggles to find her voice as a female writer, the maleable essay serves her need to engage in discursive dialogues from the margins of the literary culture of her time. Both as a woman and a member of the oligarchy, she questions cultural assumptions and gender-based binary structures common among the male writers of her time, many of whom she knew personally. Using rhetorical strategies that show the self-reflexive and subversive nature of her writing, Ocampo reads and reinterprets these works from a parenthetical feminist perspective, contesting their intellectual and aesthetic biases. The active agency of the reader as writer in these early essays shows Ocampo's awareness of her own unorthodox subject position—alienated from the conventions of her class, her gender, her national culture and language. Her autobiographical musings and her engagement with literary modernity in the 1920s and 1930s reveal a woman who accepted the liabilities of articulating an autonomous self, both in a European and a Latin American context. The influence of family bonds and patriarchal morality decisively shaped, but did not ultimately control, the way Victoria Ocampo eventually defined herself as a feminist author.

  3. An assessement of the ecosystem health of Lake Victoria (East Africa)

    African Journals Online (AJOL)

    An assessement of the ecosystem health of Lake Victoria (East Africa): Current status, trends and impacts to fishery. ... complicated the ecosystem dynamics of Lake Victoria and pose serious uncertainties about its future stability and sustainability of the fisheries resources. Lake Victoria's future sustainability requires ...

  4. Contravention of town planning regulations in Ikoyi and Victoria ...

    African Journals Online (AJOL)

    The study investigated possible relationships between educational attainment, awareness of town planning regulations and contravening these regulations in Ikoyi and Victoria Island, Lagos. Both primary and secondary data were used for the study. Secondary data were obtained from both published and unpublished ...

  5. 3D DIGITAL CADASTRE JOURNEY IN VICTORIA, AUSTRALIA

    Directory of Open Access Journals (Sweden)

    D. Shojaei

    2017-10-01

    Full Text Available Land development processes today have an increasing demand to access three-dimensional (3D spatial information. Complex land development may need to have a 3D model and require some functions which are only possible using 3D data. Accordingly, the Intergovernmental Committee on Surveying and Mapping (ICSM, as a national body in Australia provides leadership, coordination and standards for surveying, mapping and national datasets has developed the Cadastre 2034 strategy in 2014. This strategy has a vision to develop a cadastral system that enables people to readily and confidently identify the location and extent of all rights, restrictions and responsibilities related to land and real property. In 2014, the land authority in the state of Victoria, Australia, namely Land Use Victoria (LUV, has entered the challenging area of designing and implementing a 3D digital cadastre focused on providing more efficient and effective services to the land and property industry. LUV has been following the ICSM 2034 strategy which requires developing various policies, standards, infrastructures, and tools. Over the past three years, LUV has mainly focused on investigating the technical aspect of a 3D digital cadastre. This paper provides an overview of the 3D digital cadastre investigation progress in Victoria and discusses the challenges that the team faced during this journey. It also addresses the future path to develop an integrated 3D digital cadastre in Victoria.

  6. Research on School-Based Management in Victoria.

    Science.gov (United States)

    Gamage, David T.; And Others

    1996-01-01

    Describes a 1992-93 research project involving 66 state schools that attempted to ascertain the overall effectiveness of school-based management in Victoria, Australia. Findings of the Likert-style survey revealed substantial participant satisfaction with school councils' current composition, information provision, and overall functioning. (20…

  7. Fishing Business Arrangements and Sustainability in Lake Victoria ...

    African Journals Online (AJOL)

    In this article an attempt is made to analyse the existing production relations between the owners of the vessels and the crewmembers and the concern for sustainability. Our results found that the existing sharing system in Lake Victoria poses a big challenge in as far as sustainability is concerned. Some of the system such ...

  8. Implementing Co-management of Lake Victoria's Fisheries ...

    African Journals Online (AJOL)

    There are still many challenges facing the sustainable management of Lake Victoria fisheries, including; lack of compliance with regulations and rapid increase in fishing effort, environmental degradation, inadequate service provision and the high prevalence of HIV/AIDS amongst the fishing communities. Key words: Lake ...

  9. The Lake Victoria Intense Storm Early Warning System (VIEWS)

    Science.gov (United States)

    Thiery, Wim; Gudmundsson, Lukas; Bedka, Kristopher; Semazzi, Fredrick; Lhermitte, Stef; Willems, Patrick; van Lipzig, Nicole; Seneviratne, Sonia I.

    2017-04-01

    Weather extremes have harmful impacts on communities around Lake Victoria in East Africa. Every year, intense nighttime thunderstorms cause numerous boating accidents on the lake, resulting in thousands of deaths among fishermen. Operational storm warning systems are therefore crucial. Here we complement ongoing early warning efforts based on NWP, by presenting a new satellite data-driven storm prediction system, the prototype Lake Victoria Intense storm Early Warning System (VIEWS). VIEWS derives predictability from the correlation between afternoon land storm activity and nighttime storm intensity on Lake Victoria, and relies on logistic regression techniques to forecast extreme thunderstorms from satellite observations. Evaluation of the statistical model reveals that predictive power is high and independent of the input dataset. We then optimise the configuration and show that also false alarms contain valuable information. Our results suggest that regression-based models that are motivated through process understanding have the potential to reduce the vulnerability of local fishing communities around Lake Victoria. The experimental prediction system is publicly available under the MIT licence at http://github.com/wthiery/VIEWS.

  10. Study of genetic variation in population of Bipolaris victoriae , the ...

    African Journals Online (AJOL)

    Isolates of Bipolaris victoriae were analysed by random amplified polymorphic DNA (RAPD) techniques to determine the amount of intraspecific genetic variability. Seven primers were applied and DNA bands of 200-5000 bp were produced. Cluster analysis using UPGMA method gave five groups. Levels of polymorphism ...

  11. satellite lakes of lake victoria basin (tanzanian side)

    African Journals Online (AJOL)

    Studies on phytoplankton species diversity and abundance were carried out in 8 selected satellite lakes within the Lake Victoria ... cyanobacteria occurrence and their unforeseen effects such as toxin production and oxygen depletion during nights that may ..... Species extinction and concomitant ecological changes in Lake.

  12. Governance and Welfare of Fishing Communities of Lake Victoria ...

    African Journals Online (AJOL)

    ... have potable water or electricity. Educational standards remain low and many communities lack proper sanitation, and are therefore at risk of disease, while most basic facilities such as hospitals, schools and clinics are not within their reach. Key Words; Co-management, Beach Management Units, Lake Victoria, Health, ...

  13. Total mercury concentration in common fish species of Lake Victoria ...

    African Journals Online (AJOL)

    Total mercury (THg) concentration was analysed in muscles of common fish species of Lake Victoria in the eastern and southern parts of the lake using cold vapour Atomic Absorption Spectrophotometric technique. Mercury concentration in all fish species was generally lower than the WHO maximum allowable ...

  14. Transactional sex in the fishing communities along Lake Victoria ...

    African Journals Online (AJOL)

    The study describes the nature, context and implications of a unique form of transactional sexual relationships in the fishing communities along Lake Victoria in Kisumu County, Kenya. We conducted 12 focus group discussions and 17 key informant interviews among fishermen, fishmongers and fish transporters in Kisumu.

  15. Domestication of medicinal tree species in the Victoria lakeshore ...

    African Journals Online (AJOL)

    Mo

    Therefore, there is high potential of marketing forest products by the subsistence farmers. Growing medicinal plants is one great opportunity for raising household incomes in this area. A survey was conducted among herbalists living around the Victoria lakeshore region. Questionnaires were administered through formal ...

  16. Catalogue Use at the State Library of Victoria

    Science.gov (United States)

    Hider, Philip

    2008-01-01

    A questionnaire survey conducted at the State Library of Victoria indicates that users in general, and not just scholars, value the standard elements of bibliographic data found in the Library's catalogues, and consider all these elements useful for finding, identifying and selecting items. Rather than making do with less, users wanted more…

  17. Vocabulary Size Research at Victoria University of Wellington, New Zealand

    Science.gov (United States)

    Nation, Paul; Coxhead, Averil

    2014-01-01

    The English Language Institute (now the School of Linguistics and Applied Language Studies) at Victoria University of Wellington has a long history of corpus-based vocabulary research, especially after the arrival of the second director of the institute, H. V. George, and the appointment of Helen Barnard, whom George knew in India. George's…

  18. SEDIMENTS FROM SOUTHERN LAKE VICTORIA AND ITS BASIN

    African Journals Online (AJOL)

    Water, sediment and soil samples collected from Southern Lake Victoria and its basin were analysed for 76 organochlorine, organophosphorous, carbamate and pyrethroid pesticide residues. The samples were collected from sampling stations in nine districts on the Tanzanian side of the lake, namely Mwanza, Sengerema ...

  19. Early warnings of hazardous thunderstorms over Lake Victoria

    NARCIS (Netherlands)

    Thiery, Wim; Gudmundsson, Lukas; Bedka, Kristopher; Semazzi, Fredrick H.M.; Lhermitte, S.L.M.; Willems, Patrick; van Lipzig, Nicole P. M.; Seneviratne, Sonia I.

    2017-01-01

    Weather extremes have harmful impacts on communities around Lake Victoria in East Africa. Every year, intense nighttime thunderstorms cause numerous boating accidents on the lake, resulting in thousands of deaths among fishermen. Operational storm warning systems are therefore crucial. Here we

  20. Lake Victoria's Water Budget and the Potential Effects of Climate ...

    African Journals Online (AJOL)

    This paper presents the Lake Victoria water budget for the period 1950-2004 and findings of a study on potential climate change impact on the lake's Hydrology through the 21st Century. The mass balance components are computed from measured and simulated data. A2 and B2 emission scenarios of the Special Report ...

  1. Early warnings of hazardous thunderstorms over Lake Victoria

    Science.gov (United States)

    Thiery, Wim; Gudmundsson, Lukas; Bedka, Kristopher; Semazzi, Fredrick H. M.; Lhermitte, Stef; Willems, Patrick; van Lipzig, Nicole P. M.; Seneviratne, Sonia I.

    2017-07-01

    Weather extremes have harmful impacts on communities around Lake Victoria in East Africa. Every year, intense nighttime thunderstorms cause numerous boating accidents on the lake, resulting in thousands of deaths among fishermen. Operational storm warning systems are therefore crucial. Here we complement ongoing early warning efforts based on numerical weather prediction, by presenting a new satellite data-driven storm prediction system, the prototype Lake Victoria Intense storm Early Warning System (VIEWS). VIEWS derives predictability from the correlation between afternoon land storm activity and nighttime storm intensity on Lake Victoria, and relies on logistic regression techniques to forecast extreme thunderstorms from satellite observations. Evaluation of the statistical model reveals that predictive power is high and independent of the type of input dataset. We then optimise the configuration and show that false alarms also contain valuable information. Our results suggest that regression-based models that are motivated through process understanding have the potential to reduce the vulnerability of local fishing communities around Lake Victoria. The experimental prediction system is publicly available under the MIT licence at http://github.com/wthiery/VIEWS.

  2. Climate Change and Fishery Sustainability in Lake Victoria ...

    African Journals Online (AJOL)

    The fisheries of Lake Victoria have recently undergone rapid ecological and social change. Loss of diversity in terms of species richness and economic opportunity has increased the system's vulnerability to additional economic, ecological, and social stressors predicted with future climate change. This paper discusses the ...

  3. Measles outbreak in young adults in Victoria, 1999.

    Science.gov (United States)

    Lambert, S B; Morgan, M L; Riddell, M A; Andrews, R M; Kelly, H A; Leydon, J A; Catton, M C; Lynch, P A; Gercovich, D K; Lester, R A; Carnie, J A; Rouch, G J

    2000-11-06

    To describe an outbreak of measles in Victoria. Case series with cases identified through enhanced passive surveillance and outbreak-related active surveillance. State of Victoria, 1999. Number of cases; epidemiological links and patterns of transmission; patient demographic features and vaccination status; complications. 75 cases were identified (74 laboratory-confirmed; and one epidemiologically linked to a laboratory-confirmed case), with onset between 11 February and 2 May 1999. The first case was in a 21-year-old woman who had recently holidayed in Bali and worked at a large cinema complex in Melbourne. Sixteen cases occurred in people who had contact with the index case at the cinema on one evening. The outbreak spread to regional Victoria and South Australia. Median age of patients was 22 years; 64 (85%) were born between 1968 and 1981, with only one patient in the age group targeted by the primary school component of the 1998 Australian Measles Control Campaign; this child had not been vaccinated. More than a third of patients (28) were hospitalised (total, 97 inpatient days), and five were healthcare workers. This outbreak was caused by international importation of measles virus. It highlights the change in epidemiology of measles in Australia, from a disease of childhood to one predominantly affecting young adults. A strong two-dose childhood vaccination program, vigilant surveillance, and rapid response to outbreaks will continue to be the basis of measles control, but better protection for young adults should be considered.

  4. An examination of injection drug use trends in Victoria and Vancouver, BC after the closure of Victoria's only fixed-site needle and syringe programme.

    Science.gov (United States)

    Ivsins, Andrew; Chow, Clifton; Macdonald, Scott; Stockwell, Tim; Vallance, Kate; Marsh, David C; Michelow, Warren; Duff, Cameron

    2012-07-01

    Needle and syringe programmes (NSPs) have been established as effective harm reduction initiatives to reduce injection drug use (IDU)-related risk behaviours, including sharing needles. On May 31, 2008, Victoria, BC's only fixed site NSP was shut down due to community and political pressure. This study examines and compares IDU trends in Victoria with those in Vancouver, BC, a city which has not experienced any similar disruption of IDU-related public health measures. Quantitative and qualitative data were collected by interviewer-administered questionnaires conducted with injection drug users (n=579) in Victoria and Vancouver between late 2007 and late 2010. Needle sharing increased in Victoria from under 10% in early 2008 to 20% in late 2010, whilst rates remained relatively low in Vancouver. Participants in Victoria were significantly more likely to share needles than participants in Vancouver. Qualitative data collected in Victoria highlight the difficulty participants have experienced obtaining clean needles since the NSP closed. Recent injection of crack cocaine was independently associated with needle sharing. The closure of Victoria's fixed site NSP has likely resulted in increased engagement in high-risk behaviours, specifically needle sharing. Our findings highlight the contribution of NSPs as an essential public health measure. Copyright © 2011 Elsevier B.V. All rights reserved.

  5. Increasing deaths involving oxycodone, Victoria, Australia, 2000-09.

    Science.gov (United States)

    Rintoul, Angela C; Dobbin, Malcolm D H; Drummer, Olaf H; Ozanne-Smith, Joan

    2011-08-01

    In light of an emerging epidemic identified in the United States and Canada, to identify trends in fatal drug toxicity involving oxycodone and the demographic characteristics and indicators of socioeconomic disadvantage of the deceased. Population-based observational study in Victoria, Australia. Decedents whose death was reported to the Victorian Coroner between 2000 and 2009 and where oxycodone was detected. Association between supply of oxycodone and deaths. Demographic characteristics of decedents. Rate ratios of the rural or metropolitan location and socioeconomic indicators of disadvantage of the deceased. Supply to Victoria has increased nine-fold from 7.5 mg per capita in 2000 to 67.5 mg per capita in 2009. Detection of oxycodone in deaths reported to the Victorian Coroner has increased from 4 (0.08/100,000 population) in 2000 to 97 (1.78/100,000 population) in 2009-a 21-fold increase in deaths. Of the 320 cases described, 53.8% (172) were the result of drug toxicity. Of these, 52.3% were unintentional and 19.8% intentional self-harm; the remaining 27.9% are either still under investigation by the coroner or intent is unknown. Drug toxicity deaths were overrepresented in both rural areas and areas indexed with high levels of disadvantage. The substantial increase in the number of deaths involving oxycodone is strongly and significantly associated with the increase in supply. Most drug toxicity deaths involving oxycodone were unintentional. This newly identified trend in fatalities in Victoria supports concerns that a pattern of increasing deaths involving oxycodone is emerging globally.

  6. Reforming Victoria's primary health and community service sector: rural implications.

    Science.gov (United States)

    Alford, K

    2000-01-01

    In 1999 the Victorian primary care and community support system began a process of substantial reform, involving purchasing reforms and a contested selection process between providers in large catchment areas across the State. The Liberal Government's electoral defeat in September 1999 led to a review of these reforms. This paper questions the reforms from a rural perspective. They were based on a generic template that did not consider rural-urban differences in health needs or other differences including socio-economic status, and may have reinforced if not aggravated rural-urban differences in the quality of and access to primary health care in Victoria.

  7. Exploration of Victoria crater by the mars rover opportunity

    Science.gov (United States)

    Squyres, S. W.; Knoll, A.H.; Arvidson, R. E.; Ashley, James W.; Bell, J.F.; Calvin, W.M.; Christensen, P.R.; Clark, B. C.; Cohen, B. A.; De Souza, P.A.; Edgar, L.; Farrand, W. H.; Fleischer, I.; Gellert, Ralf; Golombek, M.P.; Grant, J.; Grotzinger, J.; Hayes, A.; Herkenhoff, K. E.; Johnson, J. R.; Jolliff, B.; Klingelhofer, G.; Knudson, A.; Li, R.; McCoy, T.J.; McLennan, S.M.; Ming, D. W.; Mittlefehldt, D. W.; Morris, R.V.; Rice, J. W.; Schroder, C.; Sullivan, R.J.; Yen, A.; Yingst, R.A.

    2009-01-01

    The Mars rover Opportunity has explored Victoria crater, a ???750-meter eroded impact crater formed in sulfate-rich sedimentary rocks. Impact-related stratigraphy is preserved in the crater walls, and meteoritic debris is present near the crater rim. The size of hematite-rich concretions decreases up-section, documenting variation in the intensity of groundwater processes. Layering in the crater walls preserves evidence of ancient wind-blown dunes. Compositional variations with depth mimic those ???6 kilometers to the north and demonstrate that water-induced alteration at Meridiani Planum was regional in scope.

  8. Eesti NATO Ühing juurutab demokraatlikke väärtusi / Victoria Punga ; interv. Aive Antsov

    Index Scriptorium Estoniae

    Punga, Victoria, 1977-

    2007-01-01

    Eesti NATO Ühingu tegevjuht organisatsiooni eesmärkidest, projektidest, koostööst teiste riikidega ning kaitsepoliitika ja majanduse seostest. Lisa: Väljavõte Victoria CVst; Eesti kaitsepoliitika viis plussi Victoria meelest

  9. Lunnyu soils in the Lake Victoria basin of Uganda: Link to ...

    African Journals Online (AJOL)

    Lunnyu soils in the Lake Victoria basin of Uganda: Link to toposequence and soil type. B Fungo, S Grunwald, MM Tenywa, B Vanlauwe, P Nkedi-Kizza. Abstract. We compared the physico-chemical characteristics of Lunnyu soils using soil type and slope position in order to explain their variability in the Lake Victoria basin ...

  10. A Snapshot: Multicultural Music Teaching in Schools in Victoria, Australia, Portrayed by School Teachers

    Science.gov (United States)

    Nethsinghe, Rohan Nishantha

    2012-01-01

    Due to the changing demographic factors and as demanded by the governmental policies and regulations, schools in Victoria, Australia, are expected to foster multicultural educational programs that address the diverse needs of students. Research has found that school teachers in Victoria struggle to provide the aspired to multicultural education…

  11. Editorial The “Eye” of Africa: A Vision of Lake Victoria Basin as an ...

    African Journals Online (AJOL)

    AGHOGHO A

    The “Eye” of Africa: A Vision of Lake Victoria Basin as an Environmental. Observatory. Since my days as a schoolboy in geography class, I have not been able to observe maps of the African continent without also “seeing” the profile of a face, with Lake Victoria representing the right eye, gazing adoringly at Madagascar.

  12. Victoria suudlus teeb maapoisist printsi, kuid mitte tulevase kuninga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Printsess Victoria tulevasest abikaasast Daniel Westlingist, printsess Madelaine'i kihluse lõpetamisest, Bernadotte'ide dünastia asutajast Jean Bernadotte'ist. Monarhia toetajate vähenemisest Rootsis. Printsess Victoria ja Daniel Westlingi pulmatseremooniast 19. juunil

  13. An examination of the selenium nutrition of sheep in Victoria.

    Science.gov (United States)

    Caple, I W; Andrewartha, K A; Edwards, S J; Halpin, C G

    1980-04-01

    The selenium nutrition of sheep throughout Victoria was assessed by a survey of the blood glutathione peroxidase activity in 708 flocks. It was shown that the blood glutathione peroxidase activity in sheep had a seasonal variation with lowest levels in the spring. The enzyme activity was correlated with the blood selenium concentration. Areas where blood selenium was less than 0.03 micrograms/ml in spring were defined. Sheep with low selenium nutrition were grazing pastures in the high rainfall areas on acid soils, particularly those derived from granite. Selenium concentrations in pasture samples examined were greater than 0.02 mg/kg, and it was found that superphosphate application had no significant effect on the selenium content of pasture. However, management practices such as high stocking rates and rates of application of superphosphate to pasture were associated with low blood glutathione peroxidase activities in sheep. It was concluded that the selenium nutrition of most of the sheep flocks in Victoria is adequate, and that the deficient areas are localised. There seems little requirement for supplementation of adult sheep. As the delayed type of white muscle disease in spring lambs appears to be the main selenium-responsive disorder, direct supplementation of lambs in the low selenium areas would be the most effective method of ensuring adequate selenium nutrition.

  14. Epidemiology of the 2012 influenza season in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    James Fielding

    2013-08-01

    Full Text Available Objective: To assess the magnitude and severity of the 2012 influenza season in Victoria, Australia using surveillance data from five sources. Methods: Data from influenza notifications, sentinel general practices, a sentinel hospital network, a sentinel locum service and strain typing databases for 2012 were descriptively analysed. Results: Influenza and influenza-like illness activity was moderate compared to previous years, although a considerable increase in notified laboratory-confirmed influenza was observed. Type A influenza comprised between 83% and 87% of cases from the general practitioners, hospitals and notifiable surveillance data. Influenza A/H3 was dominant in July and August, and most tested isolates were antigenically similar to the A/Perth/16/2009 virus used in the vaccine. There was a smaller peak of influenza type B in September. No tested viruses were resistant to any neuraminidase inhibitor antivirals. Higher proportions of type A/H3, hospitalized cases and those with a comorbid condition indicated for influenza vaccination were aged 65 years or older. Influenza vaccination coverage among influenza-like illness patients was 24% in sentinel general practices and 50% in hospitals. Discussion: The 2012 influenza season in Victoria was average compared to previous years, with an increased dominance of A/H3 accompanied by increases in older and hospitalized cases. Differences in magnitude and the epidemiological profile of cases detected by the different data sources demonstrate the importance of using a range of surveillance data to assess the relative severity of influenza seasons.

  15. Comprehensive nursing education in Victoria: rhetoric or reality?

    Science.gov (United States)

    Happell, B

    2001-12-01

    Significant and widespread changes to the education of the psychiatric nursing workforce in Victoria, Australia are resulting in serious problems in the recruitment of new nursing staff. In reviewing the available literature, it is evident that undergraduate nursing students do not commence their educational program with a strong interest in pursuing a career in psychiatric nursing. In light of this knowledge, the role of education in providing a comprehensive view of the nursing profession becomes paramount. Research investigating the impact of education on the attitudes of students to psychiatric nursing as a career option has produced mixed and often inconclusive results. A longitudinal study was undertaken in Victoria, Australia. Students of the majority of universities in which undergraduate nursing programs were operating participated in this study. The participants were asked to rank nine areas of nursing specialty in order of preference at the commencement and immediately prior to the completion of the nursing program. Despite a significant improvement in the popularity of psychiatric nursing as a career choice, this area was ranked at number 8 at both pre- and post-program test. The analysis of open-ended questions demonstrated a marked change in the overall attitudes towards the mentally ill and psychiatric nursing.

  16. VICTORIA PARK: A DEMOCTRATIC PUBLIC OPEN SPACE FOR INDONESIA DOMESTIC HELPERS (TKW

    Directory of Open Access Journals (Sweden)

    Parmonangan Manurung

    2016-01-01

    Full Text Available Victoria Park is the largest city park in Hong Kong. This city park is not only known in Hong Kong, but also very well known in Indonesia as a gathering place for Indonesia domestic helpers (TKW in Hong Kong. This research tried to find out some determinant factors that have been affected the public open spac of Victoria Park to be a gathering place for thousands of TKW in Sunday and holidays as their day off. In order to get the results of research, some methodological research had been conducted such as: observation (survey, mapping, interviews and literature studies. The results showed that Victoria Park has a number of factors capable of meeting the needs of domestic help-ers in Hong Kong, these factors consist of internal factors and external factors. Internally, the character and functions held Victoria Park became a very influential factor, while externally, the accessibility and support functions around Victoria Park also has a considerable influence.

  17. Infectious Lassa virus, but not filoviruses, is restricted by BST-2/tetherin.

    Science.gov (United States)

    Radoshitzky, Sheli R; Dong, Lian; Chi, Xiaoli; Clester, Jeremiah C; Retterer, Cary; Spurgers, Kevin; Kuhn, Jens H; Sandwick, Sarah; Ruthel, Gordon; Kota, Krishna; Boltz, Dutch; Warren, Travis; Kranzusch, Philip J; Whelan, Sean P J; Bavari, Sina

    2010-10-01

    Bone marrow stromal antigen 2 (BST-2/tetherin) is a cellular membrane protein that inhibits the release of HIV-1. We show for the first time, using infectious viruses, that BST-2 also inhibits egress of arenaviruses but has no effect on filovirus replication and spread. Specifically, infectious Lassa virus (LASV) release significantly decreased or increased in human cells in which BST-2 was either stably expressed or knocked down, respectively. In contrast, replication and spread of infectious Zaire ebolavirus (ZEBOV) and Lake Victoria marburgvirus (MARV) were not affected by these conditions. Replication of infectious Rift Valley fever virus (RVFV) and cowpox virus (CPXV) was also not affected by BST-2 expression. Elevated cellular levels of human or murine BST-2 inhibited the release of virus-like particles (VLPs) consisting of the matrix proteins of multiple highly virulent NIAID Priority Pathogens, including arenaviruses (LASV and Machupo virus [MACV]), filoviruses (ZEBOV and MARV), and paramyxoviruses (Nipah virus). Although the glycoproteins of filoviruses counteracted the antiviral activity of BST-2 in the context of VLPs, they could not rescue arenaviral (LASV and MACV) VLP release upon BST-2 overexpression. Furthermore, we did not observe colocalization of filoviral glycoproteins with BST-2 during infection with authentic viruses. None of the arenavirus-encoded proteins rescued budding of VLPs in the presence of BST-2. Our results demonstrate that BST-2 might be a broad antiviral factor with the ability to restrict release of a wide variety of human pathogens. However, at least filoviruses, RVFV, and CPXV are immune to its inhibitory effect.

  18. VENUS - The Victoria Experimental Network Under the Sea: First Light

    Science.gov (United States)

    Dewey, R. K.; Tunnicliffe, V.; Round, A.

    2006-05-01

    The Victoria Experimental Network Under the Sea (VENUS) is a recently installed cabled ocean observatory representing the next generation of infrastructure technology. VENUS is scheduled to consist of two major segments, one in Saanich Inlet (installed in February 2006), and a second in the Strait of Georgia (planned for October 2006). The technologies associated with both the hardware and software that will deliver data from instruments to scientists is being developed in collaboration with both the NEPTUNE Canada and MARS observatories. The presentation will provide an overview of the science projects planned for stage one of the installed instruments, the engineering design of the infrastructure, the preliminary design of the Data Management and Archive System (DMAS), lessons learned so far, and preliminary results from the first few months of data from Saanich Inlet.

  19. Myxomatosis in the Mallee region of Victoria, Australia.

    Science.gov (United States)

    Shepherd, R C; Edmonds, J W; Nolan, I F; Gocs, A

    1978-10-01

    Sharp reductions in the wild rabbit (Oryctolagus cuniculus (L.)) population in the Mallee are associated with annual myxomatosis epizootics. The extent to which the population reductions are the direct result of the epizootics varies with time of epizootic occurrence. All grazing animals in the Mallee are under nutritional stress each summer and autumn. When the epizootic occurs during the early summer heavy losses occur in a previously healthy population. Similar losses which occur in the late summer and autumn are the result of a nutritional stress - epizootic complex. The end result in each case is a population reduction of about 80%. This reduction occurs in a population which is the most resistant to myxomatosis known in Victoria and in association with epizootics caused by field strains of myxoma virus of moderate virulence only. The earlier summer epizootics are of considerable economic importance because they sharply reduce the pressure on the limited food available for other grazing animals.

  20. Literatura y vida. Una lectura de Victoria Ocampo

    Directory of Open Access Journals (Sweden)

    María Celia Vázquez

    2006-09-01

    Full Text Available The relation of literature, writer and life, particularly, the way life is understood within this relation constitutes a key element to define the peculiar way of reading literature that Victoria Ocampo had. This can be seen in her essay on Emily Brontë; though she gives priority to biography over aesthetics, Ocampo does not adopt a biographical approach nor identifies the meaning of life with that of the writer's biography since she searches the key for interpretation in natural forces such as "character" and "fate" (instead of the positivistic interaction of social and historical environment. Thus, she identifies the vital experience of nature (the moors as the key for the writer's personality as well as her novel's, Wuthering Heights.

  1. Color variations on Victoria quadrangle: support for the geological mapping

    Science.gov (United States)

    Zambon, F.; Galluzzi, V.; Carli, C.; Giacomini, L.; Massironi, M.; Palumbo, P.; Guzzetta, L.; Mancinelli, P.; Vivaldi, V.; Ferranti, L.; Pauselli, C.; Frigeri, A.; Zusi, M.; Pozzobon, R.; Cremonese, G.; Ferrari, S.; Capaccioni, F.

    2015-10-01

    Mercury is the closest planet to the Sun. Its extreme thermal environment makes it difficult to explore onsite. In 1974, Mariner 10, the first mission dedicated to Mercury, covered 45% of the surface during of the three Hermean flybys [1]. For about 30 years after Mariner 10, no other mission has flownto Mercury. Many unresolved issues need an answer, and in recent years the interest about Mercury has increased. MESSENGER mission contributed to understand Mercury's origin, its surface structure, and the nature of its magnetic field, exosphere, and magnetosphere [1]. The Mercury Dual Imaging System (MDIS) provided a global coverage of Mercury surface with variable spatial resolution. MDIS is equipped with a narrow angle camera (NAC), dedicated to the study of the geology and a wide angle camera (WAC) with 12 filters useful to investigate the surface composition[2]. Mercury has been divided into 15 quadrangles for mapping purposes [3]. The mapping process permits integration of different geological surface information to better understand the planet crust formation and evolution. Merging spectroscopically data is a poorly followed approach in planetary mapping, but it gives additional information about lithological composition, contributing to the construction of a more complete geological map [e.g. 4]. Recently, [5] proposed a first detailed map of all the Victoria quadrangle (H2). Victoria quadrangle is located in a longitude range between 270°E and 360°E and a latitude range of 22.5°N and 65°N,and itwas only partially mapped by Mariner 10 data[3]. Here we investigate the lithological variation by using the MDIS-WAC data to produce a set of color map products which could be asupport to the geological mapping [5]. The future ESA-JAXA mission to Mercury, BepiColombo, will soon contribute to improve the knowledge of Mercury surface composition and geology thanks to the Spectrometer and Imagers for MPO BepiColombo-Integrated Observatory SYStem (SIMBIO-SYS)[6].

  2. Critical Comments on Brian Victoria's "Engaged Buddhism: Skeleton in the Closet?"

    Directory of Open Access Journals (Sweden)

    Koichi Miyata

    2015-02-01

    Full Text Available In "Engaged Buddhism: A Skeleton in the Closet?" (Vol. 2 Brian Daizen Victoria claims, among other things, that Tsunesaburo Makiguchi (1871-1944, founder of the Soka Kyoiku Gakkai (forebear of the Soka Gakkai and Soka Gakkai International, was an active supporter of the Japanese wars of aggression. In this response, Koichi Miyata argues that Victoria's claims rest on the highly selective use of quotes, and ignore key interpretative issues associated with Japanese imperial fascism and its underlying belief structures. Miyata discusses the significance of Makiguchi's arrest and imprisonment under a law specifically aimed at opponents of the war efforts, in his analysis of critical lapses in Victoria's article.

  3. AcEST: DK961456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 74EF isoform B OS... 32 4.1 sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria...S VT Sbjct: 62 SPVT 65 >sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Muso

  4. End‐of‐life decisions in medical practice: a survey of doctors in Victoria (Australia)

    Science.gov (United States)

    Neil, D A; Coady, C A J; Thompson, J; Kuhse, H

    2007-01-01

    Objectives To discover the current state of opinion and practice among doctors in Victoria, Australia, regarding end‐of‐life decisions and the legalisation of voluntary euthanasia. Longitudinal comparison with similar 1987 and 1993 studies. Design and participants Cross‐sectional postal survey of doctors in Victoria. Results 53% of doctors in Victoria support the legalisation of voluntary euthanasia. Of doctors who have experienced requests from patients to hasten death, 35% have administered drugs with the intention of hastening death. There is substantial disagreement among doctors concerning the definition of euthanasia. Conclusions Disagreement among doctors concerning the meaning of the term euthanasia may contribute to misunderstanding in the debate over voluntary euthanasia. Among doctors in Victoria, support for the legalisation of voluntary euthanasia appears to have weakened slightly over the past 17 years. Opinion on this issue is sharply polarised. PMID:18055904

  5. Eutrophication, Nile perch and food-web interactions in south-east Lake Victoria

    NARCIS (Netherlands)

    Cornelissen, I.J.M.

    2015-01-01

    The increasing eutrophication, the introduction of Nile perch (Lates niloticus) and the increasing fishing pressure has changed Lake Victoria tremendously the last century. Since the 1960s, eutrophication increased primary production, enabling an increase in fish production. However, eutrophication

  6. Ecological Biogeography of the Terrestrial Nematodes of Victoria Land, Antarctica

    Directory of Open Access Journals (Sweden)

    Byron Adams

    2014-06-01

    Full Text Available The terrestrial ecosystems of Victoria Land, Antarctica are characteristically simple in terms of biological diversity and ecological functioning. Nematodes are the most commonly encountered and abundant metazoans of Victoria Land soils, yet little is known of their diversity and distribution. Herein we present a summary of the geographic distribution, habitats and ecology of the terrestrial nematodes of Victoria Land from published and unpublished sources. All Victoria Land nematodes are endemic to Antarctica, and many are common and widely distributed at landscape scales. However, at smaller spatial scales, populations can have patchy distributions, with the presence or absence of each species strongly influenced by specific habitat requirements. As the frequency of nematode introductions to Antarctica increases, and soil habitats are altered in response to climate change, our current understanding of the environmental parameters associated with the biogeography of Antarctic nematofauna will be crucial to monitoring and possibly mitigating changes to these unique soil ecosystems.

  7. Analysis of an Organisation: A University of the Third Age (U3A), Mornington, Victoria

    Science.gov (United States)

    Small, Michael

    2017-01-01

    The purpose of this paper is two fold: to look at Mornington U3A in organisational terms and then look at U3AM as a loosely coupled system. One outcome of the study would be to undertake further analyses of U3As in Victoria to determine the levels of bureaucracy under which each operates. Questions to be asked: are U3As in Victoria operating as…

  8. Sensitivity analysis of the GNSS derived Victoria plate motion

    Science.gov (United States)

    Apolinário, João; Fernandes, Rui; Bos, Machiel

    2014-05-01

    Fernandes et al. (2013) estimated the angular velocity of the Victoria tectonic block from geodetic data (GNSS derived velocities) only.. GNSS observations are sparse in this region and it is therefore of the utmost importance to use the available data (5 sites) in the most optimal way. Unfortunately, the existing time-series were/are affected by missing data and offsets. In addition, some time-series were close to the considered minimal threshold value to compute one reliable velocity solution: 2.5-3.0 years. In this research, we focus on the sensitivity of the derived angular velocity to changes in the data (longer data-span for some stations) by extending the used data-span: Fernandes et al. (2013) used data until September 2011. We also investigate the effect of adding other stations to the solution, which is now possible since more stations became available in the region. In addition, we study if the conventional power-law plus white noise model is indeed the best stochastic model. In this respect, we apply different noise models using HECTOR (Bos et al. (2013), which can use different noise models and estimate offsets and seasonal signals simultaneously. The seasonal signal estimation is also other important parameter, since the time-series are rather short or have large data spans at some stations, which implies that the seasonal signals still can have some effect on the estimated trends as shown by Blewitt and Lavellee (2002) and Bos et al. (2010). We also quantify the magnitude of such differences in the estimation of the secular velocity and their effect in the derived angular velocity. Concerning the offsets, we investigate how they can, detected and undetected, influence the estimated plate motion. The time of offsets has been determined by visual inspection of the time-series. The influence of undetected offsets has been done by adding small synthetic random walk signals that are too small to be detected visually but might have an effect on the

  9. Compositional variations on Mercury: Results from the Victoria quadrangle

    Science.gov (United States)

    Zambon, Francesca; Carli, Cristian; Galluzzi, Valentina; Capaccioni, Fabrizio; Giacomini, Lorenza; Massironi, Matteo; Palumbo, Pasquale; Cremonese, Gabriele

    2017-04-01

    Mercury was recently explored by the MESSENGER mission that orbited around the planet from March 2011 until April 2015 allowing a complete coverage of its surface. The Mercury Dual Imaging System (MDIS), mapped the Hermean surface at different spatial resolutions, due to variable altitude of the spacecraft from the surface. MDIS consists of two instruments: a Narrow Angle Camera (NAC) centered at 747nm, which acquired high-resolution images for the geological analysis, and the Wide Angle Camera (WAC), provided with 11 filters dedicated to the compositional analysis, operating in a range of wavelengths between 395 and 1040 nm. Mercury's surface has been divided into 15 quadrangles for mapping purposes. Here, we analyze the results obtained by the color composite mosaic of the quadrangle Victoria (H02) located at longitudes 270 ° - 360 ° E, and latitudes 22.5 ° N - 65 ° N. We produced a color mosaic, by using the images relative to the filters with the best spatial coverage. To obtain the 8-color mosaic of the Victoria quadrangle, we calibrated and georefenced the WAC raw images. Afterwards, we applied the Hapke photometric correction by using the parameters derived by Domingue et al. (2015). We projected and coregistered the data, and finally, we produced the mosaic. To analyze the compositional variations of the Victoria quadrangle, we consider different techniques of analysis, such as specific RGB color combinations and band ratios, which emphasize the different compositional characteristics of the surface. Furthermore, the use of clustering and classification methods allows for recognizing various terrain units, in terms of reflectance and spectral characteristics. In the H02 quadrangle, we observed a dichotomy in the RGB mosaic (R: second principal component (PC2), G: first principal component (PC1), B: 430/1000 nm; see Denevi et al. 2009) between the northern region of the quadrangle, dominated by smooth plains, and the southern part, characterized by

  10. Assessment of spatial rainfall variability in Lake Victoria Basin

    Science.gov (United States)

    Kizza, M.; Westerberg, I.; Rodhe, A.; Ntale, H. K.

    2011-12-01

    A gridded monthly rainfall dataset having a spatial resolution of 2 km and covering the period 1960-2004 was derived for the Lake Victoria basin. Such a dataset is useful for hydrological modelling aimed at resource utilisation and for estimation of catchment inflow to Lake Victoria. The lake and its basin support more than 30 million people and also contribute substantially to the River Nile flow. The major challenge in analysing the lake water balance is the estimation of the rainfall over the lake which is complicated by the varying quality and spatial coverage of rain-gauge data in the basin. In this study we addressed these problems by using satellite-derived precipitation data from two products and rain-gauge data for 362 stations around the basin to derive a monthly precipitation dataset for the entire basin, including the lake. First, the rain-gauge data were quality controlled; resulting in a rejection of 13% of the stations while 12% needed corrective actions. These results emphasise the importance of a systematic quality control of rain-guage data in this region. Thereafter we filled short gaps in the daily data series which resulted in 9,429 additional months of data. Two interpolation methods were then assessed for spatial interpolation and the universal kriging method performed slightly better than the inverse distance weighting method. The rainfall patterns in the interpolated dataset were shown to be consistent with the spatial and temporal patterns expected at the large scale as a result of the climate variability in the basin. The key problem of how to account for the enhancement of rainfall over the lake surface because of the lake-land thermal contrasts was addressed by estimating a relationship between rain-gauge and satellite data. Two satellite rainfall products, TRMM 3B43 and PERSIANN were compared to the interpolated monthly rain-gauge data for the land part of the basin. The bias in the TRMM 3B43 rainfall estimates was higher than the bias

  11. Stratigraphic relations of australites in the Port Campbell embayment, Victoria

    Science.gov (United States)

    Shoemaker, Eugene M.; Uhlherr, H. Ralph

    1999-05-01

    In the Port Campbell Embayment of Victoria, australites have been found in situ in channel deposits of the Hanson Plain Sand of Pliocene and Pleistocene age. The large majority of the australites, however, occur as a lag deposit at the basal contact of the Sturgess Sand of late Pleistocene and Holocene age and are spatially correlated with ferruginous sandstone clasts that are derived from the Hanson Plain Sand. Some of the tektites are imbedded in or bonded to the ferruginous sandstone clasts, but most are found as individual tektite fragments. A few percent of the tektites have nearly perfectly preserved, complete aerodynamically shaped forms. The sandstone clasts and associated tektites have been reworked from the much older underlying Hanson Plain and have been locally concentrated in the lag deposit. Some tektites also occur at higher levels in the Sturgess Sand, almost invariably in association with stone flakes, exotic stones transported by the aborigines, and, locally, with middens of mollusc shells. Circumstantial evidence indicates that the aborigines transported the tektites found in the upper part of the Sturgess, particularly at Stanhope Bay. As Port Campbell australites unequivocally occur in strata much older than the late Pleistocene and Holocene Sturgess, there is no longer any conflict between the apparent stratigraphic age of the tektites and the middle Pleistocene ages obtained by various chronometric methods.

  12. The bone microstructure of polar "hypsilophodontid" dinosaurs from Victoria, Australia.

    Science.gov (United States)

    Woodward, Holly N; Rich, Thomas H; Vickers-Rich, Patricia

    2018-01-18

    High-latitude (i.e., "polar") Mesozoic fauna endured months of twilight and relatively low mean annual temperatures. Yet non-avian dinosaurs flourished in this taxing environment. Fossils of basal ornithopod dinosaurs ("hypsilophodontids") are common in the Early Cretaceous high-latitude sediments of Victoria, Australia, and four taxa have been described; although their ontogenetic histories are largely unexplored. In the present study, eighteen tibiae and femora were utilized in the first multi-specimen ontogenetic histological analysis of Australian polar hypsilophodontids. The sample consists of eleven individuals from the Flat Rocks locality (Late Valanginian or Barremian), and five from the Dinosaur Cove locality (Albian). In both groups, growth was most rapid during the first three years, and skeletal maturity occurred between five and seven years. There is a weak asymptotic trend in a plot of growth mark count versus femur length, with considerable individual variation. Histology suggests two genera are present within the Dinosaur Cove sample, but bone microstructure alone could not distinguish genera within the Flat Rocks sample, or across the two geologically separate (~ 26 Ma) localities. Additional histologic sampling, combined with morphological analyses, may facilitate further differentiation between ontogenetic, individual, and species variation.

  13. Diversity of soil yeasts isolated from South Victoria Land, Antarctica

    Science.gov (United States)

    Connell, L.; Redman, R.; Craig, S.; Scorzetti, G.; Iszard, M.; Rodriguez, R.

    2008-01-01

    Unicellular fungi, commonly referred to as yeasts, were found to be components of the culturable soil fungal population in Taylor Valley, Mt. Discovery, Wright Valley, and two mountain peaks of South Victoria Land, Antarctica. Samples were taken from sites spanning a diversity of soil habitats that were not directly associated with vertebrate activity. A large proportion of yeasts isolated in this study were basidiomycetous species (89%), of which 43% may represent undescribed species, demonstrating that culturable yeasts remain incompletely described in these polar desert soils. Cryptococcus species represented the most often isolated genus (33%) followed by Leucosporidium (22%). Principle component analysis and multiple linear regression using stepwise selection was used to model the relation between abiotic variables (principle component 1 and principle component 2 scores) and yeast biodiversity (the number of species present at a given site). These analyses identified soil pH and electrical conductivity as significant predictors of yeast biodiversity. Species-specific PCR primers were designed to rapidly discriminate among the Dioszegia and Leucosporidium species collected in this study. ?? 2008 Springer Science+Business Media, LLC.

  14. Comparison of the Pathogenesis of the Angola and Ravn Strains of Marburg Virus in the Outbred Guinea Pig Model.

    Science.gov (United States)

    Cross, Robert W; Fenton, Karla A; Geisbert, Joan B; Ebihara, Hideki; Mire, Chad E; Geisbert, Thomas W

    2015-10-01

    Phylogenetic comparisons of known Marburg virus (MARV) strains reveal 2 distinct genetic lineages: Ravn and the Lake Victoria Marburg complex (eg, Musoke, Popp, and Angola strains). Nucleotide variances of >20% between Ravn and other MARV genomes suggest that differing virulence between lineages may accompany this genetic divergence. To date, there exists limited systematic experimental evidence of pathogenic differences between MARV strains. Uniformly lethal outbred guinea pig models of MARV-Angola (MARV-Ang) and MARV-Ravn (MARV-Rav) were developed by serial adaptation. Changes in genomic sequence, weight, temperature, histopathologic findings, immunohistochemical findings, hematologic profiles, circulating biochemical enzyme levels, coagulation parameters, viremia levels, cytokine levels, eicanosoid levels, and nitric oxide production were compared between strains. MARV-Rav infection resulted in delayed increases in circulating inflammatory and prothrombotic elements, notably lower viremia levels, less severe histologic alterations, and a delay in mean time to death, compared with MARV-Ang infection. Both strains produced more marked coagulation abnormalities than previously seen in MARV-infected mice or inbred guinea pigs. Although both strains exhibit great similarity to pathogenic markers of human and nonhuman primate MARV infection, these data highlight several key differences in pathogenicity that may serve to guide the choice of strain and model used for development of vaccines or therapeutics for Marburg hemorrhagic fever. Published by Oxford University Press on behalf of the Infectious Diseases Society of America 2015. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  15. Flow structures and fluid transport for the hydromedusae Sarsia tubulosa and Aequorea victoria.

    Science.gov (United States)

    Lipinski, Doug; Mohseni, Kamran

    2009-08-01

    The flow structures produced by the hydromedusae Sarsia tubulosa and Aequorea victoria are examined using direct numerical simulation and Lagrangian coherent structures (LCS). Body motion of each hydromedusa is digitized and input to a CFD program. Sarsia tubulosa uses a jetting type of propulsion, emitting a single, strong, fast-moving vortex ring during each swimming cycle while a secondary vortex of opposite rotation remains trapped within the subumbrellar region. The ejected vortex is highly energetic and moves away from the hydromedusa very rapidly. Conversely, A. victoria, a paddling type hydromedusa, is found to draw fluid from the upper bell surface and eject this fluid in pairs of counter-rotating, slow-moving vortices near the bell margins. Unlike S. tubulosa, both vortices are ejected during the swimming cycle of A. victoria and linger in the tentacle region. In fact, we find that A. victoria and S. tubulosa swim with Strouhal numbers of 1.1 and 0.1, respectively. This means that vortices produced by A. victoria remain in the tentacle region roughly 10 times as long as those produced by S. tubulosa, which presents an excellent feeding opportunity during swimming for A. victoria. Finally, we examine the pressure on the interior bell surface of both hydromedusae and the velocity profile in the wake. We find that S. tubulosa produces very uniform pressure on the interior of the bell as well as a very uniform jet velocity across the velar opening. This type of swimming can be well approximated by a slug model, but A. victoria creates more complicated pressure and velocity profiles. We are also able to estimate the power output of S. tubulosa and find good agreement with other hydromedusan power outputs. All results are based on numerical simulations of the swimming jellyfish.

  16. Characterising groundwater dynamics in Western Victoria, Australia using Menyanthes software

    Science.gov (United States)

    Woldeyohannes, Yohannes; Webb, John

    2010-05-01

    Water table across much of the western Victoria, Australia have been declining for at least the last 10-15 years, and this is attributed to the consistently low rainfall for these years, but over the same period of time there has been substantial change in land use, with grazing land replaced by cropping and tree plantations appearing in some areas. Hence, it is important to determine the relative effect the climate and land use factors on the water table changes. Monitoring changes in groundwater levels to climate variables and/or land use change is helpful in indicating the degree of threat faced to agricultural and public assets. The dynamics of the groundwater system in the western Victoria, mainly on the basalt plain, have been modelled to determine the climatic influence in water table fluctuations. In this study, a standardized computer package Menyanthes was used for quantifying the influence of climatic variables on the groundwater level, statistically estimating trends in groundwater levels and identify the properties that determine the dynamics of groundwater system. This method is optimized for use on hydrological problems and is based on the use of continuous time transfer function noise model, which estimates the Impulse response function of the system from the temporal correlation between time series of groundwater level and precipitation surplus. In this approach, the spatial differences in the groundwater system are determined by the system properties, while temporal variation is driven by the dynamics of the input into the system. 80 time series models are analysed and the model output parameter values characterized by their moments. The zero-order moment Mo of a distribution function is its area and M1 is related to the mean of the impulse response function. The relation is M1/Mo. It is a measure of the system's memory. It takes approximately 3 times the mean time (M1/Mo) for the effect of a shower to disappear completely from the system. Overall

  17. Evaluation of vehicle side airbag effectiveness in Victoria, Australia.

    Science.gov (United States)

    D'Elia, Angelo; Newstead, Stuart; Scully, Jim

    2013-05-01

    Side airbag systems were first introduced into vehicles around 1995 to help protect occupants from injury in side impact crashes. International studies have shown that side airbags are effective in reducing the risk of death and injury, however, serious injuries can still occur even when side airbags deploy. The objective of this study was to use detailed injury information from insurance injury compensation claims data linked to Police reported crash data to determine the effectiveness of side airbags in reducing the risk of death or injury for occupants involved in side impact crashes in Victoria, Australia based on the specific body regions that side airbag systems are designed to protect. It was found that head and torso-protecting dual airbag systems designed to protect the head, neck, face, chest and abdomen are highly effective in reducing driver death or injury due to near side crashes. They were associated with a statistically significant reduction of 41.1% (25.9%, 53.2%) in the odds of death or injury across all body regions; and a 48.0% (28.0%, 62.4%) reduction in the odds of death or injury to the head, neck, face, chest and abdomen. The study did not find any evidence that torso-protecting airbags alone are effective in reducing death or injury. Analysis results indicate that head and torso-protecting side airbag systems in vehicles are a highly effective technology for reducing the risk of death or injury to vehicle occupants in near side crashes. The magnitude of the injury reduction benefits estimated indicate that fitment of this technology to all vehicles should be a high priority and will yield significant savings in overall road trauma. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Marine research in the Latitudinal Gradient Project along Victoria Land, Antarctica

    Directory of Open Access Journals (Sweden)

    Paul Arthur Berkman

    2005-12-01

    Full Text Available This paper describes the conceptual framework of the Latitudinal Gradient Project that is being implemented by the New Zealand, Italian and United States Antarctic programmes along Victoria Land, Antarctica, from 72°S to 86°S. The purpose of this interdisciplinary research project is to assess the dynamics and coupling of marine and terrestrial ecosystems in relation to global climate variability. Preliminary data about the research cruises from the R/V “Italica” and R/V “Tangaroa” along the Victoria Land Coast in 2004 are presented. As a global climate barometer, this research along Victoria Land provides a unique framework for assessing latitudinal shifts in ‘sentinel’ environmental transition zones, where climate changes have an amplified impact on the phases of water.

  19. Chemodenitrification in the cryoecosystem of Lake Vida, Victoria Valley, Antarctica.

    Science.gov (United States)

    Ostrom, N E; Gandhi, H; Trubl, G; Murray, A E

    2016-11-01

    Lake Vida, in the Victoria Valley of East Antarctica, is frozen, yet harbors liquid brine (~20% salt, >6 times seawater) intercalated in the ice below 16 m. The brine has been isolated from the surface for several thousand years. The brine conditions (permanently dark, -13.4 °C, lack of O2 , and pH of 6.2) and geochemistry are highly unusual. For example, nitrous oxide (N2 O) is present at a concentration among the highest reported for an aquatic environment. Only a minor 17 O anomaly was observed in N2 O, indicating that this gas was predominantly formed in the lake. In contrast, the 17 O anomaly in nitrate (NO3-) in Lake Vida brine indicates that approximately half or more of the NO3- present is derived from atmospheric deposition. Lake Vida brine was incubated in the presence of 15 N-enriched substrates for 40 days. We did not detect microbial nitrification, dissimilatory reduction of NO3- to ammonium (NH4+), anaerobic ammonium oxidation, or denitrification of N2 O under the conditions tested. In the presence of 15 N-enriched nitrite (NO2-), both N2 and N2 O exhibited substantial 15 N enrichments; however, isotopic enrichment declined with time, which is unexpected. Additions of 15 N-NO2- alone and in the presence of HgCl2 and ZnCl2 to aged brine at -13 °C resulted in linear increases in the δ15 N of N2 O with time. As HgCl2 and ZnCl2 are effective biocides, we interpret N2 O production in the aged brine to be the result of chemodenitrification. With this understanding, we interpret our results from the field incubations as the result of chemodenitrification stimulated by the addition of 15 N-enriched NO2- and ZnCl2 and determined rates of N2 O and N2 production of 4.11-41.18 and 0.55-1.75 nmol L-1  day-1 , respectively. If these rates are representative of natural production, the current concentration of N2 O in Lake Vida could have been reached between 6 and 465 years. Thus, chemodenitrification alone is sufficient to explain the high levels of N2 O

  20. Stroke Incidence in Victoria, Australia—Emerging Improvements

    Directory of Open Access Journals (Sweden)

    Benjamin B. Clissold

    2017-05-01

    Full Text Available BackgroundEvidence of a decline in the incidence of stroke has emerged from population-based studies. These have included retrospective and prospective cohorts. However, in Australia and other countries, government bodies and stroke foundations predict a rise in the prevalence of stroke that is anticipated to increase the burden of stroke across the entire domain of care. This increase in prevalence must be viewed as different from the decline in incidence being observed, a measure of new stroke cases. In Victoria, all public emergency department visits and public and private hospital admissions are reported to the Department of Health and Human Services and include demographic, diagnostic, and procedural/treatment information.MethodsWe obtained data from financial years 1997/1998 to 2007/2008 inclusive, for all cases with a primary stroke diagnosis (ICD-10-AM categories with associated data fields. Incident cases were established by using a 5-year clearance period.ResultsFrom 2003/2004 to 2007/2008 inclusive, there were 53,425 patients with a primary stroke or TIA diagnosis. The crude incident stroke rate for first ever stroke was 211 per 100,000 per year (95% CI 205–217 [females—205 per 100,000 per year (95% CI 196–214 and males—217 per 100,000 per year (95% CI 210–224]. The overall stroke rates were seen to significantly decline over the period [males (per 100,000 per year 227 in 2003/2004 to 202 in 2007/2008 (p = 0.0157 and females (per 100,000 per year 214 in 2003/2004 to 188 in 2007/2008 (p = 0.0482]. Ischemic stroke rates also appeared to decline; however, this change was not significant.ConclusionThese results demonstrate a significant decline in stroke incidence during the study period and may suggest evidence for effectiveness of primary and secondary prevention strategies in cerebrovascular risk factor management.

  1. Stratigraphic architecture of bedrock reference section, Victoria Crater, Meridiani Planum, Mars

    Science.gov (United States)

    Edgar, Lauren A.; Grotzinger, John P.; Hayes, Alex G.; Rubin, David M.; Squyres, Steve W.; Bell, James F.; Herkenhoff, Ken E.

    2012-01-01

    The Mars Exploration Rover Opportunity has investigated bedrock outcrops exposed in several craters at Meridiani Planum, Mars, in an effort to better understand the role of surface processes in its geologic history. Opportunity has recently completed its observations of Victoria crater, which is 750 m in diameter and exposes cliffs up to ~15 m high. The plains surrounding Victoria crater are ~10 m higher in elevation than those surrounding the previously explored Endurance crater, indicating that the Victoria crater exposes a stratigraphically higher section than does the Endurance crater; however, Victoria strata overlap in elevation with the rocks exposed at the Erebus crater. Victoria crater has a well-developed geomorphic pattern of promontories and embayments that define the crater wall and that reveal thick bedsets (3–7m) of large-scale cross-bedding, interpreted as fossil eolian dunes. Opportunity was able to drive into the crater at Duck Bay, located on the western margin of Victoria crater. Data from the Microscopic Imager and Panoramic Camera reveal details about the structures, textures, and depositional and diagenetic events that influenced the Victoria bedrock. A lithostratigraphic subdivision of bedrock units was enabled by the presence of a light-toned band that lines much of the upper rim of the crater. In ascending order, three stratigraphic units are named Lyell, Smith, and Steno; Smith is the light-toned band. In the Reference Section exposed along the ingress path at Duck Bay, Smith is interpreted to represent a zone of diagenetic recrystallization; however, its upper contact also coincides with a primary erosional surface. Elsewhere in the crater the diagenetic band crosscuts the physical stratigraphy. Correlation with strata present at nearby promontory Cape Verde indicates that there is an erosional surface at the base of the cliff face that corresponds to the erosional contact below Steno. The erosional contact at the base of Cape Verde

  2. Archiving the Web: A Case Study from the University of Victoria

    Directory of Open Access Journals (Sweden)

    Corey Davis

    2014-10-01

    Full Text Available The University of Victoria Libraries started archiving websites in 2013, and it quickly became apparent that many scholarly websites being produced by faculty, especially in the digital humanities, were going to prove very challenging to effectively capture and play back. This article will provide an overview of web archiving and explore the considerable legal and technical challenges of implementing a web archiving initiative at a research library, using the University of Victoria's implementation of Archive-it, a web archiving service from the Internet Archive, as a case study, with a special focus on capturing complex, interactive websites that scholars are creating to disseminate their research in new ways.

  3. Coupled human and natural system dynamics as key to the sustainability of Lake Victoria's ecosystem services

    NARCIS (Netherlands)

    Downing, Andrea S.; van Nes, Egbert H.; Balirwa, John S.; Beuving, Joost; Bwathondi, P. O. J.; Chapman, Lauren J.; Cornelissen, Ilse J. M.; Cowx, Iain G.; Goudswaard, Kees P. C.; Hecky, Robert E.; Janse, Jan H.; Janssen, Annette B. G.; Kaufman, Les; Kishe-Machumu, Mary A.; Kolding, Jeppe; Ligtvoet, Willem; Mbabazi, Dismas; Medard, Modesta; Mkumbo, Oliva C.; Mlaponi, Enock; Munyaho, Antony T.; Nagelkerke, Leopold A. J.; Ogutu-Ohwayo, Richard; Ojwang, William O.; Peter, Happy K.; Schindler, Daniel E.; Seehausen, Ole; Sharpe, Diana; Silsbe, Greg M.; Sitoki, Lewis; Tumwebaze, Rhoda; Tweddle, Denis; van de Wolfshaar, Karen E.; van Dijk, Han; van Donk, Ellen; van Rijssel, Jacco C.; van Zwieten, Paul A. M.; Wanink, Jan; Witte, F.; Mooij, Wolf M.

    2014-01-01

    East Africa's Lake Victoria provides resources and services to millions of people on the lake's shores and abroad. In particular, the lake's fisheries are an important source of protein, employment, and international economic connections for the whole region. Nonetheless, stock dynamics are poorly

  4. The diversity of benthic mollusks of Lake Victoria and Lake Burigi ...

    African Journals Online (AJOL)

    Molluscan diversity, abundance and distribution in sediments of Lake Victoria and its satellite lake, Lake Burigi, were investigated. The survey was carried out ... Melanoides tuberculata and Biomphalaria chaonomphala were the only two gastropods represented and widely distributed in the two lakes. Bivalvia constituting of ...

  5. Connections '98. Proceedings of a Faculty Conference (4th, Victoria, British Columbia, Canada, May 1998).

    Science.gov (United States)

    Gibbons, Sandra L., Ed.; Anderson, John O., Ed.

    This proceedings contains 13 papers from the 1998 annual Faculty of Education conference at the University of Victoria, British Columbia (Canada). The papers are: (1) "Struggling with Re-Presentation, Voice, and Self in Narrative Research" (Marla Arvay); (2) "Women's Soccer in Canada: A Slow Road to Equity" (Meredith Bogle,…

  6. Nile perch fish processing waste along Lake Victoria in East Africa ...

    African Journals Online (AJOL)

    Worldwide, fish industry wastes are an important contaminant having an impact on the environment. The recovery of value added products from these residues constitutes an important waste reduction strategy for the industry. In East Africa, Nile perch fish processing into chilled fish fillet for export along Lake Victoria ...

  7. Water hyacinth hotspots in the Ugandan waters of Lake Victoria in ...

    African Journals Online (AJOL)

    Water hyacinth invaded Lake Victoria in the 1980s and, by 1998, had attained peak coverage of approximately 2 000 ha in the Ugandan waters of the lake. Control interventions, especially via biological means, significantly reduced the weed's coverage to non-nuisance levels (<10 ha) by 1999. Although resurgence was ...

  8. Perception of Aquaculture Education to Support Further Growth of Aquaculture Industry in Victoria, Australia

    Science.gov (United States)

    Awal, Sadiqul; Christie, Andrew; Watson, Matthew; Hannadige, Asanka G. T.

    2012-01-01

    Purpose: The central aim of this study was to determine the perception of aquaculture educational provisions in the state of Victoria, and whether they are sufficient to ultimately support further growth of the industry. Design/methodology/approach: Questionnaires were formulated and distributed to participants in a variety of ways, including via…

  9. Lake Victoria wetlands and the ecology of the Nile tilapia, Oreochromis niloticus Linne

    NARCIS (Netherlands)

    Balirwa, J.S.

    1998-01-01

    An ecological study of wetlands was undertaken in northern Lake Victoria (East Africa) between 1993 and 1996 with a major aim of characterising shallow vegetation-dominated interface habitats, and evaluating their importance for fish, in particular, for the stocked and socio-economically

  10. People Management Practices in the Public Health Sector: Developments from Victoria, Australia

    Science.gov (United States)

    Stanton, Pauline; Bartram, Timothy; Harbridge, Raymond

    2004-01-01

    This study investigates the impact on human resource management (HRM) practices in the public health sector in Victoria, Australia of two different government policy environments. First, it explores the Liberal Coalition Government's decentralisation of public health sector management, from 1992-1999 and second, the Labor Government's…

  11. From Aspiration to Destination: Understanding the Decisions of University Applicants in Regional Victoria

    Science.gov (United States)

    Harvey, Andrew; Burnheim, Catherine; Joschko, Lucie; Luckman, Michael

    2012-01-01

    This paper examines the choices and destinations of prospective university students from three regional areas in Victoria. The study is based on information collected for tertiary applicants in the Gippsland, Bendigo and Mildura areas, all of which host a local university campus. Using application and enrollment data, we examine the choices that…

  12. What Do the Public Search for on the Catalogue of the State Library of Victoria?

    Science.gov (United States)

    Waller, Vivienne

    2009-01-01

    This study examines what the public search for in the catalogue of the State Library of Victoria (SLV). As well as indicating the type of content being accessed, this gives an indication of what catalogue users expect of the State Library collection. A content analysis was undertaken of a random, stratified sample of 4,000 search queries typed in…

  13. Do invasive bullfrogs in Victoria, British Columbia, Canada, show evidence of parasite release?

    Science.gov (United States)

    Dare, O K; Forbes, M R

    2013-06-01

    Few studies have examined vertebrate models of invasive species to explore parasite release as a proposed mechanism through which host species might become invasive. In this study, we examined evidence for parasite release in invasive American bullfrogs (Rana catesbeiana/Lithobates catesbeianus) from five sites in Victoria, British Columbia, Canada. We examined helminth species richness, as well as the prevalence, intensity and abundance of lung and kidney fluke infections. These flukes are expected to impose costs on host survival, growth and reproductive output. We compared measures of these parasite taxa with bullfrogs from Ontario and New Brunswick where they are endemic. Helminth species richness in bullfrogs from the Victoria sites was lower than in Ontario bullfrogs, but comparable to reported indices for other endemic populations. The prevalence of lung flukes (Haematoloechus spp.) in bullfrogs from Victoria was twice as high as was observed in the Ontario bullfrogs, and higher than has been reported from other endemic locations. In four of the five study sites in Victoria, numbers of Echinostoma spp. kidney cysts were lower than observed in endemic populations; however, the fifth site had uncharacteristically high numbers of cysts. In this study, there did not appear to be clear evidence to support parasite release using either parasite species numbers, or infection by specific parasite taxa. Instead, the invasive bullfrogs demonstrated high parasite species richness and high levels of infection for parasites known to be harmful to their hosts.

  14. Parasite-mediated sexual selection and species divergence in Lake Victoria cichlid fish

    NARCIS (Netherlands)

    Maan, Martine E.; Van Rooijen, Anne M. C.; Van Alphen, Jacques J. M.; Seehausen, Ole

    We investigate the role of parasite-mediated sexual selection in the divergence of two species of Lake Victoria cichlids. Pundamilia pundamilia and Pundamilia nyererei represent a common pattern of male nuptial colour divergence between haplochromine sister species: metallic grey-blue in P.

  15. Lake Victoria wetlands and the ecology of the Nile Tilapia, Oreochromis Niloticus Linné

    NARCIS (Netherlands)

    Balirwa, J.S.

    1998-01-01

    The importance of LalVictoria wetlands for the Nile tilap'a was studied. Five wetland types were defined: papyrus, reed, bulrush, hippo grass, water hyacinth. Hydrology, vegetation and distance towards open water explained the variation in abiotic and biotic factors. Over 30 fish species were

  16. Distribution of Nile perch Lates niloticus in southern Lake Victoria is ...

    African Journals Online (AJOL)

    Although Nile perch Lates niloticus is assumed to be sensitive to low oxygen concentrations, it was found in deep water in Lake Victoria, where oxygen depletion is common during the rainy season. Since factors determining Nile perch distribution are not well understood its spatial distribution in the Mwanza Gulf of Lake ...

  17. affect rice in integrated rice-fish culture in Lake Victoria Basin, Kenya?

    African Journals Online (AJOL)

    AGHOGHO A

    To ensure increased adoption of rice-fish farming, we have to be certain that practices and adoption of these technologies fit within the available resources, the socio-cultural and economic conditions of the Lake. Victoria Basin (LVB). Practices and technologies from. Asia may be inappropriate due to differences in agro cli-.

  18. Monitoring exposure to heavy metals among children in Lake Victoria, Kenya: Environmental and fish matrix

    NARCIS (Netherlands)

    Okoth, E.O.; Admiraal, W.; Osano, O.; Ngure, V.; Kraak, M.H.S.; Omutange, E.S.

    2010-01-01

    This study used hair and nails to biomonitor heavy metals (Pb, Cd, Cr and Cu) from geological source and exposure through regular fish consumption among children in Lake Victoria, Kenya. Concentration of Pb and Cu in water reflected anthropogenic pathways, while Cd and Cr reflected accumulation from

  19. Metal concentrations in sediment and fish of Lake Victoria near and ...

    African Journals Online (AJOL)

    Concentrations of metals in sediment and fish as well as organic matter contents of sediment from Lake Victoria were investigated. The objective of the study was to compare levels of metals in sediment and fish from areas of the lake that are within and outside catchments with gold mining activities. The results showed that ...

  20. Testing the Marine Hypothesis for The Opportunity Landing Site at Victoria Crater

    Science.gov (United States)

    Parker, T. J.

    2006-12-01

    Hypothesis Summary: 1. Meridiani Planum is a marine sulfate platform deposit, analogous to terrestrial carbonate platforms but with sulfate mineralogy, laid down during one or multiple marine transgressions over the landing site region. 2. Outcrop laminations, ripples, and larger, dune-scale bedforms are subaqueous in origin, produced by tidal currents. Aqueous deposits may be interbedded with crossbedded aeolian deposits of same composition derived from subjacent water-lain deposits during lowstands. At the scale of observations made by Opportunity, the marine hypothesis differs from the consensus, sabkha model, in two relatively minor ways (but with important differences in the inferred paleoenvironments). 3. Blueberry and cobble "lag" on top of outcrop is a lag, but indicates erosion of perhaps many meters, even tens of meters or more of outcrop material from the region by water. Wind erosion has been very limited over geologic time (perhaps less than a meter locally). 4. Remarkably-flat, horizontal geomorphic surface of outcrop was produced by shallow standing water locally, controlling both deposition and erosion of the sulfate outcrop material to within a few meters of sea level. 5. Craters in the landing site exhibit a continuum of degradation states, with Endurance and Victoria typifying the best preserved craters visited (or to be visited) by Opportunity, and Erebus and Terra Nova representing the most degraded craters visited that are larger than 100 meters across. Terra Nova is similar to numerous kilometer-scale "rock ring" craters in the Meridiani Planum landing site. 6. "Serrated" rim at Victoria is similar to, but fresher in expression, rim morphology at Erebus Crater, and may indicate water pouring over crater rim during tidal or storm surges in water level across the region. Predictions to be tested at Victoria Crater: 1. The crater's ejecta and raised rim have been destroyed by tidal currents in shallow standing water. There is no Endurance

  1. Dicty_cDB: Contig-U14564-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Pseudomonas fluorescens SBW25 c... 32 9.8 DQ447651_7( DQ447651 |pid:none) Lake Victoria marburgv...uschii clone CDS3047 al... 32 9.8 DQ447650_7( DQ447650 |pid:none) Lake Victoria marburgvirus - DRC19... 32 9

  2. AcEST: BP918808 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ge structural protein OS=Lake Victoria marb... 30 6.5 sp|P14745|CD44_PAPHA CD44 antigen OS=Papio hamadryas G...5262|L_MABVP Large structural protein OS=Lake Victoria marburgvirus (strain Popp-

  3. AcEST: BP921491 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 32 3.4 sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marb... 30 9.8 >sp|Q56A10|ZN608_MOUSE Z...e structural protein OS=Lake Victoria marburgvirus (strain Ravn-87) GN=L PE=3 SV=1 Length = 2327 Score = 30.

  4. Soil surface lowering due to soil erosion in villages near Lake Victoria, Uganda

    Science.gov (United States)

    de Meyer, A.; Deckers, J.; Poesen, J.; Isabirye, M.

    2009-04-01

    In the effort to pinpoint the sources of sediment pollution in Lake Victoria, the contribution of sedi-ment from compounds, landing sites, main roads and footpaths is determined in the catchment of Na-bera Bay and Kafunda Bay at the northern shore of Lake Victoria in southern Uganda. The amount of soil loss in compounds and landing sites is determined by the reconstruction of the original and current soil surface according to botanical and man-made datable objects. The soil erosion rate is then deter-mined by dividing the eroded soil volume (corrected for compaction) by the age of the oldest datable object. In the study area, the average soil erosion rate in compounds amounts to 107 Mg ha-1 year-1 (per unit compound) and in landing sites to 207 Mg ha-1 year-1 (per unit landing site). Although com-pounds and landing sites occupy a small area of the study area (1.1 %), they are a major source of sediment to Lake Victoria (63 %). The soil loss on footpaths and main roads is calculated by multip-lying the total length of footpaths and main roads with the average width and depth (measured towards a reference surface). After the correction for compaction is carried out, the soil erosion rate on foot-paths amounts to 34 Mg ha-1 year-1 and on main roads to 35 Mg ha-1 year-1. Also footpaths and main roads occupy a small area of the study area (1.1 %), but contribute disproportionately to the total soil loss in the catchment (22 %). In this research, the information about the village/compound given by the villager/owner is indispensable. In accordance to an adaptation of the model of McHugh et al. (2002), 32 % of the sediment that is generated in the catchment, is deposited in Lake Victoria (i.e. 2 209 Mg year-1 or 0.7 Mg ha-1 year-1). The main buffer in the study area is papyrus at the shore of Lake Victoria. Also sugarcane can be a major buffer. However, the sugarcane-area is intersected by com-pounds, landing sites, footpaths and main roads that generate large amounts of

  5. Species-specific relationships between water transparency and male coloration within and between two closely related Lake Victoria cichlid species

    NARCIS (Netherlands)

    Castillo Cajas, Ruth F; Selz, Oliver M; Ripmeester, Erwin A P; Seehausen, Ole; Maan, Martine E

    2012-01-01

    Environmental variation in signalling conditions affects animal communication traits, with possible consequences for sexual selection and reproductive isolation. Using spectrophotometry, we studied how male coloration within and between populations of two closely related Lake Victoria cichlid

  6. Preliminary assessment of the cocial, economic and environmental impacts of Water Hyacinth in Lake Victoria basin and status of control

    OpenAIRE

    Mailu, A.M.

    2001-01-01

    The paper presents preliminary data collected in an assessment of the social, economic and environmental impacts of water hyacinth in the Lake Victoria Basin. A summary of the status of control and strategies for the future is given. The report draws on field observations made, studies through interviews of affected communities and organisations, personal communications and published reports by scientists in the region. Lake Victoria, the world’s second largest freshwater body, su...

  7. Towards understanding hydroclimatic change in Victoria, Australia – preliminary insights into the "Big Dry"

    Directory of Open Access Journals (Sweden)

    A. S. Kiem

    2010-03-01

    Full Text Available Since the mid-1990s the majority of Victoria, Australia, has experienced severe drought conditions (i.e. the "Big Dry" characterized by streamflow that is the lowest in approximately 80 years of record. While decreases in annual and seasonal rainfall totals have also been observed, this alone does not seem to explain the observed reduction in flow. In this study, we investigate the large-scale climate drivers for Victoria and demonstrate how these modulate the regional scale synoptic patterns, which in turn alter the way seasonal rainfall totals are compiled and the amount of runoff per unit rainfall that is produced. The hydrological implications are significant and illustrate the need for robust hydrological modelling, that takes into account insights into physical mechanisms that drive regional hydroclimatology, in order to properly understand and quantify the impacts of climate change (natural and/or anthropogenic on water resources.

  8. Use of regionalisation approach to develop fire frequency curves for Victoria, Australia

    Science.gov (United States)

    Khastagir, Anirban; Jayasuriya, Niranjali; Bhuyian, Muhammed A.

    2017-11-01

    It is important to perform fire frequency analysis to obtain fire frequency curves (FFC) based on fire intensity at different parts of Victoria. In this paper fire frequency curves (FFCs) were derived based on forest fire danger index (FFDI). FFDI is a measure related to fire initiation, spreading speed and containment difficulty. The mean temperature (T), relative humidity (RH) and areal extent of open water (LC2) during summer months (Dec-Feb) were identified as the most important parameters for assessing the risk of occurrence of bushfire. Based on these parameters, Andrews' curve equation was applied to 40 selected meteorological stations to identify homogenous stations to form unique clusters. A methodology using peak FFDI from cluster averaged FFDIs was developed by applying Log Pearson Type III (LPIII) distribution to generate FFCs. A total of nine homogeneous clusters across Victoria were identified, and subsequently their FFC's were developed in order to estimate the regionalised fire occurrence characteristics.

  9. Art at Second Hand: Prints after European Pictures in Victoria before 1870

    Directory of Open Access Journals (Sweden)

    Alison Inglis

    2011-06-01

    Full Text Available This article examines the significance of the large number of European reproductive prints present in the public and private art collections of early colonial Victoria. Several factors are identified as contributing to this popularity; ranging from the suitability of the print medium for the export market to the existence of informed print connoisseurs amongst colonial collectors and artists. This article also demonstrates some of the typical features of Australian art history; in that it is concerned with the evaluation of the Australian art world through reference to European culture (the centre-periphery debate and also that it limits its discussion to the art of a particular Australian state (Victoria. The nineteenth-century division of Australia into different colonies had ramifications for Australian art history that continue to the present day – namely; the tendency to interpret colonial artistic activities from a regional perspective.

  10. ZnO-Fe2O3 heterojunction for photocatalytic degradation of victoria blue dye

    Science.gov (United States)

    Kumar, Pushpendra; Khatri, Taslimahemad; Bawa, Harpreet; Kaur, Jashandeep

    2017-07-01

    In the present study, ZnO-Fe2O3 heterojunction has been successfully synthesized by co-precipitation method for photocatalytic degradation of Victoria blue dye. The synthesized samples were subjected to XRD for microstructural characterization and scanning electron microscopy for morphological investigation. The typical X-ray diffraction pattern shows exhaustive evolution of hexagonal wurtzite phase of ZnO and α-Fe2O3 having crystalline in the range of 34-54 nm. The synthesized samples were applied for degradation of victoria blue dye under UV illumination. ZnO-Fe2O3 heterojunction showed higher photocatalytic activity for dye degradation compared to bare ZnO. This rise in photocatalytic activity can be attributed to enhanced charge separation derived from coupling of ZnO and Fe2O3. In this manuscript, the effect of photocatalyst dose, irradiation time and initial dye concentration on photodegradation of dye is reported in detail.

  11. Strain and displacement measurements for the June 9, 1980 Victoria, Mexico Earthquake

    Science.gov (United States)

    Darby, D.; Nyland, E.; Suarez, F.; Chavez, D.; Gonzalez, J.

    A microgeodetic network 22 km south east of Est. Guadalupe Victoria, Baja California Norte, installed in late May 1980, has been resurveyed in an experiment that started 12 hours after the June 9, 1980 Victoria earthquake, which had an epicenter at 10 km depth about 12 km from the network. The resurvey was complete by June 13. Both the initial observations and the resurvey were done with HP3800 distance meter equipment. Some angular control was provided with a Wild T3 theodolite. The network underwent a compressive strain of 7 ± 3 micro strain essentially parallel the Cerro Prieto fault about the time of the earthquake. Strains of this size are associated with simple dislocation models of earthquakes of this magnitude. Its direction appears to be anomalous however. This may indicate compression related to soil liquefaction processes or strain near the end of the slip plane.

  12. Impacts of changing water price and availability on irrigated dairy farms in northern Victoria

    OpenAIRE

    Ho, Christie K.M.; Armstrong, Dan P.; Doyle, Peter T.; Malcolm, Bill

    2004-01-01

    Farming systems throughout the Murray-Darling Basin are under increasing scrutiny from the perspective of ecological sustainability of farm and catchment systems. In northern Victoria, the dairy industry is a major user of water, and contributes to the environmental issues. Changes in irrigation water price, availability and policy will invariably impact on the viability of dairy farming in this region, but the diversity of dairy farm systems suggests that the impact will vary between farms. ...

  13. Imperialist women in Edwardian Britain : the Victoria League, 1899-1914

    OpenAIRE

    Riedi, Elizabeth L.

    1998-01-01

    This thesis, based on private papers, society records, autobiographies and memoirs, newspapers and periodicals, examines one mainly female imperialist organisation - the Victoria League - and the women who ran it. It considers two related questions - what made Edwardian women imperialist, and how, within the limits of Edwardian society, could they express their imperialism? The thesis shows that several of the League's founders and executive had visited South Africa during or s...

  14. Lake Victoria wetlands and the ecology of the Nile tilapia, Oreochromis niloticus Linne

    OpenAIRE

    Balirwa, J.S.

    1998-01-01

    An ecological study of wetlands was undertaken in northern Lake Victoria (East Africa) between 1993 and 1996 with a major aim of characterising shallow vegetation-dominated interface habitats, and evaluating their importance for fish, in particular, for the stocked and socio-economically important Oreochromis niloticus LINNÉ (the Nile tilapia). From field and laboratory experiments, five major habitat types could be defined by the type of the dominant emergent ma...

  15. Intestinal schistosomiasis among preschool children along the shores of Lake Victoria in Uganda

    DEFF Research Database (Denmark)

    Nalugwa, A.; Olsen, Annette; Tukahebwa, M. E.

    2015-01-01

    prevalence and intensity of infection were examined in 3058 children from 5 districts along Lake Victoria shoreline, eastern Uganda. For each child one stool sample was collected on three consecutive days. The Kato-Katz technique was used to prepare stool smears on slides for microscopic examination. Short...... for schistosomiasis takes preschool children into consideration and that health education on transmission of schistosomiasis is delivered to the endemic communities regularly....

  16. A Bottom-Up Understanding of Illegal, Unreported, and Unregulated Fishing in Lake Victoria

    Directory of Open Access Journals (Sweden)

    Joseph Luomba

    2016-10-01

    Full Text Available Illegal, unreported, and unregulated (IUU fishing is a major concern in fisheries management around the world. Several measures have been taken to address the problem. In Lake Victoria, the alleviation of IUU fishing is implemented through the Regional Plan of Action (RPOA-IUU, which restricts use of certain fishing gear, as well as prohibits fishing in closed areas and during closed seasons. Despite the long-term efforts to monitor and control what goes on in the fisheries, IUU fishing has persisted in Lake Victoria. Inspired by interactive governance theory, this paper argues that the persistence of IUU fishing could be due to different images that stakeholders have about the situation, rather than the lack of management competency. Through structured interviews with 150 fisheries stakeholders on Ijinga Island in the southeastern part of Lake Victoria, Tanzania, using paired comparison questionnaires, the study elicits stakeholders’ perspective about the severity of different locally-pertinent fishing-related activities. The results show that while fisheries stakeholder groups agree on their judgments about certain fishing gears, some differences are also apparent. For instance, fisheries managers and scientists do not always agree with fishing people about what activities cause the most damage to fisheries resources and ecosystem. Further, they tend to consider some IUU fishing-related activities less damaging than some non-IUU fishing. Such disparity creates governability challenges, pointing to the need to revisit relevant regulatory measures and to make them consistent with the knowledge and judgments of all stakeholders. Based on these findings, we discuss governing interventions that may contribute to addressing IUU fishing in Lake Victoria and elsewhere.

  17. A Comparison of digestive Tract Morphology in muskoxen and caribou from Victoria Island, Northwest Territories, Canada

    Directory of Open Access Journals (Sweden)

    Hans Staaland

    1997-04-01

    Full Text Available Although caribou and muskoxen coexist in close proximity on southeastern Victoria Island, they appear primarily adapted to different diets and foraging strategies. Visual inspection and analysis of rumen contents for fiber and lignin from the study (unpubl. also indicate a predominantly graminoid diet in the muskoxen and a more varied diet with a substantial browse component in the caribou.This should reduce the likelihood of competition for limited food resources in winter.

  18. B chromosomes have a functional effect on female sex determination in Lake Victoria cichlid fishes.

    Directory of Open Access Journals (Sweden)

    Kohta Yoshida

    2011-08-01

    Full Text Available The endemic cichlid fishes in Lake Victoria are a model system for speciation through adaptive radiation. Although the evolution of the sex-determination system may also play a role in speciation, little is known about the sex-determination system of Lake Victoria cichlids. To understand the evolution of the sex-determination system in these fish, we performed cytogenetic analysis in 11 cichlid species from Lake Victoria. B chromosomes, which are present in addition to standard chromosomes, were found at a high prevalence rate (85% in these cichlids. In one species, B chromosomes were female-specific. Cross-breeding using females with and without the B chromosomes demonstrated that the presence of the B chromosomes leads to a female-biased sex ratio in this species. Although B chromosomes were believed to be selfish genetic elements with little effect on phenotype and to lack protein-coding genes, the present study provides evidence that B chromosomes have a functional effect on female sex determination. FISH analysis using a BAC clone containing B chromosome DNA suggested that the B chromosomes are derived from sex chromosomes. Determination of the nucleotide sequences of this clone (104.5 kb revealed the presence of several protein-coding genes in the B chromosome, suggesting that B chromosomes have the potential to contain functional genes. Because some sex chromosomes in amphibians and arthropods are thought to be derived from B chromosomes, the B chromosomes in Lake Victoria cichlids may represent an evolutionary transition toward the generation of sex chromosomes.

  19. Salinity in Water Markets : An ExperimentalInvestigation of the Sunraysia Salinity Levy, Victoria

    OpenAIRE

    C. Duke; L. Gangadharan

    2005-01-01

    Irrigation can have a significant negative impact on the environment. Irrigation impacts contribute a significant portion to the estimated forty six million dollar cost per annum of salinity in the Murray River, Australia. Policies available to regulators include externality taxes and levies. In 2002 the Victorian Government introduced a system of salinity levies in the irrigation regions of Sunraysia, northern Victoria. These levies differ from typical taxes because they also introduce trade...

  20. Satellite-Based Assessment of the spatial extent of Aquatic Vegetation in Lake Victoria

    Science.gov (United States)

    Clark, W.; Aligeti, N.; Jeyaprakash, T.; Martins, M.; Stodghill, J.; Winstanley, H.

    2011-12-01

    Lake Victoria in Africa is the second largest freshwater lake in the world and is known for its abundance of aquatic wildlife. In particular over 200 different fish species are caught and sold by local fisherman. The lake is a major contributor to the local economy as a corridor of transportation, source of drinking water, and source of hydropower. However, the invasion of aquatic vegetation such as water hyacinth in the lake has disrupted each of these markets. Aquatic vegetation now covers a substantial area of the coastline blocking waterways, disrupting hydropower, hindering the collection of drinking water and decreasing the profitability of fishing. The vegetation serves as a habitat for disease carrying mosquitoes as well as snakes and snails that spread the parasitic disease bilharzia. The current control measures of invasive aquatic vegetation rely on biological, chemical and mechanical control. The objective of this study was to utilize remote sensing to map aquatic vegetation within Lake Victoria from 2000 to 2011. MODIS, Landsat 4-5TM, and Landsat 7-ETM imagery was employed to perform change detections in vegetation and identify the extent of aquatic vegetation throughout the years. The efficiency of containment efforts were evaluated and ideal time for application of such efforts were suggested. A methodology for aquatic vegetation surveillance was created. The results of this project were presented as a workshop to the Lake Victoria Fisheries Organization, SERVIR, and other partner organizations. The workshop provided instruction into the use of NASA and other satellite derived products. Time series animations of the spatial extent of aquatic vegetation within the lake were created. By identifying seasons of decreased aquatic vegetation, ideal times to employ control efforts were identified. SERVIR will subsequently utilize the methodologies and mapping results of this study to develop operational aquatic vegetation surveillance for Lake Victoria.

  1. B chromosomes have a functional effect on female sex determination in Lake Victoria cichlid fishes.

    Science.gov (United States)

    Yoshida, Kohta; Terai, Yohey; Mizoiri, Shinji; Aibara, Mitsuto; Nishihara, Hidenori; Watanabe, Masakatsu; Kuroiwa, Asato; Hirai, Hirohisa; Hirai, Yuriko; Matsuda, Yoichi; Okada, Norihiro

    2011-08-01

    The endemic cichlid fishes in Lake Victoria are a model system for speciation through adaptive radiation. Although the evolution of the sex-determination system may also play a role in speciation, little is known about the sex-determination system of Lake Victoria cichlids. To understand the evolution of the sex-determination system in these fish, we performed cytogenetic analysis in 11 cichlid species from Lake Victoria. B chromosomes, which are present in addition to standard chromosomes, were found at a high prevalence rate (85%) in these cichlids. In one species, B chromosomes were female-specific. Cross-breeding using females with and without the B chromosomes demonstrated that the presence of the B chromosomes leads to a female-biased sex ratio in this species. Although B chromosomes were believed to be selfish genetic elements with little effect on phenotype and to lack protein-coding genes, the present study provides evidence that B chromosomes have a functional effect on female sex determination. FISH analysis using a BAC clone containing B chromosome DNA suggested that the B chromosomes are derived from sex chromosomes. Determination of the nucleotide sequences of this clone (104.5 kb) revealed the presence of several protein-coding genes in the B chromosome, suggesting that B chromosomes have the potential to contain functional genes. Because some sex chromosomes in amphibians and arthropods are thought to be derived from B chromosomes, the B chromosomes in Lake Victoria cichlids may represent an evolutionary transition toward the generation of sex chromosomes.

  2. Leuconidae (Crustacea: Cumacea) from the collections of the Museum Victoria, Australia.

    Science.gov (United States)

    Gerken, Sarah

    2016-01-21

    The collections of the Museum Victoria have yielded six new leuconid species in five genera from Australian waters: Austroleucon adiazetos n. sp., A. dolosolevis n. sp., Eudorellopsis mykteros n. sp., Kontiloleucon australiensis n. gen., n. sp., Leucon (Alytoleucon) dolichorhinos n. sp., Ommatoleucon megalopos n. sp. as well as the new genus Kontiloleucon. Leucon (Leucon) echinolophotos n. sp. is a new species from off Enderby Land, Antarctica. Keys to the Australian leuconid genera and species are included.

  3. Recent reduction in the water level of Lake Victoria has created more habitats for Anopheles funestus

    Directory of Open Access Journals (Sweden)

    Futami Kyoko

    2008-07-01

    Full Text Available Abstract Background The water level of Lake Victoria has fallen more than 1.5 m since 1998, revealing a narrow strip of land along the shore. This study determined whether the recent drop in the water level has created additional breeding grounds for malaria vectors. Methods The recent and past shorelines were estimated using landmarks and a satellite image. The locations of breeding habitats were recorded using a GPS unit during the high and low lake water periods. GIS was used to determine whether the breeding habitats were located on newly emerged land between the new and old shorelines. Results Over half of the breeding habitats existed on newly emerged land. Fewer habitats for the Anopheles gambiae complex were found during the low water level period compared to the high water period. However, more habitats for Anopheles funestus were found during the high water level period, and they were all located on the newly emerged land. Conclusion The recent reduction in water level of Lake Victoria has increased the amount of available habitat for A. funestus. The results suggest that the water drop has substantially affected the population of this malaria vector in the Lake Victoria basin, particularly because the lake has a long shoreline that may harbour many new breeding habitats.

  4. Urban eutrophication and its spurring conditions in the Murchison Bay of Lake Victoria.

    Science.gov (United States)

    Kabenge, Martin; Wang, Hongtao; Li, Fengting

    2016-01-01

    The efficiency of Lake Victoria in providing its ecosystem services to riparian states, both immediate and along the Nile river basin, is strongly related to its water quality. Over the past few decades, eutrophication has increased in the lake arising from increased inflow of nutrients. This study was carried out in the Murchison Bay area of Lake Victoria with the aims of assessing the progress of eutrophication nutrient enrichment into the lake between 1990 and 2014. Using Landsat satellite floating algae index (FAI) products and data from laboratory analysis of water samples, the study revealed that floating algae reoccurred periodically with coverage varying between 1 and 18 km(2). The findings also indicated that the range of nitrate-nitrogen concentrations increased greatly with maximum concentrations recorded at 31.2 mg l(-1) in 2007 from 0.084 mg l(-1) in 1990. The soluble reactive phosphorus concentration range showed a maximum of 1.45 mg l(-1) in 2007 from 0.043 mg l(-1) in 1990. The chlorophyll levels increased from an average of 17 μg l(-1) in 1992 by threefold in 1996 but had however declined and halved in intensity by 2011. The eutrophication that has occurred in Lake Victoria over the past decades has been due to pollution from industrial, residential, and agricultural areas within the catchment.

  5. Genetic structure of pelagic and littoral cichlid fishes from Lake Victoria.

    Directory of Open Access Journals (Sweden)

    Miyuki Takeda

    Full Text Available The approximately 700 species of cichlids found in Lake Victoria in East Africa are thought to have evolved over a short period of time, and they represent one of the largest known examples of adaptive radiation. To understand the processes that are driving this spectacular radiation, we must determine the present genetic structure of these species and elucidate how this structure relates to the ecological conditions that caused their adaptation. We analyzed the genetic structure of two pelagic and seven littoral species sampled from the southeast area of Lake Victoria using sequences from the mtDNA control region and 12 microsatellite loci as markers. Using a Bayesian model-based clustering method to analyze the microsatellite data, we separated these nine species into four groups: one group composed of pelagic species and another three groups composed mainly of rocky-shore species. Furthermore, we found significant levels of genetic variation between species within each group at both marker loci using analysis of molecular variance (AMOVA, although the nine species often shared mtDNA haplotypes. We also found significant levels of genetic variation between populations within species. These results suggest that initial groupings, some of which appear to have been related to habitat differences, as well as divergence between species within groups took place among the cichlid species of Lake Victoria.

  6. Women's experience of domiciliary postnatal care in Victoria and South Australia: a population-based survey.

    Science.gov (United States)

    Biro, Mary Anne; Yelland, Jane S; Sutherland, Georgina A; Brown, Stephanie J

    2012-11-01

    Despite the expansion of postnatal domiciliary services, we know little about the women receiving visits and how they regard their care. The aim of this study is to examine the provision of postnatal domiciliary care from a consumer perspective. All women who gave birth in September-October 2007 in South Australia and Victoria were mailed questionnaires 6 months after the birth. Women were asked if they had received a midwifery home visit, and to rate the care they received. More women in South Australia reported receiving a domiciliary visit than in Victoria (88.0% v. 76.0%) and they were more likely to rate their care as 'very good' (69.1% v. 63.4%). Younger women, women on a lower income, who were holding a healthcare concession card or who had not completed secondary education were less likely to receive a visit. Although the majority of women in public maternity care in Victoria and South Australia receive domiciliary care and rate it positively, there are significant state-based differences. Those more likely to benefit from domiciliary care are less likely to receive a visit. There is a need to further explore the purpose, aims and content of domiciliary care at individual and state-wide levels.

  7. Sediment Production from Settlements and Farmlands within Lake Victoria Shoreline Zone in Uganda and Tanzania

    Directory of Open Access Journals (Sweden)

    Isabirye, M.

    2010-01-01

    Full Text Available In spite of the general acceptance that the current land use changes are unlikely to yield a sustainable environment, the source of sediment that causes eutrophication in Lake Victoria is not clearly understood. It is hypothesized that roads, footpaths, and compounds (settlement are a major source of sediments. This study was conducted on the northern Lake Victoria shoreline to determine the rate of sediment generated by agricultural and settlement land use types. Results show that settlements generate significantly higher sediment yields i.e. between 17- 87 ton.ha-1. yr -1 whereas agricultural land use types produced between 0-27 ton ha-1.yr-1. The high sediment yield from settlements is attributed to high runoff coefficients and the occurrence of gully erosion. The high sediment yield from settlements justifies the need to conduct further investigations on the contribution of settlements to sediment production in catchments with different soil - landscape and climatic setting in the Lake Victoria catchment.

  8. Comparison of mortality following hospitalisation for isolated head injury in England and Wales, and Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    Belinda J Gabbe

    Full Text Available BACKGROUND: Traumatic brain injury (TBI remains a leading cause of death and disability. The National Institute for Health and Clinical Excellence (NICE guidelines recommend transfer of severe TBI cases to neurosurgical centres, irrespective of the need for neurosurgery. This observational study investigated the risk-adjusted mortality of isolated TBI admissions in England/Wales, and Victoria, Australia, and the impact of neurosurgical centre management on outcomes. METHODS: Isolated TBI admissions (>15 years, July 2005-June 2006 were extracted from the hospital discharge datasets for both jurisdictions. Severe isolated TBI (AIS severity >3 admissions were provided by the Trauma Audit and Research Network (TARN and Victorian State Trauma Registry (VSTR for England/Wales, and Victoria, respectively. Multivariable logistic regression was used to compare risk-adjusted mortality between jurisdictions. FINDINGS: Mortality was 12% (749/6256 in England/Wales and 9% (91/1048 in Victoria for isolated TBI admissions. Adjusted odds of death in England/Wales were higher compared to Victoria overall (OR 2.0, 95% CI: 1.6, 2.5, and for cases <65 years (OR 2.36, 95% CI: 1.51, 3.69. For severe TBI, mortality was 23% (133/575 for TARN and 20% (68/346 for VSTR, with 72% of TARN and 86% of VSTR cases managed at a neurosurgical centre. The adjusted mortality odds for severe TBI cases in TARN were higher compared to the VSTR (OR 1.45, 95% CI: 0.96, 2.19, but particularly for cases <65 years (OR 2.04, 95% CI: 1.07, 3.90. Neurosurgical centre management modified the effect overall (OR 1.12, 95% CI: 0.73, 1.74 and for cases <65 years (OR 1.53, 95% CI: 0.77, 3.03. CONCLUSION: The risk-adjusted odds of mortality for all isolated TBI admissions, and severe TBI cases, were higher in England/Wales when compared to Victoria. The lower percentage of cases managed at neurosurgical centres in England and Wales was an explanatory factor, supporting the changes made to the NICE

  9. Aquatic and fisheries survey of the upper Victoria Nile: a report prepared for AES Nile Power Bujagali hydropower project, final report

    OpenAIRE

    2000-01-01

    The aquatic ecosystem of the Upper Victoria Nile is part of a wider complex of water bodies (lakes and rivers) in Uganda that is of immense socioeconomic importance, especially the fisheries. A source of food, income, energy, irrigation and drinking water, the protection, sustainable use and management of the Upper Victoria Nile water resources are vital to Uganda's economy. The Upper Victoria Nile,due to its abundance of socio-economic benefits,provides a significant contribution to Ugand...

  10. British History is Their History: Britain and the British Empire in the History Curriculum of Ontario, Canada and Victoria, Australia 1930-1975

    National Research Council Canada - National Science Library

    Stephen J Jackson

    2017-01-01

    This article investigates the evolving conceptions of national identity in Canada and Australia through an analysis of officially sanctioned history textbooks in Ontario, Canada and Victoria, Australia...

  11. Monitoring geodynamic activity in the Victoria Land, East Antarctica: Evidence from GNSS measurements

    Science.gov (United States)

    Zanutta, A.; Negusini, M.; Vittuari, L.; Cianfarra, P.; Salvini, F.; Mancini, F.; Sterzai, P.; Dubbini, M.; Galeandro, A.; Capra, A.

    2017-10-01

    GNSS networks in Antarctica are a fundamental tool to define actual crustal displacements due to geological and geophysical processes and to constrain the glacial isostatic models (GIA). A large network devoted to the detection and monitoring of crustal deformations in the Northern Victoria Land (Victoria Land Network for DEFormation control - VLNDEF), was monumented during the 1999-2000 and 2000-2001 field campaigns, as part of Italian National Program for Antarctic Research and surveyed periodically during the Southern summer seasons. In this paper, GPS observations of VLNDEF collected over a more than 15-year span, together with various selected POLENET sites and more than 70 IGS stations, were processed with Bernese Software, using a classical double difference approach. A solution was obtained combining NEQs by means of ADDNEQ2/FODITS tools embedded in Bernese Software. All the Antarctic sites were kept free and a subset of 50 IGS stations were used to frame VLNDEF into ITRF2008. New evidence provided by analysis of GPS time series for the VLNDEF network is presented; also displacements along the vertical component are compared with the recently published GIA models. The absolute velocities indicate an overall displacement of the northern Victoria Land region along the south-east direction (Ve = 10.6 mm/yr, Vn = -11.5 mm/yr) and an average uplift rate of Vu = 0.5 mm/yr. Two GIA models have been analyzed: ICE-6G_C-VM5a proposed by Argus et al. (2014), Peltier et al. (2015) and W12A_v1 by Whitehouse et al. (2012a,b). Up rates, predicted over the VLNDEF sites by the mentioned GIA models, have been extracted and compared with those observed. A preliminary comparison with GPS-derived vertical rates shows that the Victoria Land ICE-6G_C-VM5 and W12A_v1 GIA models predict overestimated uplift rates of 0.7 and 0.9 mm/yr weighted mean residuals respectively. The mean horizontal relative motions within the Victoria Land (VL) area are in most cases negligible, while only

  12. Stable isotope paleoecology of Late Pleistocene Middle Stone Age humans from the Lake Victoria basin, Kenya.

    Science.gov (United States)

    Garrett, Nicole D; Fox, David L; McNulty, Kieran P; Faith, J Tyler; Peppe, Daniel J; Van Plantinga, Alex; Tryon, Christian A

    2015-05-01

    Paleoanthropologists have long argued that environmental pressures played a key role in human evolution. However, our understanding of how these pressures mediated the behavioral and biological diversity of early modern humans and their migration patterns within and out of Africa is limited by a lack of archaeological evidence associated with detailed paleoenvironmental data. Here, we present the first stable isotopic data from paleosols and fauna associated with Middle Stone Age (MSA) sites in East Africa. Late Pleistocene (∼100-45 ka, thousands of years ago) sediments on Rusinga and Mfangano Islands in eastern Lake Victoria (Kenya) preserve a taxonomically diverse, non-analog faunal community associated with MSA artifacts. We analyzed the stable carbon and oxygen isotope composition of paleosol carbonate and organic matter and fossil mammalian tooth enamel, including the first analyses for several extinct bovids such as Rusingoryx atopocranion, Damaliscus hypsodon, and an unnamed impala species. Both paleosol carbonate and organic matter data suggest that local habitats associated with human activities were primarily riverine woodland ecosystems. However, mammalian tooth enamel data indicate that most large-bodied mammals consumed a predominantly C4 diet, suggesting an extensive C4 grassland surrounding these riverine woodlands in the region at the time. These data are consistent with other lines of paleoenvironmental evidence that imply a substantially reduced Lake Victoria at this time, and demonstrate that C4 grasslands were significantly expanded into equatorial Africa compared with their present distribution, which could have facilitated dispersal of human populations and other biotic communities. Our results indicate that early populations of Homo sapiens from the Lake Victoria region exploited locally wooded and well-watered habitats within a larger grassland ecosystem. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. The molecular epidemiology of norovirus outbreaks in Victoria, 2014 to 2015
.

    Science.gov (United States)

    Bruggink, Leesa D; Moselen, Jean M; Marshall, John A

    2017-03-31

    Noroviruses are a leading cause of outbreaks of gastroenteritis. This study examined the incidence and molecular characteristics of norovirus outbreaks in healthcare and non-healthcare settings in Victoria, Australia, over 2 years (2014-2015). Norovirus was detected in 65.7% and 60.4% of gastroenteritis outbreaks investigated for the years 2014 and 2015 respectively. There was a significant decline in the number of norovirus outbreaks in the period 2014 to 2015 although in both years norovirus outbreaks peaked in the latter part of the year. Norovirus Open Reading Frame (ORF) 2 (capsid) genotypes identified included GI.2, GI.3, GI.4, GI.5, GI.6, GI.9, GII.2, GII.3, GII.4, GII.6, GII.7, GII.8, GII.13 and GII.17. GII.4 was the most common genotype detected. In addition, the following ORF 1/ORF 2 recombinant forms were confirmed: GII.P4_NewOrleans_2009/GII.4_Sydney_2012, GII.P12/GII.3, GII.Pb (GII.21)/GII.3, GII.Pe/GII.2 and GII.Pe/GII.4_Sydney_2012. A significant decline was noted in the chief norovirus strain GII.Pe/GII.4_Sydney_2012 between 2014 and 2015 but there was a re-emergence of a GII.P4_ NewOrleans _2009 norovirus strain. Outbreaks involving the GII.P17/GII.17 genotype were also detected for the first time in Victoria. GI genotypes circulating in Victoria for the 2 years 2014 and 2015 underwent a dramatic change between the 2 years of the survey. Many genotypes could occur in both healthcare and non-healthcare settings although GI.3, GII.6, and GII.4 were significantly more common in healthcare settings. The study emphasises the complex way in which norovirus circulates throughout the community.

  14. Sex and sport: sexual risk behaviour in young people in rural and regional Victoria.

    Science.gov (United States)

    Kong, Fabian Y S; Hocking, Jane S; Link, Chris Kyle; Chen, Marcus Y; Hellard, Margaret E

    2010-06-01

    To determine the prevalence of chlamydia and understand sexual risk behaviour in 16-29 year olds in rural Victoria through a chlamydia testing program undertaken at local sporting clubs. Young people were recruited from the Loddon Mallee region of Victoria, Australia between May and September 2007. After a night of sporting practice, participants provided a first pass urine sample and completed a brief questionnaire about sexual risk behaviour. Those positive for chlamydia were managed by telephone consultation with a practitioner from Melbourne Sexual Health Centre. A total of 709 young people participated (77% male, 23% female) in the study; 77% were sexually active. Overall chlamydia prevalence in sexually active participants was 5.1% (95% confidence interval [CI]: 3.4-7.3); 7.4% in females (95% CI: 3.5-13.6) and 4.5% in males (95% CI: 2.7-6.9). Approximately 60% of males and 20% of females consumed alcohol at high 'Risky Single Occasion Drinking' levels at least weekly and 60% had used an illicit drug in their lifetime. Nearly 45% reported having sex in the past year when they usually would not have because they were too drunk or high. Sexually transmissible infection (STI) knowledge was generally poor and only 25% used a condom the last time they had sex. Chlamydia prevalence was high in our study population. Many participants had poor knowledge about STIs and low condom use. These findings combined with high levels of risky alcohol use and having sex while intoxicated highlights the need for programs in rural and regional Victoria that combine both STI testing and prevention and education programs.

  15. The Most Effective Methods for Delivering Severe Weather Early Warnings to Fishermen on Lake Victoria.

    Science.gov (United States)

    Tushemereirwe, Richard; Tuhebwe, Doreen; Cooper, Mary Ann; D'ujanga, Florence Mutonyi

    2017-02-22

    Introduction : It is estimated that five thousand people die on Lake Victoria every year by drowning which is triggered by severe weather hazards like lightning. Objectives :  In order to improve predictability of severe weather conditions on Lake Victoria, there is need to deliver timely and effective Severe Weather Early Warning Systems (SWEWS) to those at risk. On Lake Victoria, previous SWEW service trials ceased with the end of the funding grants. This study therefore assessed the possibility of sustaining the SWEW service by assessing willingness to pay.   Methods : An assessment was conducted between March and May 2015 to determine the SWEW service improvements desired by the population. A convenience sample of respondents was gathered and interviewed during impromptu visits to landing sites on Lake Victoria. The respondents were also among community members that had earlier participated in a pilot assessing the feasibility of mobile phones is delivering SWEW alerts.  Semi-structured questionnaires were administered to fishermen and fisher folks at the landing site to gather suggestions/strategies for (i) better design and implementation of SWEW service, (ii) use of smart phones, and (iii) their ability and willingness to pay for a SWEW service. Results were presented as frequencies. Results : Two hundred fifteen respondents from fourteen landing sites (communities) were interviewed. Over 50% of the respondents (113/215) were aware about at least one community member who had been injured due to lightening on the lake in the past year. Ninety two percent (198/215) of the respondents reported using mobile phones as their main tool of communication but only 4% had smart phones that could receive early warning weather alerts through internet connectivity. Seventy five percent of respondents said they would welcome a system that could deliver commercial weather alerts and 65% were willing to pay for such a service.   Conclusions : A SWEW service is feasible

  16. Gambling revenues as a public administration issue: electronic gaming machines in Victoria.

    Science.gov (United States)

    Pickernell, David; Keast, Robyn; Brown, Kerry; Yousefpour, Nina; Miller, Chris

    2013-12-01

    Gambling activities and the revenues derived have been seen as a way to increase economic development in deprived areas. There are also, however, concerns about the effects of gambling in general and electronic gaming machines (EGMs) in particular, on the resources available to the localities in which they are situated. This paper focuses on the factors that determine the extent and spending of community benefit-related EGM-generated resources within Victoria, Australia, focusing in particular on the relationships between EGM activity and socio-economic and social capital indicators, and how this relates to the community benefit resources generated by gaming.

  17. A Baseline Air Quality Assessment Onboard a Victoria Class Submarine: HMCS Windsor

    Science.gov (United States)

    2006-05-01

    défense Canada – Toronto; May 2006. Pour faciliter l’élaboration de futurs plans de gestion de la qualité de l’air à bord des nouveaux sous-marins de...visant à améliorer la gestion de la qualité de l’air à bord de sous-marins de classe Victoria. Ces recommandations comprennent : l’examen de tous les... ambient air from the WSC (centre of the torpedo racks, used as bunk space); Senior Rates Mess Accommodation Space (aft compartment); Junior Rates

  18. Gastropod diversity, distribution and abundance in habitats with and without anthropogenic disturbances in Lake Victoria, Kenya

    DEFF Research Database (Denmark)

    Lange, C. N.; Kristensen, Thomas K.; Madsen, Henry

    2013-01-01

    We investigated freshwater gastropod diversity, abundance and distribution in habitats with and without anthropogenic disturbance in two localities, Ndere in the Winam Gulf and Mbita Point, Lake Victoria, Kenya, from May 2002 to January 2004. A total of 133 984 gastropod specimens belonging to 15...... and other wastes so as to reduce local eutrophication, thereby reducing risks associated with transmission of potential snail-borne diseases. © 2013...... species were recorded, 14 from Mbita and 12 from Ndere. Two species, Ferrissia kavirondica and Cleopatra cridlandi, which were recorded only from undisturbed habitats, could be indicators of least disturbed habitats. Water chemistry did differ between fish landing sites and undisturbed habitats at some...

  19. Microbial quality and safety of fresh and dried Rastrineobola argentea from Lake Victoria, Tanzania

    DEFF Research Database (Denmark)

    Baniga, Zebedayo; Dalsgaard, Anders; Mhongole, Ofred J

    2017-01-01

    Rastrineobola argentea (silver cyprinid/sardines) is an important commercial fish species found in Lake Victoria. It is an important protein source for consumers in several African countries including Tanzania. A cross-sectional study was conducted using standard methods to assess the bacteriolog...... sites contained 30% (n = 20) and those from the markets contained 15% (n = 20) Salmonella spp. Salmonella spp. were not detected in sardines dried on racks. To conclude, sun drying of sardines on racks is an effective drying method providing a safe product for human consumption....

  20. A new species of Anabarhynchus (Diptera: Therevidae from an ocean beach in south east Victoria

    Directory of Open Access Journals (Sweden)

    David Ferguson

    2014-09-01

    Full Text Available Anabarhynchus Macquart 1848 is a large genus of the Therevidae (Diptera that are endemic to Australasia with a couple of described species from Melanesia. We describe and illustrate Anabarhynchus oceanus sp. n., a species found on ocean beaches in eastern Victoria, Australia. The species shares most characters with the monobasic A. kampmeierae species group of Lyneborg (2001, but also shares a unique feature of the male genitalia with the endemic New Zealand genus Megathereva Lyneborg, 1992. This new species brings the total number of described Australian species in the genus to 113.

  1. VICTORIA: A mechanistic model of radionuclide behavior in the reactor coolant system under severe accident conditions. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Heams, T J [Science Applications International Corp., Albuquerque, NM (United States); Williams, D A; Johns, N A; Mason, A [UKAEA, Winfrith, (England); Bixler, N E; Grimley, A J [Sandia National Labs., Albuquerque, NM (United States); Wheatley, C J [UKAEA, Culcheth (England); Dickson, L W [Atomic Energy of Canada Ltd., Chalk River, ON (Canada); Osborn-Lee, I [Oak Ridge National Lab., TN (United States); Domagala, P; Zawadzki, S; Rest, J [Argonne National Lab., IL (United States); Alexander, C A [Battelle, Columbus, OH (United States); Lee, R Y [Nuclear Regulatory Commission, Washington, DC (United States)

    1992-12-01

    The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided.

  2. La construcción de legitimidad del Frente para la Victoria (1988-1991 Frente para la Victoria's construction of legitimacy (1988-1991

    Directory of Open Access Journals (Sweden)

    Pamela Sosa

    2011-06-01

    Full Text Available El trabajo aborda la construcción de legitimidad del Frente para la Victoria (FV en el escenario político de Santa Cruz desde su nacimiento en 1988 hasta llegar a la gobernación en 1991. Se identifican tres fuentes de legitimidad construidas de manera alternativa al debilitamiento de la credibilidad de los partidos políticos tradicionales: la UCR, el PJ, el PI y el MID, entre otros. En este contexto, el Frente para la Victoria desplegó sus estrategias de legitimación apelando a la unidad de lo diverso y sumando referentes individuales de todo el arco político. Por otro lado, apeló a través de sus discursos y la conformación de los elencos y organizaciones a representar la fragmentación social propia de una sociedad compuesta por capas migratorias y, por último, construyó una novedosa oferta política a-partidaria acorde a las representaciones de la crisis estatal a mediados del '80 a partir de la reivindicación de los valores de la gestión, la eficiencia, el orden, el trabajo y la gobernabilidad. Sus estrategias de legitimación muestran cómo la primera etapa de construcción de poder político del FV fue efecto de su trayectoria en la frontera de los débiles grupos sociales y políticos.O trabalho aborda a construção de legitimidade do Frente para la Victoria (FV no cenário político de Santa Cruz desde seu nascimento em 1988 até chegar ao governo em 1991. Identificam-se três fontes de legitimidade construídas de maneira alternativa ao enfraquecimento da credibilidade dos partidos políticos tradicionais: a UCR, o PJ, o PI e o MID, entre outros. Neste contexto, o Frente para la Victoria desdobrou suas estratégias de legitimação apelando à unidade do que for diverso e somando referências individuais de todo o arco político. Por outro lado, apelou, através de seus discursos e a conformação dos elencos e organizações, a representar a fragmentação social própria de uma sociedade composta por camadas migrat

  3. Influence of the Pearl River estuary and vertical mixing in Victoria Harbor on water quality in relation to eutrophication impacts in Hong Kong waters.

    Science.gov (United States)

    Yin, Kedong; Harrison, Paul J

    2007-06-01

    This study presents water quality parameters such as nutrients, phytoplankton biomass and dissolved oxygen based on 11 years of water quality data in Victoria Harbor and examined how the Pearl River estuary discharge in summer and year round sewage discharge influenced these parameters. Nutrients in Victoria Harbor were strongly influenced by both the Pearl River and sewage effluent, as indicated by the high NO(3) inputs from the Pearl River in summer and higher NH(4) and PO(4) in Victoria Harbor than both its sides. N:P ratios were low in the dry season, but increased to >16:1 in the wet season, suggesting that P is potentially the most limiting nutrient in this area during the critical period in the summer. Although there were generally high nutrients, the phytoplankton biomass was not as high as one would expect in Victoria Harbor. In fact, there were high concentrations of chl near the bottom well below the photic zone. Salinity near the bottom was lower in Victoria Harbor than at the two entrances to Victoria Harbor, suggesting strong vertical mixing within Victoria Harbor. Therefore, strong vertical mixing and horizontal advection appear to play an important role in significantly reducing eutrophication impacts in Victoria Harbor. Consequently, dissolved oxygen near the bottom was low in summer, but only occasionally dipped to 2 mgL(-1) despite the high organic loading from sewage effluent.

  4. Round the bend: a brief history of mental health nursing in Victoria, Australia 1848 to 1950's.

    Science.gov (United States)

    Sands, Natisha Marina

    2009-06-01

    This paper presents a history of mental health nursing in Victoria, Australia from 1848 to the 1950's, or the asylum years to the era of the mental hospital. The research for this historical overview was conducted as part of a literature review for a mental health nursing doctoral thesis, which included an account of the evolution of the profession from asylum attendant to the present time. The literature reviewed for this project revealed a distinct lack of a coherent, chronological account of the historical development of mental health nursing in Victoria, and this paper seeks to address that knowledge gap.

  5. Aprendiendo a entender. Victoria Ocampo y su descubrimiento de los Estados Unidos

    Directory of Open Access Journals (Sweden)

    Plotkin, Mariano

    2002-12-01

    Full Text Available The article analyzes the evolving relationship that Argentine intellectual and cultural entrepreneur Victoria Ocampo established with the United States. Through her trajectory the article analyzes broader topics such as the evolution of the Argentine social and intellectual élite’s project of modernization. Ocampo was at the same time a typical and a unique representative of the Argentine social élite. She was typical in the way she was educated in a cosmopolitan environment. She was unique because she occupied a central figure in the Argentine field of cultural production since the 1920 until her death in the late 1970s.

    El artículo analiza la evolución de la compleja relación que la intelectual y empresaria cultural argentina Victoria Ocampo estableció con los Estados Unidos. A través de esta trayectoria, el artículo analiza también temas mas amplios como la evolución de los proyectos modernizadores de la élite social e intelectual argentina. Ocampo era a la vez una representante típica y única de su clase social. Era típica por la manera en que fue educada en un ambiente cosmopolita. Era única por el lugar central que ocupó en el campo intelectual argentino desde la década de 1920 hasta su muerte a finales de los años 70.

  6. Reasons women give for contemplating or undergoing abortion: a qualitative investigation in Victoria, Australia.

    Science.gov (United States)

    Kirkman, Maggie; Rosenthal, Doreen; Mallett, Shelley; Rowe, Heather; Hardiman, Annarella

    2010-11-01

    To increase understanding of women's perspectives on considering or undergoing elective abortion. Qualitative study. A large public women's hospital in the state of Victoria, Australia. Sixty women who had contacted a public pregnancy advisory service in Victoria, Australia, seeking information, advice, or appointments in relation to an unplanned or unwanted pregnancy. Qualitative telephone interviews. The iterative qualitative analysis employed the five stages of a thematic framework approach. Themes in women's accounts of considering or undergoing elective abortion. Women's accounts emphasized their reasons for considering or seeking abortion. Decisions were made in the context of their lives as a whole; influences were usually contingent and multiple. Reasons related to the woman herself, the potential child, existing children, her partner and other significant relationships, and financial matters. This research used qualitative methods to produce the only recent study of its kind in Australia. Women's accounts reveal the complex personal and social contexts within which reproductive events must be comprehended and the thoughtfulness with which they make decisions. Results of this research will assist health-care professionals to increase their insights into women's reproductive experiences. Copyright © 2010 Elsevier B.V. All rights reserved.

  7. Individual and community correlates of young people's high-risk drinking in Victoria, Australia.

    Science.gov (United States)

    Livingston, Michael; Laslett, Anne-Marie; Dietze, Paul

    2008-12-01

    To examine key individual- and community-level correlates of regular very high-risk drinking (more than 20 drinks at least 12 times a year for males and more than 11 drinks at least 12 times a year for females) among young (16-24) drinkers in Victoria. CATI survey of 10,879 young Victorian drinkers. Multi-level modelling of correlates of proportion drinking at very high-risk levels at both individual (e.g. age, gender) and community levels (e.g. alcohol outlet density, remoteness). One-fifth of the sample reported regular (at least monthly) very high-risk drinking. Significant individual-level correlates of very high-risk drinking included age, gender, cultural background, recreational spending money, life stage, living situation, family conflict and age at first drink. Significant community-level correlates included remoteness (living in a rural area) and packaged liquor outlet density. The study highlights a range of important factors relating to regular drinking of dangerous amounts of alcohol by youth. Interventions aimed at preventing early initiation or managing recreational spending should be explored. Further, regulatory management of packaged liquor outlets and or remote rural communities in Victoria with high levels of dangerous drinking should be a priority.

  8. A longitudinal study of the cost of food in Victoria influenced by geography and nutritional quality.

    Science.gov (United States)

    Palermo, Claire; McCartan, Julia; Kleve, Sue; Sinha, Kompal; Shiell, Alan

    2016-06-01

    To monitor the cost and affordability of a nutritious diet and to assess the influence of distance from the capital city and socioeconomic status on the cost of nutritious food in Victoria. Twenty-six of Victoria's 79 local government areas (33%) were randomly chosen for inclusion in the study. A random sample of stores was selected for inclusion from each local government area. The cost of the 44 'healthy' and 10 'discretionary' food and drinks in the healthy food basket for a family of four for a fortnight was collected during the winter and summer of 2012, 2013 and 2014. The mean cost of the basket increased from $424.06 ± 38.22 in winter 2012 to $451.19 ± 33.83 in summer 2014 (pcost. These findings show that a healthy diet may be unaffordable for some Victorians. The cost of food is a key factor influencing intake. Public health strategies may need to consider strategies to make healthy food more affordable for some. © 2015 Public Health Association of Australia.

  9. Prescription opioid dispensing and prescription opioid poisoning: Population data from Victoria, Australia 2006 to 2013.

    Science.gov (United States)

    Berecki-Gisolf, Janneke; Hassani-Mahmooei, Behrooz; Clapperton, Angela; McClure, Roderick

    2017-02-01

    To describe recent trends in opioid prescribing and prescription opioid poisoning resulting in hospitalisation or death in Victoria, Australia. This is a population-based ecological study of residents of Victoria, 2006 - 14. Australian Bureau of Statistics residential population data were combined with Pharmaceutical Benefits Scheme (PBS) opioid prescription data, Victorian Admitted Episodes Data (VAED) and cause of death data. Annual opioid dispensings increased by 78% in 2006 - 13, from 0.33 to 0.58 per population. Opioid use increased with age: in 2013, 14% of Victorian residents aged ≥65 years filled at least one oxycodone prescription. In 2006 - 14, prescription opioid related hospital admissions increased by 6.8% per year, from 107 to 187 /1,000,000 person-years; 56% were due to intentional self-poisoning. Annual deaths increased from 21 to 28 /1,000,000 persons, in 2007 - 11. Admissions and deaths peaked at 25-44 years. Although both opioid prescribing and poisoning have increased, there is discrepancy between the exposed group (dispensings increased with age) and those with adverse consequences (rates peaked at ages 25-44 years). A better understanding is needed of drivers of prescribing and adverse consequences. Together with monitoring of prescribing and poisoning, this will facilitate early detection and prevention of a public health problem. © 2016 The Authors.

  10. VIRGINIA WOOLF EN LOS TESTIMONIOS DE VICTORIA OCAMPO: TENSIONES ENTRE FEMINISMO Y COLONIALISMO

    Directory of Open Access Journals (Sweden)

    Alicia Salomone

    2006-11-01

    Full Text Available En este artículo se analizan una serie de textos ensayísticos de la escritora argentina Victoria Ocampo (1890-1979, en los que ella aborda la relación que la ligó a Virginia Woolf, su principal referente en términos literarios y feministas. Desde perspectivas teóricas postcoloniales y feministas, se hace una interpretación de los textos de Ocampo, observando los límites que la cosmovisión colonialista impone no solo a sus diálogos con Woolf, sino al despliegue de su propia escrituraThis article reviews a series of essays by the Argentine writer Victoria Ocampo (1890-1979 in which she deals with the relationship that bound her to Virginia Woolf, her main referent in literary and feminist terms. From postcolonial theoretical perspectives, an interpretation of Ocampo's texts is made, while noticing the limits that the colonialist cosmic vision imposed not only on her dialogues with Woolf but on the development of her own writing

  11. Reproductive efficiency of Thoroughbred and Standardbred horses in north-east Victoria.

    Science.gov (United States)

    Nath, L C; Anderson, G A; McKinnon, A O

    2010-05-01

    To evaluate the reproductive efficiency of horse farms in north-east Victoria and identify aspects of management to be targeted for improving reproductive efficiency. Retrospective study. Records from seven Thoroughbred (TB) and four Standardbred (STB) studs in north-east Victoria from 1990 to 2001 were reviewed; 8813 cycles in 4455 mares were analysed. TB mares were inseminated by natural mating, whereas STB mares (89%) were artificially inseminated. The overall early pregnancy rate per cycle was 68.8% for TB mares and for STB mares, 68.3%. Multiple pregnancy per cycle was more frequent in TB (8.3%) than in STB (4.6%) mares (P reproductive status within the TB than the STB mares. Pregnancy rate per cycle among stallions ranged from 48% to 79%. On-farm pregnancy rates in both breeds were higher than previously reported and likely reflect improvements in reproductive management. The disparity between breeds in the inseminations per cycle and proportion of barren mares exposed the differing structures of the two industries, and presents a target for improving the reproductive efficiency in STBs. The difference between breeds in the multiple pregnancy rate per cycle likely reflects the higher ovulation rate of TB mares. The variability in pregnancy rate per cycle between the 22 stallions was associated with differences in individual inherent fertility and the quality of stallion management.

  12. Climatic variability in combination with eutrophication drives adaptive responses in the gills of Lake Victoria cichlids.

    Science.gov (United States)

    van Rijssel, Jacco C; Hecky, Robert E; Kishe-Machumu, Mary A; Meijer, Saskia E; Pols, Johan; van Tienderen, Kaj M; Ververs, Jan D; Wanink, Jan H; Witte, Frans

    2016-12-01

    Textbook examples of adaptive radiation often show rapid morphological changes in response to environmental perturbations. East Africa's Lake Victoria, famous for its stunning adaptive radiation of cichlids, has suffered from human-induced eutrophication over the past decades. This cultural eutrophication is thought to be partly responsible for the dramatically reduced cichlid biodiversity, but climatic variability in itself might also have contributed to the eutrophication which resulted in low oxygen levels and decreased water transparency. To determine how recent environmental changes have influenced the lake and its cichlids over the past 50 years, we gathered environmental and meteorological variables and compared these with gill surface area of four cichlid species. We found that during the period of severe eutrophication and temperature increase (1980s), reduced wind speeds coincided with a reduction in oxygen levels and a decrease in both water temperature and transparency. The gill surface area in three out of the four cichlid species increased during this period which is consistent with adaptive change in response to increased hypoxia. During the 2000s, wind speeds, oxygen levels, water transparency and water temperature increased again, while cichlid gill surface area decreased. Our results imply that climatic changes and especially wind speed and direction might play a crucial role in tropical lake dynamics. The changes in Lake Victoria's water quality coincide with fluctuations in cichlid gill surface area, suggesting that these fish can respond rapidly to environmental perturbations, but also that climatic variability, together with continued eutrophication, might be detrimental to the lake's cichlid biodiversity.

  13. Acute stress ulceration prophylaxis: point prevalence surveys in intensive care units in Victoria, 1997 and 2005.

    Science.gov (United States)

    Robertson, Megan S; Wilson, Stuart J; Cade, John F

    2008-03-01

    To assess current practice in acute stress ulceration (ASU) prophylaxis in adult intensive care units in Victoria, Australia, in 1997 and 2005. Point prevalence surveys using a structured telephone questionnaire of ASU prophylaxis practices were performed in adult ICUs in Victoria on 11 November 1997 and 13 April 2005. All Victorian ICUs identified on each study day participated, comprising 30 ICUs in 1997 and 35 ICUs in 2005. Presence of a clinical protocol or guideline for ASU prophylaxis increased significantly from 23% in 1997 to 54% in 2005 (P = 0.01). Overall provision of ASU prophylaxis to ICU patients also increased significantly from 67% in 1997 to 86% in 2005 (P 1997 to 45% in 2005 (P 1997 and 2005. Use of ASU prophylaxis for patients admitted to Victorian ICUs increased significantly from 1997 to 2005, with an associated increase in the presence of protocols or guidelines for ASU prophylaxis. Although agents currently used for ASU prophylaxis in Victorian ICUs are consistent with available evidence, we are concerned that ASU prophylaxis is given to all patients admitted to the ICU rather than targeted to patients in high-risk categories.

  14. Re-visitando a Federica Montseny. Una lectura de La Victoria y sus lecturas

    Directory of Open Access Journals (Sweden)

    Lozano de la Pola, Ana

    2006-06-01

    Full Text Available This article wants to be a close reading of La Victoria, Federica Montseny’s novel published in 1925, in order to achieve two objectives: on the one hand, to break down the clichés that normally appear in Montseny’s work –her “revolutionary melodrama”- as a perfect example of the eternal “ethic-aesthetic” paradox and, on the other hand, to point out the capability of this kind of study to dynamize the so-called “women’s literature” in the context of the XX Century Spanish literature.Este artículo pretende hacer una lectura atenta de La Victoria, novela de Federica Montseny publicada en 1925, con dos objetivos: en primer lugar, deshacer los clichés que suelen tratar la obra de esta autora como representante de la eterna “paradoja ético-estética” que suponen sus “folletines revolucionarios” y, en segundo, señalar la capacidad que tiene el estudio de este tipo de obras para dinamizar la categoría de “literatura de mujeres” con el fin de evitar su estancamiento en el ámbito de la literatura española del s. XX.

  15. Comparison of Sterol Biomarkers for Sewage with other Measures in Victoria Harbour, B.C., Canada

    Science.gov (United States)

    Mudge, S. M.; Lintern, D. Gwyn

    1999-01-01

    A lipid biomarker survey was conducted in Victoria Harbour, Canada, to compare the distribution of sewage-derived organic matter with existing results from bacterial studies. Previous surveys [Miller (1993) Report prepared by Capital Regional District Engineering Department, Victoria, B.C. Canada and Miller et al. (1995) Report prepared by CRD Environmental Services Group and Aquatic Science Consultants Ltd., B.C., Canada] of sewage contamination in the harbour were based principally on infrequent faecal coliform counts. The use of lipid biomarkers to determine time-averaged concentrations of sewage components in sediments may be a more appropriate method for defining areas where sewage is causing environmental or human health risks. 5β-Coprostanol was measured together with other sterols, fatty acids and fatty alcohols. Generally, sewage contamination shown by these lipid biomarkers was coincident with high faecal coliform counts from previous studies. However, this survey suggests, contrary to faecal coliform counts, that Portage Inlet was a region where sewage had accumulated in the sediments, possibly due to nearby overflow facilities or tidal pumping. Although the bacterial counts were low, sewage-derived organic matter was accumulating in the slack areas. In sediments of the Gorge and West Bay there were low faecal biomarker concentrations; this was probably due to the strong tidal currents which do not allow faecal matter to settle in sediments. Faecal coliform counts, however, indicated poor water quality in these same regions but this probably reflects fresh discharges passing through this area without leading to settlement.

  16. Rural Health and Spiritual Care Development: A Review of Programs across Rural Victoria, Australia.

    Science.gov (United States)

    Carey, Lindsay B; Hennequin, Christine; Krikheli, Lillian; O'Brien, Annette; Sanchez, Erin; Marsden, Candace R

    2016-06-01

    Given declining populations in rural areas and diminishing traditional religious support, this research explores whether spiritual care education programs would be beneficial for and appreciated by those working in rural health and/or community organizations. An overview of literature identified three dominant rural health issues affecting the provision of spiritual care in rural areas, namely the disparity between rural and urban areas in terms of resources, the lack of access to services, plus the need for education and training within rural areas. Spiritual Health Victoria Incorporated (Victoria, Australia) sought to address these issues with the implementation of a variety of spiritual education programs within rural areas. Results of an evaluation of these programs are presented specifying participant demographics, reasons why participants attended, their evaluation of the program and any recommendations for future programs. In overall terms, the results indicated that at least 90% of participants favorably rated their attended program as either 'very good' or 'good' and indicated that the main reason for their attendance was to develop their own education and/or practice of spiritual care within their rural context for the benefit of local constituents. Several recommendations are made for future programs.

  17. Algal biomass and pigments along a latitudinal gradient in Victoria Land lakes, East Antarctica

    Directory of Open Access Journals (Sweden)

    Francesca Borghini

    2016-05-01

    Full Text Available It is generally accepted that Antarctic terrestrial diversity decreases as latitude increases, but latitudinal patterns of several organisms are not always as clear as expected. The Victoria Land region is rich in lakes and ponds and spans 8 degrees of latitude that encompasses gradients in factors such as solar radiation, temperature, ice cover and day length. An understanding of the links between latitudinally driven environmental and biodiversity changes is essential to the understanding of the ecology and evolution of Antarctic biota and the formulation of hypotheses about likely future changes in biodiversity. As several studies have demonstrated that photosynthetic pigments are an excellent, although underused, tool for the study of lacustrine algal communities, the aim of the present study was to investigate variations in algal biomass and biodiversity across the latitudinal gradient of Victoria Land using sedimentary pigments. We test the hypothesis that the biodiversity of freshwater environments decreases as latitude increases. On the basis of our results, we propose using the number of sedimentary pigments as a proxy for algal diversity and the sum of chlorophyll a and bacteriochlorophyll a with their degradation derivatives as an index of biomass. Overall, our data show that biomass and diversity decrease as latitude increases but local environmental conditions, in particular, natural levels of eutrophy, can affect both productivity and diversity.

  18. Performance of 119 Brazilian children on Stroop paradigm: Victoria version Desempenho de 119 crianças brasileiras no paradigma Stroop: versão Victoria

    Directory of Open Access Journals (Sweden)

    Helenice Charchat-Fichman

    2009-06-01

    Full Text Available BACKGROUND: The Stroop paradigm evaluates susceptibility to interference and is sensitive to dysfunction in frontal lobes. Performance in the Stroop changes along the development. Despite its usefulness in research and clinical settings, there are few studies with Brazilian samples. OBJECTIVE: This study investigates the performance and age effect on Stroop paradigm of Brazilian children. METHOD: A sample of 119 children, aged from 7 to 10 years, was submitted to the Victoria version of Stroop. RESULTS: The pattern of results observed was similar to that observed in foreign studies with adults and children. Younger children were overall slower than older ones (positive correlation between age and naming time. Also, younger children showed more susceptible to interference than older ones (negative correlation between age and number of errors for the maximal interference condition. CONCLUSION: There was an age effect explained in terms of developmental changes in information processing velocity and attention selectivity.INTRODUÇÃO: O paradigma Stroop avalia a susceptibilidade à interferência e é sensível a disfunção nos lobos frontais. O desempenho no Stroop muda durante o desenvolvimento. Apesar de sua utilidade na pesquisa e na clínica, existem poucos estudos brasileiros. OBJETIVO: Investigar o desempenho e efeito de idade de crianças brasileiras no Stroop. MÉTODO: A versão Victoria do Stroop foi aplicada em 119 crianças (7 a 10 anos. RESULTADOS: O padrão de resultados observado é comparável a estudos estrangeiros com adultos e crianças. Crianças mais jovens foram mais lentas do que as mais velhas (correlação positiva entre idade e tempo de nomeação. Os mais jovens apresentaram maior susceptibilidade à interferência, comparados aos mais velhos (correlação negativa entre idade e número de erros para a condição de interferência máxima. CONCLUSÃO: O efeito de idade foi observado e discutido em termos de mudanças na

  19. Three Decades of Implementation of School-Based Management in the Australian Capital Territory and Victoria in Australia

    Science.gov (United States)

    Gammage, David T.

    2008-01-01

    Purpose: The purpose of this paper is to explore how the process of implementation of school-based management (SBM) has worked within the public school systems in the Australian Capital Territory (ACT) and Victoria in Australia. The period covered was 1976-2006. Design/methodology/approach: The approach adopted was the mixed methodology which…

  20. Language in the Workplace Project and Workplace Communication for Skilled Migrants Course at Victoria University of Wellington, New Zealand

    Science.gov (United States)

    de Bres, Julia; Holmes, Janet; Joe, Angela; Marra, Meredith; Newton, Jonathan; Riddiford Nicky; Vine, Bernadette

    2009-01-01

    The School of Linguistics and Applied Language Studies (LALS) at Victoria University of Wellington conducts research and teaching in Linguistics, Applied Linguistics, Writing and Deaf Studies. It incorporates a Deaf Studies Research Unit, which undertakes research on topics relating to deaf people and their language in New Zealand, and the New…

  1. University of Victoria Genome British Columbia Proteomics Centre Partners with CPTAC | Office of Cancer Clinical Proteomics Research

    Science.gov (United States)

    University of Victoria Genome British Columbia Proteomics Centre, a leader in proteomic technology development, has partnered with the U.S. National Cancer Institute (NCI) to make targeted proteomic assays accessible to the community through NCI’s CPTAC Assay Portal (https://assays.cancer.gov).

  2. Possible implications of Rabbit Calicivirus Disease for malleefowl Leipoa ocellata Gould in the north-west of Victoria

    NARCIS (Netherlands)

    Sandell, P.

    1999-01-01

    Parks Victoria and the Department of Natural Resources & Environment (NRE) are collaborating with agencies from the other States and the Commonwealth of Australia in a national program of detailed monitoring and surveillance of the effects of Rabbit Calicivirus Disease (RCD). A component of the

  3. Victoria Khiterer. Jewish City or Inferno of Russian Israel? A History of the Jews in Kiev Before February 1917.

    Directory of Open Access Journals (Sweden)

    Kimberly St. Julian-Varnon

    2017-09-01

    Full Text Available Book review of Victoria Khiterer. Jewish City or Inferno of Russian Israel? A History of the Jews in Kiev Before February 1917. Academic Studies Press, 2016. Jews of Russia and Eastern Europe and Their Legacy, series editor, Maxim D. Shrayer. xx, 474 pp. Illustrations. Tables. Maps. Appendix. Bibliography. Index. $89.00, cloth.

  4. The Development and Use of Individual Learning Plans for Deaf and Hard of Hearing Students in Victoria, Australia

    Science.gov (United States)

    Brown, P. Margaret; Byrnes, Linda J.

    2014-01-01

    This study investigated the Individual Learning Plans of eighty-eight students who were deaf and hard of hearing attending facilities and schools for the deaf in Victoria Australia. The students' assessment and planning portfolios were scrutinised for evidence of formal and informal assessment used to generate goals for the Individual Learning…

  5. Chequered fortunes in global exports: The sociogenesis of African entrepreneurship in the Nile Perch Business at Lake Victoria, Uganda

    NARCIS (Netherlands)

    Beuving, J.J.

    2013-01-01

    This article looks at African entrepreneurship in the Nile perch export business at Lake Victoria, Uganda. Often heralded as an economic success story, this business has perhaps another tale to tell. The fishermen, traders and other small-scale entrepreneurs at the lower end of the export chain face

  6. Inter-guild differences and possible causes of the recovery of cichlid species in Lake Victoria, Tanzania

    NARCIS (Netherlands)

    Kishe-Machumu, Mary Alphonce

    2012-01-01

    Until the 1970s, the fish fauna of Lake Victoria was dominated by 500+ endemic haplochromine cichlid species in which detritivores was the dominant group followed by zooplanktivores. With the upsurge of Nile perch in the 1980s, a strong decline of haplochromines occurred. During the1990s, a

  7. Large serological survey showing cocirculation of Ebola and Marburg viruses in Gabonese bat populations, and a high seroprevalence of both viruses in Rousettus aegyptiacus.

    Science.gov (United States)

    Pourrut, Xavier; Souris, Marc; Towner, Jonathan S; Rollin, Pierre E; Nichol, Stuart T; Gonzalez, Jean-Paul; Leroy, Eric

    2009-09-28

    Ebola and Marburg viruses cause highly lethal hemorrhagic fevers in humans. Recently, bats of multiple species have been identified as possible natural hosts of Zaire ebolavirus (ZEBOV) in Gabon and Republic of Congo, and also of marburgvirus (MARV) in Gabon and Democratic Republic of Congo. We tested 2147 bats belonging to at least nine species sampled between 2003 and 2008 in three regions of Gabon and in the Ebola epidemic region of north Congo for IgG antibodies specific for ZEBOV and MARV. Overall, IgG antibodies to ZEBOV and MARV were found in 4% and 1% of bats, respectively. ZEBOV-specific antibodies were found in six bat species (Epomops franqueti, Hypsignathus monstrosus, Myonycteris torquata, Micropteropus pusillus, Mops condylurus and Rousettus aegyptiacus), while MARV-specific antibodies were only found in Rousettus aegyptiacus and Hypsignathus monstrosus. The prevalence of MARV-specific IgG was significantly higher in R. aegyptiacus members captured inside caves than elsewhere. No significant difference in prevalence was found according to age or gender. A higher prevalence of ZEBOV-specific IgG was found in pregnant females than in non pregnant females. These findings confirm that ZEBOV and MARV co-circulate in Gabon, the only country where bats infected by each virus have been found. IgG antibodies to both viruses were detected only in Rousettus aegyptiacus, suggesting that this bat species may be involved in the natural cycle of both Marburg and Ebola viruses. The presence of MARV in Gabon indicates a potential risk for a first human outbreak. Disease surveillance should be enhanced in areas near caves.

  8. Large serological survey showing cocirculation of Ebola and Marburg viruses in Gabonese bat populations, and a high seroprevalence of both viruses in Rousettus aegyptiacus

    Directory of Open Access Journals (Sweden)

    Rollin Pierre E

    2009-09-01

    Full Text Available Abstract Background Ebola and Marburg viruses cause highly lethal hemorrhagic fevers in humans. Recently, bats of multiple species have been identified as possible natural hosts of Zaire ebolavirus (ZEBOV in Gabon and Republic of Congo, and also of marburgvirus (MARV in Gabon and Democratic Republic of Congo. Methods We tested 2147 bats belonging to at least nine species sampled between 2003 and 2008 in three regions of Gabon and in the Ebola epidemic region of north Congo for IgG antibodies specific for ZEBOV and MARV. Results Overall, IgG antibodies to ZEBOV and MARV were found in 4% and 1% of bats, respectively. ZEBOV-specific antibodies were found in six bat species (Epomops franqueti, Hypsignathus monstrosus, Myonycteris torquata, Micropteropus pusillus, Mops condylurus and Rousettus aegyptiacus, while MARV-specific antibodies were only found in Rousettus aegyptiacus and Hypsignathus monstrosus. The prevalence of MARV-specific IgG was significantly higher in R. aegyptiacus members captured inside caves than elsewhere. No significant difference in prevalence was found according to age or gender. A higher prevalence of ZEBOV-specific IgG was found in pregnant females than in non pregnant females. Conclusion These findings confirm that ZEBOV and MARV co-circulate in Gabon, the only country where bats infected by each virus have been found. IgG antibodies to both viruses were detected only in Rousettus aegyptiacus, suggesting that this bat species may be involved in the natural cycle of both Marburg and Ebola viruses. The presence of MARV in Gabon indicates a potential risk for a first human outbreak. Disease surveillance should be enhanced in areas near caves.

  9. Structural basis for Marburg virus VP35-mediated immune evasion mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Ramanan, Parameshwaran; Edwards, Megan R.; Shabman, Reed S.; Leung, Daisy W.; Endlich-Frazier, Ariel C.; Borek, Dominika M.; Otwinowski, Zbyszek; Liu, Gai; Huh, Juyoung; Basler, Christopher F.; Amarasinghe, Gaya K. [Sinai; (WU-MED); (UTSMC)

    2013-07-22

    Filoviruses, marburgvirus (MARV) and ebolavirus (EBOV), are causative agents of highly lethal hemorrhagic fever in humans. MARV and EBOV share a common genome organization but show important differences in replication complex formation, cell entry, host tropism, transcriptional regulation, and immune evasion. Multifunctional filoviral viral protein (VP) 35 proteins inhibit innate immune responses. Recent studies suggest double-stranded (ds)RNA sequestration is a potential mechanism that allows EBOV VP35 to antagonize retinoic-acid inducible gene-I (RIG-I) like receptors (RLRs) that are activated by viral pathogen–associated molecular patterns (PAMPs), such as double-strandedness and dsRNA blunt ends. Here, we show that MARV VP35 can inhibit IFN production at multiple steps in the signaling pathways downstream of RLRs. The crystal structure of MARV VP35 IID in complex with 18-bp dsRNA reveals that despite the similar protein fold as EBOV VP35 IID, MARV VP35 IID interacts with the dsRNA backbone and not with blunt ends. Functional studies show that MARV VP35 can inhibit dsRNA-dependent RLR activation and interferon (IFN) regulatory factor 3 (IRF3) phosphorylation by IFN kinases TRAF family member-associated NFkb activator (TANK) binding kinase-1 (TBK-1) and IFN kB kinase e (IKKe) in cell-based studies. We also show that MARV VP35 can only inhibit RIG-I and melanoma differentiation associated gene 5 (MDA5) activation by double strandedness of RNA PAMPs (coating backbone) but is unable to inhibit activation of RLRs by dsRNA blunt ends (end capping). In contrast, EBOV VP35 can inhibit activation by both PAMPs. Insights on differential PAMP recognition and inhibition of IFN induction by a similar filoviral VP35 fold, as shown here, reveal the structural and functional plasticity of a highly conserved virulence factor.

  10. Poética de la autotraducción: María Victoria Atencia

    Directory of Open Access Journals (Sweden)

    López Martínez, María Isabel

    2015-12-01

    Full Text Available Self-translation is an ancient but poorly researched practice. This article analyses an exceptional case: the reflection on self-translation as exposed in poetry. A case in point is the poem «Voz traducida», from the poetry collection De la llama en que arde (1988. Indeed, the poem selected for examination was written by M.ª Victoria Atencia (Málaga, 1931, an expert both in writing poetry and in translating literature. Her book of poems also contains an original text, «Rosas», in Galician, and its corresponding Spanish translation. Both translation and reflection are complementary in her compositions. These poetic creations attest to the fact that artfulness works as a depiction of the next creation. Furthermore, this study will deeply explore the poet’s most important literary thoughts.La autotraducción es una práctica antigua, pero poco estudiada. El presente artículo analiza un caso excepcional: la reflexión sobre la autotraducción expuesta en la lírica. Para ello, se analiza el poema de M.ª Victoria Atencia «Voz traducida», perteneciente al libro titulado De la llama en que arde (1988. Es un ejemplo de que la tarea de traducir funciona como un motivo que origina una nueva creación. Además, permite que el lector conozca facetas importantes del pensamiento literario de la escritora. M.ª Victoria Atencia, además de poeta, es una experta traductora. El libro contiene también dos versiones del poema «Rosas», en gallego y en español, pruebas de la dimensión práctica de los planteamientos teóricos de la autora y de su coherencia estética. Ambas facetas, la traducción y la reflexión, son complementarias en la obra de la autora.

  11. Characteristics of potential gasifier fuels in selected regions of the Lake Victoria Basin

    Directory of Open Access Journals (Sweden)

    Geoffrey O. Mosiori

    2015-05-01

    Full Text Available All countries in the Lake Victoria Basin depend mostly on hydroelectric power for the provision of energy. Gasification technology has a high potential for reducing biomass energy consumption whilst increasing access to modern energy services. The key aspect for the failure of gasification operations in the Lake Victoria Basin is inadequate adaptation of gasification equipment to fuel characteristics, lack of fuel specification and inappropriate material choice. We therefore investigated the thermo-chemical characterisation of six biomass fuels, namely Pinus caribaea, Calitris robusta, Cupressus lusitanica, Eucalyptus grandis, Pinus patula and sugarcane bagasse from selected regions of the Lake Victoria Basin. Ultimate analysis was done using a Flash 2000 elemental analyser. Moisture content, ash content and volatile matter were determined in oven and muffle furnaces while heating values were determined using a Gallenkamp calorimeter. The mean percentage levels obtained indicate that all six biomass fuels had a mean range for nitrogen of 0.07±0.2–0.25±0.07%, for carbon of 40.45±0.61–48.88±0.29%, for hydrogen of 4.32±0.13–5.59±0.18% and for oxygen of 43.41±1.58–51.1±0.64%. Moisture content ranged between 25.74±1.54% and 56.69±0.52%, ash content between 0.38±0.02% and 2.94±0.14%, volatile matter between 74.68±0.49% and 82.71±0.19% and fixed carbon between 14.35±0.33% and 24.74±0.27%. Heating values ranged between 16.95±0.10 MJ/kg and 19.48±0.42 MJ/kg. The results suggest that all six biomass fuels are potential biomass gasification materials.

  12. Extent and drainage status of organic soils in the Lake Victoria catchment

    Science.gov (United States)

    Barthelmes, Reni; Barthelmes, Alexandra; Joosten, Hans

    2016-04-01

    When considering peatlands and organic soils in the tropics, the huge areas in SE Asia prevail in public and scientific perception, whereas Africa has largely been out of focus. However, East Africa contains large areas of organic soils as well. They basically occur in the high altitudes of the uplifted flanks of the East African Rift System, isolated volcanoes and the Ethiopian highlands, in the Zambezian floodplains (e.g. Zambia), and in coastal environments (e.g. Mozambique and Madagascar). We used a mapping approach that integrates old field data and maps, specialized landscape and peatland-related knowledge, and modern RS and GIS techniques to elaborate a comprehensive and rather reliable overview of organic soils (incl. peatlands) in the Lake Victoria catchment. Maps at a scale of 1:25,000 have been prepared for Burundi, Kenya, Rwanda, Tanzania and Uganda. The land use intensity has been estimated for all organic soil areas based on satellite and aerial imagery. Feeding the Nile River, sustaining a fast growing and widely poor population and already facing climatic changes, organic soils of the Lake Victoria neighbouring countries are partially under heavy threat. We mapped 10,645 km2 of organic soils for the entire area of which 8,860 km2 (83.2%) seem to be in near natural condition. We assume slightly drainage and low degradation for 564 km2 (5.3%) and intensive drainage and heavy degradation for 1,222 km2 (11.5%). Degradation hotspot is Burundi with 522 km2 (79.5%) of heavily drained and degrading organic soils. This area assessment has been quite conservative to not overestimate the extent of organic soils. A reserve of 5-7,000 km2 of wetlands in the Lake Victoria catchment may include peatlands too, which needs to be confirmed in field surveys. Considering the key role of peatlands and organic soils for water provision and regulation and their rapid degradation due to drainage and inappropriate use, this inventory might be a step towards organic soil

  13. Temperature and hydrologic variability of Lake Victoria, East Africa since the Late Pleistocene

    Science.gov (United States)

    Berke, M. A.; Johnson, T. C.; Werne, J. P.; Schouten, S.; Sinninghe Damste, J. S.

    2010-12-01

    Recent organic geochemical advances have facilitated the comparison between continental temperature change and hydrologic variability. TEX86, a proxy based on the lipids of aquatic Crenarchaeota that show a positive correlation with growth temperature, was used to reconstruct surface water temperatures from Lake Victoria, East Africa during the latest Pleistocene-Holocene. Hydrologic conditions were interpreted using paleoecological implications of shifting pollen and diatom assemblages found in the lake (Kendall, 1969; Stager et al., 2003) and will be compared with future compound specific δ13C data from terrestrial biomarkers in order to determine the patterns of rainfall and aridity in this region. Initial comparisons of climatic changes seen in temperature and hydrologic records appear to show consistency between warm/wet intervals and cool/dry intervals that is often assumed, but more rarely shown, in tropical Africa. Lake Victoria temperatures show a steady warming beginning 16 cal ka, with a pause around the Younger Dryas, dominated by arid conditions and strong savannah grassland development during this interval. There is continued warming to a sustained thermal maximum for this portion of the record at ~10.5-8.5 ka, which generally coincides with the beginning of the Holocene Hypsithermal, an interval of elevated temperatures and precipitation throughout much of tropical Africa. This thermal maximum occurs during the most humid interval of this record (~9.5-8.3 ka), shown by an increase of humid forest pollen and high diatom abundance (due to increased water column mixing and nutrient runoff). Temperatures abruptly cool ~1.5°C in <800 years while precipitation becomes somewhat more seasonally restricted, coinciding with an abrupt drop in inferred P:E ratio and reduction in wind-driven mixing. The record then shows a general cooling, reaching a Holocene thermal minimum of ~18.4°C at ~4.5 ka, contrary to other East African continental and marine

  14. The Meaning of ‘General Paralysis of the Insane’ in Victoria, Australia; 1886 to 1906

    Directory of Open Access Journals (Sweden)

    Roberts, Phillip

    2014-06-01

    Full Text Available This paper presents a conclusion to the meaning of the historical diagnosis “general paralysis of the insane” in nineteenth century Victorian Registrar General”s reports. Most studies suggest that in the past the diagnosis refers to neuro-syphilis, and while after 1906 this is not disputed, this paper will show that the diagnosis had a much broader meaning incorporating many forms of degenerative brain disease during the study period (Victoria 1886 to 1906. It is acknowledged, however, that the use of this diagnosis may have varied dramatically in the past based on a doctor’s education and/or background. This conclusion has been arrived at by analysing both government and general hospital records on the Australian, Victorian population. This paper also presents methods for determining the meaning of obsolete medical diagnoses where the definition is poorly understood.En este trabajo presenta una conclusión sobre el significado de la “parálisis general de los locos” como diagnóstico en los informes del Victorian Registrar General durante el siglo XIX. La mayoría de los estudios sugieren que en el pasado el diagnóstico se refiere a la neuro-sífilis, y aunque después de 1906 no se discute, este trabajo mostrará que el diagnóstico tiene un significado mucho más amplio e incorpora muchas formas de enfermedad degenerativa del cerebro durante el período de estudio (Victoria 1886 a 1906. Se reconoce, sin embargo, que el uso de este diagnóstico puede haber variado drásticamente en el pasado dependiendo de la formación y del ambiente médico. Se ha llegado a esta conclusión mediante el análisis de los registros hospitalarios de la población de Victoria, Australia. Este documento también presenta métodos para determinar el significado de los diagnósticos médicos obsoletos cuya definición es confusa.

  15. Residual susceptibility to measles among young adults in Victoria, Australia following a national targeted measles-mumps-rubella vaccination campaign

    Directory of Open Access Journals (Sweden)

    Leydon Jennie A

    2007-06-01

    Full Text Available Abstract Background Past measles immunisation policies in Australia have resulted in a cohort of young adults who have been inadequately vaccinated, but who also have low levels of naturally acquired immunity because immunisation programs have decreased the circulation of wild virus. A measles-mumps-rubella (MMR immunisation campaign aimed at addressing this susceptibility to measles among young adults was conducted in Australia in 2001–2. By estimating age-specific immunity, we aimed to evaluate the success of this campaign in the state of Victoria. Methods We conducted serosurveys after the young adult MMR program at state and national levels to estimate immunity among young adults born between 1968–82. We compared results of the Victorian (state surveys with the Victorian component of the national surveys and compared both surveys with surveys conducted before the campaign. We also reviewed all laboratory confirmed measles cases in Victoria between 2000–4. Results The Victorian state serosurveys indicated no significant change in immunity of the cohort following the young adult MMR campaign (83.9% immune pre and 85.5% immune post campaign while the Victorian component of the national serosurvey indicated a significant decline in immunity (91.0% to 84.2%; p = 0.006. Both surveys indicated about 15% susceptibility to measles among young Victorian adults after the campaign. Measles outbreaks in Victoria between 2000–4 confirmed the susceptibility of young adults. Outbreaks involved a median of 2.5 cases with a median age of 24.5 years. Conclusion In Victoria, the young adult MMR program appears to have had no effect on residual susceptibility to measles among the 1968–82 birth cohort. Young adults in Victoria, as in other countries where past immunisation policies have left a residual susceptible cohort, represent a potential problem for the maintenance of measles elimination.

  16. LAKE VICTORIA AND THE COMMON PROPERTY DEBATE: IS THE TRAGEDY OF THE COMMONS A THREAT TO ITS FUTURE?

    Directory of Open Access Journals (Sweden)

    Erick Ochieng OGELLO

    2013-12-01

    Full Text Available Lake Victoria is the largest among the African Great Lakes in East African region that are believed to have both dynamic and fragile aquatic ecosystems. Within two decades, the lake has experienced extensive resource exploitation leading to constrained productivity and drastic decline of native biodiversity. Intensive non-selective fishing, catchment vegetation degradation, industrial and agricultural pollution, the introduction of exotic species and uneven patchwork of governmental laws are some of the reasons for the current ecological woes facing Lake Victoria. This paper intends to stimulate recognition of Lake Victoria and its catchment as a lived Com­mons, to be shared, protected, managed and enjoyed by all who live around it. The paper compares the original biodiversity status of the lake with the current status and discusses the role of unlimited access as a function of the loss of the Lake’s biological wealth. The Lake’s water resource base, fishery, wetlands and other aquatic resources have been exhaustively discussed. In this review, we uphold the Hardin’s school of thought that freedom of the commoners causes resource overuse leading to poverty. Therefore, limiting freedom could be essential. However, there is need for provision of alternative means of survival since people with no choices would continue over-exploiting ecosystems even under limited access. The Lake Victoria basin commons should be protected by strict legal and clear political frame­work based on public trust doctrine, reinforced in law that the Lake is vital for the survival of people, plants and animals living on or near it and therefore must be protected for the common good. The political jurisdictions should consider governing the Lake basin as one integrated watershed. It is our fervent hope that bordering communities will secure grass root movements to protect and nurture Lake Victoria and its environs for the benefit of the present and future

  17. Seismicity and arrival-time residuals from the Victoria Earthquake of June 9, 1980

    Energy Technology Data Exchange (ETDEWEB)

    Wong, V.; Frez, J.

    1981-01-01

    Hypocenter distribution in space and time of the aftershock activity from the Victoria Earthquake of June 9, 1980 was studied. It was concluded that the main event excited aftershocks in several pre-existing nests at the northwest end of the Cerro Prieto Fault, but no significant activity occurred at the immediate neighborhood of the main event. The depth of the aftershocks increases with the distance from the northwest end of the fault and this feature might be related with the higher temperatures and the spreading center located between the ends of the Imperial and Cerro Prieto Faults. The significance of the arrival-times residuals for local and regional stations is discussed both for P and S-waves and the importance of obtaining station corrections is emphasized. The non-uniqueness in determining a structure which minimizes the residuals is illustrated. Two different structures which satisfy the local data are presented.

  18. Journalist to the interview: professionals routines. The case of Ciudad Victoria, Tamaulipas, México

    Directory of Open Access Journals (Sweden)

    Carlos David SANTAMARÍA OCHOA

    2014-10-01

    Full Text Available The newspaper interview is sort of use in printed newspapers in Ciudad Victoria Tamaulipas, Mexico. Journalists argue lack of time-space and is to develop this type of work. An analysis of the publications of the largest newspapers in this city dad throws the result that no literary interviews are published, the em-ployee's resource for structuring news and sporadically of reports. This paper develops conducting depth interviews with journalists pe-active, which reaffirm the limited use given the corresponding gender, as well as an analysis of the works published in newspapers printed cases in the capital of Tamaulipas, only on local information section. Lack of time for preparation, few spaces and I shift to electronic means are the most common causes.

  19. Compliance with regulations by "swim-with-dolphins" operations in Port Phillip Bay, Victoria, Australia.

    Science.gov (United States)

    Scarpaci, Carol; Dayanthi, Nugegoda; Corkeron, Peter J

    2003-03-01

    Managing the activities of commercial wildlife viewing tends to involve either restricting the number of industry participants and/or regulating the activities or industry participants. We report on operator compliance with regulations regarding humans swimming with free-ranging bottlenose dolphins ( Tursiops sp.) in Port Phillip Bay, Victoria, Australia. A total of 128 commercial dolphin-swim trips was studied between September 1998 and April 2000. Four permit conditions were investigated: approach type, swim time, time in proximity of dolphins, and presence of "fetal fold" calves. Results demonstrate noncompliance by operators to all of the four permit conditions studied. Compliance with temporal conditions was poorer than with other conditions. When conducting studies on the extent to which tourism affects cetaceans, investigators should consider whether tourist operations comply with existing regulations or guidelines.

  20. Suffering by comparison: Twitter users' reactions to the Victoria's Secret Fashion Show.

    Science.gov (United States)

    Chrisler, Joan C; Fung, Kaitlin T; Lopez, Alexandra M; Gorman, Jennifer A

    2013-09-01

    Social comparison theory suggests that evaluating the self in comparison with others (e.g., peers, celebrities, models) can influence body image. Experimental studies that have tested effects of viewing idealized images in the media often show that women feel worse about themselves after seeing images that illustrate the beauty ideal. Twitter presents a naturally occurring opportunity to study viewers' reactions. An analysis was conducted of 977 tweets sent immediately before and during the 2011 Victoria's Secret Fashion Show that reference the show. Although the majority were idiosyncratic remarks, many tweets contain evidence of upward social comparisons to the fashion models. There were tweets about body image, eating disorders, weight, desires for food or alcohol, and thoughts about self-harm. The results support social comparison theory, and suggest that vulnerable viewers could experience negative affect, or even engage in harmful behaviors, during or after viewing the show or others like it. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Environmental factors associated with the foliage cover of invasive fairy grass (Lachnagrostis filiformis) in Victoria, Australia.

    Science.gov (United States)

    Gosney, Kate; Florentine, Singarayer K

    2018-01-01

    Fairy grass (Lachnagrostis filiformis) is an Australian native grass that has recently become a major concern for rural communities. Its dried inflorescences are blown by the wind and build up against fences and buildings, becoming a severe fire hazard. Understanding the ecology of fairy grass and its impacts on rural communities is relevant to its management. Four dry lake beds in Western Victoria were selected to determine if environmental factors, such as lake, location, direction, altitude and road type and the covariates of pH, soil salinity, soil moisture and distance to nearest road, are related to the presence of fairy grass. The 'lake' factor was the only environmental parameter that was significantly associated with the presence of this weed.

  2. Fine resolution AMS {sup 14}C chronology for Lunette-Lake sediment sequences, Lake Bolac, Victoria

    Energy Technology Data Exchange (ETDEWEB)

    Cook, E. [Monash University, Clayton, VIC (Australia). Centre for Palynology and Palaeoecology, Department of Geography and Environmental Science

    1998-12-31

    This study aims to provide a fine-resolution chronology for lake sediment records from Lakes Bolac and Turangmoroke, located within the drier part of the Western Plains, Victoria. These lakes are expected to be sensitive to subtle climate and vegetation variability and have long been recognised as archaeologically rich, bearing stone tools, hearth and other cultural materials dated to the late Pleistocene (Horton, 1984; former Victorian Aboriginal Survey, unpublished data). Fine-resolution chronological control has rarely been attempted in this sedimentary and (semi-arid) climatic context owing to the paucity of material available for conventional {sup 14}C dating. However, pollen and microscopic charcoal in the lake sediments at Bolac and Turangmoroke are suitable for AMS age determination with the most important sedimentary section well within the range of {sup 14}C making them ideal records for such a study. Recent dating results, which have substantially increased chronostratigraphic interpretation of concurrent palaeoecological and sedimentological work in progress, are presented

  3. PREDICTION OF THE LIKELIHOOD OF HOUSEHOLDS FOOD SECURITY IN THE LAKE VICTORIA REGION OF KENYA

    Directory of Open Access Journals (Sweden)

    Peter Nyamuhanga Mwita

    2011-06-01

    Full Text Available This paper considers the modeling and prediction of  households food security status using a sample of households in the  Lake Victoria region of Kenya. A priori expected food security  factors and their measurements are given. A binary logistic regression model  derived was fitted to thirteen priori expected factors. Analysis of the marginal effects revealed that effecting the use of the seven significant determinants: farmland size, per capita aggregate production, household size, gender of household head, use of fertilizer, use of pesticide/herbicide and education of household head,  increase the likelihood of a household being food secure. Finally, interpretations  of   predicted conditional probabilities, following improvement of significant determinants,  are given.

  4. Reality check of laboratory service effectiveness during pandemic (H1N1) 2009, Victoria, Australia.

    Science.gov (United States)

    Catton, Michael; Druce, Julian; Papadakis, Goergina; Tran, Thomas; Birch, Christopher

    2011-06-01

    In Australia, the outbreak of pandemic (H1N1) 2009 began in Melbourne, Victoria; in the first 17 days, the Victorian Infectious Diseases Reference Laboratory detected 977 cases. Although the laboratory had a pandemic plan in place, a retrospective evaluation found 3 major variations from plan assumptions: 1) higher peak demand not limited by a case definition, 2) prolonged peak demand because containment attempts continued despite widespread influenza, and 3) unexpected influence of negative test results on public health actions. Although implementation of the plan was generally successful, the greatest challenges were limited availability of skilled staff and test reagents. Despite peak demand of 1,401 tests per day, results were provided within the usual 24 hours of specimen receipt; however, turnaround time seemed slower because of slow transport times (>3 days for 45% of specimens). Hence, effective laboratory capability might be enhanced by speeding transport of specimens and improving transmission of clinical data.

  5. La legobiografía de Victoria Ocampo: evocaciones de una lectora (des)autorizada

    OpenAIRE

    Vélez, Irma

    2012-01-01

    Pero no conseguiré hacer nada en el campo de la novela. Tengo que escribir à batons rompus, cuando se me antoje. Jamás podré crear un personaje. Lo llevaría a la rastra, y eso no sirve. Y todos mis personajes serían “yo” disfrazada. Perfectamente insoportable. ¿Cómo demonios puede uno deshacerse de su “yo” ?(Fragmento de Carta a Delfina Bunge, Autobiografía II, p. 85)En 1910, Victoria Ocampo cumple 20 años, apenas dos años después que en Santiago se auspiciara la sede del Primer Congreso Cien...

  6. La legobiografía de Victoria Ocampo: evocaciones de una lectora (desautorizada

    Directory of Open Access Journals (Sweden)

    Irma Vélez

    2006-07-01

    Full Text Available Pero no conseguiré hacer nada en el campo de la novela. Tengo que escribir à batons rompus, cuando se me antoje. Jamás podré crear un personaje. Lo llevaría a la rastra, y eso no sirve. Y todos mis personajes serían “yo” disfrazada. Perfectamente insoportable. ¿Cómo demonios puede uno deshacerse de su “yo” ?(Fragmento de Carta a Delfina Bunge, Autobiografía II, p. 85En 1910, Victoria Ocampo cumple 20 años, apenas dos años después que en Santiago se auspiciara la sede del Primer Congreso Cien...

  7. Coupled human and natural system dynamics as key to the sustainability of Lake Victoria's ecosystem services

    Directory of Open Access Journals (Sweden)

    Andrea S. Downing

    2014-12-01

    Full Text Available East Africa's Lake Victoria provides resources and services to millions of people on the lake's shores and abroad. In particular, the lake's fisheries are an important source of protein, employment, and international economic connections for the whole region. Nonetheless, stock dynamics are poorly understood and currently unpredictable. Furthermore, fishery dynamics are intricately connected to other supporting services of the lake as well as to lakeshore societies and economies. Much research has been carried out piecemeal on different aspects of Lake Victoria's system; e.g., societies, biodiversity, fisheries, and eutrophication. However, to disentangle drivers and dynamics of change in this complex system, we need to put these pieces together and analyze the system as a whole. We did so by first building a qualitative model of the lake's social-ecological system. We then investigated the model system through a qualitative loop analysis, and finally examined effects of changes on the system state and structure. The model and its contextual analysis allowed us to investigate system-wide chain reactions resulting from disturbances. Importantly, we built a tool that can be used to analyze the cascading effects of management options and establish the requirements for their success. We found that high connectedness of the system at the exploitation level, through fisheries having multiple target stocks, can increase the stocks' vulnerability to exploitation but reduce society's vulnerability to variability in individual stocks. We describe how there are multiple pathways to any change in the system, which makes it difficult to identify the root cause of changes but also broadens the management toolkit. Also, we illustrate how nutrient enrichment is not a self-regulating process, and that explicit management is necessary to halt or reverse eutrophication. This model is simple and usable to assess system-wide effects of management policies, and can

  8. Maternal and Child Health Nurses work with refugee families: Perspectives from regional Victoria, Australia.

    Science.gov (United States)

    Willey, Suzanne M; Cant, Robyn P; Williams, Allison; McIntyre, Meredith

    2018-01-21

    This study aimed to explore service provision for Victorian regional refugee families from the perspective of Maternal and Child Health nurses. Increasingly, more families from a refugee background are resettling in regional Victoria. The refugee journey has significant effect on families. Refugee families with infants and young children can be provided with support by Maternal and Child Health services; however, many families experience barriers to ongoing engagement with this service. This descriptive study used focus group and questionnaire. A purposive sample of 26 Maternal and Child Health Nurses was drawn from six municipalities throughout regional Victoria, where higher numbers of people from a refugee background resettle. Six focus groups were held in 2014. Audio-recorded narratives were transcribed, prior to inductive thematic analysis. Participating nurses were experienced nurses, averaging 12 years in the service. Four major themes emerged: 'How to identify women from a refugee background'; 'The Maternal and Child Health nurse role when working with families from a refugee background'; 'Interpreting issues', and 'Access to other referral agencies'. Nurses worked to develop a relationship with families, attending to a complex mix of issues which were complicated by language barriers. Nurses found their role in supporting refugee families required additional time and more home visits. To provide best practice, Maternal and Child Health nurses need (i) ongoing professional development; (ii) time, flexibility, and creativity to build relationships with refugee families and (iii) better access to services that enhance communication, such as interpreting services and translated resources. Nurses require ongoing professional development to help them address the multifaceted needs of families of refugee background. With limited resources available in regional areas, accessing further education can be challenging. Distance education models and organisational

  9. Intended and unintended consequences of abortion law reform: perspectives of abortion experts in Victoria, Australia.

    Science.gov (United States)

    Keogh, L A; Newton, D; Bayly, C; McNamee, K; Hardiman, A; Webster, A; Bismark, M

    2017-01-01

    In Victoria, Australia, abortion was decriminalised in October 2008, bringing the law in line with clinical practice and community attitudes. We describe how experts in abortion service provision perceived the intent and subsequent impact of the 2008 Victorian abortion law reform. Experts in abortion provision in Victoria were recruited for a qualitative semi-structured interview about the 2008 law reform and its perceived impact, until saturation was reached. Nineteen experts from a range of health care settings and geographic locations were interviewed in 2014/2015. Thematic analysis was conducted to summarise participants' views. Abortion law reform, while a positive event, was perceived to have changed little about the provision of abortion. The views of participants can be categorised into: (1) goals that law reform was intended to address and that have been achieved; (2) intent or hopes of law reform that have not been achieved; (3) unintended consequences; (4) coincidences; and (5) unfinished business. All agreed that law reform had repositioned abortion as a health rather than legal issue, had shifted the power in decision making from doctors to women, and had increased clarity and safety for doctors. However, all described outstanding concerns; limited public provision of surgical abortion; reduced access to abortion after 20 weeks; ongoing stigma; lack of a state-wide strategy for equitable abortion provision; and an unsustainable workforce. Law reform, while positive, has failed to address a number of significant issues in abortion service provision, and may have even resulted in a 'lull' in action. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  10. Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS).

    Science.gov (United States)

    Nyamweya, Chrispine; Desjardins, Christopher; Sigurdsson, Sven; Tomasson, Tumi; Taabu-Munyaho, Anthony; Sitoki, Lewis; Stefansson, Gunnar

    2016-01-01

    Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS) to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May) and mixing (June-August). Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza) and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents) that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.

  11. The Green Dialysis Survey: Establishing a Baseline for Environmental Sustainability across Dialysis Facilities in Victoria, Australia.

    Science.gov (United States)

    Barraclough, Katherine A; Gleeson, Alice; Holt, Stephen G; Agar, John Wm

    2017-11-02

    The Green Dialysis Survey aimed to 1) establish a baseline for environmental sustainability (ES) across Victorian dialysis facilities, and 2) guide future initiatives to reduce the environmental impact of dialysis delivery. Nurse unit managers of all Victorian public dialysis facilities received an online link to the survey, which asked 107 questions relevant to the ES of dialysis services. Responses were received from 71/83 dialysis facilities in Victoria (86%), representing 628/660 dialysis chairs (95%). Low energy lighting was present in 13 facilities (18%), 18 (25%) recycled reverse osmosis water and 7 (10%) reported use of renewable energy. Fifty-six facilities (79%) performed comingled recycling but only 27 (38%) recycled polyvinyl chloride plastic. A minority educated staff in appropriate waste management (n=30;42%) or formally audited waste generation and segregation (n=19;27%). Forty-four (62%) provided secure bicycle parking but only 33 (46%) provided shower and changing facilities. There was limited use of tele- or video-conferencing to replace staff meetings (n=19;27%) or patient clinic visits (n=13;18%). A minority considered ES in procurement decisions (n=28;39%) and there was minimal preparedness to cope with climate change. Only 39 services (49%) confirmed an ES policy and few had ever formed a green group (n=14; 20%) or were currently undertaking a green project (n=8;11%). Only 15 facilities (21%) made formal efforts to raise awareness of ES. This survey provides a baseline for practices that potentially impact the environmental sustainability of dialysis units in Victoria, Australia. It also identifies achievable targets for attention. This article is protected by copyright. All rights reserved.

  12. Benthic macroinvertebrate community structure in Napoleon Gulf, Lake Victoria: effects of cage aquaculture in eutrophic lake.

    Science.gov (United States)

    Egessa, Robert; Pabire, Gandhi Willy; Ocaya, Henry

    2018-02-02

    An investigation was conducted on the macro-benthic fauna of the Napoleon Gulf in the northern part of Lake Victoria from March 2011 to December 2016 at the cage fish farm. The aim was to examine the likely impact of cage aquaculture on macro-benthic invertebrates. Cage aquaculture is now a common practice on Lake Victoria yet little is known about its long-term effect on macro-benthic faunal assemblages. Temporal variation indicated a general decline in annual faunal density at the farm area with corresponding stability at upstream (control) and downstream sites. Arthropods remained numerically dominant at the control and downstream sites. The percentage abundance of EPT (Ephemeroptera, Plecoptera, and Trichoptera) and Malacostraca was highest at the upstream and lowest at the farm area. The farm area which initially was dominated by molluscs became dominated by arthropods after 3 years. The decrease in density of molluscs at the farm area was attributed to the general decrease in density of two species: Bellamya unicolor (Gastropoda) and Corbicula africana (Bivalvia). These two species were initially abundant but showed decline within the farm area with corresponding stability at the upstream and downstream areas. Oligochaete annelids were more abundant within the farm area than at the upstream and downstream sites. These findings suggested that molluscs offered better prediction of the impact of cages on the environment than arthropods. Besides that, in a community dominated by pollution-tolerant organisms, the impact of aquaculture may not be immediate especially when organic loading from aquaculture is moderate.

  13. Sex workers can be screened too often: a cost-effectiveness analysis in Victoria, Australia.

    Science.gov (United States)

    Wilson, David P; Heymer, Kelly-Jean; Anderson, Jonathan; O'Connor, Jody; Harcourt, Christine; Donovan, Basil

    2010-04-01

    Commercial sex is licensed in Victoria, Australia such that sex workers are required to have regular tests for sexually transmitted infections (STIs). However, the incidence and prevalence of STIs in sex workers are very low, especially since there is almost universal condom use at work. We aimed to conduct a cost-effectiveness analysis of the financial cost of the testing policy versus the health benefits of averting the transmission of HIV, syphilis, chlamydia and gonorrhoea to clients. We developed a simple mathematical transmission model, informed by conservative parameter estimates from all available data, linked to a cost-effectiveness analysis. We estimated that under current testing rates, it costs over $A90,000 in screening costs for every chlamydia infection averted (and $A600,000 in screening costs for each quality-adjusted life year (QALY) saved) and over $A4,000,000 for every HIV infection averted ($A10,000,000 in screening costs for each QALY saved). At an assumed willingness to pay of $A50,000 per QALY gained, HIV testing should not be conducted less than approximately every 40 weeks and chlamydia testing approximately once per year; in comparison, current requirements are testing every 12 weeks for HIV and every 4 weeks for chlamydia. Mandatory screening of female sex workers at current testing frequencies is not cost-effective for the prevention of disease in their male clients. The current testing rate required of sex workers in Victoria is excessive. Screening intervals for sex workers should be based on local STI epidemiology and not locked by legislation.

  14. The job satisfaction of female sex workers working in licensed brothels in Victoria, Australia.

    Science.gov (United States)

    Bilardi, Jade E; Miller, Amanda; Hocking, Jane S; Keogh, Louise; Cummings, Rosey; Chen, Marcus Y; Bradshaw, Catriona S; Fairley, Christopher K

    2011-01-01

    Previous studies have examined sex workers' attitudes to work but not their levels of job satisfaction compared with other occupations. The job satisfaction levels and standards of living of sex workers in licensed brothels in Victoria were compared with Australian women. Responses to a questionnaire that included questions about sex work and their "most likely alternative job." Survey data was compared with identical questions from the Households, Income and Labour Dynamics in Australia Survey. A structured survey was undertaken with sex workers in Victoria attending a a sexual health service. Of the 112 sex workers who agreed to participate in the study, 85 (76%) completed the survey. The median years women had been working as sex workers was three (range 0.1-18). The main reasons women started sex work was because "they needed the money" (69%), were attracted to the flexible hours (44%) or had a particular goal in mind (43%). The two biggest concerns women had about sex work were their safety (65%) and the risk of sexually transmitted infections (65%). When compared with the median job satisfaction scores of Australian women working in sex workers' "most likely alternative jobs," 50% of sex workers reported a higher median satisfaction score for sex work in relation to hours worked, 47% in relation to flexibility, 43% in relation to total pay, 26% in relation to job security, 19% in relation to the work itself, and 25% in relation to overall job satisfaction. Women reported that they primarily do sex work for financial gain although a significant minority prefer it to other work they would be likely to do. These results should be interpreted in the context that the presence of personality disorders that are common among sex workers were not measured in this study. © 2010 International Society for Sexual Medicine.

  15. El periodista ante la entrevista: rutinas profesionales. El caso de Ciudad Victoria, Tamaulipas, México

    Directory of Open Access Journals (Sweden)

    Santamaría Ochoa, Carlos David

    2013-06-01

    Full Text Available En español: La entrevista periodística es un género en desuso en los diarios impresos de Ciudad Victoria Tamaulipas, México. Los periodistas argumentan falta de tiempo y espacio para desarrollar este tipo de trabajos.Un análisis de las publicaciones de los diarios de mayor circulación en esta ciudad arroja como resultado el que no se publican entrevistas literarias; el recurso es empleado para la estructuración de noticias y, esporádicamente, de reportajes.El presente trabajo se desarrolla realizando entrevistas a profundidad con periodistas en activo, los que reafirman el poco uso que se da al género correspondiente, así como un análisis de los trabajos publicados en los diarios impresos de la capital de Tamaulipas, únicamente en la sección de información local.Falta de tiempo para la preparación, pocos espacios y el cambio hacia los me-dios electrónicos son las causas más recurrentes. In english: The newspaper interview is sort of use in printed newspapers in Ciudad Victoria Tamaulipas, Mexico. Journalists argue lack of time-space and is to develop this type of work.An analysis of the publications of the largest newspapers in this city dad throws the result that no literary interviews are published, the em-ployee's resource for structuring news and sporadically of reports.This paper develops conducting depth interviews with journalists pe-active, which reaffirm the limited use given the corresponding gender, as well as an analysis of the works published in newspapers printed cases in the capital of Tamaulipas, only on local information section. Lack of time for preparation, few spaces and I shift to electronic means are the most common causes.

  16. Perceptions about interventions to control schistosomiasis among the Lake Victoria island communities of Koome, Uganda.

    Directory of Open Access Journals (Sweden)

    Richard E Sanya

    2017-10-01

    Full Text Available Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities.In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach.Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials.Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.

  17. Tsetse fly (G. f. fuscipes distribution in the Lake Victoria basin of Uganda.

    Directory of Open Access Journals (Sweden)

    Mugenyi Albert

    2015-04-01

    Full Text Available Tsetse flies transmit trypanosomes, the causative agent of human and animal African trypanosomiasis. The tsetse vector is extensively distributed across sub-Saharan Africa. Trypanosomiasis maintenance is determined by the interrelationship of three elements: vertebrate host, parasite and the vector responsible for transmission. Mapping the distribution and abundance of tsetse flies assists in predicting trypanosomiasis distributions and developing rational strategies for disease and vector control. Given scarce resources to carry out regular full scale field tsetse surveys to up-date existing tsetse maps, there is a need to devise inexpensive means for regularly obtaining dependable area-wide tsetse data to guide control activities. In this study we used spatial epidemiological modelling techniques (logistic regression involving 5000 field-based tsetse-data (G. f. fuscipes points over an area of 40,000 km2, with satellite-derived environmental surrogates composed of precipitation, temperature, land cover, normalised difference vegetation index (NDVI and elevation at the sub-national level. We used these extensive tsetse data to analyse the relationships between presence of tsetse (G. f. fuscipes and environmental variables. The strength of the results was enhanced through the application of a spatial autologistic regression model (SARM. Using the SARM we showed that the probability of tsetse presence increased with proportion of forest cover and riverine vegetation. The key outputs are a predictive tsetse distribution map for the Lake Victoria basin of Uganda and an improved understanding of the association between tsetse presence and environmental variables. The predicted spatial distribution of tsetse in the Lake Victoria basin of Uganda will provide significant new information to assist with the spatial targeting of tsetse and trypanosomiasis control.

  18. Tsetse fly (G. f. fuscipes) distribution in the Lake Victoria basin of Uganda.

    Science.gov (United States)

    Albert, Mugenyi; Wardrop, Nicola A; Atkinson, Peter M; Torr, Steve J; Welburn, Susan C

    2015-04-01

    Tsetse flies transmit trypanosomes, the causative agent of human and animal African trypanosomiasis. The tsetse vector is extensively distributed across sub-Saharan Africa. Trypanosomiasis maintenance is determined by the interrelationship of three elements: vertebrate host, parasite and the vector responsible for transmission. Mapping the distribution and abundance of tsetse flies assists in predicting trypanosomiasis distributions and developing rational strategies for disease and vector control. Given scarce resources to carry out regular full scale field tsetse surveys to up-date existing tsetse maps, there is a need to devise inexpensive means for regularly obtaining dependable area-wide tsetse data to guide control activities. In this study we used spatial epidemiological modelling techniques (logistic regression) involving 5000 field-based tsetse-data (G. f. fuscipes) points over an area of 40,000 km2, with satellite-derived environmental surrogates composed of precipitation, temperature, land cover, normalised difference vegetation index (NDVI) and elevation at the sub-national level. We used these extensive tsetse data to analyse the relationships between presence of tsetse (G. f. fuscipes) and environmental variables. The strength of the results was enhanced through the application of a spatial autologistic regression model (SARM). Using the SARM we showed that the probability of tsetse presence increased with proportion of forest cover and riverine vegetation. The key outputs are a predictive tsetse distribution map for the Lake Victoria basin of Uganda and an improved understanding of the association between tsetse presence and environmental variables. The predicted spatial distribution of tsetse in the Lake Victoria basin of Uganda will provide significant new information to assist with the spatial targeting of tsetse and trypanosomiasis control.

  19. The effect of an area-based intervention on breastfeeding rates in Victoria, Australia.

    Science.gov (United States)

    Kelaher, Margaret; Dunt, David; Feldman, Peter; Nolan, Andrea; Raban, Bridie

    2009-04-01

    Best Start is an area-based early childhood intervention where projects are developed and implemented through a community partnership. A core tenet of the initiative is that implementing projects through a partnership generates greater value than would be expected if projects were undertaken independently by partner members. In this study we examine whether: (1) Best Start is effective in increasing the proportion of infants being fully breastfed at 3 months and 6 months. (2) The quality of community partnerships is a potential mechanism for change. Best Start was implemented in Victoria, Australia. The study examined breastfeeding rates before and after Best Start in sites with Best Start breastfeeding projects compared to the rest of state. The relationship between partnership quality scores and breastfeeding percentages was also examined. Both analyses controlled for socioeconomic and demographic differences and clustering by area. Best Start targeted some of the most socially disadvantaged communities in Victoria. In the 3 years of its operation, the rates of fully breastfeeding at 3 months (OR 1.30, 95% CI 1.14-1.47) and 6 months (OR 1.33, 95% CI 1.1-1.61) increased in Best Start sites compared to the rest of the state. Quality of partnership scores was positively associated with increased percentages of fully breastfeeding (3 months=OR 1.03, 95% CI 1.01-1.06; 6 months=OR 1.03, 95% CI 0.98-1.08). These results suggest that area-based interventions are effective in increasing percentages of fully breastfeeding. The study also supported the idea that developing quality community partnerships had a positive influence on their success.

  20. Impact of an outright ban on the availability of commercial tanning services in Victoria, Australia.

    Science.gov (United States)

    Sinclair, C; Cleaves, N; Dunstone, K; Makin, J; Zouzounis, S

    2016-08-01

    Australian states have introduced an outright ban on commercial artificial tanning sunbeds. This was based on evidence from systematic reviews affirming a strong association between tanning bed use and increased risk of melanoma. The implementation of the ban provides an opportunity to assess the effectiveness of the legislation in preventing access to artificial UV radiation. Compliance with the ban has been enforced and monitored by government departments. We additionally monitored online tanning bed advertisements before and after the ban, showing a decline over time in the number of sunbeds advertised for sale on gumtree.com.au and ebay.com.au, from a peak of 115 advertisements in May 2014 to 50 or fewer per month from February 2015. There was also an increase in advertised price, with the percentage of sunbeds offered in Victoria on gumtree.com.au at higher than $2 000 increasing from around 25% between January and June 2014 to 65% in the quarter following the introduction of the ban. Advertisements on gumtree.com.au from individuals wishing to access a sunbed in a private home in Victoria increased from only isolated instances in the months immediately prior to the ban, to between 25 and 77 advertisements per month in the quarter following the ban. In summary, the introduction of an outright ban of commercial sunbeds has achieved a dramatic reduction in the availability of harmful artificial UV radiation sources in Australia. Long-term benefits to the health of the population and a reduction in costs to the health system are expected to result. © 2016 British Association of Dermatologists.

  1. A tephra chronostratigraphic framework for the Frontier Mountain blue-ice field (northern Victoria Land, Antarctica)

    Science.gov (United States)

    Curzio, Pietro; Folco, Luigi; Ada Laurenzi, Marinella; Mellini, Marcello; Zeoli, Antonio

    2008-03-01

    Englacial tephra provide chronostratigraphic markers in the Antarctic ice sheets. Structural, mineralogical, geochemical and geochronological data on selected samples allowed the reconstruction of a chronostratigraphic framework for the Frontier Mountain blue-ice field—an important meteorite trap on the southeastern flank of Talos Dome in northern Victoria Land. The stratigraphic thickness of the blue-ice succession is ˜1150 m. The 40Ar- 39Ar age of one layer close to the stratigraphic bottom of the ice succession is 100±5 ka and constrains the maximum age of the bulk of Frontier Mountain blue ice. The 49±11 ka age of a second layer at a depth of ˜950 m in the stratigraphic succession indicates that >90% of the ice is younger than this value. These ages agree well with the terrestrial ages of meteorites found on the blue ice (up to 140±30 ka), suggesting a mechanism of exhumation of meteorites by ablation after englacial transport. Particle size (up to several tens of microns) and the alkaline compositional character of 22 layers allow correlation with source volcanoes within the Cenozoic magmatism associated with the West Antarctic Rift System. The proximal Mount Melbourne, Mount Rittman and The Pleiades (within a radius of ˜250 km) are the best candidate source volcanoes. The reconstructed chronostratigraphic framework thus lays the foundations for a detailed investigation of ˜100 ka of explosive volcanism in northern Victoria Land. Furthermore, in light of the ongoing ice core drilling project at Talos Dome, the Frontier Mountain ice succession may become important for establishing regional correlations, for sampling and dating key tephra layers, and for selecting ice successions for high-resolution studies of past atmospheric chemistry and fallout.

  2. Biological Diversity and Resilience: Lessons from the Recovery of Cichlid Species in Lake Victoria

    Directory of Open Access Journals (Sweden)

    Alex O. Awiti

    2011-03-01

    Full Text Available A fundamental feature of the Anthropocene is the inexorable erosion of the self-repairing capacity or adaptive renewal of natural systems because of natural perturbation, exploitation, or management failure. The concept of resilience offers a systematic framework for understanding the dynamics and variables that govern response dynamics of ecosystems. Resilience of haplochromine cichlids is assessed using limnological and biodiversity changes in Lake Victoria, the world's second largest freshwater lake, over the last five decades. The review explores the resurgence of the haplochromine cichlids using Holling's adaptive renewal cycle and attempts to illustrate how resilience-based management approaches might learn from an inadvertent management experiment. The introduction in the 1980s of the Nile perch (Lates niloticus, a fecund and voracious predator of the endemic phytoplankton feeding haplochromine cichlids, anthropogenic eutrophication, and deep water hypoxia have combined in a synergistic way to increase the vulnerability of the lake ecosystem to perturbations that were hitherto absorbed. However, the upsurge in commercial Nile perch fishing appears to be enabling the resurgence of the haplochromine cichlids. The resurgence of haplochromine cichlids is characterized by phenotypic plasticity, ecological and life history traits and demonstrates the critical role of response diversity in the maintenance of systems resilience. Resilience of the haplochromine cichlids resides in the requisite functional response diversity and habitat diversity that provide the resources for renewal and regeneration. This paper concludes that management of Nile perch fisheries and control of nutrient loading into Lake Victoria could halt or reverse eutrophication, hence offer the best promise for a diverse, productive, and resilient social-ecological system.

  3. Tradução para o Português de Queen Victoria in Her Letters and Journals de Christopher Hibbert

    OpenAIRE

    Monteiro, Caroline Feital

    2014-01-01

    A presente dissertação de mestrado tem como um dos objetivos produzir a tradução para o português de quatro seções da obra Queen Victoria in her letters and journals/ A Rainha Victoria em suas cartas e diários de Christopher Hibbert, publicada pela editora Sutton Publishing Limited na Inglaterra em 2000. Nas seções Queen regnant, Family life, Monarchs and ministers e ‘Frequent difficulties’, as anotações e as cartas da Rainha Victoria (1819-1901) da Inglaterra apresentam um pouco de história ...

  4. Comparing women pharmacy consumers’ experiences with weight loss treatment in Victoria and Nottingham: a cross-sectional study

    Science.gov (United States)

    2014-01-01

    Background There has been a recent increase in weight management services available in pharmacies across Australia and England. The aim of this study was to determine the following between women in Victoria and Nottingham: similarities and differences of what weight management options are preferred by women pharmacy consumers; how they feel about pharmacists providing advice in this area; and what they desire in a weight management program. Method Women pharmacy consumers were randomly approached by a researcher in community pharmacies in Victoria and Nottingham and asked to complete a questionnaire regarding their own weight management experiences. The questionnaire was self-completed or researcher-administered and was comprised of four main sections that focused on the participant’s general health, previous weight loss experiences, their ideal weight management program and their demographics. Data was entered in SPSS 19 and logistic regression was used to identify any differences in weight loss experiences between women. Results The participant rates were high: 86% (n = 395/460) in Victoria and 98% in Nottingham (n = 215/220). Overall, women in Victoria and Nottingham were similar with comparable demographics. Approximately 50% (250/507) of women were in the overweight or obese body mass index category, with over 70% (n = 436/610) of women having attempted to lose weight in the past. The majority of women (n = 334/436) felt comfortable receiving advice from pharmacists. In the logistic regression analysis women in Nottingham were found to be significantly less likely to have utilised a pharmacy weight management program in the last five years (OR: 0.23 CI: 0.08, 0.63) and were significantly less likely to want an ideal weight management program located in a pharmacy (OR: 0.49 CI: 0.30, 0.82) compared to women in Victoria. No significant associations between location and feeling comfortable with a pharmacist advising on weight loss or wanting a pharmacist in an

  5. Community genetics reveal elevated levels of sympatric gene flow among morphologically similar but not among morphologically dissimilar species of Lake Victoria cichlid fish

    NARCIS (Netherlands)

    Konijnendijk, N.; Joyce, D.A.; Mrosso, H.D.J.; Egas, M.; Seehausen, O.

    2011-01-01

    We examined genetic structure among five species of Lake Victoria haplochromine cichlids in four island communities, using a full factorial sampling design that compared genetic differentiation between pairs of species and populations of varying morphological similarity and geographical proximity.

  6. Amphibians and squamate reptiles from the latest early Pleistocene of Cueva Victoria (Murcia, southeastern Spain, SW Mediterranean): Paleobiogeographic and paleoclimatic implications

    OpenAIRE

    BLAIN, H.A.; BAILON, S.; AGUSTÍ BALLESTER, J.

    2009-01-01

    The karstic filling of Cueva Victoria in southeastern Spain, dated from the latest early Pleistocene (ca. 1.1 Ma), is famous for providing primate fossil remains (Theropithecus) of typical African origin, in the general controversy on the antiquity of the first hominid settlements in Western Europe and their possible entrance into Europe through the Strait of Gibraltar. Cueva Victoria has also furnished the following fauna of anurans and squamate reptiles: cf. Pelodytes sp. (Pelodytidae), ...

  7. Scenario-based water resources planning for utilities in the Lake Victoria region

    Science.gov (United States)

    Mehta, V. K.; Aslam, O.; Dale, L.; Miller, N.; Purkey, D.

    2010-12-01

    Cities in the Lake Victoria (LV) region are experiencing the highest growth rates in Africa, at the same time that their water resource is threatened by domestic waste and industrial pollution. Urban centers use local springs, wetlands and Lake Victoria as source waters. As efforts to meet increasing demand accelerate, integrated water resources management (IWRM) tools provide opportunities for utilities and other stakeholders to develop a planning framework comprehensive enough to include short term (e.g. landuse change), as well as longer term (e.g. climate change) scenarios. This paper presents IWRM models built using the Water Evaluation And Planning (WEAP) decision support system, for three pilot towns in the LV region - Bukoba (Tanzania), Masaka (Uganda), and Kisii (Kenya). Their current populations are 100,000, 70,000 and 200,000 respectively. Demand coverage is ~70% in Masaka and Bukoba, and less than 50% in Kisii. IWRM models for each town were calibrated under current system performance based on site visits, utility reporting and interviews. Projected water supply, demand, revenues and costs were then evaluated against a combination of climate, demographic and infrastructure scenarios upto 2050. In Masaka, flow and climate data were available to calibrate a runoff model to simulate streamflow at water intake. In Masaka, without considering climate change, the system is infrastructure-limited and not water availability (hydrology) limited until 2035, under projected population growth of 2.17%. Under a wet climate scenario as projected by GCM’s for the LV region, the current wetland source could supply all expected demands until 2050. Even under a drought scenario, the wetland could supply all demand until 2032, if the supply infrastructure is updated at an estimated cost of USD 10.8 million. However, demand targets can only be met at the expense of almost no water returning to the wetland downstream of the intake by 2035, unless substantial investments

  8. Rock Glaciers in the Upper Basin of Bermejo River, Santa Victoria, Argentina

    Science.gov (United States)

    Ahumada, A. L.; Íbáñez Palacios, G. P.; Toledo, M. A.; Páez, S. V.

    2013-05-01

    The Bermejo River is an international basin in the Tropical Andes, Santa Victoria range. The Santa Victoria range extend in N-S sense (22°08' and 23°00' South latitude between 65° and 65°30' West longitude). It maxim height is about 5.055 m s.n.m. and it average height is 3000 m s.n.m. There have been localize intact rock glaciers (active and inactive) and relict. The rock glaciers are frozen water reservoir and regulate the water regime in the high mountain over the world. The global warming effects have been express in this region with average annual air temperatures in increase: The series of temperatures of La Quiaca weather station, years 1911-2010, shows an increase about 1° C (from 9,14° C to 10,08° C) since 70' decade to actuality. This study aims to contribute to the survey of intact rock glaciers and the suite of accompanying landforms. The geographic identification and location of rock glaciers have made through the interpretation of aerial photographs and LandSat 7 and Aster Images in comparison with Google Earth using GIS and visual interpretation technics. This information has controlled with fieldwork in several campaigns. The rock glaciers are classified (in base of it activity) in actives, inactives and relict. The first and the second class were grouped in a category called intact rock glaciers for simplify it identification. The unified categories are water-storing. In the fieldwork have determinated the following aspects: 1- Active processes determination (needle ice, lenticular ice formation, etc.) and its sedimentary products: sucrose structure, inverted gradation, extrusion, open work gravels. 2- Location and geomorphologic measurement of rock glaciers and periglacial forms. There are identified 318 intact rock glaciers in high basin of Bermejo river, Sub-basins Condado river, Los Toldos-Lipeo river and Iruya river, Santa Victoria range. The actives rock glaciers, indicators of discontinuous permafrost, are installed from 4300 m s

  9. Religión y religiosidad en la poesía de María Victoria Atencia

    OpenAIRE

    Gómez Yebra, Antonio Agustín

    2015-01-01

    La poesía de María Victoria Atencia está hecha de fervores y de claridades, dijo Manuel Alcántara cuando la presentó como pregonera de la Semana Santa de Málaga en 1985. El contacto con Dios, oral (y sentimental), es una de las señales de la piedad de María Victoria, que cree en el Dios de la religión católica, tan fuertemente marcada por la herencia hebrea del Antiguo Testamento, pero que ella ha heredado fundamentalmente a través del Nuevo. De los primeros libros de la Biblia hay a...

  10. Outbreaks of sarcoptic mange in free-ranging koala populations in Victoria and South Australia: a case series.

    Science.gov (United States)

    Speight, K N; Whiteley, P L; Woolford, L; Duignan, P J; Bacci, B; Lathe, S; Boardman, W; Scheelings, T F; Funnell, O; Underwood, G; Stevenson, M A

    2017-07-01

    To describe outbreaks of sarcoptic mange caused by Sarcoptes scabiei in free-ranging koalas in Victoria (December 2008 to November 2015) and South Australia (October 2011 to September 2014). Koalas affected by mange-like lesions were reported by wildlife carers, veterinary practitioners or State Government personnel to the Faculty of Veterinary and Agricultural Sciences at The University of Melbourne and the School of Animal and Veterinary Sciences at The University of Adelaide. Skin scrapings were taken from live and dead koalas and S. scabiei mites were identified. Tissues from necropsied koalas were examined histologically. Outbreaks of sarcoptic mange were found to occur in koalas from both Victoria (n = 29) and South Australia (n = 29) for the first time. The gross pathological and histopathological changes are described. We present the first reported cases of sarcoptic mange outbreaks in free-ranging koalas. © 2017 Australian Veterinary Association.

  11. Characterization of Staphylococcus aureus isolates from raw milk sources in Victoria, Australia.

    Science.gov (United States)

    McMillan, Kate; Moore, Sean C; McAuley, Catherine M; Fegan, Narelle; Fox, Edward M

    2016-07-29

    Highly pathogenic strains of Staphylococcus aureus can cause disease in both humans and animals. In animal species, including ruminants, S. aureus may cause severe or sub-clinical mastitis. Dairy animals with mastitis frequently shed S. aureus into the milk supply which can lead to food poisoning in humans. The aim of this study was to use genotypic and immunological methods to characterize S. aureus isolates from milk-related samples collected from 7 dairy farms across Victoria. A total of 30 S. aureus isolates were collected from milk and milk filter samples from 3 bovine, 3 caprine and 1 ovine dairy farms across Victoria, Australia. Pulsed Field Gel Electrophoresis (PFGE) identified 11 distinct pulsotypes among isolates; all caprine and ovine isolates shared greater than 80 % similarity regardless of source. Conversely, bovine isolates showed higher diversity. Multi-Locus Sequence Typing (MLST) identified 5 different sequence types (STs) among bovine isolates, associated with human or ruminant lineages. All caprine and ovine isolates were ST133, or a single allele variant of ST133. Two new novel STs were identified among isolates in this study (ST3183 and ST3184). With the exception of these 2 new STs, eBURST analysis predicted all other STs to be founding members of their associated clonal complexes (CCs). Analysis of genetic markers revealed a diverse range of classical staphylococcal enterotoxins (SE) among isolates, with 11 different SEs identified among bovine isolates, compared with just 2 among caprine and ovine isolates. None of the isolates contained mecA, or were resistant to oxacillin. The only antibiotic resistance identified was that of a single isolate resistant to penicillin; this isolate also contained the penicillin resistance gene blaZ. Production of SE was observed at 16 °C and/or 37 °C in milk, however no SE production was detected at 12 °C. Although this study characterized a limited number of isolates, bovine-associated isolates

  12. A high-resolution aeromagnetic survey over the Lanterman Range, northern Victoria Land, Antarctica

    Science.gov (United States)

    Ruppel, Antonia; Läufer, Andreas; Crispini, Laura; Capponi, Giovanni; Lisker, Frank

    2017-04-01

    During the GANOVEX XI (German North Victoria Land Expedition) in 2015-16, a high-resolution aeromagnetic survey was carried out over the Lanterman Range in northern Victoria Land (NVL). The helicopter-based survey aimed to resolve the fine structure over the so-called Lanterman Suture Zone, which represents one of the main key areas regarding geodynamic evolution of NVL during the Early Palaeozoic Ross Orogeny. This was achieved by reducing the flight line spacing to 1-2 km with 10 km tie lines and flying in a terrain-following mode. The survey was completed by ground truth magnetic susceptibility readings by using a Kappameter KM-7. The Ross-aged basement of NVL is subdivided into three tectonometamorphic so-called "terranes", comprising from W to E the Wilson-, the Bowers- and the Robertson Bay Terrane. They are generally interpreted to have formed by accretion processes at the Palaeo-Pacific active continental margin of East Gondwana in the Cambrian and Ordovician. The survey over the Lanterman Range covered parts of the two western terranes, namely the Wilson and Bowers terranes, which are separated by the Lanterman Fault Zone. This polyphase tectonic discontinuity is characterized by a belt of mafic and ultramafic rocks comprising metabasites with eclogite-facies relicts. Preliminary results show two distinct and nearly parallel magnetic lineaments in the survey area that will be further interpreted by combined magnetic susceptibility measurements and geological field data. One magnetic lineament correlates well with the known boundary between the Wilson and Bowers terranes, which comprises also a metaconglomerate belt with mafic to ultramafic clasts. The second, further easterly magnetic lineament is so far not supported by outcrops of associated highly magnetic rocks in the field. Similar parallel structures have been observed further to the southeast and seem to be offset by a major sinistral strike-slip fault zone of possibly post-Jurassic age. One

  13. Developmental effects of environmental light on male nuptial coloration in Lake Victoria cichlid fish

    Directory of Open Access Journals (Sweden)

    Daniel Shane Wright

    2018-01-01

    Full Text Available Background Efficient communication requires that signals are well transmitted and perceived in a given environment. Natural selection therefore drives the evolution of different signals in different environments. In addition, environmental heterogeneity at small spatial or temporal scales may favour phenotypic plasticity in signaling traits, as plasticity may allow rapid adjustment of signal expression to optimize transmission. In this study, we explore signal plasticity in the nuptial coloration of Lake Victoria cichlids, Pundamilia pundamilia and Pundamilia nyererei. These two species differ in male coloration, which mediates species-assortative mating. They occur in adjacent depth ranges with different light environments. Given the close proximity of their habitats, overlapping at some locations, plasticity in male coloration could contribute to male reproductive success but interfere with reproductive isolation. Methods We reared P. pundamilia, P. nyererei, and their hybrids under light conditions mimicking the two depth ranges in Lake Victoria. From photographs, we quantified the nuptial coloration of males, spanning the entire visible spectrum. In experiment 1, we examined developmental colour plasticity by comparing sibling males reared in each light condition. In experiment 2, we assessed colour plasticity in adulthood, by switching adult males between conditions and tracking coloration for 100 days. Results We found that nuptial colour in Pundamilia did respond plastically to our light manipulations, but only in a limited hue range. Fish that were reared in light conditions mimicking the deeper habitat were significantly greener than those in conditions mimicking shallow waters. The species-specific nuptial colours (blue and red did not change. When moved to the opposing light condition as adults, males did not change colour. Discussion Our results show that species-specific nuptial colours, which are subject to strong divergent

  14. Approach to medical missions: Dr. Neil Macvicar and the Victoria Hospital, Lovedale, South Africa, circa 1900-1950

    OpenAIRE

    Lunde, Martin Jacob

    2009-01-01

    This thesis examines the thought, work, and impact of the Scottish medical missionary, Dr Neil Macvicar, as well other personnel connected to the Victoria Hospital at the Lovedale mission in the Eastern Cape. Of special concern for study in medical history, missiology, and relief development studies, this work centres on Macvicar’s modern Western conceptions of Christianity, biomedicine, civilisation, African cosmological understandings, and traditional methods of healing, within the last ye...

  15. An overview of Australia?s Phytophthora species assemblage in natural ecosystems recovered from a survey in Victoria

    OpenAIRE

    Dunstan, William A.; Howard, Kay; StJ. Hardy, Giles E.; Burgess, Treena I.

    2016-01-01

    Although Phytophthora species cause serious diseases worldwide, until recently the main focus on disease in natural ecosystems in southern Australia has been on the distribution and impact of P. cinnamomi. However, new Phytophthora pathogens have emerged from natural ecosystems, and there is a need to better understand the diversity and distribution of these species in our natural forests, woodlands and heathlands. From a survey along a 70 km pipeline easement in Victoria, Phytophthora specie...

  16. Regions With Low Rates of Bystander Cardiopulmonary Resuscitation (CPR) Have Lower Rates of CPR Training in Victoria, Australia

    OpenAIRE

    Bray, Janet E.; Straney, Lahn; Smith, Karen; Cartledge, Susie; Case, Rosalind; Bernard, Stephen; Finn, Judith

    2017-01-01

    Background Bystander cardiopulmonary resuscitation (CPR) more than doubles the chance of surviving an out‐of‐hospital cardiac arrest. Recent data have shown considerable regional variation in bystander CPR rates across the Australian state of Victoria. This study aims to determine whether there is associated regional variation in rates of CPR training and willingness to perform CPR in these communities. Methods and Results We categorized each Victorian postcode as either a low or high bystand...

  17. Las guerras de las mujeres en la guerra :[homenaje a la teórica deminista Victoria Sau

    Directory of Open Access Journals (Sweden)

    Lourdes Pérez González

    2011-12-01

    This paper pays tribute to the work of the feminist theorist Victoria Sau. The article relies on the three mythological or literary figures used by the author to exemplify the different stages of feminism -Cassandra, Antigone and Lysistrata- in order to review the roles played in different moments and places by women in war, understood as a defence mechanism intended to preserve the patriarchal system. As long as this mechanism is not dismantled, these roles will not disappear.

  18. Biologically relevant physical measurements in the ice-free valleys of southern Victoria Land: soil temperature profiles and ultraviolet radiation

    Science.gov (United States)

    Nienow, J. A.; Meyer, M. A.; Friedmann, E. I. (Principal Investigator)

    1986-01-01

    As part of the ongoing comprehensive study of the cryptoendolithic microbial community in the ice-free valleys of southern Victoria Land, thermal properties of the soil and the ultraviolet radiation regime were measured. Although soil temperature profiles have been measured in the ice-free valleys (e.g., Cameron et al. 1970; Cameron 1972), these are the first such data from higher elevations. This is apparently the first time the ultraviolet radiation regime has been measured in the Antarctic.

  19. A study of heavy metal pollution in Lake Victoria sediments by Energy Dispersive X-Ray Fluorescence.

    Science.gov (United States)

    Makundi, I N

    2001-01-01

    Sources of heavy metal pollution of Lake Victoria is of interest due to its economic and domestic implication in East Africa. Sediments from the shore of Lake Victoria and from some streams flowing into the lake have been analyzed for their heavy metal content using Energy Dispersive X-Ray Fluorescence (EDXRF) analysis. The samples were collected from seventeen different locations around the Municipality of Mwanza divided into three zones according to their activities. The results show that sediments from Mwanza North, which is least in anthropogenic activities, contains Cr and Co in addition to metals of terrestrial origin (K, Ca, Ti, Mn, Fe, Rb, Sr, Y, and Zr), samples from Mwanza Central, which is the town center, contains high concentrations of V, Cu, Zn and Pb, and samples collected from Mwanza South, which is the industrial area, contains the highest concentrations of V, Cu, Zn, As and Pb. It is concluded that the industrial and sewage wastes discharged into the lake are the main sources of the heavy metal contamination of Lake Victoria. Further studies will be required to assess detriments of these pollutants to human and aquatic life before policy for the factories responsible is put in place.

  20. Climatic, socio-economic, and health factors affecting human vulnerability to cholera in the Lake Victoria basin, East Africa.

    Science.gov (United States)

    Olago, Daniel; Marshall, Michael; Wandiga, Shem O; Opondo, Maggie; Yanda, Pius Z; Kanalawe, Richard; Githeko, Andrew K; Downs, Tim; Opere, Alfred; Kavumvuli, Robert; Kirumira, Edward; Ogallo, Laban; Mugambi, Paul; Apindi, Eugene; Githui, Faith; Kathuri, James; Olaka, Lydia; Sigalla, Rehema; Nanyunja, Robinah; Baguma, Timothy; Achola, Pius

    2007-06-01

    Cholera epidemics have a recorded history in the eastern Africa region dating to 1836. Cholera is now endemic in the Lake Victoria basin, a region with one of the poorest and fastest growing populations in the world. Analyses of precipitation, temperatures, and hydrological characteristics of selected stations in the Lake Victoria basin show that cholera epidemics are closely associated with El Niño years. Similarly, sustained temperatures high above normal (T(max)) in two consecutive seasons, followed by a slight cooling in the second season, trigger an outbreak of a cholera epidemic. The health and socioeconomic systems that the lake basin communities rely upon are not robust enough to cope with cholera outbreaks, thus rendering them vulnerable to the impact of climate variability and change. Collectively, this report argues that communities living around the Lake Victoria basin are vulnerable to climate-induced cholera that is aggravated by the low socioeconomic status and lack of an adequate health care system. In assessing the communities' adaptive capacity, the report concludes that persistent levels of poverty have made these communities vulnerable to cholera epidemics.

  1. Potential Impacts of Climate Change on Precipitation over Lake Victoria, East Africa, in the 21st Century

    Directory of Open Access Journals (Sweden)

    Mary Akurut

    2014-08-01

    Full Text Available Precipitation over Lake Victoria in East Africa greatly influences its water balance. Over 30 million people rely on Lake Victoria for food, potable water, hydropower and transport. Projecting precipitation changes over the lake is vital in dealing with climate change impacts. The past and future precipitation over the lake were assessed using 42 model runs obtained from 26 General Circulation Models (GCMs of the newest generation in the Coupled Model Intercomparison Project (CMIP5. Two CMIP5 scenarios defined by Representative Concentration Pathways (RCP, namely RCP4.5 and RCP8.5, were used to explore climate change impacts. The daily precipitation over Lake Victoria for the period 1962–2002 was compared with future projections for the 2040s and 2075s. The ability of GCMs to project daily, monthly and annual precipitation over the lake was evaluated based on the mean error, root mean square error and the frequency of occurrence of extreme precipitation. Higher resolution models (grid size <1.5° simulated monthly variations better than low resolution models (grid size >2.5°. The total annual precipitation is expected to increase by less than 10% for the RCP4.5 scenario and less than 20% for the RCP8.5 scenario over the 21st century, despite the higher (up to 40% increase in extreme daily intensities.

  2. Control of swimming in the hydrozoan jellyfish Aequorea victoria: subumbrellar organization and local inhibition.

    Science.gov (United States)

    Satterlie, Richard A

    2008-11-01

    The subumbrella of the hydrozoan jellyfish Aequorea victoria (previously classified as Aequorea aequorea) is divided by numerous radial canals and attached gonads, so the subumbrellar musculature is partitioned into subumbrellar segments. The ectoderm of each segment includes two types of muscle: smooth muscle with a radial orientation, used for local (feeding and righting) and widespread (protective) radial responses, and striated muscle with a circular orientation which produces swim contractions. Two subumbrellar nerve nets were found, one of which stained with a commercial antibody produced against the bioactive peptide FMRFamide. Circular muscle cells produce a single, long-duration action potential with each swim, triggered by a single junctional potential. In addition, the circular cells are electrically coupled so full contractions require both electrotonic depolarization from adjacent cells and synaptic input from a subumbrellar nerve net. The radial cells, which form a layer superficial to the circular cells, are also activated by a subumbrellar nerve net, and produce short-duration action potentials. The radial muscle cells are electrically coupled to one another. No coupling exists between the two muscle layers. Spread of excitation between adjacent segments is decremental, and nerve net-activated junctional potentials disappear during local inhibition of swimming (such as with a radial response). Variable swim contractions are controlled by a combination of synaptic input from the motor network of the inner nerve ring, synaptic input from a subumbrellar nerve net, and electrotonic depolarization from adjacent, active muscle cells.

  3. A new marine ecosystem model for the University of Victoria Earth System Climate Model

    Directory of Open Access Journals (Sweden)

    D. P. Keller

    2012-09-01

    Full Text Available Earth System Climate Models (ESCMs are valuable tools that can be used to gain a better understanding of the climate system, global biogeochemical cycles and how anthropogenically-driven changes may affect them. Here we describe improvements made to the marine biogeochemical ecosystem component of the University of Victoria's ESCM (version 2.9. Major changes include corrections to the code and equations describing phytoplankton light limitation and zooplankton grazing, the implementation of a more realistic zooplankton growth and grazing model, and the implementation of an iron limitation scheme to constrain phytoplankton growth. The new model is evaluated after a 10 000-yr spin-up and compared to both the previous version and observations. For the majority of biogeochemical tracers and ecosystem processes the new model shows significant improvements when compared to the previous version and evaluated against observations. Many of the improvements are due to better simulation of seasonal changes in higher latitude ecosystems and the effect that this has on ocean biogeochemistry. This improved model is intended to provide a basic new ESCM model component, which can be used as is or expanded upon (i.e., the addition of new tracers, for climate change and biogeochemical cycling research.

  4. The impact of extensive loss of telecommunications on general practice: A case study in rural Victoria.

    Science.gov (United States)

    Tran, Nancy H; Pedler, Daryl

    2017-04-01

    To describe the impact of major loss of telecommunications on general practice in a rural region of Australia. A multi-stage qualitative study. Purposively selected participants were invited to contribute to initial data collection using an online survey, followed by interviews with selected participants. Thematic analysis of the data was performed by both research team members. South-western Victoria, Australia. Individuals from organisations involved in Telstra recovery efforts, disaster management, health care and general practice staff. The survey collected freeform responses from participants. Semi-structured interviews further explored a variety of experiences from purposively selected participants. Organisations and practices in the region were prepared for major disasters, but not for the unusual and 'limited' disaster of losing telecommunications, including lack of Internet access and loss of telephone services. Although alternative measures were found for telecommunications, there was still a significant impact on many health-care-related activities and general practice functionality during the outage period. In particular, there was an increase in duties for administrative staff to compensate for loss of telecommunications. Patient traffic for many services decreased due to uncertainty about availability and continuation of business. The Warrnambool outage could be used as a case study illustrating the dramatic impact of communication loss. Major impacts include changes in patient traffic, increased administrative duties and slowing of patient care. When developing or assessing disaster management plans, general practices should consider the impact of telecommunication loss on functionality and prepare appropriate alternative, accessible and reliable measures. © 2016 National Rural Health Alliance Inc.

  5. An overview of Australia's Phytophthora species assemblage in natural ecosystems recovered from a survey in Victoria.

    Science.gov (United States)

    Dunstan, William A; Howard, Kay; StJ Hardy, Giles E; Burgess, Treena I

    2016-06-01

    Although Phytophthora species cause serious diseases worldwide, until recently the main focus on disease in natural ecosystems in southern Australia has been on the distribution and impact of P. cinnamomi. However, new Phytophthora pathogens have emerged from natural ecosystems, and there is a need to better understand the diversity and distribution of these species in our natural forests, woodlands and heathlands. From a survey along a 70 km pipeline easement in Victoria, Phytophthora species were isolated from 249 rhizosphere samples and 25 bait bags deployed in 21 stream, river, or wetland locations. Of the 186 Phytophthora isolates recovered, 130 were identified to species based on ITS sequence data. Ninety-five isolates corresponded to 13 described Phytophthora species while additionally 35 isolates were identified as Clade 6 hybrids. Phytophthora cinnamomi was the most common species isolated (31 %), followed by P. elongata (6 %), both species were only recovered from soil. Samples from sites with the highest soil moisture at the time of sampling had the highest yield of isolates. Consistent with other studies throughout the world, Clade 6 species and their hybrids dominated water samples, although many of these species were also recovered less frequently from soil samples. Many of the species recovered in this study have not previously been reported from eastern Australia, reinforcing that Phytophthora species are widespread, abundant and diverse in natural ecosystems. We have probably been underestimating Phytophthora diversity in Australia.

  6. Reforming Defences to Homicide in Victoria: Another Attempt to Address the Gender Question

    Directory of Open Access Journals (Sweden)

    Bronwyn Naylor

    2017-08-01

    Full Text Available In 2005 in the Australian state of Victoria, significant changes were made to the defences to homicide. These reforms were in response to long standing concerns about the gendered operation of provocation and self-defence by feminist researchers and advocates, Law Reform Commissions, the media and political pressures. This paper critically examines the reforms and the extent to which they have addressed these varied concerns and interests. The paper argues that these important law reforms have challenged some of the powerful narratives being used in the courts that minimise the existence and significance of family violence in intimate relationships. We see this particularly in judicial sentencing remarks. However, law reform must be accompanied by a shift in legal culture to be effective in practice. To this end, we argue that legal professionals need to have information about how to utilise the new family violence provisions as well as ongoing training and professional development to promote consistent understandings of family violence across the criminal justice system.

  7. Psychiatric/Mental health nursing education in Victoria, Australia: barriers to specialization.

    Science.gov (United States)

    Happell, Brenda

    2006-04-01

    The introduction of undergraduate comprehensive nursing education in Victoria, Australia, during the 1990s has resulted in significant changes in undergraduate preparation for psychiatric/mental health nursing. Comprehensive programs became charged with the responsibility of preparing graduates to provide care for people experiencing a mental illness across a broad range of health-care settings, as well as providing a pathway for graduates with an interest in specialist practice in this field. The aim of this article is to clearly articulate the issues associated with psychiatric/mental health nursing education at the undergraduate level, including prevalence of mental illness, the inadequacy of psychiatric/mental health nursing theory and practice at undergraduate level, the negative attitudes of students toward this field of practice, and the subsequent failure of nursing education and practice initiatives to provide a clear mechanism for specialization in this important area of nursing practice. Throughout the article, the distinction between generalist and specialist preparation is argued and accompanied by a call for nursing education to recognize and address the issues associated with both domains.

  8. Development and reliability testing of the Victoria Bowel Performance Scale (BPS).

    Science.gov (United States)

    Downing, G Michael; Kuziemsky, Craig; Lesperance, Mary; Lau, Francis; Syme, Ann

    2007-11-01

    With changes in bowel function being a common and often distressful issue for palliative care patients, the ability to easily monitor and record changes in bowel status would be helpful in addressing quality of care. Most bowel tools record either constipation or diarrhea, but not both. A new tool, the Victoria Bowel Performance Scale (BPS), was designed as an ordinal nine-point scale from -4 (severe constipation) to +4 (severe diarrhea) and includes three parameters: visual stool characteristics, bowel pattern, and ability to control defecation. This study tested the reliability of BPS using case scenarios in a test-retest format. Sixty-seven raters in Time Period 1 and 54 raters in Time Period 2 ranked the 18 cases. The intraclass correlation coefficients for absolute agreement were 0.822 and 0.853 for Time Periods 1 and 2, respectively. Results showed that the raters were consistent in their scoring over time, with an average Cohen's kappa of 0.70 over all of the raters. The average Pearson correlation coefficient between Time Periods 1 and 2 scores was 0.92. Further prospective testing in day-to-day clinical care is needed to further confirm the reliability and clinical utility of the BPS. A BPS management guideline has been developed to assist with decision making for each BPS score, which also requires validation.

  9. Strategies used by dentists in Victoria, Australia, to manage children with anxiety or behavior problems.

    Science.gov (United States)

    Wright, F A; McMurray, N E; Giebartowski, J

    1991-01-01

    Two hundred and sixty-seven Australian dentists from the State of Victoria, representing members of the Australian Society of Dentistry for Children (AusSDC) and randomly selected practitioners, responded to a survey on attitudes and practices in the management of anxious children or children with behavior problems. The most common strategies used by dentists in this study were: permitting the child to exercise some form of control over terminating the treatment, if they were experiencing difficulties; furnishing waiting areas with play materials; and using a Tell-Show-Do approach to the provision of dental care. Members of the Australian Society of Dentistry for Children differed from general dentists by more frequently teaching anxious children a technique of relaxation and also by more frequently using a mouth prop or rubber dam during the delivery of care. Younger dentists tended to use behavioral strategies more frequently than older practitioners. Women dentists more frequently than male dentists, used strategies including: spending more time with the child before entering the operatory; setting shorter appointment sessions; and permitting the child to hold a toy or a mirror during dental treatment. In contrast to North American studies, few of the Australian dentists used the Hand-Over-Mouth technique to control hysteria. Australian dentists appeared to rely more frequently than their North American colleagues on setting shorter appointment sessions as a major strategy in managing children with anxiety or other behavioral difficulties.

  10. Motor vehicle exhaust gas suicide in Victoria, Australia 1998-2002.

    Science.gov (United States)

    Brennan, Chris; Routley, Virginia; Ozanne-Smith, Joan

    2006-01-01

    Motor vehicle exhaust gas suicide (MVEGS) is the second most frequent method of suicide in Victoria, Australia. It is a highly lethal method of suicide with 1.5 deaths for every hospital admission. Australian regulations require all vehicles manufactured since 1998 to have a maximum carbon monoxide exhaust emission level of 2.1 g/km, reduced from the previous level of 9.6 g/km. Information surrounding all Victorian MVEGS between 1998-2002 was analyzed to determine whether suicides occurred in vehicles with the lower emission levels. Between 1998-2002, 607 suicides by this means were recorded while just 393 hospital admissions were recorded for the same period. Mean carboxyhaemoglobin levels were significantly lower in fatalities using vehicles manufactured from 1998, however suicide still occurred in these vehicles (n = 25). The extent to which the new regulations contributed to the relatively low rate of suicide in vehicles less than 5 years old compared to their frequency in the fleet remains unknown. Based on international experience and the age of the Victorian vehicle fleet, it may take well over a decade until substantial decreases in MVEGS are observed in the absence of active preventive measures.

  11. Observed Marine Debris in the Pacific Ocean 00e2?? Victoria to Maui 2012

    Science.gov (United States)

    Location and descriptions of marine debris observed by the Sailing Vessel (S/V) Family Affair yacht during the Victoria, British Columbia to Maui, Hawaii Yacht Race in July 2012. These observations are organized according to the following map layers: Family Affairs Observations, Fleet Debris Levels, Return Vessels Special Reports, Roll Call Debris Data-Race, Special Report Debris-Race, Vessel Specific Observations, and Return Vessel Specific Levels Observations.The March, 2011 tsunami that affected northern Japan washed enormous amounts of debris out to sea. While most of this debris sank quickly out at sea, much remains on the surface and by ocean current and wind is working its way across the Pacific Ocean. In early days, the U.S. National Oceanic and Atmospheric Administration (NOAA) could track the debris slick by satellite, but by early 2012, the debris had become too dispersed to track. News stories have reported containers with motorcycles on Haida Gwaii, whole fishing boats in Alaska, and sections of concrete dock in Oregon. Recent reports are about the struggles of local governments to deal with cleaning up and disposing of flotsam washing up on local beaches.

  12. Unforeseen misuses of bed nets in fishing villages along Lake Victoria

    Directory of Open Access Journals (Sweden)

    Futami Kyoko

    2008-08-01

    Full Text Available Abstract Background To combat malaria, the Kenya Ministry of Health and nongovernmental organizations (NGOs have distributed insecticide-treated nets (ITNs for use over beds, with coverage for children under five years of age increasing rapidly. Nevertheless, residents of fishing villages have started to use these bed nets for drying fish and fishing in Lake Victoria. This study investigated the extent of bed net misuse in fishing villages. Methods Seven fishing villages along the lake were surveyed to estimate how widely bed nets were being used for fishing and drying fish. Villagers were asked why they used the bed nets for such purposes. Results In total, 283 bed nets were being used for drying fish. Of these, 239 were long-lasting insecticidal bed nets (LLIN and 44 were non-long-lasting insecticidal bed nets (NLLIN. Further, 72 of the 283 bed nets were also being used for fishing. The most popular reasons were because the bed nets were inexpensive or free and because fish dried faster on the nets. LLINs were preferred to NLLINs for fishing and drying fish. Conclusion There is considerable misuse of bed nets for drying fish and fishing. Many villagers are not yet fully convinced of the effectiveness of LLINs for malaria prevention. Such misuses may hamper the efforts of NGOs and governmental health organizations.

  13. Content analysis of school anti-bullying policies: a comparison between New Zealand and Victoria, Australia.

    Science.gov (United States)

    Marsh, Louise; McGee, Rob; Hemphill, Sheryl A; Williams, Sheila

    2011-12-01

    To undertake a detailed analysis of the content of anti-bullying policies in schools in New Zealand (NZ) and Victoria, Australia. The content of anti-bullying policies from 253 NZ schools and 93 Victorian schools were analysed in terms of definitions of bullying behaviour; reporting, recording and responding to bullying incidents; communicating and evaluating the policy; and outlining strategies for preventing bullying. There was a wide range in 'policy scores' between schools, and Victorian schools scored higher on nearly every area compared with NZ schools. In both regions, definitions rarely included bullying on the grounds of homophobia, religion or disability; or bullying between adults and students. Policies also lacked detail about the responsibilities of non-teaching staff in dealing with bullying, and rarely described follow-up after a bullying incident. Few policies explained how the policy would be evaluated, and many failed to mention preventive strategies. This study highlights some important areas that are deficient in NZ and Victorian school anti-bullying policies, and emphasises the need for guidance on how schools can develop an effective anti-bullying policy. Having more comprehensive anti-bullying policies will give schools a much better chance of reducing bullying.

  14. Highly Heterogeneous Soil Bacterial Communities around Terra Nova Bay of Northern Victoria Land, Antarctica

    Science.gov (United States)

    Lim, Hyoun Soo; Hong, Soon Gyu; Kim, Ji Hee; Lee, Joohan; Choi, Taejin; Ahn, Tae Seok; Kim, Ok-Sun

    2015-01-01

    Given the diminished role of biotic interactions in soils of continental Antarctica, abiotic factors are believed to play a dominant role in structuring of microbial communities. However, many ice-free regions remain unexplored, and it is unclear which environmental gradients are primarily responsible for the variations among bacterial communities. In this study, we investigated the soil bacterial community around Terra Nova Bay of Victoria Land by pyrosequencing and determined which environmental variables govern the bacterial community structure at the local scale. Six bacterial phyla, Actinobacteria, Proteobacteria, Acidobacteria, Chloroflexi, Cyanobacteria, and Bacteroidetes, were dominant, but their relative abundance varied greatly across locations. Bacterial community structures were affected little by spatial distance, but structured more strongly by site, which was in accordance with the soil physicochemical compositions. At both the phylum and species levels, bacterial community structure was explained primarily by pH and water content, while certain earth elements and trace metals also played important roles in shaping community variation. The higher heterogeneity of the bacterial community structure found at this site indicates how soil bacterial communities have adapted to different compositions of edaphic variables under extreme environmental conditions. Taken together, these findings greatly advance our understanding of the adaption of soil bacterial populations to this harsh environment. PMID:25799273

  15. Economic, social and resource management factors influencing groundwater trade: Evidence from Victoria, Australia

    Science.gov (United States)

    Gill, Bruce; Webb, John; Stott, Kerry; Cheng, Xiang; Wilkinson, Roger; Cossens, Brendan

    2017-07-01

    In Victoria, Australia, most groundwater resources are now fully allocated and opportunities for new groundwater development can only occur through trading of license entitlements. Groundwater usage has rarely exceeded 50% of the available licensed volume, even in the 2008/9 drought year, and 50 to 70% of individual license holders use less than 5% of their allocation each year. However, little groundwater trading is occurring at present. Interviews were conducted with groundwater license holders and water brokers to investigate why the Victorian groundwater trade market is underdeveloped. Responses show there is a complex mix of social, economic, institutional and technical reasons. Barriers to trade are influenced by the circumstances of each groundwater user, administrative process and resource management rules. Water brokers deal with few trades at low margins and noted unrealistic selling prices and administrative difficulties. Irrigators who have successfully traded identify that there are few participants in trading, technical appraisals are expensive and administrative requirements and fees are burdensome, especially when compared to surface water trading. Opportunities to facilitate trade include groundwater management plan refinement and improved information provision. Simplifying transaction processes and costs, demonstrating good resource stewardship and preventing third party impacts from trade could address some concerns raised by market participants. There are, however, numerous individual circumstances that inhibit groundwater trading, so it is unlikely that policy and process changes alone could increase usage rates without greater demand for groundwater or more favourable farming economic circumstances.

  16. Short-term droughts forecast using Markov chain model in Victoria, Australia

    Science.gov (United States)

    Rahmat, Siti Nazahiyah; Jayasuriya, Niranjali; Bhuiyan, Muhammed A.

    2017-07-01

    A comprehensive risk management strategy for dealing with drought should include both short-term and long-term planning. The objective of this paper is to present an early warning method to forecast drought using the Standardised Precipitation Index (SPI) and a non-homogeneous Markov chain model. A model such as this is useful for short-term planning. The developed method has been used to forecast droughts at a number of meteorological monitoring stations that have been regionalised into six (6) homogenous clusters with similar drought characteristics based on SPI. The non-homogeneous Markov chain model was used to estimate drought probabilities and drought predictions up to 3 months ahead. The drought severity classes defined using the SPI were computed at a 12-month time scale. The drought probabilities and the predictions were computed for six clusters that depict similar drought characteristics in Victoria, Australia. Overall, the drought severity class predicted was quite similar for all the clusters, with the non-drought class probabilities ranging from 49 to 57 %. For all clusters, the near normal class had a probability of occurrence varying from 27 to 38 %. For the more moderate and severe classes, the probabilities ranged from 2 to 13 % and 3 to 1 %, respectively. The developed model predicted drought situations 1 month ahead reasonably well. However, 2 and 3 months ahead predictions should be used with caution until the models are developed further.

  17. Liturgy and Music in Hereford Cathedral in the Time of Queen Victoria and Beyond

    Directory of Open Access Journals (Sweden)

    Tessa Murdoch

    2017-04-01

    Full Text Available The Victorian Gothic Revival and its focus on liturgical neo-medievalism inspired the 1860s restoration of the medieval Hereford Cathedral. In this restoration, the new screen played a central part. Designed by George Gilbert Scott and manufactured by the firm of Francis Skidmore in Coventry, the screen was commissioned in order to re-unite the choir with the nave. The symbolism and colours decorating the screen harmonized with the medieval and later features of the cathedral, including the high altar reredos, organ pipes, and floor tiles. Hereford Cathedral Library preserves historical accounts of the interior and original music manuscripts by Edward Elgar and Frederick Ouseley that illustrate, with the musical inserts provided, the rich tradition of choral music and liturgy which continues to this day with key liturgies and the annual Three Choirs Festival linking Gloucester, Hereford, and Worcester. Memorials and stained-glass windows dedicated to successive precentors embellish the musical vocabulary of the interior. In focusing on the musical culture connected with Hereford Cathedral, this essay seeks to enrich the interpretation of the restored Hereford Screen in its secular setting at the Victoria and Albert Museum, London.

  18. Is Gippsland environmentally iodine deficient? Water iodine concentrations in the Gippsland region of Victoria, Australia.

    Science.gov (United States)

    Rahman, Ashequr; Deacon, Nicholas; Panther, Barbara; Chesters, Janice; Savige, Gayle

    2010-12-01

      This paper provides evidence of environmental iodine deficiency in the Gippsland region.   Quantitative study; water samples were collected from 18 water treatment plants and four rain water tanks across Gippsland and water iodine concentrations were measured.   Gippsland region of Victoria, Australia.   This paper reports on the iodine concentration of drinking water from sources across Gippsland and examines the contribution of iodine from water to the Gippsland diet. This study also briefly examines the relationship between the concentration of iodine in water and distance from the sea. The cut-off value for water iodine concentrations considered to be indicative of environmental iodine deficiency is water from 18 Gippsland water treatment plants was 0.38 µg L(-1) and would therefore make negligible difference to the dietary intake of iodine. This finding also falls well below the suggested dietary intake of iodine from water estimated by the 22nd Australian Total Diet Study. Our study found no linear relationship between the water iodine concentration and distance from the sea.   As Gippsland has environmental iodine deficiency there is a greater probability that people living in this region are at higher risk of dietary iodine deficiency than those living in environmentally iodine sufficient regions. Populations living in areas known to have environmental iodine deficiency should be monitored regularly to ensure that problems of iodine deficiency, especially amongst the most vulnerable, are addressed promptly. © 2010 The Authors. Australian Journal of Rural Health © National Rural Health Alliance Inc.

  19. A study of autotrophic communities in two Victoria Land lakes (Continental Antarctica using photosynthetic pigments

    Directory of Open Access Journals (Sweden)

    Roberto BARGAGLI

    2010-08-01

    Full Text Available The composition of algal pigments and extracellular polymeric substances (EPS was determined in microbial mats from two lakes in Victoria Land (Continental Antarctica with different lithology and environmental features. The aim was to expand knowledge of benthic autotrophic communities in Antarctic lacustrine ecosystems, providing reference data for future assessment of possible changes in environmental conditions and freshwater communities. The results of chemical analyses were supported by microscopy observations. Pigment profiles showed that filamentous cyanobacteria are dominant in both lakes. Samples from the water body at Edmonson Point had greater biodiversity, fewer pigments and lower EPS ratios than those from the lake at Kar Plateau. Differences in mat composition and in pigment and EPS profile between the two lakes are discussed in terms of local environmental conditions such as lithology, ice-cover and UV radiation. The present study suggests that a chemical approach could be useful in the study of benthic communities in Antarctic lakes and their variations in space and time.

  20. Forensic odontology, part 3. The Australian bushfires - Victoria state, February 2009.

    Science.gov (United States)

    Hinchliffe, J

    2011-04-09

    This paper aims to demonstrate the stages in the disaster victim identification of those who lost their lives in the Australian bushfires that raged across the state of Victoria in February 2009. Communities were damaged or destroyed leaving families distressed and homeless, and as the number of deaths increased the Disaster Victim Identification (DVI) teams were activated, with plans evolving to deal with this emergency. The identification process was challenging due to many factors, such as the dangers and difficulties involved in body recovery and the charring and commingling of remains. It would take several months of careful work to identify the dead using a multidisciplinary approach. The impact of this incident will have long-lasting consequences for the families and communities involved. At the time of writing all but one of the 173 victims had been identified, mostly by dental methods: quite remarkable when only small fragments of the dental structures remained in many cases. This article is based on the author's personal experience working to assist the organised and experienced Australian Dental DVI Team.

  1. Public values for integration in natural disaster management and planning: A case study from Victoria, Australia.

    Science.gov (United States)

    Rawluk, Andrea; Ford, Rebecca M; Neolaka, Fendi L; Williams, Kathryn J

    2017-01-01

    Values can be useful for identifying what is important to individuals and communities, yet there is currently not a coherent way to conceptualize, identify, and organize the breadth of values that can be affected by a natural disaster. This research proposes a conceptual framework for how to conceptualize, identify, and organize values, and proposes a concrete, tangible value called the valued entity. The framework is applied in two studies of bushfire in Victoria, Australia: 112 submissions from individuals to the 2009 Victorian Bushfires Royal Commission and interviews with 30 members of the public in bushfire risk landscapes. Our findings suggest that: what people value ranges from abstract to concrete; prevalent abstract values include benevolence and universalism; prevalent mid-level valued attributes include natural attributes of landscapes and human life and welfare; prevalent valued entities are people and properties close to the person. Comparison between the two studies suggests people with more recent experience with bushfire refer less to the importance of natural places and natural attributes. The conceptual framework can act as a boundary object to facilitate researchers and policy-makers understanding the breadth of values affected by natural disaster events and management actions and how governance can better consider values at different scales. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  2. Morchella australiana sp. nov., an apparent Australian endemic from New South Wales and Victoria.

    Science.gov (United States)

    Elliott, Todd F; Bougher, Neale L; O'Donnell, Kerry; Trappe, James M

    2014-01-01

    An abundant fruiting of a black morel was encountered in temperate northwestern New South Wales (NSW), Australia, during a mycological survey in Sep 2010. The site was west of the Great Dividing Range in a young, dry sclerophyll forest dominated by Eucalyptus and Callitris north of Coonabarabran in an area known as the Pilliga Scrub. Although the Pilliga Scrub is characterized by frequent and often large, intense wildfires, the site showed no sign of recent fire, which suggests this species is not a postfire morel. Caps of the Morchella elata-like morel were brown with blackish ridges supported by a pubescent stipe that became brown at maturity. Because no morel has been described as native to Australia, the collections were subjected to multilocus molecular phylogenetic and morphological analyses to assess its identity. Results of these analyses indicated that our collection, together with collections from NSW and Victoria, represented a novel, genealogically exclusive lineage, which is described and illustrated here as Morchella australiana T. F. Elliott, Bougher, O'Donnell & Trappe, sp. nov.

  3. Longitudinal effects of school drug policies on student marijuana use in Washington State and Victoria, Australia.

    Science.gov (United States)

    Evans-Whipp, Tracy J; Plenty, Stephanie M; Catalano, Richard F; Herrenkohl, Todd I; Toumbourou, John W

    2015-05-01

    We examined the longitudinal effect of schools' drug policies on student marijuana use. We used data from the International Youth Development Study, which surveyed state-representative samples of students from Victoria, Australia, and Washington State. In wave 1 (2002), students in grades 7 and 9 (n = 3264) and a school administrator from each participating school (n = 188) reported on school drug policies. In wave 2 (2003), students reported on their marijuana use. We assessed associations between student-reported and administrator-reported policy and student self-reported marijuana use 1 year later. Likelihood of student marijuana use was higher in schools in which administrators reported using out-of-school suspension and students reported low policy enforcement. Student marijuana use was less likely where students reported receiving abstinence messages at school and students violating school policy were counseled about the dangers of marijuana use. Schools may reduce student marijuana use by delivering abstinence messages, enforcing nonuse policies, and adopting a remedial approach to policy violations rather than use of suspensions.

  4. Microbiological Safety and Food Handling Practices of Seed Sprout Products in the Australian State of Victoria.

    Science.gov (United States)

    Symes, Sally; Goldsmith, Paul; Haines, Heather

    2015-07-01

    Seed sprouts have been implicated as vehicles for numerous foodborne outbreaks worldwide. Seed sprouts pose a unique food safety concern because of the ease of microbiological seed contamination, the inherent ability of the sprouting process to support microbial growth, and their consumption either raw or lightly cooked. To examine seed sprout safety in the Australian state of Victoria, a survey was conducted to detect specific microbes in seed sprout samples and to investigate food handling practices relating to seed sprouts. A total of 298 seed sprout samples were collected from across 33 local council areas. Escherichia coli was detected in 14.8%, Listeria spp. in 12.3%, and Listeria monocytogenes in 1.3% of samples analyzed. Salmonella spp. were not detected in any of the samples. A range of seed sprout handling practices were identified as potential food safety issues in some food businesses, including temperature control, washing practices, length of storage, and storage in proximity to unpackaged ready-to-eat potentially hazardous foods.

  5. Finding Space for Participation: Fisherfolk Mobility and Co-Management of Lake Victoria Fisheries

    Science.gov (United States)

    Nunan, Fiona; Luomba, Joseph; Lwenya, Caroline; Yongo, Ernest; Odongkara, Konstantine; Ntambi, Baker

    2012-08-01

    The literature on fisheries co-management is almost silent on the issue of the movement of fisherfolk within fisheries, although such movement must have implications for the effectiveness of co-management. The introduction of co-management often involves the formation of new structures that should enable the participation of key stakeholder groups in decision-making and management, but such participation is challenging for migrating fishers. The article reports on a study on Lake Victoria, East Africa, which investigated the extent of movement around the lake and the implications of movement for how fishers participate and are represented in co-management, and the implications of the extent and nature of movement for co-management structures and processes. The analysis draws on the concept of space from the literature on participation in development and on a framework of representation in fisheries co-management in addressing these questions. The created space is on an `invited' rather than open basis, reflecting the top-down nature of implementation and the desire to secure participation of different occupational groups, as well as women in a male-dominated sector. The more powerful boat owners dominate positions of power within the co-management system, particularly as the levels of co-management, from sub-district to national, are traversed. The limited power and resources of boat crew are exacerbated by the degree and nature of movement around the lake, making effective participation in co-management decision-making a challenge.

  6. A positive association between cryptosporidiosis notifications and ambient temperature, Victoria, Australia, 2001-2009.

    Science.gov (United States)

    Kent, Lillian; McPherson, Michelle; Higgins, Nasra

    2015-12-01

    Increased temperatures provide optimal conditions for pathogen survival, virulence and replication as well as increased opportunities for human-pathogen interaction. This paper examined the relationship between notifications of cryptosporidiosis and temperature in metropolitan and rural areas of Victoria, Australia between 2001 and 2009. A negative binomial regression model was used to analyse monthly average maximum and minimum temperatures, rainfall and the monthly count of cryptosporidiosis notifications. In the metropolitan area, a 1 °C increase in monthly average minimum temperature of the current month was associated with a 22% increase in cryptosporidiosis notifications (incident rate ratio (IRR) 1.22; 95% confidence interval (CI) 1.13-1.31). In the rural area, a 1 °C increase in monthly average minimum temperature, lagged by 3 months, was associated with a 9% decrease in cryptosporidiosis notifications (IRR 0.91; 95% CI 0.86-0.97). Rainfall was not associated with notifications in either area. These relationships should be considered when planning public health response to ecological risks as well as when developing policies involving climate change. Rising ambient temperature may be an early warning signal for intensifying prevention efforts, including appropriate education for pool users about cryptosporidiosis infection and management, which might become more important as temperatures are projected to increase as a result of climate change.

  7. Selection of electrogenic bacteria for microbial fuel cell in removing Victoria blue R from wastewater.

    Science.gov (United States)

    Chen, Chih-Yu; Tsai, Teh-Hua; Wu, Pei-Ssu; Tsao, Shuo-En; Huang, Yu-Shan; Chung, Ying-Chien

    2018-01-28

    This study was conducted to select electrogenic bacteria from wastewater sludge. Phylogenetic analysis revealed that Proteobacteria was the dominant phylum in the microbial fuel cell (MFC) during the decomposition process of organic pollutants. Five culturable bacteria strains - namely, Bacillus subtilis, Flavobacterium sp., Aeromonas hydrophila, Citrobacter freundii, and Stenotrophomonas sp. - have a double potential in dye removal and electricity generation. We inoculated the mixed electrogenic bacteria at a specific ratio and treated them with a triphenylmethane dye, Victoria blue R (VBR), to evaluate their electricity generation ability for the artificial and real wastewater. The results of the VBR shock-loading experiment indicated that the inoculated MFC could adapt to shock loading in 1-2 days and exhibited high removal efficiency (95-100%) for 100-800 mg L-1 VBR with a power density of 8.62 ± 0.10 to 34.81 ± 0.25 mW m-2. The selected electrogenic bacteria in the MFC could use VBR as only electron donor for power generation. The matrix effects of the real wastewater on VBR removal and electricity generation of MFC were insignificant. VBR degradation by the electrogenic bacteria involves a stepwise demethylation process to yield partially dealkylated VBR species. In addition, these results demonstrate the feasibility of inoculating culturable bacteria strains to develop an efficient MFC for purifying wastewater.

  8. The photodynamic effect of Victoria blue BO on peripheral blood mononuclear and leukemic cells

    Energy Technology Data Exchange (ETDEWEB)

    Fiedorowicz, M. [Hugo Kollatay Univ. of Agriculture, Krakow (Poland); Pituch-Noworolska, A.; Zembala, M. [Polish-American Children`s Hospital, Krakow (Poland). Dept. of Clinical Immunology

    1997-05-01

    The photodynamic effect of Victoria blue BO (VB-BO) and photoirradiation on peripheral blood mononuclear cells was studied. The cells were preincubated with VB-BO followed by photoirradiation and overnight culture. The highest percentage of dead cells (propidium iodide assay in flow cyctometry) was seen in the monocyte population. The lymphocytes showed a lower sensitivity to VB-BO photodynamic action than the monocytes (12% vs 80% of PI-positive cells). The effect of VB-BO and phototreatment on lymphocyte function was studied using a mitogen-induced proliferation assay. A decrease of mitogen response was observed. The VB-BO and photoirradiation were also used on leukemic cells. The leukemic cells from acute myeloid leukemia and B precursors leukemia were sensitive to VB-BO photodynamic action. The high VB-BO sensitivity of monocytes and leukemic cells (myeloid and lymphoid B derived) suggests possible application of VB-BO for selective depletion of monocytes or sensitive leukemic cells. (author).

  9. Sensitive voltammetric detection of yeast RNA based on its interaction with Victoria Blue B

    Directory of Open Access Journals (Sweden)

    WEI SUN

    2009-12-01

    Full Text Available Voltammetric studies of the interaction of yeast RNA (y-RNA with Victoria Blue B (VBB are described in this paper. Furthermore, a linear sweep voltammetric method for the detection of y-RNA was established. The reaction conditions, such as acidity and amount of buffer solution, the concentration of VBB, the reaction time and temperature, etc., were carefully investigated by second order derivative linear sweep voltammetry. Under the optimal conditions, the reduction peak current of VBB at –0.75 V decreased greatly after the addition of y-RNA to the solution without any shift of the reduction peak potential. Based on the decrease of the peak current, a new quantitative method for the determination of y-RNA was developed. The effects of co-existing substances on the determination were carefully investigated and three synthetic samples were determined with satisfactory results. The stoichiometry of the VBB–y-RNA complex was calculated by linear sweep voltammetry and the interaction mechanism is discussed.

  10. Relationships between body fatness, small-screen sedentary activity and regionality among schoolchildren in Victoria, Australia.

    Science.gov (United States)

    Aucote, Helen M; Cooper, Andrew

    2009-06-01

    To examine the difference in body fatness and engagement in small-screen activities across children living in different degrees of regionality, and to examine the relationship between child body fatness and small-screen activities. Cross-sectional study design. Grade 5-6 schoolchildren (n = 393) from central and metropolitan Victoria, and a parent/guardian of each child (n = 393). Parents completed a questionnaire on their child's engagement in television (TV) viewing and video game playing (VGP). Children's weight and height were measured by a researcher. Body mass index (BMI) (kg/m(2)) was calculated and adjusted for age and sex. Regionality (metropolitan, population > 100 000; regional, 100 000 > population < 20 000; and rural, population < 10 000) and socioeconomic status (socioeconomic indexes for areas: index of disadvantage) were assigned according to school attended. BMI did not differ across regionality or sex. Boys engaged in more VGP than girls, and metropolitan children engaged in more VGP than rural and regional children. TV viewing did not differ across sex or regionality. VGP did not predict BMI, and TV viewing did not predict girls' BMI. Three to four per cent of the variance in boys' BMI was predicted by TV viewing. Boys and metropolitan children engage in more VGP. Boys', but not girls', BMI is related to TV viewing. Interventions designed to decrease engagement in TV viewing should be targeting boys.

  11. The shortened dental arch concept: awareness and opinion of dentists in Victoria, Australia.

    Science.gov (United States)

    Abuzar, M A; Humplik, A J; Shahim, N

    2015-09-01

    The occlusion of a complete dental arch is generally desirable but not necessary nor always achievable in many individuals. It is, however, relevant for dentists to consider what minimum number of teeth is required by individuals for oral function. This study investigated dentists' awareness and opinion of the shortened dental arch (SDA) concept in an Australian context. A self-administered voluntary and anonymous questionnaire was mailed to a sample of 434 dentists, randomly selected from both rural and metropolitan locations in Victoria, Australia. The information collected included awareness of the SDA concept and its application as a treatment option. More than half of the respondents (61%) were aware of the SDA concept. All respondents 'agreed' or 'strongly agreed' with the seven criteria of SDA proposed in this study based on Käyser (1989). The majority (78.4%) believed that the SDA concept is useful in clinical practice. Dentists with dentists who responded to this survey agreed that the SDA is a practical and useful treatment modality for older adults with limitations to complex restorative care. However, application of the SDA varied considerably among dentists. © 2015 Australian Dental Association.

  12. Psychological distress and risky sexual behaviours among women aged 16-25 years in Victoria, Australia.

    Science.gov (United States)

    Nguyen, Nhuong T; Subasinghe, Asvini K; Wark, John D; Reavley, Nicola; Garland, Suzanne M

    2017-12-01

    Identifying factors related to risky sexual behaviour may contribute to preventive and interventional approaches to reduce negative mental health outcomes among young women. The aim of this study was to investigate the association between psychological distress and risky sexual behaviours in females aged 16-25 years in Victoria, Australia. Data were extracted from the Young Female Health Initiative (YFHI), a study in which participants were recruited via advertisements on Facebook. Logistic regression was used to assess associations between psychological distress, as measured by the Kessler 10 (K10) Psychological Distress Scale, and risky sexual behaviours. Data were available from 200 sexually active participants and 40 non-sexually active participants. We found that the K10 score was independently associated with sex while under the influence of alcohol or drugs (odds ratio: 1.7; 95% confidence intervals: 1.2, 2.7; P = 0.006). Although data were collected from a small sample of young women, we found that those with underlying psychological distress may adopt risky sexual behaviours, especially if concomitantly drinking alcohol or taking drugs.

  13. Socio-demographic profile of child and adolescent users of oral health services in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    J Rodrigo

    2014-09-01

    Full Text Available The aim of this study was to investigate the socio-demographic characteristics of the eligible population of users of public oral health care services in the Australian state of Victoria, aged 17 years or younger. The study was conducted as a secondary analysis of data collected from July 2008 to June 2009 for 45,728 young clients of public oral health care. The sample mean age was 8.9 (SD: 3.5 years. The majority (82.7% was between 6 and 17 years of age, and 50.3% were males. The majority (76.6% was Australian-born and spoke English at home (89.1%. The overall mean DMFT was 1.0 (SD: 2.1 teeth, with a mean dmft of 3.16 (SD: 5.79 teeth. Data indicate that, among six year olds in the Significant Caries Index (SiC category, the mean dmft was 6.82 teeth. Findings corroborate social inequalities in oral health outcome and provide suggestions for oral health services to develop strategies and priorities to reduce inequalities in health and well-being, and better coordinate and target services to local needs.

  14. Continuous bioelectricity generation through treatment of Victoria blue R: A novel microbial fuel cell operation.

    Science.gov (United States)

    Chen, Chih-Yu; Wang, Guey-Horng; Tsai, Teh-Hua; Chen, Wan-Tzu; Chung, Ying-Chien

    2017-07-29

    A novel two-chamber microbial fuel cell (MFC) operation with a continuous anaerobic-aerobic decolorization system was developed to improve the degradation of the triphenylmethane dye, Victoria blue R (VBR). In addition, bioelectricity was generated during the VBR degradation process, and the operation parameters were optimized. The results indicated that the VBR removal efficiency and electricity generation were affected by the VBR concentration, liquid retention time (LRT), external resistance, gas retention time (GRT), and shock loading. The optimal operation parameters were as follows: VBR concentration, 600 mg L-1; LRT, 24 h; external resistance, 3300 Ω; and GRT, 60 s. Under these operating conditions, the VBR removal efficiency, COD removal efficiency, and power density were 98.2% ± 0.3%, 97.6% ± 0.5%, and 30.6 ± 0.4 mW m-2, respectively. According to our review of the relevant literature, this is the first paper to analyze the electrical characteristics of a continuous two-chamber MFC operation and demonstrate the feasibility of the simultaneous electricity generation and decolorization of VBR.

  15. Upper Paleozoic glacigenic deposits of Gondwana: Stratigraphy and paleoenvironmental significance of a tillite succession in Northern Victoria Land (Antarctica)

    Science.gov (United States)

    Cornamusini, Gianluca; Talarico, Franco M.; Cirilli, Simonetta; Spina, Amalia; Olivetti, Valerio; Woo, Jusun

    2017-08-01

    Late Paleozoic glacial deposits are widespread in Gondwana. In Antarctica the best outcrops occur in the Central Transantarctic Mountains, Ellsworth Mountains, Pensacola Mountains, and in Southern Victoria Land, whereas they are rare and very scattered in Northern Victoria Land, which represents a linkage sector with Tasmania and eastern Australia. The aim of the present research is to define the stratigraphic setting and the environmental interpretation of a poorly studied Lower Permian glacigenic succession located near Orr Glacier in the Lanterman Range in Northern Victoria Land. It has great importance because it represents the only significant glacigenic succession for this wide area, marking and defining time and modality of a glacial-postglacial transition during the early Permian, a critical time-interval in the paleoenvironmental evolution of southern Gondwana. This succession, named here as the Lanterman Formation, lies directly on to crystalline basement, and is overlain by a thick Permian fluvial succession (Takrouna Formation). The results provided by sedimentological facies analysis and palynological analysis, integrated with a limited petrographic characterization, show a correlation framework between two isolated successions, outlining their stratigraphic architecture and subdivided into a lower glacial portion and an upper postglacial portion. The former, Asselian in age, is dominated by diamictite, sandstone, mudstone with lonestones, and carbonate deposits, suggesting repeated advance and retreat of a terrestrial glacier, with facies associations indicating environmental changes from subglacial to glaciofluvial, to glaciolacustrine. The latter is dominated by lacustrine mudstone with decreasing lonestones upward, thin bedded sandstone, conglomerate and a thick fluvial sandstone and pebbly sandstone succession at the top, signalling the transition to a fluvial system through time. The overall dataset suggests that the late Paleozoic glacigenic

  16. Risk Factors Associated with Ebola and Marburg Viruses Seroprevalence in Blood Donors in the Republic of Congo

    Science.gov (United States)

    Moyen, Nanikaly; Thirion, Laurence; Emmerich, Petra; Dzia-Lepfoundzou, Amelia; Richet, Hervé; Boehmann, Yannik; Dimi, Yannick; Gallian, Pierre; Gould, Ernest A.; Günther, Stephan; de Lamballerie, Xavier

    2015-01-01

    Background Ebola and Marburg viruses (family Filoviridae, genera Ebolavirus and Marburgvirus) cause haemorrhagic fevers in humans, often associated with high mortality rates. The presence of antibodies to Ebola virus (EBOV) and Marburg virus (MARV) has been reported in some African countries in individuals without a history of haemorrhagic fever. In this study, we present a MARV and EBOV seroprevalence study conducted amongst blood donors in the Republic of Congo and the analysis of risk factors for contact with EBOV. Methodology and Findings In 2011, we conducted a MARV and EBOV seroprevalence study amongst 809 blood donors recruited in rural (75; 9.3%) and urban (734; 90.7%) areas of the Republic of Congo. Serum titres of IgG antibodies to MARV and EBOV were assessed by indirect double-immunofluorescence microscopy. MARV seroprevalence was 0.5% (4 in 809) without any identified risk factors. Prevalence of IgG to EBOV was 2.5%, peaking at 4% in rural areas and in Pointe Noire. Independent risk factors identified by multivariate analysis were contact with bats and exposure to birds. Conclusions/Significance This MARV and EBOV serological survey performed in the Republic of Congo identifies a probable role for environmental determinants of exposure to EBOV. It highlights the requirement for extending our understanding of the ecological and epidemiological risk of bats (previously identified as a potential ecological reservoir) and birds as vectors of EBOV to humans, and characterising the protection potentially afforded by EBOV-specific antibodies as detected in blood donors. PMID:26047124

  17. Application of Satellite Observations to Manage Natural Disasters in the Lake Victoria Basin

    Science.gov (United States)

    Habib, Shahid; Policelli, F.; Irwin, D.; Korme, Tesfaye; Adler, Bob; Hong, Yang

    2010-01-01

    Lake Victoria, the second largest fresh water lake in the Eastern part of Africa is a vital natural resource for the economic well being and prosperity of over 30 million people located in riparian regions of Uganda, Kenya and Tanzania. It covers a large area of about 68,870 km2 and produces a GDP of about US $30 billion per year. The region is also very much prone to natural disasters such as severe floods during heavy precipitation periods in the Eastern part of Africa. In addition to floods, the precipitation also produces large infestations of mosquito larvae due to the standing water in many areas. This further causes multiple vector borne diseases such as Malaria, Rift Valley Fever and more. These problems are of serious concern and require active and aggressive surveillance and management to minimize the loss of human and animal lives and property damage. Satellite imagery and observations along with the in situ measurements provide a great tool to analyze and study this area and inform the policy makers to make calculated policy decisions which are more beneficial to the environment. Recently, NASA and USAID have joined forces with the Regional Center for Mapping of Resources for Development (RCMRD) located in Nairobi, Kenya to utilize multiple NASA sensors such as TRMM, SRTM and MODIS to develop flood potential maps for the Lake Victoria Basin. The idea is to generate a flood forecasts and "nowcasts" that can be sent to the disaster management organizations of Uganda, Kenya, and Tanzania. Post flood event satellite imagery is becoming a common tool to assess the areas inundated by flooding. However, this work is unique undertaking by utilizing land imaging and atmospheric satellites to build credible flood potential maps. At same time, we are also studying the potential occurrence and spread of Rift Valley Fever disease based on the short term climate records and precipitation data. These activities require multi-nation coordination and agreements and

  18. A statewide review of postnatal care in private hospitals in Victoria, Australia

    Science.gov (United States)

    2010-01-01

    Background Concerns have been raised in Australia and internationally regarding the quality and effectiveness of hospital postnatal care, although Australian women receiving postnatal care in the private maternity sector rate their satisfaction with care more highly than women receiving public maternity care. In Victoria, Australia, two-thirds of women receive their maternity care in the public sector and the remainder in private health care sector. A statewide review of public hospital postnatal care in Victoria from the perspective of care providers found many barriers to care provision including the busyness of postnatal wards, inadequate staffing and priority being given to other episodes of care; however the study did not include private hospitals. The aim of this study was replicate the review in the private sector, to explore the structure and organisation of postnatal care in private hospitals and identify those aspects of care potentially impacting on women's experiences and maternal and infant care. This provides a more complete overview of the organisational structures and processes in postnatal care in all Victorian hospitals from the perspective of care providers. Methods A mixed method design was used. A structured postal survey was sent to all Victorian private hospitals (n = 19) and key informant interviews were undertaken with selected clinical midwives, maternity unit managers and obstetricians (n = 11). Survey data were analysed using descriptive statistics and interview data analysed thematically. Results Private hospital care providers report that postnatal care is provided in very busy environments, and that meeting the aims of postnatal care (breastfeeding support, education of parents and facilitating rest and recovery for women following birth) was difficult in the context of increased acuity of postnatal care; prioritising of other areas over postnatal care; high midwife-to-woman ratios; and the number and frequency of visitors. These

  19. A statewide review of postnatal care in private hospitals in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Forster Della A

    2010-05-01

    Full Text Available Abstract Background Concerns have been raised in Australia and internationally regarding the quality and effectiveness of hospital postnatal care, although Australian women receiving postnatal care in the private maternity sector rate their satisfaction with care more highly than women receiving public maternity care. In Victoria, Australia, two-thirds of women receive their maternity care in the public sector and the remainder in private health care sector. A statewide review of public hospital postnatal care in Victoria from the perspective of care providers found many barriers to care provision including the busyness of postnatal wards, inadequate staffing and priority being given to other episodes of care; however the study did not include private hospitals. The aim of this study was replicate the review in the private sector, to explore the structure and organisation of postnatal care in private hospitals and identify those aspects of care potentially impacting on women's experiences and maternal and infant care. This provides a more complete overview of the organisational structures and processes in postnatal care in all Victorian hospitals from the perspective of care providers. Methods A mixed method design was used. A structured postal survey was sent to all Victorian private hospitals (n = 19 and key informant interviews were undertaken with selected clinical midwives, maternity unit managers and obstetricians (n = 11. Survey data were analysed using descriptive statistics and interview data analysed thematically. Results Private hospital care providers report that postnatal care is provided in very busy environments, and that meeting the aims of postnatal care (breastfeeding support, education of parents and facilitating rest and recovery for women following birth was difficult in the context of increased acuity of postnatal care; prioritising of other areas over postnatal care; high midwife-to-woman ratios; and the number and

  20. Family Presence During Resuscitation (FPDR): Observational case studies of emergency personnel in Victoria, Australia.

    Science.gov (United States)

    Porter, Joanne E; Miller, Nareeda; Giannis, Anita; Coombs, Nicole

    2017-07-01

    Family Presence During Resuscitation (FPDR), although not a new concept, remains inconsistently implemented by emergency personnel. Many larger metropolitan emergency departments (ED) have instigated a care coordinator role, however these personnel are often from a non-nursing background and have therefore limited knowledge about the clinical aspects of the resuscitation. In rural emergency departments there are simply not enough staff to allocate an independent role. A separate care coordinator role, who is assigned to care for the family and not take part in the resuscitation has been well documented as essential to the successful implementation of FPDR. One rural and one metropolitan emergency department in the state of Victoria, Australia were observed and data was collected on FPDR events. The participants consisted of resuscitation team members, including; emergency trained nurses, senior medical officers, general nurses and doctors. The participants were not told that the data would be recorded around interactions with family members or team discussions regarding family involvement in the resuscitation, following ethical approval involving limited disclosure of the aims of the study. Seventeen adult presentations (Metro n=9, Rural n=8) were included in this study and will be presented as resuscitation case studies. The key themes identified included ambiguity around resuscitation status, keeping the family informed, family isolation and inter-professional communication. During 17 adult resuscitation cases, staff were witnessed communicating with family, which was often limited and isolation resulted. Family were often uninformed or separated from their family member, however when a family liaison person was available it was found to be beneficial. This research indicated that staff could benefit from a designated family liaison role, formal policy and further education. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Exploring Service Providers' Perspectives in Improving Childhood Obesity Prevention among CALD Communities in Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    Sheila Cyril

    Full Text Available Childhood obesity rates have been increasing disproportionately among disadvantaged communities including culturally and linguistically diverse (CALD migrant groups in Australia due to their poor participation in the available obesity prevention initiatives. We sought to explore service providers' perceptions of the key factors influencing the participation of CALD communities in the existing obesity prevention services and the service requirements needed to improve CALD communities' participation in these services.We conducted a qualitative study using focus group discussions involving fifty-nine service providers from a range of services, who are involved in the health and wellbeing of children from CALD groups living in four socioeconomically disadvantaged areas in Victoria, Australia.Thematic analysis of the data showed three major themes including community-level barriers to CALD engagement in childhood obesity prevention services; service-level barriers to the delivery of these services; and proposed changes to current childhood obesity prevention approaches. Integrating obesity prevention messages within existing programs, better coordination between prevention and treatment services and the establishment of a childhood obesity surveillance system, were some of the important changes suggested by service providers.This study has found that low CALD health literacy, lack of knowledge of cultural barriers among service providers and co-existing deficiencies in the structure and delivery of obesity prevention services negatively impacted the participation of CALD communities in obesity prevention services. Cultural competency training of service providers would improve their understanding of the cultural influences of childhood obesity and incorporate them into the design and development of obesity prevention initiatives. Service providers need to be educated on the pre-migratory health service experiences and health conditions of CALD

  2. Prehospital management of supraventricular tachycardia in Victoria, Australia: epidemiology and effectiveness of therapies.

    Science.gov (United States)

    Smith, Gavin; McD Taylor, David; Morgans, Amee; Cameron, Peter

    2014-08-01

    The present study examined patient demographics, characteristics and the effectiveness of current prehospital supraventricular tachycardia (SVT) management by ambulance paramedics in Victoria, Australia. We conducted a retrospective study of all Victorian patients attended by paramedics between 14 February 2012 and 13 February 2013, where SVT was the initial or final diagnosis. Patients were excluded if SVT was not captured on ECG, incomplete data were recorded, or SVT began after initial assessment. Data were extracted from the VACIS(®) clinical data warehouse. Accuracy of paramedic SVT diagnosis was examined. Nine hundred and thirty-three patients were enrolled, including 882 (94.5%) adults and 564 (60.5%) women. Mean adult and paediatric (SVT in 119/123 (96.7%, 95% CI: 91.5, 99.0) of adult ECG strips examined. There were 273/882 (31.0%) patients who spontaneously reverted while in paramedic care. Valsalva manoeuvre was undertaken by 212/882 (24.0%) patients and reverted the SVT in 99/358 (27.7%) attempts. Verapamil was administered to 38/882 (4.3%) patients and reverted 33 (86.8%). Aramine was administered to 43/882 (4.9%) patients and 35 reverted following administration (81.4%). Synchronised cardioversion (70 J) reverted four patients at first attempt. Ultimately, 438 (49.7%) patients remained in SVT on arrival at hospital. Patient characteristics associated with SVT are more likely to be middle-aged women with a history of hypertension and hypercholesterolaemia. Therapies were underutilised leading to reduced clinical guideline effectiveness. Where therapies were instigated, reversion rates are greater than previously reported. © 2014 Australasian College for Emergency Medicine and Australasian Society for Emergency Medicine.

  3. Influence of voluntary standards and design modifications on trampoline injury in Victoria, Australia.

    Science.gov (United States)

    Ashby, Karen; Eager, David; D'Elia, Angelo; Day, Lesley

    2015-10-01

    To examine the influence of the voluntary Australian trampoline standard (AS 4989-2006) and market-driven design modifications on relevant trampoline injuries. Trend and intervention analysis on frequencies and proportions of hospital-treated trampoline-related injury in Victoria, Australia, extracted from the Victorian Emergency Minimum Dataset from 1 July 1999 to 30 June 2013. The injuries relevant to the AS were contact with spring and frame, and multiple-user injury. Falls from trampolines were relevant for netted trampolines, a market-driven modification. Frequency of all trampoline injuries increased by 11.4% (95% CI 10.0% to 11.7%) on average each year. Spring and frame, and fall injuries increased to a lesser extent (8.7%, 95% CI 6.9% to 9.8% and 7.3%, 95% CI 5.8% to 8.3%, respectively). Multiple-user injuries increased by 21.0% (95% CI 16.3% to 21.9%). As a proportion of all trampoline injuries, spring and frame injury and falls injury decreased, while multiple-user injuries increased. The intervention analysis showed no significant change in spring and frame injuries associated with the AS (p=0.17). A significant increase was found for multiple-user injuries (p=0.01), in particular for the 0-year to 4-year age group (ptrampolines appear to be associated with a decrease in falls from trampolines but an increase in injuries to multiple users. A mandated trampoline safety standard and a safety campaign including warnings about multiple users is recommended. Continued monitoring of injury data will be required. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  4. Modelling density-dependent flow and solute transport at the Lake Tutchewop saline disposal complex, Victoria

    Science.gov (United States)

    Simmons, Craig T.; Narayan, Kumar A.

    1998-05-01

    Intercepted saline groundwaters and drainage effluent from irrigation are commonly stored in both natural and artificial saline disposal basins throughout the Murray-Darling Basin of Australia. Their continued use as wastewater evaporation sites requires an understanding of existing groundwater dynamics. The useful of individual basins, their sustainability and possible environmental impacts remain largely unknown. In this work, the movement of salt to the underlying groundwater system from Lake Tutchewop, a saline disposal complex in north-central Victoria, was modelled in cross-section. Due to the salinity contrast between the hypersaline basin waters and the regional groundwater, it was necessary to simulate density-dependent flow behaviour. Under certain conditions, these density-stratified systems may become unstable leading to the onset of convective behaviour, which greatly increases the movement of salt from the basin to the groundwater system. Modelled concentration profiles in the aquifer system and calculated seepage rates from the basin show that Lake Tutchewop is stable under its present operating regime. The downward movement of salt is mainly controlled by diffusion and dispersion. The calibrated model was used to assess the impact of several management scenarios using time-dependent boundary conditions for lake salinity and water levels. The influence of heterogeneous basin linings on ensuing salt flux rates is examined, and results show that increased solute transport will occur under such conditions. A sensitivity analysis performed on governing variables showed that salt fluxes were most sensitive to lake salinity levels. A solute Rayleigh number defined in terms of basin salinity and hydrogeologic parameters is seen to be an effective tool for predicting the long term behaviour of such saline disposal basins. The models and concepts developed in this work may find application in the design and management of saline disposal complexes.

  5. Making medicine; producing pleasure: A critical examination of medicinal cannabis policy and law in Victoria, Australia.

    Science.gov (United States)

    Lancaster, Kari; Seear, Kate; Ritter, Alison

    2017-11-01

    Several jurisdictions around the world have introduced policies and laws allowing for the legal use of cannabis for therapeutic purposes. However, there has been little critical discussion of how the object of 'medicinal cannabis' is enacted in policy and practice. Informed by Carol Bacchi's poststructuralist approach to policy analysis and the work of science and technology studies scholars, this paper seeks to problematise the object of 'medicinal cannabis' and examine how it is constituted through governing practices. In particular, we consider how the making of the object of 'medicinal cannabis' might constrain or enact discourses of pleasure. As a case example, we take the Victorian Law Reform Commission's review of law reform options to allow people in the Australian state of Victoria to be treated with medicinal cannabis. Through analysis of this case example, we find that although 'medicinal cannabis' is constituted as a thoroughly medical object, it is also constituted as unique. We argue that medicinal cannabis is enacted in part through the production of another object (so-called 'recreational cannabis') and the social and political meanings attached to both. Although both 'substances' are constituted as distinct, 'medicinal cannabis' relies on the 'absent presence' of 'recreational cannabis' to define and shape what it is. However, we find that contained within this rendering of 'medicinal cannabis' are complex enactments of health and wellbeing, which open up discourses of pleasure. 'Medicinal cannabis' appears to challenge the idea that the effects of 'medicine' cannot be understood in terms of pleasure. As such, the making of 'medicinal cannabis' as a medical object, and its invocation of broad notions of health and wellbeing, expand the ways in which drug effects can be acknowledged, including pleasurable and desirable effects, helping us to think differently about both medicine and other forms of drug use. Copyright © 2017 Elsevier B.V. All rights

  6. Subglacial Calcites from Northern Victoria Land: archive of Antarctic volcanism in the Last Glacial Maximum

    Science.gov (United States)

    Frisia, Silvia; Weirich, Laura; Hellstrom, John; Borsato, Andrea; Golledge, Nicholas R.; Anesio, Alexandre M.; Bajo, Petra; Drysdale, Russell N.; Augustinus, Paul C.; Barbante, Carlo; Cooper, Alan

    2017-04-01

    Subglacial carbonates bear similarities to stalagmites in their fabrics and the potential to obtain precise chronologies using U-series methods. Their chemical properties also reflect those of their parent waters, which, in contrast to stalagmites, are those of subglacial meltwaters. In analogy to speleothems, stable Carbon isotope ratios and trace elements such as Uranium, Iron and Manganese provide the opportunity to investigate ancient extreme environments without the need to drill through thousands of metres of ice. Sedimentological, geochemical and microbial evidence preserved in LGM subglacial calcites from Northern Victoria Land, close to the East Antarctic Ice Sheet margin, allow us to infer that subglacial volcanism was active in the Trans Antarctic Mountain region and induced basal ice melting. We hypothesize that a meltwater reservoir was drained and injected into interconnected basal pore systems where microbial processes enhanced bedrock weathering and, thus, released micronutrients. Volcanic influence is supported by the presence of fluorine (F) and sulphur in sediment-laden calcite layers containing termophilic species. Notably, calcite δ13C points to dissolved inorganic carbon evolved from subglacial metabolic processes. Once transported to the sea, soluble iron likely contributed to fertilizing the Southern Ocean and CO2 drawdown. This is the first well-dated evidence for LGM volcanism in Antarctica, which complements the record of volcanic eruptions retrieved from Talos Dome ice core, and supports the hypothesis of large-scale volcanism as an important driver of climate change. We conclude that subglacial carbonates are equivalent to speleothems in their palaeoclimate potential and may become a most useful source of information of ecosystems and processes at peak glacials in high altitude/high latitude settings.

  7. Individual and community factors for railway suicide: a matched case-control study in Victoria, Australia.

    Science.gov (United States)

    Too, Lay San; Spittal, Matthew J; Bugeja, Lyndal; McClure, Roderick; Milner, Allison

    2016-06-01

    This study aims to simultaneously examine individual- and community-level factors associated with railway suicide. We performed a case-control study in Victoria, Australia between 2001 and 2012. Data on cases of railway suicide were obtained from the National Coronial Information System (a database of coronial investigations). Controls were living individuals randomly selected from the Household, Income and Labour Dynamics in Australia study, matching to cases on age groups, sex and year of exposures. A conditional logistic regression model was used to assess the individual-level and community-level influences on individual odds of railway suicide, controlling for socioeconomic status. Individual-level diagnosed mental illness increased railway suicide odds by six times [95 % confidence interval (CI) 4.5, 9.2]. Community-level factors such as living in an area with a presence of railway tracks [odds ratio (OR) 1.8, 95 % CI 1.2, 2.8], within a city (OR 3.2, 95 % CI 1.9, 5.4), and with a higher overall suicide rate (OR 1.02, 95 % CI 1.01, 1.04) were independently associated with greater individual odds of railway suicide compared to living in an area without a presence of railway tracks, outside a city, and with a relatively lower overall suicide rate. The effects of mental illness and high incidence of overall suicides are prominent, but not specific on railway suicide. The effects of presence of railway tracks and city residence suggest the importance of accessibility to the railways for individual risk of railway suicide. Prevention efforts should focus on vulnerable people live in areas with easy access to the railways.

  8. Travel Destinations and Sexual Behavior as Indicators of Antibiotic Resistant Shigella Strains--Victoria, Australia.

    Science.gov (United States)

    Lane, Courtney R; Sutton, Brett; Valcanis, Mary; Kirk, Martyn; Walker, Cathryn; Lalor, Karin; Stephens, Nicola

    2016-03-15

    Knowledge of relationships between antibiotic susceptibility of Shigella isolates and travel destination or other risk factors can assist clinicians in determining appropriate antibiotic therapy prior to susceptibility testing. We describe relationships between resistance patterns and risk factors for acquisition in Shigella isolates using routinely collected data for notified cases of shigellosis between 2008 and 2012 in Victoria, Australia. We included all shigellosis patients notified during the study period, where Shigella isolates were tested for antimicrobial sensitivity using Clinical and Laboratory Standards Institute breakpoints. Cases were interviewed to collect data on risk factors, including recent travel. Data were analyzed using Stata 13.1 to examine associations between risk factors and resistant strains. Of the 500 cases of shigellosis, 249 were associated with overseas travel and 210 were locally acquired. Forty-six of 51 isolates of Indian origin displayed decreased susceptibility or resistance to ciprofloxacin. All isolates of Indonesian origin were susceptible to ciprofloxacin. Twenty-six travel-related isolates were resistant to all tested oral antimicrobials. Male-to-male sexual contact was the primary risk factor for 80% (120/150) of locally acquired infections among adult males, characterized by distinct periodic Shigella sonnei outbreaks. Clinicians should consider travel destination as a marker for resistance to common antimicrobials in returning travelers, where severe disease requires empirical treatment prior to receipt of individual sensitivity testing results. Repeated outbreaks of locally acquired shigellosis among men who have sex with men highlight the importance of prevention and control measures in this high-risk group. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.

  9. Dual diagnosis discourse in Victoria Australia: the responsiveness of mental health services.

    Science.gov (United States)

    Roberts, Bridget M; Maybery, Darryl

    2014-01-01

    In recent decades, psychiatric services have been challenged to be more responsive to patients' coexisting problems, in particular those concerning substance use. In Australia this has been referred to as a "No Wrong Door" approach. This paper explores the meanings of this move for the acute mental health sector, including attitudes toward a No Wrong Door approach to people with a dual diagnosis of mental illness and substance use disorder.   This qualitative study involved a review of the research literatures, analysis of policy documents, and interviews with 19 key informants in a case study of the State of Victoria, Australia.   The analysis resulted in two broad themes surrounding the implications of dual diagnosis discourse for the mental health sector. The first involves progress regarding the concept of No Wrong Door with subthemes including interprofessional cultural conflicts, intersectoral professional status issues, terminology, problem definition, perspectives on serious mental illness, the role of the client, and pharmacological treatment. The second overarching theme focuses upon informants' thoughts on future directions for the sector and highlights divided opinion on the implications of dual diagnosis discourse for the mental health service and social care systems.   While the perspectives on system change and multiple issues such as resource concerns and cultural clashes are presented here, the informants in this study also gave clear guidance for the future of dual diagnosis work in the mental health sector (e.g., focusing on orienting services toward consumer strengths and recovery), along with recommendations for future research. This paper contributes to the small body of qualitative research on the history and course of efforts to develop appropriate practice in mental health services with regard to patients who have substance use problems and other mental health disorders.

  10. Population surveys of Nile crocodiles (Crocodylus niloticus in the Murchison Falls National Park, Victoria Nile, Uganda

    Directory of Open Access Journals (Sweden)

    Behangana Mathias

    2017-12-01

    Full Text Available 1. A 12-month-long survey (April 2013 to March 2014 for Nile crocodiles (Crocodylus niloticus was conducted along a section of the Victoria Nile/Ramsar site of Murchison Falls National Park, in order to update the historic information on crocodile populations in the area, locating nesting areas, determining seasonality patterns and habitat use, and assess the current abundance and the population size trends since the 1960s. The methods employed included visual encounter surveys, transect counts and opportunistic methods, by using boats. 2. In general, there were diurnal and seasonal fluctuations in the number of crocodile sightings. The crocodile sightings peaked between the months of June and August, with the highest mean number of sightings encountered on any single day being 67 (in July 2013, and the second peak was between January and March with the highest mean of 118 recorded in January 2014. The second peak also coincided with the crocodile breeding season. This clearly shows that the distribution of the sub-population sampled followed a climatic regime. 3. Crocodiles were observed most frequently in water (37%. Grassy banks, islands, river mouths and sandy banks constituted about 47% of the habitats utilised by the crocodile population. Although basking was the most frequent type of activity performed by crocodiles (50% over the entire survey period, their key activities varied significantly from month to month. Nesting was very visible during the last quarter of the year and the first quarter of the New Year. 4. There was a clear decline of the abundance of crocodiles in this population between 1960s and nowadays. This declining trend was obvious also taking into account the various survey methodologies employed over the decades.

  11. Governance of quality of care: a qualitative study of health service boards in Victoria, Australia.

    Science.gov (United States)

    Bismark, Marie M; Studdert, David M

    2014-06-01

    To describe the engagement of health service boards with quality-of-care issues and to identify factors that influence boards' activities in this area. We conducted semistructured interviews with 35 board members and executives from 13 public health services in Victoria, Australia. Interviews focused on the role currently played by boards in overseeing quality of care. We also elicited interviewees' perceptions of factors that have influenced their current approach to governance in this area. Thematic analysis was used to identify key themes from interview transcripts. Virtually all interviewees believed boards had substantial opportunities to influence the quality of care delivered within the service, chiefly through setting priorities, monitoring progress, holding staff to account and shaping culture. Perceived barriers to leveraging this influence included insufficient resources, gaps in skills and experience among board members, inadequate information on performance and regulatory requirements that miss the mark. Interviewees converged on four enablers of more effective quality governance: stronger regional collaborations; more tailored board training on quality issues; smarter use of reporting and accreditation requirements; and better access to data that was reliable, longitudinal and allowed for benchmarking against peer organisations. Although health service boards are eager to establish quality of care as a governance priority, several obstacles are blocking progress. The result is a gap between the rhetoric of quality governance and the reality of month-to-month activities at the board level. The imperative for effective board-level engagement in this area cannot be met until these barriers are addressed. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  12. Impacts of reclaimed water irrigation on soil antibiotic resistome in urban parks of Victoria, Australia.

    Science.gov (United States)

    Han, Xue-Mei; Hu, Hang-Wei; Shi, Xiu-Zhen; Wang, Jun-Tao; Han, Li-Li; Chen, Deli; He, Ji-Zheng

    2016-04-01

    The effluents from wastewater treatment plants have been recognized as a significant environmental reservoir of antibiotics and antibiotic resistance genes (ARGs). Reclaimed water irrigation (RWI) is increasingly used as a practical solution for combating water scarcity in arid and semiarid regions, however, impacts of RWI on the patterns of ARGs and the soil bacterial community remain unclear. Here, we used high-throughput quantitative PCR and terminal restriction fragment length polymorphism techniques to compare the diversity, abundance and composition of a broad-spectrum of ARGs and total bacteria in 12 urban parks with and without RWI in Victoria, Australia. A total of 40 unique ARGs were detected across all park soils, with genes conferring resistance to β-lactam being the most prevalent ARG type. The total numbers and the fold changes of the detected ARGs were significantly increased by RWI, and marked shifts in ARG patterns were also observed in urban parks with RWI compared to those without RWI. The changes in ARG patterns were paralleled by a significant effect of RWI on the bacterial community structure and a co-occurrence pattern of the detected ARG types. There were significant and positive correlations between the fold changes of the integrase intI1 gene and two β-lactam resistance genes (KPC and IMP-2 groups), but no significant impacts of RWI on the abundances of intI1 and the transposase tnpA gene were found, indicating that RWI did not improve the potential for horizontal gene transfer of soil ARGs. Taken together, our findings suggested that irrigation of urban parks with reclaimed water could influence the abundance, diversity, and compositions of a wide variety of soil ARGs of clinical relevance. Irrigation of urban parks with treated wastewater significantly increased the abundance and diversity of various antibiotic resistance genes, but did not significantly enhance their potential for horizontal gene transfer. Copyright © 2015 Elsevier

  13. Developmental effects of visual environment on species-assortative mating preferences in Lake Victoria cichlid fish.

    Science.gov (United States)

    Wright, D S; Demandt, N; Alkema, J T; Seehausen, O; Groothuis, T G G; Maan, M E

    2017-02-01

    Local adaptation can be a potent force in speciation, with environmental heterogeneity leading to niche specialization and population divergence. However, local adaption often requires nonrandom mating to generate reproductive isolation. Population divergence in sensory properties can be particularly consequential in speciation, affecting both ecological adaptation and sexual communication. Pundamilia pundamila and Pundamilia nyererei are two closely related African cichlid species that differ in male coloration, blue vs. red. They co-occur at rocky islands in southern Lake Victoria, but inhabit different depth ranges with different light environments. The species differ in colour vision properties, and females exert species-specific preferences for blue vs. red males. Here, we investigated the mechanistic link between colour vision and preference, which could provide a rapid route to reproductive isolation. We tested the behavioural components of this link by experimentally manipulating colour perception - we raised both species and their hybrids under light conditions mimicking shallow and deep habitats - and tested female preference for blue and red males under both conditions. We found that rearing light significantly affected female preference: shallow-reared females responded more strongly to P. pundamilia males and deep-reared females favoured P. nyererei males - implying that visual development causally affects mate choice. These results are consistent with sensory drive predictions, suggesting that the visual environment is key to behavioural isolation of these species. However, the observed plasticity could also make the species barrier vulnerable to environmental change: species-assortative preferences were weaker in females that were reared in the other species' light condition. © 2016 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2016 European Society For Evolutionary Biology.

  14. First molecular characterisation of Cryptosporidium and Giardia from Bubalus bubalis (water buffalo) in Victoria, Australia.

    Science.gov (United States)

    Abeywardena, Harshanie; Jex, Aaron R; von Samson-Himmelstjerna, Georg; Haydon, Shane R; Stevens, Melita A; Gasser, Robin B

    2013-12-01

    We conducted a molecular epidemiological survey of Cryptosporidium and Giardia from Bubalus bubalis (water buffalo) on two extensive farms (450 km apart) in Victoria, Australia. Faecal samples (n=476) were collected from different age groups of water buffalo at two time points (six months apart) and tested using a PCR-based mutation scanning-targeted sequencing-phylogenetic approach, employing markers within the small subunit of ribosomal RNA (designated pSSU) and triose phosphate isomerase (ptpi) genes. Based on pSSU data, Cryptosporidium parvum, Cryptosporidium bovis and Cryptosporidium genotypes 1, 2 (each 99% similar genetically to Cryptosporidium ryanae) and 3 (99% similar to Cryptosporidium suis) were detected in two (0.4%), one (0.2%), 38 (8.0%), 16 (3.4%) and one (0.2%) of the 476 samples tested, respectively. Using ptpi, Giardia duodenalis assemblages A and E were detected in totals of 56 (11.8%) and six (1.3%) of these samples, respectively. Cryptosporidium was detected on both farms, whereas Giardia was detected only on farm B, and both genera were detected in 1.5% of all samples tested. The study showed that water buffaloes on these farms excreted C. parvum and/or G. duodenalis assemblage A, which are consistent with those found in humans, inferring that these particular pathogens are of zoonotic significance. Future work should focus on investigating, in a temporal and spatial manner, the prevalence and intensity of such infections in water buffaloes in various geographical regions in Australia and in other countries. Copyright © 2013 Elsevier B.V. All rights reserved.

  15. Factors associated with sickness certification of injured workers by General Practitioners in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Rasa Ruseckaite

    2016-04-01

    Full Text Available Abstract Background Work-related injuries resulting in long-term sickness certification can have serious consequences for injured workers, their families, society, compensation schemes, employers and healthcare service providers. The aim of this study was to establish what factors potentially are associated with the type of sickness certification that General Practitioners (GPs provide to injured workers following work-related injury in Victoria, Australia. Methods This was a retrospective population-based cohort study was conducted for compensation claims lodged by adults from 2003 to 2010. A logistic regression analysis was performed to assess the impact of various factors on the likelihood that an injured worker would receive an alternate/modified duties (ALT, n = 28,174 vs. Unfit for work (UFW, n = 91,726 certificate from their GP. Results A total of 119,900 claims were analysed. The majority of the injured workers were males, mostly age of 45-54 years. Nearly half of the workers (49.9 % with UFW and 36.9 % with ALT certificates had musculoskeletal injuries. The multivariate regression analysis revealed that for most occupations older men (55-64 years were less likely to receive an ALT certificate, (OR = 0.86, (95%CI, 0.81 – 0.91. Workers suffering musculoskeletal injuries or occupational diseases were nearly twice or three times at higher odds of receiving an ALT certificate when compared to fractures. Being seen by a GP experienced with workers’ compensation increased the odds of receiving ALT certificate (OR = 1.16, (95%CI, 1.11 – 1.20. Occupation and industry types were also important factors determining the type of certificate issued to the injured worker. Conclusions This study suggests that specific groups of injured workers (i.e. older age, workers with mental health issues, in rural areas are less likely to receive ALT certificates.

  16. Medical review licensing outcomes in drivers with visual field loss in Victoria, Australia

    Science.gov (United States)

    Muir, Carlyn; Charlton, Judith L; Odell, Morris; Keeffe, Jill; Wood, Joanne; Bohensky, Megan; Fildes, Brian; Oxley, Jennifer; Bentley, Sharon; Rizzo, Matthew

    2017-01-01

    Background Good vision is essential for safe driving and studies have associated visual impairment with an increased crash risk. Currently, there is little information about the medical review of drivers with visual field loss. This study examines the prevalence of visual field loss among drivers referred for medical review in one Australian jurisdiction and investigates factors associated with licence outcome in this group. Methods A random sample of 10,000 (31.25 per cent) medical review cases was extracted for analysis from the Victorian licensing authority. Files were screened for the presence of six visual field-related medical conditions. Data were captured on a range of variables, including referral source, age, gender, health status, crash history and licence outcome. Prevalence analyses were univariate and descriptive. Logistic regression was used to assess factors associated with licence outcomes in the visual field loss group. Results Approximately 1.9 per cent of the 10,000 medical review cases screened had a visual field loss condition identified (n=194). Among the visual field loss group, 57.2 per cent were permitted to continue driving (conditional/unconditional licence). Primary referral sources were the police, self-referrals and general medical practitioners. Key factors associated with licence test outcomes were visual field condition, age group, crash involvement and referral to the Driver Licensing Authority’s Medical Advisors. Those who were younger had a crash involvement triggering referral and those who were referred to the Medical Advisors were more likely to have a positive licensing outcome. Conclusion The evidence base for making licensing decisions is complicated by the variable causes, patterns, progressions and measuring technologies for visual field loss. This study highlighted that the involvement of an expert medical advisory service in Victoria resulted in an increased likelihood that drivers with visual field loss will be

  17. Sleep-Related Infant Deaths in Victoria: A Retrospective Case Series Study.

    Science.gov (United States)

    Bugeja, Lyndal; Dwyer, Jeremy; McIntyre, Sara-Jane; Young, Jeanine; Stephan, Karen Lesley; McClure, Roderick John

    2016-05-01

    There is general agreement that in some circumstances, sharing a sleep surface of any kind with an infant increases the risk of sudden unexpected death in infancy. There is a paucity of research conducted in Australia examining this issue. This study examines the frequency and distribution of sleep-related infant deaths in a defined population, and reports the proportion that occurred in the context of bed-sharing. A retrospective population-based case series study was conducted of infants (≤365 days) who died in a sleeping context during the period 1 January 2008 to 31 December 2010 in the state of Victoria, Australia. Information about the infant, caregiver, sleeping environment and bed-sharing was collected from a review of the coroner's death investigation record. During the 3-year study period, 72 infant deaths occurred in a sleeping context. Of these, 33 (45.8 %) occurred in the context of bed-sharing: n = 7 in 2008; n = 11 in 2009; and n = 15 in 2010. Further analysis of the 33 deaths occurring in the context of bed-sharing showed that in this group, bed-sharing was largely intentional, habitual and most often involved the mother as one of the parties. Given the case series nature of the study design, a causal relationship between bed-sharing and infant death could not be inferred. However the fact that nearly half of all sleep-related deaths occurred in the context of bed-sharing, provides strong support for the need to undertake definitive analytic studies in Australia so that evidence-based advice can be provided to families regarding the safety of bed-sharing practices.

  18. Strategic Actions for Increasing the Submission of Digital Cadastral Data by the Surveying Industry Based on Lessons Learned from Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Hamed Olfat

    2018-02-01

    Full Text Available ePlan, as a digital cadastral data initiative, is a collaborative program between the land authorities and the surveying industry which aims to replace paper and PDF cadastral plans and surveys with digital data. ePlan is currently operational in Australia, New Zealand and Singapore. ePlan was introduced in the State of Victoria in 2011 and has been operational in this jurisdiction for 2D plans since 2013. On average, one ePlan application is currently submitted to a digital plan lodgment portal every two weeks. The low uptake of ePlan is caused by several technical and non-technical challenges. This paper provides an overview of cadastral information transitioning from paper to digital in Victoria. The research methodology to identify the challenges in Victoria for the adoption of ePlan is then described. This is followed by a discussion on the identified challenges. The paper then proposes a generic framework of strategic actions to increase the uptake of digital cadastral data based on the lessons learned from Victoria. The initiatives suggested by this framework to address the ePlan challenges in Victoria and increase its uptake are also introduced. The paper concludes with a direction for future research.

  19. Geologic map and structural analysis of the Victoria quadrangle (H2) of Mercury based on NASA MESSENGER images

    Science.gov (United States)

    Galluzzi, V.; Di Achille, G.; Ferranti, L.; Rothery, D. A.; Palumbo, P.

    The first stratigraphic and geologic study of Mercury was released by Trask & Guest (1975) followed by Spudis & Guest (1988, and references therein), whose work was based on the images taken by Mariner 10 covering 42% of the total surface of Mercury. The planet has been officially divided into fifteen quadrangles: 2 polar, 5 equatorial and 8 at midlatitudes. Quadrangle H2 (= Hermes sheet n.2), named ``Victoria'' (20oN - 65oN Lon.; 270oE - 0o Lat.), was partially mapped by McGill & King (1983), though a wide area (˜64%) remained unmapped due to the lack of imagery. Following the terrain units recognized and described by the above authors, we have produced a geologic map of the entire quadrangle using MESSENGER (MErcury Surface, Space ENvironment, GEochemistry and Ranging) images. The images taken by the Mercury Dual Imaging System (MDIS) Wide Angle Camera (WAC) and Narrow Angle Camera (NAC) allowed us to map geologic and tectonic features in much greater detail than the previously published map (mapping scale range between 1:300k and 1:600k). We classified craters larger than 20 km using three relative age classes, which are a simplification of the past five degradation classes defined by McCauley et al. (1981). Victoria quadrangle is characterized by a localized N-S thrust array constituted by Victoria Rupes, Endeavour Rupes and Antoniadi Dorsum to the East and by a more diffuse system of NE-SW oriented fault arrays to the West: the two systems seem to be separated by a tectonic bulge. The Victoria-Endeavour-Antoniadi system has been interpreted as a fold-and-thrust belt by Byrne et al. (2014) and a previous study made on craters cross-cut by its thrusts reveals fault dips of 15-20o and a near dip slip motion (Galluzzi et al., 2015). This geologic map has the aim to build a regional model of its structural framework. Deciphering the geological setting of this quadrangle will bring important insights for understanding the tectonic evolution of the whole planet

  20. Uncertainties in Flow-Duration-Frequency Relationships of High and Low Flow Extremes in Lake Victoria Basin

    OpenAIRE

    Charles Onyutha; Patrick Willems

    2013-01-01

    This paper focuses on uncertainty analysis to aid decision making in applications of statistically modeled flow-duration-frequency (FDF) relationships of both daily high and low flows. The analysis is based on 24 selected catchments in the Lake Victoria basin in Eastern Africa. The FDF relationships were derived for aggregation levels in the range 1–90 days for high flows and 1–365 days for low flows. The validity of the projected FDF quantiles for high return periods T was checked using grow...

  1. Lope and the Creation of Contemporary Heroes: «La nueva victoria de don Gonzalo de Córdoba» y «La nueva victoria del marqués de Santa Cruz»

    Directory of Open Access Journals (Sweden)

    Teresa Ferrer Valls

    2013-05-01

    Full Text Available Lope defended the usefulness of history presented on stage, that is, theatre’s function of preserving and creating a collective memory. In the case of La nueva victoria de don Gonzalo and La nueva victoria del marqués de Santa Cruz, this playwright dramatized military events that took place immediately before the composition of these plays. In this article i will analyze the fundamental traits of those texts in relation to Lope’s desire to please his patrons and, at the same time, to participate in the making of a Spanish national identity, which intensified during the first years of king Philip IV’s reign through different media, among them painting and theatre. This paper ends reflecting on the risk assumed by the playwright when dealing with recent political events. This is exemplified by the existing news about the prohibition of a play by Lope, nowadays lost, related to the death of the king of Sweden, in which the protagonists of the two aforementioned plays are also referenced.

  2. ‘A token of their love’: Queen Victoria Memorials in New Zealand

    Directory of Open Access Journals (Sweden)

    Mark Stocker

    2016-06-01

    Full Text Available This article provides an overview of the four metropolitan sculptural memorials to Queen Victoria in late-colonial New Zealand, which all immediately precede the colony’s Dominion status (1907. In chronological order, they were erected in Auckland, Christchurch, Wellington, and Dunedin. While the Auckland memorial was unveiled within the Queen’s lifetime, her death in 1901 catalysed the commission of more ambitious counterparts in Wellington and Dunedin, and a degree of intercity rivalry was consciously articulated in advocacy for them. The memorials reflect a Pākeha (European New Zealand sense of identity as a loyal, pro-monarchical, and imperial colony, but also as a ‘Better Britain’, with a proud sense of prosperity and achievement. Local content features prominently in two of them, notably the signing with Māori of the Treaty of Waitangi (1840 in one of the reliefs for the capital city memorial (Wellington, and an ambitious celebration of fifty years of provincial achievement in the pedestal sculpture for the Christchurch counterpart. Due to a dearth of home-grown talent, together with the belief in the artistic superiority of Britain (often known at the time as ‘Home’, British sculptors were invariably commissioned for these memorials. Cost-effectiveness, prestige, and the ability to render a realistic likeness were all criteria behind the choice of artists, with Francis John Williamson commissioned for two of them (Auckland and Christchurch. In researching this article, extensive use has been made of primary newspaper sources to document the political context of the memorials. In all of them, particularly that of Christchurch, New Zealand’s loyalty to Britain in the South African War (1899–1902 was a leading issue. Artistic and aesthetic issues and analysis were less prominent, although there was a widespread belief that the Queen should be honoured for purely symbolic and not utilitarian causes. While emphasis is given

  3. Use of Modern Family Planning Methods in Fishing Communities of Lake Victoria, Uganda.

    Science.gov (United States)

    Nanvubya, Annet; Ssempiira, Julius; Mpendo, Juliet; Ssetaala, Ali; Nalutaaya, Annet; Wambuzi, Mathias; Kitandwe, Paul; Bagaya, Bernard S; Welsh, Sabrina; Asiimwe, Stephen; Nielsen, Leslie; Makumbi, Fredrick; Kiwanuka, Noah

    2015-01-01

    Fishing communities (FCs) in Uganda have high HIV infection rates but poor access to health services including family planning (FP). Although FP is a cost-effective public health intervention, there is a paucity of data on knowledge and use of modern FP in FCs. This study determined knowledge and use of modern FP methods in FCs of Uganda. Data were accrued from a 12-month follow up of 1,688 HIV-uninfected individuals, 18-49 years from 8 FCs along Lake Victoria, between September 2011 and March 2013. Data on knowledge and use of modern FP were collected through a semi-structured questionnaire. Prevalence Risk Ratios with corresponding 95% CIs were used to determine factors associated with Modern FP knowledge and use. The mean age was 31.4 years, with nearly half (48.8%) being females while more than half (58.6%) had attained up to primary education level. Knowledge of modern FP was high, 87.5% (1477/1688); significantly higher among females [adj. PRR = 4.84 (95% CI; 3.08, 7.61)], among older respondents (25-29 years) [adj. PRR = 1.83 (95% CI; 1.12, 2.99)] compared to younger ones (18-24 years) and among those conducting business [adj. PRR = 2.42(95% CI; 1.02, 5.74)] relative to those primarily in fishing. Just over a third (35.2%, 595/1688) reported use of at least one modern FP method. Use of modern FP methods was significantly higher among females [adj. PRR = 2.04 (95% CI; 1.56, 2.65, and among those reporting multiple sexual partnerships [adj. PRR = 2.12, 95% CI; 1.63, 2.76)]. Nonuse of modern methods was mostly due to desire for more children (30.6%), fear of side effects (12.2%) and partner refusal (5.2%). Despite their high knowledge of FP, FCs have low use of modern FP methods. Key barriers to use of modern FP methods were high fertility desires, fear of perceived side effects and partner refusal of methods.

  4. The Role of Thermogenesis in the Pollination Biology of the Amazon Waterlily Victoria amazonica

    Science.gov (United States)

    SEYMOUR, ROGER S.; MATTHEWS, PHILIP G. D.

    2006-01-01

    • Background and Aims Several families of tropical plants have thermogenic flowers that show a 2-d protogynous sequence. Most are pollinated by large beetles that remain for the entire period in the flowers, where they compete for mates and feed. Active beetles require high body temperatures that they can achieve endogenously at great energy expense or attain passively and cheaply in a warm environment. Floral heating is therefore hypothesized to be a direct energy reward to endothermic beetles, in addition to its accepted role in enhancing scent production. • Methods This study measures the pattern of floral heat production (as temperature in 20 flowers and respiration rates in five flowers) in Victoria amazonica at field sites in Guyana and correlates floral temperatures with body temperatures necessary for activity in visiting Cyclocephala hardyi beetles. • Key Results Thermogenesis occurred in a bimodal pattern, with peaks associated with the arrival and departure of beetles near sunset. Peak CO2 production rates averaged 2·9 µmol s−1, equivalent to a heat production of 1·4 W. Heat was generated mainly in the floral chamber on the first evening and by the stamen complex on the second. Mean chamber temperature remained between 29·3 and 34·7 °C during the first night, when ambient temperature was 23·5–25·2 °C. Beetles actively competed for mates and consumed stylar processes in the floral chamber, where their mean thoracic temperature was 33·2 °C. At the lower ambient temperatures outside of the flower, beetles capable of sustained flight had a similar mean temperature of 32·0 °C. • Conclusions Floral heating is not only associated with attraction, but continues throughout the night when beetles are active inside the flower and increases again when they leave. Floral chamber temperatures similar to activity temperatures of actively endothermic beetles imply that thermogenesis is an energy reward. PMID:17018568

  5. A problem-oriented approach to understanding adaptation: lessons learnt from Alpine Shire, Victoria Australia.

    Science.gov (United States)

    Roman, Carolina

    2010-05-01

    Climate change is gaining attention as a significant strategic issue for localities that rely on their business sectors for economic viability. For businesses in the tourism sector, considerable research effort has sought to characterise the vulnerability to the likely impacts of future climate change through scenarios or ‘end-point' approaches (Kelly & Adger, 2000). Whilst useful, there are few demonstrable case studies that complement such work with a ‘start-point' approach that seeks to explore contextual vulnerability (O'Brien et al., 2007). This broader approach is inclusive of climate change as a process operating within a biophysical system and allows recognition of the complex interactions that occur in the coupled human-environmental system. A problem-oriented and interdisciplinary approach was employed at Alpine Shire, in northeast Victoria Australia, to explore the concept of contextual vulnerability and adaptability to stressors that include, but are not limited to climatic change. Using a policy sciences approach, the objective was to identify factors that influence existing vulnerabilities and that might consequently act as barriers to effective adaptation for the Shire's business community involved in the tourism sector. Analyses of results suggest that many threats, including the effects climate change, compete for the resources, strategy and direction of local tourism management bodies. Further analysis of conditioning factors revealed that many complex and interacting factors define the vulnerability and adaptive capacity of the Shire's tourism sector to the challenges of global change, which collectively have more immediate implications for policy and planning than long-term future climate change scenarios. An approximation of the common interest, i.e. enhancing capacity in business acumen amongst tourism operators, would facilitate adaptability and sustainability through the enhancement of social capital in this business community. Kelly, P

  6. Presentations to general practice before a cancer diagnosis in Victoria: a cross-sectional survey.

    Science.gov (United States)

    Lacey, Karen; Bishop, James F; Cross, Hannah L; Chondros, Patty; Lyratzopoulos, Georgios; Emery, Jon D

    2016-07-18

    To assess variations in the number of general practitioner visits preceding a cancer diagnosis, and in the length of the interval between the patient first suspecting a problem and their seeing a hospital specialist. Analysis of data provided to the Cancer Patient Experience Survey (CPES; survey response rate, 37.7%) by 1552 patients with one of 19 cancer types and treated in one of five Victorian Comprehensive Cancer Centre hospitals, 1 October 2012 - 30 April 2013. The primary outcome was the proportion of patients who had had three or more GP consultations about cancer-related health problems before being referred to hospital. The secondary outcome was the interval between the patient first suspecting a problem and their seeing a hospital specialist. 34% of the patients included in the final analyses (426 of 1248) had visited a GP at least three times before referral to a hospital doctor. The odds ratios (reference: rectal cancer; adjusted for age, sex, language spoken at home, and socio-economic disadvantage index score) varied according to cancer type, being highest for pancreatic cancer (3.2; 95% CI, 1.02-9.9), thyroid cancer (2.5; 95% CI, 0.9-6.6), vulval cancer (2.5; 95% CI, 0.7-8.7) and multiple myeloma (2.4; 95% CI, 1.1-5.5), and lowest for patients with breast cancer (0.4; 95% CI, 0.2-0.8), cervical cancer (0.5; 95% CI, 0.1-2.1), endometrial cancer (0.5; 95% CI, 0.2-1.4) or melanoma (0.7; 95% CI, 0.3-1.5). Cancer type also affected the duration of the interval from symptom onset to seeing a hospital doctor; it took at least 3 months for more than one-third of patients with prostate or colon cancer to see a hospital doctor. Certain cancer types were more frequently associated with multiple GP visits, suggesting they are more challenging to recognise early. In Victoria, longer intervals from the first symptoms to seeing a hospital doctor for colon or prostate cancer may reflect poorer community symptom awareness, later GP referral, or limited access to

  7. Differences in the population structure of Neisseria meningitidis in two Australian states: Victoria and Western Australia.

    Directory of Open Access Journals (Sweden)

    Shakeel Mowlaboccus

    Full Text Available Neisseria meningitidis is the causative agent of invasive meningococcal disease (IMD. A recombinant vaccine called Bexsero® incorporates four subcapsular antigens (fHbp, NHBA, NadA and PorA which are used to assign a Bexsero® antigen sequence type (BAST to each meningococcal strain. The vaccine elicits an immune response against combinations of variants of these antigens which have been grouped into specific BAST profiles that have been shown to have different distributions within geographical locations thus potentially affecting the efficacy of the vaccine. In this study, invasive meningococcal disease isolates from the western seaboard of Australia (Western Australia; WA were compared to those from the south-eastern seaboard (Victoria; VIC from 2008 to 2012. Whole-genome sequencing (WGS of 131 meningococci from VIC and 70 meningococci from WA were analysed for MLST, FetA and BAST profiling. Serogroup B predominated in both jurisdictions and a total of 10 MLST clonal complexes (cc were shared by both states. Isolates belonging to cc22, cc103 and cc1157 were unique to VIC whilst isolates from cc60 and cc212 were unique to WA. Clonal complex 41/44 represented one-third of the meningococcal population in each state but the predominant ST was locally different: ST-6058 in VIC and ST-146 in WA. Of the 108 BAST profiles identified in this collection, only 9 BASTs were simultaneously observed in both states. A significantly larger proportion of isolates in VIC harboured alleles for the NHBA-2 peptide and fHbp-1, antigenic variants predicted to be covered by the Bexsero® vaccine. The estimate for vaccine coverage in WA (47.1% [95% CI: 41.1-53.1%] was significantly lower than that in VIC (66.4% [95% CI: 62.3-70.5%]. In conclusion, the antigenic structure of meningococci causing invasive disease in two geographically distinct states of Australia differed significantly during the study period which may affect vaccine effectiveness and highlights the

  8. Trends in incidence and survival for upper tract urothelial cancer (UTUC) in the state of Victoria--Australia.

    Science.gov (United States)

    Woodford, Richard; Ranasinghe, Weranja; Aw, Hau Choong; Sengupta, Shomik; Persad, Raj

    2016-04-01

    To investigate the incidence and mortality trends of upper tract urothelial cancers (UTUC) in Victoria over the last decade. Age-adjusted incidence and mortality rates were calculated for UTUC. These were identified using data from the Victorian Cancer Registry from 2001 until 2011 based on histological diagnoses. Age at diagnosis, sex and demographical location were compared. The age-standardised incidence of UTUC remained stable from 2001 to 2011. There were 278 deaths from UTUC over this period with an overall 5-year survival rate of 32%. There was no significant difference in survival between 2001-06 and 2007-11 (30% vs 36%, respectively). Lower age at diagnosis was associated with a significant improvement in survival (P = 0.01). Sex and geographical location appeared to have no effect on survival. The 5-year survival rates for UTUC in Victoria are poor, particularly in comparison to worldwide data. In contrast to worldwide trends, the incidence of UTUC appears to be stable. No significant improvement in 5-year survival rates over the short study period was identified. These findings highlight the difficulties in managing this rare yet deadly malignancy. © 2015 The Authors BJU International © 2015 BJU International Published by John Wiley & Sons Ltd.

  9. Verification of an alternative sludge treatment process for pathogen reduction at two wastewater treatment plants in Victoria, Australia.

    Science.gov (United States)

    Irwin, R; Surapaneni, A; Smith, D; Schmidt, J; Rigby, H; Smith, S R

    2017-08-01

    At South East Water wastewater treatment plants (WwTPs) in Victoria, Australia, biosolids are stockpiled for three years in compliance with the State guidelines to achieve the highest pathogen reduction grade (T1), suitable for unrestricted use in agriculture and landscaping. However, extended stockpiling is costly, may increase odour nuisance and greenhouse gas emissions, and reduces the fertiliser value of the biosolids. A verification programme of sampling and analysis for enteric pathogens was conducted at two WwTPs where sludge is treated by aerobic and anaerobic digestion, air drying (in drying pans or solar drying sheds) and stockpiling, to enumerate and, if present, monitor the decay of a range of enteric pathogens and parasites. The sludge treatment processes at both WwTPs achieved T1 grade biosolids with respect to prescribed pathogenic bacterial numbers (3 log 10 enteric virus reduction after a storage period of one year. No Ascaris eggs were detected in the influent to the WwTPs, confirming previous studies that the presence of helminth infections in Victoria is extremely low and that Ascaris is not applicable as a control criterion for the microbiological quality of biosolids in the region.

  10. Investigation of weldments in Victoria-class submarine pressure-hull using magnetic flux leakage and Barkhausen noise

    Science.gov (United States)

    Samimi, A. A.; Babbar, V.; Krause, T. W.; Clapham, L.

    2014-02-01

    Evaluation of the stress state within submarine hulls can contribute to risk assessments, which provide assurance that in-service induced stresses will not adversely affect the service life of the naval structure. The purpose of this study was to evaluate the feasibility of using magnetic NDE techniques for identification of stresses associated with weldments in two original pressure hulls of Canada's Victoria class submarines. Magnetic Flux Leakage (MFL) and flux-controlled Barkhausen Noise measurements were investigated for identification of patch boundaries and welds in two sections of Victoria-class submarine-hull steel. While MFL showed clear demarcation of weld boundaries, Barkhausen measurements did not provide sufficiently clear response to identify these features in submarine hull samples. For a better understanding of Barkhausen response, uniaxial tensile stress was investigated on separate samples of submarine steel. A nonlinear dependence of Barkhausen response was observed, with a weaker sensitivity to tensile stresses below 200 MPa. This behavior, combined with the presence of substantial surface compressive stresses, was used to explain the observed insensitivity of Barkhausen measurements to the presence of welds.

  11. Pesticide residues in Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) from Southern Lake Victoria, Tanzania

    Energy Technology Data Exchange (ETDEWEB)

    Henry, L. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania); Kishimba, M.A. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania)]. E-mail: kishimba@chem.udsm.ac.tz

    2006-03-15

    Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers ({alpha} and {beta}) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels.

  12. Desired Chinese medicine practitioner capabilities and professional development needs: a survey of registered practitioners in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Radloff Alex

    2008-01-01

    Full Text Available Abstract Background The State of Victoria in Australia introduced Chinese medicine practitioner registration in 2000 and issued its education guidelines in late 2002 for introduction in 2005. This study obtained practitioners' views on desired capabilities for competent Chinese medicine practice and to identify professional development needs. Methods A questionnaire, consisting of 28 predefined capabilities in four categories with a rating scale of importance from one to five, was developed and sent to all registered Chinese medicine practitioners in the State of Victoria, Australia in October, 2005. Results Two hundreds and twenty eight completed questionnaires were returned which represented a response rate of 32.5%. Of the four categories of capabilities, technical capabilities were considered to be the most important for clinical practice. Specifically, the ability to perform acupuncture treatment and/or dispense an herbal prescription was ranked the highest. In contrast, research and information management capabilities were considered the least important. The educational background of practitioners appeared to be an important factor influencing their rating of capabilities. Significantly, nearly double the number of practitioners with Australian qualifications than practitioners trained overseas valued communication as an important capability. For continuing professional education, clinical skills courses were considered as a priority while research degree studies were not. Conclusion Registered Chinese medicine practitioners viewed skills training as important but did not support the need for research and information management training. This represents a significant hurdle to developing Chinese medicine as a form of evidence-based healthcare.

  13. Readiness of communities to engage with childhood obesity prevention initiatives in disadvantaged areas of Victoria, Australia.

    Science.gov (United States)

    Cyril, Sheila; Polonsky, Michael; Green, Julie; Agho, Kingsley; Renzaho, Andre

    2017-07-01

    Objective Disadvantaged communities bear a disproportionate burden of childhood obesity and show low participation in childhood obesity prevention initiatives. This study aims to examine the level of readiness of disadvantaged communities to engage with childhood obesity prevention initiatives. Methods Using the community readiness model, 95 semi-structured interviews were conducted among communities in four disadvantaged areas of Victoria, Australia. Community readiness analysis and paired t-tests were performed to assess the readiness levels of disadvantaged communities to engage with childhood obesity prevention initiatives. Results The results showed that disadvantaged communities demonstrated low levels of readiness (readiness score=4/9, 44%) to engage with the existing childhood obesity prevention initiatives, lacked knowledge of childhood obesity and its prevention, and reported facing challenges in initiating and sustaining participation in obesity prevention initiatives. Conclusion This study highlights the need to improve community readiness by addressing low obesity-related literacy levels among disadvantaged communities and by facilitating the capacity-building of bicultural workers to deliver obesity prevention messages to these communities. Integrating these needs into existing Australian health policy and practice is of paramount importance for reducing obesity-related disparities currently prevailing in Australia. What is known about the topic? Childhood obesity prevalence is plateauing in developed countries including Australia; however, obesity-related inequalities continue to exist in Australia especially among communities living in disadvantaged areas, which experience poor engagement in childhood obesity prevention initiatives. Studies in the USA have found that assessing disadvantaged communities' readiness to participate in health programs is a critical initial step in reducing the disproportionate obesity burden among these communities

  14. A very high infection intensity of Schistosoma mansoni in a Ugandan Lake Victoria fishing community is required for association with highly prevalent organ related morbidity

    DEFF Research Database (Denmark)

    Tukahebwa, Edridah M.; Magnussen, Pascal; Madsen, Henry

    2013-01-01

    In schistosomiasis control programmes using mass chemotherapy, epidemiological and morbidity aspects of the disease need to be studied so as to monitor the impact of treatment, and make recommendations accordingly. These aspects were examined in the community of Musoli village along Lake Victoria...

  15. Balancing the people, profit and planet dimensions in international marketing channels : a study on coordinating mechanisms in the Nile perch channel from Lake Victoria

    NARCIS (Netherlands)

    Kambewa, E.

    2007-01-01

    Keywords: people, profit, planet, marketing channels, contracts, sustainability, quality,LakeVictoria, conjointanalysis

  16. Reassessing the Effects of Early Adolescent Alcohol Use on Later Antisocial Behavior: A Longitudinal Study of Students in Victoria, Australia, and Washington State, United States

    Science.gov (United States)

    Hemphill, Sheryl A.; Heerde, Jessica A.; Scholes-Balog, Kirsty E.; Smith, Rachel; Herrenkohl, Todd I.; Toumbourou, John W.; Catalano, Richard F.

    2014-01-01

    The effect of early adolescent alcohol use on antisocial behavior was examined at 1- and 2-year follow-up in Washington State, United States, and Victoria, Australia. Each state used the same methods to survey statewide representative samples of students ("N" = 1,858, 52% female) in 2002 (Grade 7 [G7]), 2003 (Grade 8 [G8]), and 2004…

  17. Effects of Early Adolescent Alcohol Use on Mid-Adolescent School Performance and Connection: A Longitudinal Study of Students in Victoria, Australia and Washington State, United States

    Science.gov (United States)

    Hemphill, Sheryl A.; Heerde, Jessica A.; Scholes-Balog, Kirsty E.; Herrenkohl, Todd I.; Toumbourou, John W.; Catalano, Richard F., Jr.

    2014-01-01

    Background: This article examines the effect of early adolescent alcohol use on mid-adolescent school suspension, truancy, commitment, and academic failure in Washington State, United States, and Victoria, Australia. Also of interest was whether associations remain after statistically controlling for other factors known to predict school outcomes.…

  18. Triumphs Show: What Makes Art History? Year 7 Exploit the Resources of the Victoria and Albert Museum's Medieval Gallery to Create and Curate Their Own Answer

    Science.gov (United States)

    Copsey, Sarah

    2014-01-01

    What do 14 Year 7 students, an art teacher, a history teacher and the Victoria and Albert Museum have in common? They are all part of the "Stronger Together" Museum Champion project run by The Langley Academy and the River & Rowing Museum and supported by Arts Council England, designed to engage students, teachers and museum staff…

  19. Comparison of photodegradative efficiencies and mechanisms of Victoria Blue R assisted by Nafion-coated and fluorinated TiO{sub 2} photocatalysts

    Energy Technology Data Exchange (ETDEWEB)

    Chen, K.T. [Department of General Education, Ming Hsing University of Science and Technology, 304, Taiwan (China); Lu, C.S. [Department of General Education, National Taichung Nursing College, Taichung 403, Taiwan (China); Chang, T.H. [Department of General Education, Ming Hsing University of Science and Technology, 304, Taiwan (China); Lai, Y.Y. [Department of Applied Chemistry, Chung-Shan Medical University, Taichung 402, Taiwan (China); Chang, T.H. [Department of Electronic Engineering, Ming Hsing University of Science and Technology, 304, Taiwan (China); Wu, C.W. [Department of Applied Chemistry, Chung-Shan Medical University, Taichung 402, Taiwan (China); Chen, C.C., E-mail: ccchen@ms3.ntcu.edu.tw [Department of Science Application and Dissemination, National Taichung University, Taichung 403, Taiwan (China)

    2010-02-15

    The purposes of this research were to study the effects of two modified photocatalysts, Nafion-coated TiO{sub 2} and fluorinated TiO{sub 2}, and photocatalytic degradation of Victoria Blue R in aqueous solution. Photocatalytic degradation of Victoria Blue R was accelerated by the modified photocatalysts. Bulk and surface characterizations of the resulting powders were carried out. Attachment of the anions to the TiO{sub 2} surface using the Nafion-coated-TiO{sub 2} possibly results in increased adsorption of the cationic dye, and the degradation rate is larger for the cationic dye. It was found that Victoria Blue R on the two illuminated TiO{sub 2} surfaces underwent very different changes. To obtain a better understanding on the mechanistic details of this modified-TiO{sub 2}-assisted photodegradation of the Victoria Blue R dye with UV irradiation, a large number of intermediates of the process were separated, identified, and characterized by a high-performance liquid chromatography-mass spectrometry technique. Several probable photodegradation pathways were proposed and discussed.

  20. Effect of gap size on seedling establishment, growth and survival at three years in mountain ash (Eucalyptus regnans F. Muell.) forest in Victoria, Australia

    NARCIS (Netherlands)

    Meer, van der P.J.; Dignan, P.; Saveneh, A.G.

    1999-01-01

    Establishment, growth and survival of Eucalyptus regnans F. Muell. seedlings was studied at two sites over three years under a range of small gaps (up to 30mx30m) and large gaps (50mx50m up to clearfells) in a gap cutting experiment in mountain ash forest at Tanjil Bren, Victoria, Australia. In both

  1. High seroprevalance of Neospora caninum in dogs in Victoria, Australia, compared to 20 years ago

    Directory of Open Access Journals (Sweden)

    Sarah Sloan

    2017-10-01

    Full Text Available Abstract Background Canids are definitive hosts of the apicomplexan parasite Neospora caninum, the leading cause of abortion in cattle worldwide. For horizontal transmission from canids to occur, oocysts of N. caninum must be shed by the definitive host into the environment of susceptible intermediate hosts such as cattle. The purpose of this study was to determine the prevalence of N. caninum in canids in Victoria, Australia’s leading dairy producing state. Results Neospora-like oocysts were observed in 8% (18/234 of faecal samples from wild dogs, domestic dogs and red foxes from Victoria, Australia. However, none tested positive for N. caninum DNA using a quantitative PCR. In a separate sample population, blood sera from 483 domestic dogs were tested for anti-N. caninum antibodies using competitive ELISA. A subset of cELISA samples were re-tested using indirect fluorescence antibody test (IFAT. A seroprevalence of 29.8% (144/483; 95% CI: 11.7–47.8% was calculated when using cELISA; whereas it was 32.9% (27/80; 95% CI: 15.8–51.8% using IFAT. Potential risk factors were evaluated using univariable analyses and then assessed in separate multivariable models. Using ‘aged’ dogs as a reference, the seroprevalence of ‘adolescent’ and ‘adult’ dogs was 88% (P = 0.05 and 91% (P = 0.08, respectively, indicating seroprevalence increases with age. There was a 19% higher likelihood of infection in rural locations (P = 0.10 relative to urban areas. Jack Russell Terriers had a 22% higher risk of a cELISA-positive result (P = 0.05 regardless of geographical location, age or sex. Conclusion These results demonstrate that exposure to N. caninum in domestic dogs is widespread in Victoria, although faecal oocyst shedding is infrequent. Our results indicate increased N. caninum seroprevalance status in dogs over the past two decades. The results imply that dogs get either exposed to the infected meat more frequently or that vertical dam to

  2. Breaking down barriers to eye care for Indigenous people: a new scheme for delivery of eye care in Victoria.

    Science.gov (United States)

    Napper, Genevieve; Fricke, Tim; Anjou, Mitchell D; Jackson, A Jonathan

    2015-09-01

    This report describes the implementation of and outcomes from a new spectacle subsidy scheme and de-centralised care options for Aboriginal and Torres Strait Islander peoples in Victoria, Australia. The Victorian Aboriginal Spectacle Subsidy Scheme (VASSS) commenced in 2010, as an additional subsidy to the long-established Victorian Eyecare Service (VES). The Victorian Aboriginal Spectacle Subsidy Scheme aimed to improve access to and uptake of affordable spectacles and eye examinations by Indigenous Victorians. The scheme is overseen by a committee convened by the Victorian Government's Department of Health and Human Services and includes eye-health stakeholders from the Aboriginal community and government, not-for-profit, university and Aboriginal communities. Key features of the Victorian Aboriginal Spectacle Subsidy Scheme include reduced and certain patient co-payments of $10, expanded spectacle frame range, broadened eligibility and community participation in service design and implementation. We describe the services implemented by the Australian College of Optometry (ACO) in Victoria and their impact on access to eye-care services. In 2014, optometric services were available at 36 service sites across Victoria, including 21 Aboriginal Health Services (AHS) sites. Patient services have increased from 400 services per year in 2009, to 1,800 services provided in 2014. During the first three years of the Victorian Aboriginal Spectacle Subsidy Scheme program (2010 to 2013), 4,200 pairs of glasses (1,400 pairs per year) were provided. Further funding to 2016/17 will lift the number of glasses to be delivered to 6,600 pairs (1,650 per year). This compares to population projected needs of 2,400 pairs per year. Overcoming the barriers to using eye-care services by Indigenous people can be difficult and resource intensive; however the Victorian Aboriginal Spectacle Subsidy Scheme provides an example of positive outcomes achieved through carefully designed and

  3. Exploring the 'follow-through experience': a statewide survey of midwifery students and academics conducted in Victoria, Australia.

    Science.gov (United States)

    McLachlan, Helen L; Newton, Michelle; Nightingale, Helen; Morrow, Jane; Kruger, Gina

    2013-09-01

    Follow-through experiences (which enable midwifery students to experience continuity of care with individual women through pregnancy, labour and birth and the postnatal period) are a component of midwifery education programmes in Australia and the United Kingdom. Current accreditation standards in Australia require midwifery students to have a total of 20 continuity of care experiences with an average of 20 hours per woman over the duration of their course. There has been limited research regarding students' and academics' experiences of follow-through experiences; and there has been debate regarding the appropriate number of follow-through experiences in midwifery curricula. This study aimed to explore the follow-through experience from the perspective of midwifery students and academics in Victoria, Australia. cross-sectional design using a web-based survey. Victoria, Australia. Students (n=401) and academics (n=35) from all seven universities in Victoria that offer accredited midwifery programmes including the Bachelor of Midwifery, Bachelor of Nursing/Bachelor of Midwifery double degree, Postgraduate Diploma of Midwifery and Masters of Midwifery (entry to practice). Students and academics were in agreement that continuity of care is important to women. They considered the follow-through experience to be a unique and valuable learning opportunity and agreed that follow-through experiences should be included in midwifery education programmes. However, students and academics raised major concerns about the impact of follow-through experiences on students' capacity to meet university course requirements (such as missing lectures/tutorials and clinical placements), and spending extensive periods of time on-call both within and outside the university semester. Students and academics also reported concerns about the impact of follow-through experiences on students' personal lives, including paid employment and family responsibilities (such as childcare or caring for

  4. Chronology for the Cueva Victoria fossil site (SE Spain): Evidence for Early Pleistocene Afro-Iberian dispersals.

    Science.gov (United States)

    Gibert, Luis; Scott, Gary R; Scholz, Denis; Budsky, Alexander; Ferràndez, Carles; Ribot, Francesc; Martin, Robert A; Lería, María

    2016-01-01

    Cueva Victoria has provided remains of more than 90 species of fossil vertebrates, including a hominin phalanx, and the only specimens of the African cercopithecid Theropithecus oswaldi in Europe. To constrain the age of the vertebrate remains we used paleomagnetism, vertebrate biostratigraphy and (230)Th/U dating. Normal polarity was identified in the non-fossiliferous lowest and highest stratigraphic units (red clay and capping flowstones) while reverse polarity was found in the intermediate stratigraphic unit (fossiliferous breccia). A lower polarity change occurred during the deposition of the decalcification clay, when the cave was closed and karstification was active. A second polarity change occurred during the capping flowstone formation, when the upper galleries were filled with breccia. The mammal association indicates a post-Jaramillo age, which allows us to correlate this upper reversal with the Brunhes-Matuyama boundary (0.78 Ma). Consequently, the lower reversal (N-R) is interpreted as the end of the Jaramillo magnetochron (0.99 Ma). These ages bracket the age of the fossiliferous breccia between 0.99 and 0.78 Ma, suggesting that the capping flowstone was formed during the wet Marine Isotopic Stage 19, which includes the Brunhes-Matuyama boundary. Fossil remains of Theropithecus have been only found in situ ∼1 m below the B/M boundary, which allows us to place the arrival of Theropithecus to Cueva Victoria at ∼0.9-0.85 Ma. The fauna of Cueva Victoria lived during a period of important climatic change, known as the Early-Middle Pleistocene Climatic Transition. The occurrence of the oldest European Acheulean tools at the contemporaneous nearby site of Cueva Negra suggest an African dispersal into SE Iberia through the Strait of Gibraltar during MIS 22, when sea-level was ∼100 m below its present position, allowing the passage into Europe of, at least, Theropithecus and Homo bearing Acheulean technology. Copyright © 2015 Elsevier Ltd. All

  5. Morfologia da flor, fruto e plântula de Victoria amazonica (Poepp.) J.C. Sowerby (Nymphaeaceae)

    OpenAIRE

    Rosa-Osman,Sônia Maciel da; Rodrigues,Robson; Mendonça,Maria Sílvia de; Souza,Luiz Antonio de; Piedade,Maria Teresa Fernandez

    2011-01-01

    Victoria amazonica (Poepp.) J.C. Sowerby é uma hidrófita que ocorre nas várzeas de águas brancas e igapós da Bacia Amazônica e na Bacia do rio Paraguai. A morfologia da flor, fruto e plântula/"tirodendro" é objeto do presente trabalho. O material botânico foi coletado em Parintins e Manaus, estado do Amazonas, Brasil. A análise morfológica foi feita em material fresco e fixado em FAA 50. O desenvolvimento das plântulas foi realizado no escuro em frascos com água com teor reduzido de oxigênio....

  6. In vitro antiplasmodial activity and toxicity assessment of plant extracts used in traditional malaria therapy in the Lake Victoria Region

    Directory of Open Access Journals (Sweden)

    Teresa Akeng'a Ayuko

    2009-08-01

    Full Text Available As part of our program screening the flora of the Lake Victoria Region, a total of 54 organic extracts from seven plant families (8 species were individually tested for antiplasmodial activity against chloroquine-sensitive [Sierra Leone (D-6] and chloroquine-resistant [Vietnam (W-2] strains. Only 22% of these extracts exhibited very high in vitro antiplasmodial activity. Six methanol (MeOH extracts and one chloroform extract showed in vitro antiplasmodial activity against the D-6 Plasmodium falciparum strain, while only three MeOH extracts were active against the W-2 strain. All of the ethyl acetate extracts proved to be inactive against both strains of P. falciparum. A brine shrimp cytotoxicity assay was used to predict the potential toxicity of the extracts. The cytotoxicity to antiplasmodial ratios for the MeOH extracts were found to be greater than 100, which could indicate that the extracts are of low toxicity.

  7. Peer Group Patterns of Alcohol-Using Behaviors Among Early Adolescents in Victoria, Australia, and Washington State, United States.

    Science.gov (United States)

    Leung, Rachel K; Toumbourou, John W; Hemphill, Sheryl A; Catalano, Richard F

    2016-12-01

    The goal of this study was to examine and cross-nationally compare the peer group patterns of alcohol-drinking behaviors among cohorts of early adolescents (ages 11-14 years) in Victoria, Australia, and Washington State, United States. Latent transition analysis revealed that after 1 year, transitions congruent with peer influence (whereby non-drinking adolescents initiated alcohol use in the presence of drinking peers) and reverse peer influence were observed in both states; however, transitions congruent with peer selection (whereby drinking adolescents self-selected into drinking peer groups) were only observed among Victorian early adolescents. Findings were interpreted to suggest that Australian family and cultural norms that more commonly allow early adolescent alcohol use lead to a higher rate of peer selection. © 2015 The Authors. Journal of Research on Adolescence © 2015 Society for Research on Adolescence.

  8. The consequences of land use change on nutrient exports: a regional scale assessment in south-west Victoria, Australia.

    Science.gov (United States)

    Ierodiaconou, Daniel; Laurenson, Laurie; Leblanc, Marc; Stagnitti, Frank; Duff, Gordon; Salzman, Scott; Versace, Vincent

    2005-03-01

    Estimation of nutrient load production based on multi-temporal remotely sensed land use data for the Glenelg-Hopkins region in south-west Victoria, Australia, is discussed. Changes in land use were mapped using archived Landsat data and computerised classification techniques. Land use change has been rapid in recent history with 16% of the region transformed in the last 22 years. Total nitrogen and phosphorus loads were estimated using an export coefficient model. The analysis demonstrates an increase in modelled nitrogen and phosphorus loadings from 1980 to 2002. Whilst such increases were suspected from past anecdotal and ad-hoc evidence, our modelling estimated the magnitude of such increases and thus demonstrated the enormous potential of using remote sensing and GIS for monitoring regional scale environmental processes.

  9. Late Pleistocene-Holocene volcanic activity in northern Victoria Land recorded in Ross Sea (Antarctica) marine sediments

    Science.gov (United States)

    Del Carlo, P.; Di Roberto, A.; Di Vincenzo, G.; Bertagnini, A.; Landi, P.; Pompilio, M.; Colizza, E.; Giordano, G.

    2015-05-01

    Eight pyroclastic fall deposits have been identified in cores of Late Pleistocene-Holocene marine sediments from the Ross Sea (Antarctica), and their components, granulometry and clast morphologies were analysed. Sedimentological, petrographic and geochemical analysis of clasts, with 40Ar-39Ar dating of alkali feldspar grains, indicate that during this period at least five explosive eruptions of mid to high intensity (plinian to subplinian) occurred, and that three of these eruptions took place from Mount Melbourne volcanic complex, between 137.1 ± 3.4 and 12 ka. Geochemical comparison of the studied tephra with micro- and crypto-tephra recovered from deep Antarctic ice cores and from nearby englacial tephra at Frontier Mountain indicates that eruptive activity in the Melbourne Volcanic Province of northern Victoria Land was intense during the Late Pleistocene-Holocene, but only a general area of provenance for the majority of the identified tephra can be identified.

  10. Las redes sociales y migratorias, un acercamiento al fenómeno migratorio de Perote, Veracruz y Guadalupe Victoria, Puebla.

    OpenAIRE

    López Toxqui, María Guadalupe

    2010-01-01

    La migración de mexicanos hacia los Estados Unidos se incrementó en los años 2000 a 2006 en 37.29%, favoreciendo las remesas que para el 2008 fueron de 23,978.99 millones de dólares, el estado con mayor monto fue Michoacán con 2,263.55 millones de dólares y Veracruz recibió 1,473.9. El objetivo fue caracterizar la migración de los municipios de Perote Veracruz y Guadalupe Victoria, Puebla. El enfoque metodológico fueron las redes sociales. Los resultados muestran que los migrantes tenían una...

  11. Maternal region of birth and stillbirth in Victoria, Australia 2000-2011: A retrospective cohort study of Victorian perinatal data.

    Directory of Open Access Journals (Sweden)

    Miranda L Davies-Tuck

    Full Text Available There is growing evidence from high-income countries that maternal country of birth is a risk factor for stillbirth. We aimed to examine the association between maternal region of birth and stillbirth between 2000 and 2011 inclusive in Victoria, Australia.Retrospective population based cohort study of all singleton births at 24 or more weeks gestational age from 2000-2011 in Victoria, Australia. Stillbirths due to termination of pregnancy, babies with congenital anomalies and Indigenous mothers were excluded. Main Outcome Measure: Stillbirth.Over the 12-year period there were 685,869 singleton births and 2299 stillbirths, giving an overall stillbirth rate of 3·4 per 1000 births. After adjustment for risk factors, compared to women born in Australia/New Zealand, women born in South Asia (aOR 1.27, 95% CI 1.01-1.53, p = 0.01, were more likely to have a stillbirth whereas women born in South East and East Asia were (aOR 0.60, (95% CI 0.49-0.72, p<0.001 less likely to have a stillbirth. Additionally, the increasing rate of stillbirth as gestation length progressed began to rise earlier and more steeply in the South Asian compared to Australian/New Zealand born women. The following risk factors were also significantly associated with an increased odds of stillbirth in multivariate analyses: maternal age <20 and 35 years and more, nulliparity, low socio-economic status, previous stillbirth, no ultrasound reported in 1st trimester, pre-existing hypertension, antepartum haemorrhage and failure to detect growth restriction antenatally.Maternal region of birth is an independent risk factor for stillbirth. Improvements in the rate of stillbirth, particularly late pregnancy stillbirth, are likely to be gained in high-income settings where clinical care is informed by maternal region of birth.

  12. Linking land use changes to surface water quality variability in Lake Victoria: some insights from remote sensing

    Science.gov (United States)

    Mugo, R. M.; Limaye, A. S.; Nyaga, J. W.; Farah, H.; Wahome, A.; Flores, A.

    2016-12-01

    The water quality of inland lakes is largely influenced by land use and land cover changes within the lake's catchment. In Africa, some of the major land use changes are driven by a number of factors, which include urbanization, intensification of agricultural practices, unsustainable farm management practices, deforestation, land fragmentation and degradation. Often, the impacts of these factors are observable on changes in the land cover, and eventually in the hydrological systems. When the natural vegetation cover is reduced or changed, the surface water flow patterns, water and nutrient retention capacities are also changed. This can lead to high nutrient inputs into lakes, leading to eutrophication, siltation and infestation of floating aquatic vegetation. To assess the relationship between land use and land cover changes in part of the Lake Victoria Basin, a series of land cover maps were derived from Landsat imagery. Changes in land cover were identified through change maps and statistics. Further, the surface water chlorophyll-a concentration and turbidity were derived from MODIS-Aqua data for Lake Victoria. Chlrophyll-a and turbidity are good proxy indicators of nutrient inputs and siltation respectively. The trends in chlorophyll-a and turbidity concentrations were analyzed and compared to the land cover changes over time. Certain land cover changes related to agriculture and urban development were clearly identifiable. While these changes might not be solely responsible for variability in chlrophyll-a and turbidity concentrations in the lake, they are potentially contributing factors to this problem. This work illustrates the importance of addressing watershed degradation while seeking to solve water quality related problems.

  13. Attitudes, Knowledge and Factors Associated with Human Papillomavirus (HPV) Vaccine Uptake in Adolescent Girls and Young Women in Victoria, Australia.

    Science.gov (United States)

    Tung, Iris L Y; Machalek, Dorothy A; Garland, Suzanne M

    2016-01-01

    Human papillomavirus (HPV) vaccination targets high-risk HPV16/18 that cause 70% of all cancers of the cervix. In Australia there is a fully-funded, school-based National HPV Vaccination Program which has achieved vaccine initiation rate of 82% among age-eligible females. Improving HPV vaccination rates is important in the prevention of morbidity and mortality associated with HPV-related disease. This study aimed to identify factors and barriers associated with uptake of the HPV vaccine in the Australian Program. Between 2011 and 2014, females aged 18-25 years, living in Victoria, Australia who were offered HPV vaccination between 2007 and 2009 as part of the National HPV Vaccination Program, living in Victoria, Australia were recruited into a a young women's study examining effectiveness of the Australian National HPV Vaccination Program. Overall, 668 participants completed the recruitment survey, which collected data of participants' demographics and HPV knowledge. In 2015 these participants were invited to complete an additional supplementary survey on parental demographics and attitudes towards vaccinations. In 2015, 417 participants completed the supplementary survey (62% response rate). Overall, 19% of participants were unvaccinated. In multivariate analyses, HPV vaccination was significantly associated with their being born in Australia (pAttitudes towards general health, vaccinations in general, as well as HPV vaccines are important in HPV vaccine uptake. Long-term monitoring of the knowledge, attitude and beliefs towards HPV vaccination in the community is critical to ensure a continued high uptake of the vaccine and success of the program.

  14. Regions With Low Rates of Bystander Cardiopulmonary Resuscitation (CPR) Have Lower Rates of CPR Training in Victoria, Australia.

    Science.gov (United States)

    Bray, Janet E; Straney, Lahn; Smith, Karen; Cartledge, Susie; Case, Rosalind; Bernard, Stephen; Finn, Judith

    2017-06-05

    Bystander cardiopulmonary resuscitation (CPR) more than doubles the chance of surviving an out-of-hospital cardiac arrest. Recent data have shown considerable regional variation in bystander CPR rates across the Australian state of Victoria. This study aims to determine whether there is associated regional variation in rates of CPR training and willingness to perform CPR in these communities. We categorized each Victorian postcode as either a low or high bystander CPR region using data on adult, bystander-witnessed, out-of-hospital cardiac arrests of presumed cardiac etiology (n=7175) from the Victorian Ambulance Cardiac Arrest Registry. We then surveyed adult Victorians (n=404) and compared CPR training data of the respondents from low and high bystander CPR regions. Of the 404 adults surveyed, 223 (55%) resided in regions with low bystander CPR. Compared with respondents from high bystander CPR regions, respondents residing in regions with low bystander CPR had lower rates of CPR training (62% versus 75%, P=0.009) and lower self-ratings for their overall knowledge of CPR (76% versus 84%, P=0.04). There were no differences between the regions in their reasons for not having undergone CPR training or in their willingness to perform CPR. Rates of survival for bystander-witnessed, out-of-hospital cardiac arrests were significantly lower in low bystander CPR regions (15.7% versus 17.0%, PCPR training and lower survival in regions with lower rates of bystander CPR in Victoria, Australia. Targeting these regions with CPR training programs may improve bystander CPR rates and out-of-hospital cardiac arrest outcomes. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley.

  15. Composition and Genetic Diversity of Mosquitoes (Diptera: Culicidae) on Islands and Mainland Shores of Kenya's Lakes Victoria and Baringo.

    Science.gov (United States)

    Ajamma, Yvonne Ukamaka; Villinger, Jandouwe; Omondi, David; Salifu, Daisy; Onchuru, Thomas Ogao; Njoroge, Laban; Muigai, Anne W T; Masiga, Daniel K

    2016-11-01

    The Lake Baringo and Lake Victoria regions of Kenya are associated with high seroprevalence of mosquito-transmitted arboviruses. However, molecular identification of potential mosquito vector species, including morphologically identified ones, remains scarce. To estimate the diversity, abundance, and distribution of mosquito vectors on the mainland shores and adjacent inhabited islands in these regions, we collected and morphologically identified adult and immature mosquitoes and obtained the corresponding sequence variation at cytochrome c oxidase 1 (COI) and internal transcribed spacer region 2 (ITS2) gene regions. A total of 63 species (including five subspecies) were collected from both study areas, 47 of which have previously been implicated as disease vectors. Fourteen species were found only on island sites, which are rarely included in mosquito diversity surveys. We collected more mosquitoes, yet with lower species composition, at Lake Baringo (40,229 mosquitoes, 32 species) than at Lake Victoria (22,393 mosquitoes, 54 species). Phylogenetic analysis of COI gene sequences revealed Culex perexiguus and Cx tenagius that could not be distinguished morphologically. Most Culex species clustered into a heterogeneous clade with closely related sequences, while Culex pipiens clustered into two distinct COI and ITS2 clades. These data suggest limitations in current morphological identification keys. This is the first DNA barcode report of Kenyan mosquitoes. To improve mosquito species identification, morphological identifications should be supported by their molecular data, while diversity surveys should target both adults and immatures. The diversity of native mosquito disease vectors identified in this study impacts disease transmission risks to humans and livestock. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America.

  16. Exploring midwifery students' views and experiences of caseload midwifery: A cross-sectional survey conducted in Victoria, Australia.

    Science.gov (United States)

    Dawson, Kate; Newton, Michelle; Forster, Della; McLachlan, Helen

    2015-02-01

    in Australia, models of maternity care that offer women continuity of care with a known midwife have been promoted. Little is known about the intentions of the future midwifery workforce to work in such models. This study aimed to explore midwifery students' views and experiences of caseload midwifery and their work intentions in relation to the caseload model following graduation. cross-sectional survey. Victoria, Australia. 129 midwifery students representing all midwifery course pathways (Post Graduate Diploma, Bachelor of Midwifery, Bachelor of Nursing/Bachelor of Midwifery) in Victoria. midwifery students from all course pathways considered that continuity of care is important to women and indicated that exposure to continuity models during their course was very positive. Two-thirds of the students (67%) considered that the continuity experiences made them want to work in a caseload model; only 5% reported that their experiences had discouraged them from continuity of care work in the future. Most wanted a period of consolidation to gain experience as a midwife prior to commencing in the caseload model. Perceived barriers to caseload work were being on-call, and challenges in regard to work/life balance and family commitments. midwifery students in this study were very positive about caseload midwifery and most would consider working in caseload after a period of consolidation. Continuity of care experiences during students' midwifery education programmes appeared to provide students with insight and understanding of continuity of care for both women and midwives. Further research should explore what factors influence students' future midwifery work, whether or not their plans are fulfilled, and whether or not the caseload midwifery workforce can be sustained. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Surface faults in the gulf coastal plain between Victoria and Beaumont, Texas

    Science.gov (United States)

    Verbeek, Earl R.

    1979-01-01

    Displacement of the land surface by faulting is widespread in the Houston-Galveston region, an area which has undergone moderate to severe land subsidence associated with fluid withdrawal (principally water, and to a lesser extent, oil and gas). A causative link between subsidence and fluid extraction has been convincingly reported in the published literature. However, the degree to which fluid withdrawal affects fault movement in the Texas Gulf Coast, and the mechanism(s) by which this occurs are as yet unclear. Faults that offset the ground surface are not confined to the large (>6000-km2) subsidence “bowl” centered on Houston, but rather are common and characteristic features of Gulf Coast geology. Current observations and conclusions concerning surface faults mapped in a 35,000-km2 area between Victoria and Beaumont, Texas (which area includes the Houston subsidence bowl) may be summarized as follows: (1) Hundreds of faults cutting the Pleistocene and Holocene sediments exposed in the coastal plain have been mapped. Many faults lie well outside the Houston-Galveston region; of these, more than 10% are active, as shown by such features as displaced, fractured, and patched road surfaces, structural failure of buildings astride faults, and deformed railroad tracks. (2) Complex patterns of surface faults are common above salt domes. Both radial patterns (for example, in High Island, Blue Ridge, Clam Lake, and Clinton domes) and crestal grabens (for example, in the South Houston and Friendswood-Webster domes) have been recognized. Elongate grabens connecting several known and suspected salt domes, such as the fault zone connecting Mykawa, Friendswood-Webster, and Clear Lake domes, suggest fault development above rising salt ridges. (3) Surface faults associated with salt domes tend to be short (10 km), occur singly or in simple grabens, have gently sinuous traces, and tend to lie roughly parallel to the ENE-NE “coastwise” trend common to regional growth

  18. AcEST: DK961333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q1PDC9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|Q6UY68|VP35_MABVO Polymerase cofactor VP35 OS=Lake Vict...oria m... 32 3.9 sp|P35259|VP35_MABVM Polymerase cofactor VP35 OS=Lake Victoria m...... 32 3.9 sp|Q1PD52|VP35_MABVA Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|O54898|CAC1G_RAT Volt...dependent T-type calcium channel s... 32 5.1 sp|Q03039|VP35_MABVP Polymerase cofactor VP35 OS=Lake Victoria ...C9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria marburgvirus (strain Ravn-87) GN=VP35 PE=3 SV=1 Leng

  19. Oceanographic profile plankton, Temperature Salinity and other measurements collected using bottle from VICTORIA 1 FISHING BOAT), ALEJERO HUMBOLDT and other platforms in the South Pacific, Coastal S Pacific and other locations from 1980 to 1982 (NODC Accession 0002083)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity and other measurements found in dataset OSD taken from the VICTORIA 1(FISHING BOAT), ALEJERO HUMBOLDT and other platforms in the South...

  20. La Victoria de Pedro Aguirre Cerda: ideas para una renovación urbana sin gentrificación para Santiago./ La Victoria of Pedro Aguirre Cerda: ideas for an urban renewal without gentrification in Santiago.

    Directory of Open Access Journals (Sweden)

    Ernesto López

    2012-12-01

    Full Text Available El modelo de renovación urbana en altura de Santiago, en expansión hacia áreas populares del pericentro, es una forma de acumulación de renta de suelo, con efectos de desplazamiento social, es decir, gentrificación. Sin embargo, el pericentro de Santiago es un espacio donde coexisten amplias necesidades y capacidades de densificación urbana sin desplazamiento. Tomando como caso de estudio el desarrollo urbano histórico y actual de la población La Victoria, en Pedro Aguirre Cerda (PAC, se plantea una investigación enfocada en dos perspectivas: histórica, definiendo este espacio desde la dialéctica entre movimientos sociales urbanos y producción espacial específica; y normativa, como una propuesta espacial que combina aspectos claves de mejoramiento barrial y densificación inclusiva y autosustentable. Se evidencia de esta forma la alta complejidad espacial del pericentro de Santiago de Chile, así como la existencia de alternativas de renovación residencial pericentral que sean social y políticamente inclusivas y de bajo impacto en términos de expulsión./ The model of high-rise urban renewal sprawls towards Santiago de Chile’s inner city. This model can be understood as a form of gentrification based on considerable accumulation of the rent gap, while its externalities generate social displacement and physical dilapidation. Notwithstanding, Santiago’s inner city is also a lived space where both needs and capacities of urban regeneration (without displacement coexist. Focusing on the case of La Victoria población, located in the southern municipality of Pedro Aguirre Cerda (PAC, this article seeks to address the following two topics: historically, the inner city responds to a dialectic of urban social movements and specific spatial production; normatively, as an ongoing research project shows, it is feasible to combine neighbourhood regeneration, urban density increase, and citizen participation. The article substantiates the

  1. Morfologia da flor, fruto e plântula de Victoria amazonica (Poepp. J.C. Sowerby (Nymphaeaceae Morphology of flower, fruit and seedling of Victoria amazonica (Poepp. J.C. Sowerby (Nymphaeaceae

    Directory of Open Access Journals (Sweden)

    Sônia Maciel da Rosa-Osman

    2011-03-01

    Full Text Available Victoria amazonica (Poepp. J.C. Sowerby é uma hidrófita que ocorre nas várzeas de águas brancas e igapós da Bacia Amazônica e na Bacia do rio Paraguai. A morfologia da flor, fruto e plântula/"tirodendro" é objeto do presente trabalho. O material botânico foi coletado em Parintins e Manaus, estado do Amazonas, Brasil. A análise morfológica foi feita em material fresco e fixado em FAA 50. O desenvolvimento das plântulas foi realizado no escuro em frascos com água com teor reduzido de oxigênio. As flores possuem pedicelo longo e são hemicíclicas, diclamídeas, monoclinas e com antese vespertina. Os frutos são carnosos, indeiscentes, com pseudossincarpia. As sementes apresentam arilo que atua na dispersão pela água. As plântulas se desenvolvem em condições de hipoxia e apresentam um cotilédone exposto acicular. O "tirodendro" apresenta eofilos com heterofilia. As flores apresentam caracteres morfológicos básicos da família, a definição do tipo de fruto exige estudo ontogenético e a heterofilia é um caráter típico de plântulas/"tirodendros"de Nymphaeaceae.Victoria amazonica (Poepp. J.C. Sowerby is a hydrophyte that occurs in the white water leas and igapos of the Amazonian and Paraguay Basin. The flower, fruit and seedling/"tirodendro" morphology is the object of the present work. The botanical material was collected at Parintins and Manaus, Amazonian state, Brazil. The morphological analysis was made in both fresh and fixed material. The seedling development was accomplished in flasks with water containing little oxygen and maintained in the darkness. Flowers present long pedicel and they are hemicyclic, dichlamydeous, bisexual with vespertine anthesis. Fruits are fleshy, indehiscent with pseudo-syncarpy. Seeds present aril that acts in the water dispersion. Seedlings grow in hypoxy conditions and they present an acicular and exposed cotyledon. The "tirodendro" stage presents eophylls with heterophylly. Flowers

  2. DNA barcoding of schistosome cercariae reveals a novel sub-lineage within Schistosoma rodhaini from Ngamba Island Chimpanzee Sanctuary, Lake Victoria.

    Science.gov (United States)

    Standley, C J; Stothard, J R

    2012-10-01

    While Schistosoma rodhaini is typically considered a parasite of small mammals and is very scantly distributed in the Lake Victoria basin, it is known to hybridize with the more widespread Schistosoma mansoni, the causative agent of intestinal schistosomiasis. As part of broader parasitological and malacological surveys for S. mansoni across Lake Victoria, schistosome cercariae were harvested from a field-caught Biomphalaria choanomphala taken on Ngamba Island Chimpanzee Sanctuary, Uganda. Upon DNA barcoding, these cercariae were found to be a mixture of both S. rodhaini and S. mansoni, with further phylogenetic analysis revealing a hitherto unknown sub-lineage within S. rodhaini. Despite repeated sampling for eggs and miracidia from both chimpanzees and staff on Ngamba Island Sanctuary, detection of S. rodhaini within local definitive hosts awaits additional efforts, which should be mindful of a potential host role of spotted-necked otters.

  3. Compatibility of Ugandan Schistosoma mansoni isolates with Biomphalaria snail species from Lake Albert and Lake Victoria

    DEFF Research Database (Denmark)

    Adriko, Moses; Standley, Claire J.; Tinkitina, Benjamin

    2013-01-01

    -sympatric S. mansoni isolates. After a prepatent period of 20 days, a daily 10-hourly snail shedding for cercariae was done to determine the infection rate, cercarial production per hour and survival period of infected snails. The study suggests that when parasite strains from a different geographical origin......In order to investigate the capacity of being intermediate host for Schistosoma mansoni, the Ugandan F1 generation of Biomphalaria snail species that were laboratory-bred from parent populations originally collected from either Lake Victoria or Lake Albert was challenged with sympatric and non...... locations, were highly susceptible to the S. mansoni isolates. Thus if B. choanomphala, which is an efficient intermediate host in Lake Victoria, is given an opportunity to occupy Lake Albert, it will most likely be compatible with the Albertine S. mansoni parasites. Equally, if B. stanleyi, currently...

  4. Myxomatosis: the occurrence of antibody to a soluble antigen of myxoma virus in wild rabbits, Oryctolagus cuniculus (L.), in Victoria, Australia.

    Science.gov (United States)

    Edmonds, J W; Shepherd, R C; Nolan, I F

    1978-10-01

    The occurrence of antibody of myxoma virus in wild rabbits following epizootics is highest in the semi-arid north-west of Victoria and lowest in temperate southern Victoria. Occurrence ranges up to about 90% in the north-west and to about 70% in the south except on the Western Plains where epizootics are rare and antibody occurrence seldom exceeds 30%. The establishment of the European rabbit flea may be changing the pattern of occurrence of antibody in the north-west by causing spring outbreaks of myxomatosis. It is suggested that the effects of the replacement of a simple recurring system of epizootic and breeding season several months apart by the occurrence of myxomatosis twice in the same year, once coincident with the breeding season, will be complex. The occurrence of detectable antibody may be less dependent on the infection rate and may be dependent to some extent on the relative timing of spring myxomatosis and the breeding season.

  5. Un paso de América: Alfonso Reyes, Victoria Ocampo y el cosmopolitismo en la década de 1930 / Un paso de América: Alfonso Reyes, Victoria Ocampo and the Cosmopolitanism in the 1930’s

    Directory of Open Access Journals (Sweden)

    Gorica Majstorovic

    2014-12-01

    Full Text Available El artículo trata de las construcciones americanistas del cosmopolitismo (entendido en relación a la geopolítica imperial en los textos de Victoria Ocampo y Alfonso Reyes de los años treinta. Al analizar su relación con los movimientos de inmigración y la subsiguiente revalorización de la nación, el artículo postula que en Alfonso Reyes la mediación cosmopolita es «des-jerarquizada», ubicada casi siempre en una «periferia», a diferencia de Victoria Ocampo cuyas visiones cosmopolitas son mediadas desde un «centro» —ya sea París o Buenos Aires— y relacionadas con una jerarquía de valores estéticos y políticos.The article deals with Americanist constructions of cosmopolitanism (understood in relation to the imperial geopolitics in the texts of Victoria Ocampo and Alfonso Reyes in the 1930’s. Upon analyzing its relationship with immigration movements and the subsequent revaluation of the nation, the article suggests that in Alfonso Reyes cosmopolitan mediation is «dis-hierarchized», almost always located in a periphery, unlike Victoria Ocampo whose cosmopolitan visions are mediated from a «center» —either Paris or Buenos Aires— and related to a hierarchy of aesthetic and political values.

  6. Stable isotope analyses and demographic responses counter prospects of planktivory by Caridina (Decapoda: Atyidae) in Lake Victoria.

    Science.gov (United States)

    Hart, Rob C; Campbell, Linda M; Hecky, R E

    2003-07-01

    Caridina nilotica, a freshwater atyid prawn, is a vital component of the Lake Victoria ecosystem. Despite its important role in the food web leading to Nile perch, the diet of Caridina is not well understood. Caridina freshly collected from the inshore littoral and offshore plankton of Lake Victoria were cultured individually under laboratory conditions on (A) decomposing hydrophytes, (B) living hydrophytes, (C) planktonic algae, (D) zooplankton and (E) 35- microm filtered lake water (a 'starvation' control). Inter-moult intervals (IMI, days), size-standardized moult intervals (MI, days mm(-1)), per moult growth increments (PMI, mm) and survivorship (%) were monitored daily for up to 5 weeks. Significant effects of both food type and shrimp source on MI were revealed by ANOVA. MI increased progressively from treatment A to D, and was shorter in offshore than littoral shrimps. Food influence on IMI was confirmed by ANCOVA. PMI values were close to the limits of detection, but were generally in line with MI responses. PMI values were marginal in treatments A and B, and negligible or negative in treatments D and especially E. Survivorship values, although confounded by non-dietary factors, were generally consistent with dietary influences on MI, although values obtained for treatment E were inconsistently high for true starvation. Disparate responses between inshore and offshore shrimps hint at possible ecotypic differentiation, or perhaps the existence of cryptic species. Stable isotope analyses (SIA, delta13C and delta15N signatures) of cultured shrimps were further consistent with their utilization of food type A but not D. SIA signatures of feral shrimps maintained in situ in enclosure bags with three separate potential fresh hydrophyte food sources (Vossia cuspidata, Cyperus papyrus, and Eichhornia crassipes) reflected Caridina's probable dietary reliance on decomposed organic matter with accompanying bacterial exudates. Collections of feral shrimps from various

  7. The population structure of Glossina fuscipes fuscipes in the Lake Victoria basin in Uganda: implications for vector control

    Directory of Open Access Journals (Sweden)

    Hyseni Chaz

    2012-10-01

    Full Text Available Abstract Background Glossina fuscipes fuscipes is the primary vector of trypanosomiasis in humans and livestock in Uganda. The Lake Victoria basin has been targeted for tsetse eradication using a rolling carpet initiative, from west to east, with four operational blocks (3 in Uganda and 1 in Kenya, under a Pan-African Tsetse and Trypanosomiasis Eradication Campaign (PATTEC. We screened tsetse flies from the three Ugandan PATTEC blocks for genetic diversity at 15 microsatellite loci from continental and offshore populations to provide empirical data to support this initiative. Methods We collected tsetse samples from 11 sites across the Lake Victoria basin in Uganda. We performed genetic analyses on 409 of the collected tsetse flies and added data collected for 278 individuals in a previous study. The flies were screened across 15 microsatellite loci and the resulting data were used to assess the temporal stability of populations, to analyze patterns of genetic exchange and structuring, to estimate dispersal rates and evaluate the sex bias in dispersal, as well as to estimate demographic parameters (NE and NC. Results We found that tsetse populations in this region were stable over 4-16 generations and belong to 4 genetic clusters. Two genetic clusters (1 and 2 corresponded approximately to PATTEC blocks 1 and 2, while the other two (3 and 4 fell within PATTEC block 3. Island populations grouped into the same genetic clusters as neighboring mainland sites, suggesting presence of gene flow between these sites. There was no evidence of the stretch of water separating islands from the mainland forming a significant barrier to dispersal. Dispersal rates ranged from 2.5 km per generation in cluster 1 to 14 km per generation in clusters 3 and 4. We found evidence of male-biased dispersal. Few breeders are successfully dispersing over large distances. Effective population size estimates were low (33–310 individuals, while census size estimates

  8. Anthropogenic Factors Are the Major Cause of Hospital Admission of a Threatened Species, the Grey-Headed Flying Fox (Pteropus poliocephalus), in Victoria, Australia

    OpenAIRE

    Titus Franciscus Scheelings; Sarah Elizabeth Frith

    2015-01-01

    To determine the reasons for presentation and outcomes of hospitalised grey-headed flying foxes (Pteropus poliocephalus) in Victoria, Australia, a retrospective analysis was performed on 532 records from two wildlife hospitals. Cases were categorised based on presenting signs and outcomes determined. Anthropogenic factors (63.7%) were a major cause of flying fox admissions with entanglement in fruit netting the most significant risk for bats (36.8%). Overall the mortality rate for flying fox ...

  9. Changes in feeding biology of Nile tilapia, Oreochromis niloticus (L.), after invasion of water hyacinth, Eichhornia crassipes (Mart.) Solms, in Lake Victoria, Kenya

    OpenAIRE

    Njiru, M.

    1999-01-01

    Oreochrimis niloticus (L.) was introduced to Lake victoria in the 1950s. It remained relatively uncommon in catches until 1965, when the numbers began to increase dramatically. It is now the third most important commercial fish species after the Nile perch, Lates niloticus (L.) and Rastrineobola argentea (Pellegrin). Oreochromis niloticus is considered a herbivore, feeding mostly on algae and plant material. The diet now appears to be more diversified , with insects, fish, algae and plant mat...

  10. Análisis sobre los imaginarios del trabajo en los trabajadores informales en la plazoleta la victoria de la ciudad de Quito.

    OpenAIRE

    Álvarez Iza, Myriam Alicia

    2014-01-01

    The present paper summarizes the results of the study on the imaginary work of informal workers in the Square "LA VICTORIA" in the Metropolitan District of Quito, which places look Communication and analysis from the City, in order to identify the conceptions with subjects around work, status, employment relationship, the interaction, the conception of time, space, salary, health. The aspects mentioned to identify each individual develops imaginary that often are not perceived but are p...

  11. Contrasting effects of fire severity on regeneration of the dominant woody species in two coastal plant communities at Wilsons Promontory, Victoria

    OpenAIRE

    Morgan, John W.; Nield, Catharine M.

    2013-01-01

    Following wildfire in 2005 at Wilsons Promontory, Victoria, we asked how fire severity affected the postfire regeneration of dominant woody species in two coastal plant communities. We documented the effects of fire severity (unburned, low, high) on stand mortality and seedling regeneration in shrublands dominated by the obligate seeder Leptospermum laevigatum (Myrtaceae) and woodlands dominated by the resprouting Banksia integrifolia var. integrifolia (Proteaceae). Leptospermum laevigatum is...

  12. INDIAN INTERNATIONAL STUDENT SAFETY IN MELBOURNE AND THE VICTORIA POLICE – THE DEVELOPMENT OF A CRISIS AND THE PERCEPTIONS THAT PROPELLED IT

    OpenAIRE

    Maria Fleming

    2012-01-01

    The international education sector is a major export earning industry for the Australian economy according to the Australian Government. It is also central to the nation’s international relations ambitions. However, Australia’s reputation as a safe and welcoming environment has been questioned following a series of highly publicised assaults against international students, particularly Indian nationals studying in Melbourne. This study analyses the effects of the Victoria Police public commun...

  13. The Victoria West: earliest prepared core technology in the Acheulean at Canteen Kopje and implications for the cognitive evolution of early hominids.

    Science.gov (United States)

    Li, Hao; Kuman, Kathleen; Lotter, Matt G; Leader, George M; Gibbon, Ryan J

    2017-06-01

    Prepared core technology illustrates in-depth planning and the presence of a mental template during the core reduction process. This technology is, therefore, a significant indicator in studying the evolution of abstract thought and the cognitive abilities of hominids. Here, we report on Victoria West cores excavated from the Canteen Kopje site in central South Africa, with a preliminary age estimate of approximately 1 Ma (million years ago) for these cores. Technological analysis shows that the Victoria West cores bear similarities to the 'Volumetric Concept' as defined for the Levallois, a popular and widely distributed prepared core technology from at least 200 ka (thousand years ago). Although these similarities are present, several notable differences also occur that make the Victoria West a unique and distinctive prepared core technology; these are: elongated and convergent core shapes, consistent blow directions for flake removal, a predominance of large side-struck flakes, and the use of these flakes to make Acheulean large cutting tools. This innovative core reduction strategy at Canteen Kopje extends the roots of prepared core technology to the latter part of the Early Acheulean and clearly demonstrates an increase in the cognitive abilities and complexities of hominids in this time period.

  14. British History is Their History: Britain and the British Empire in the History Curriculum of Ontario, Canada and Victoria, Australia 1930-1975

    Directory of Open Access Journals (Sweden)

    Stephen J Jackson

    2017-07-01

    Full Text Available This article investigates the evolving conceptions of national identity in Canada and Australia through an analysis of officially sanctioned history textbooks in Ontario, Canada and Victoria, Australia. From the 1930s until the 1950s, Britain and the British Empire served a pivotal role in history textbooks and curricula in both territories. Textbooks generally held that British and imperial history were crucial to the Canadian and Australian national identity. Following the Second World War, textbooks in both Ontario and Victoria began to recognize Britain’s loss of power, and how this changed Australian and Canadian participation in the British Empire/Commonwealth. But rather than advocate for a complete withdrawal from engagement with Britain, authors emphasized the continuing importance of the example of the British Empire and Commonwealth to world affairs. In fact, participation in the Commonwealth was often described as of even more importance as the Dominions could take a more prominent place in imperial affairs. By the 1960s, however, textbook authors in Ontario and Victoria began to change their narratives, de-emphasizing the importance of the British Empire to the Canadian and Australian identity. Crucially, by the late 1960s the new narratives Ontarians and Victorians constructed claimed that the British Empire and national identity were no longer significantly linked. An investigation into these narratives of history will provide a unique window into officially acceptable views on imperialism before and during the era of decolonization.

  15. Fast food restaurant locations according to socioeconomic disadvantage, urban-regional locality, and schools within Victoria, Australia.

    Science.gov (United States)

    Thornton, Lukar E; Lamb, Karen E; Ball, Kylie

    2016-12-01

    Features of the built environment provide opportunities to engage in both healthy and unhealthy behaviours. Access to a high number of fast food restaurants may encourage greater consumption of fast food products. The distribution of fast food restaurants at a state-level has not previously been reported in Australia. Using the location of 537 fast food restaurants from four major chains (McDonald׳s, KFC, Hungry Jacks, and Red Rooster), this study examined fast food restaurant locations across the state of Victoria relative to area-level disadvantage, urban-regional locality (classified as Major Cities, Inner Regional, or Outer Regional), and around schools. Findings revealed greater locational access to fast food restaurants in more socioeconomically disadvantaged areas (compared to areas with lower levels of disadvantage), nearby to secondary schools (compared to primary schools), and nearby to primary and secondary schools within the most disadvantaged areas of the major city region (compared to primary and secondary schools in areas with lower levels of disadvantage). Adjusted models showed no significant difference in location according to urban-regional locality. Knowledge of the distribution of fast food restaurants in Australia will assist local authorities to target potential policy mechanisms, such as planning regulations, where they are most needed.

  16. The Development of a Customization Framework for the WRF Model over the Lake Victoria Basin, Eastern Africa on Seasonal Timescales

    Directory of Open Access Journals (Sweden)

    R. Argent

    2015-01-01

    Full Text Available Lake Victoria, Africa, supports millions of people. To produce reliable climate projections, it is desirable to successfully model the rainfall over the lake accurately. An initial step is taken here with customization of the Weather, Research, and Forecast (WRF model. Of particular interest is an asymmetrical rainfall pattern across the lake basin, due to a diurnal land-lake breeze. The main aim is to present a customization framework for use over the lake. This framework is developed by conducting several series of model runs to investigate aspects of the customization. The runs are analyzed using Tropical Rainfall Measuring Mission rainfall data and Climatic Research Unit temperature data. The study shows that the choice of parameters and lake surface temperature initialization can significantly alter the results. Also, the optimal physics combinations for the climatology may not necessarily be suitable for all circumstances, such as extreme years. The study concludes that WRF is unable to reproduce the pattern across the lake. The temperature of the lake is too cold and this prevents the diurnal land-lake breeze reversal. Overall, this study highlights the importance of customizing a model to the region of research and presents a framework through which this may be achieved.

  17. Market power in tradable emission markets. A laboratory testbed for emission trading in Port Phillip Bay, Victoria

    Energy Technology Data Exchange (ETDEWEB)

    Cason, Timothy N. [Department of Economics, Krannert School of Management, Purdue University, West Lafayette, IN 47907-1310 (United States); Gangadharan, Lata [Department of Economics, University of Melbourne, Melbourne, Vic. 3010 (Australia); Duke, Charlotte [Economics Branch, Natural Resources and the Environment, Level 13, 8 Nicholson St, East Melbourne, Vic. 3002 (Australia)

    2003-10-01

    In theory, competitive emission permit markets minimize total abatement costs. Permit markets are often imperfectly competitive, however, and may be thin and dominated by large firms. The dominant firm(s) could exercise market power and increase other firms' costs of pollution control, while reducing their own emission control costs. This paper reports a testbed laboratory experiment to examine whether a dominant firm can exercise market power in a permit market organized using the double auction trading institution. Our parameters approximate the abatement costs of sources in a proposed tradable emissions market for the reduction of nitrogen in the Port Phillip Watershed in Victoria, Australia. We vary across treatments the initial allocation of permits to sources, so that in one treatment the seller of permits is a monopolist and in another treatment the market is duopolistic. We also vary the information that subjects have about the number and abatement costs of their competitors. We find that prices and seller profits are higher and efficiency is lower on average in the monopoly sessions compared with the duopoly sessions, but the differences are not substantial and are not statistically significant due to pronounced variation across sessions. Moreover, prices, profits and transaction volumes are usually much closer to the competitive equilibrium (CE) than the monopoly equilibrium.

  18. Do changes in lifestyle engagement moderate cognitive decline in normal aging? Evidence from the Victoria Longitudinal Study.

    Science.gov (United States)

    Small, Brent J; Dixon, Roger A; McArdle, John J; Grimm, Kevin J

    2012-03-01

    Do lifestyle activities buffer normal aging-related declines in cognitive performance? The emerging literature will benefit from theoretically broader measurement of both lifestyle activities and cognitive performance, and longer-term longitudinal designs complemented with dynamic statistical analyses. We examine the temporal ordering of changes in lifestyle activities and changes in cognitive neuropsychological performance in older adults. We assembled data (n = 952) across a 12-year (5-wave) period from the Victoria Longitudinal Study. Latent change score models were applied to examine whether (and in which temporal order) changes in physical, social, or cognitive lifestyle activities were related to changes in three domains of cognitive performance. Two main results reflect the dynamic coupling among changes in lifestyle activities and cognition. First, reductions in cognitive lifestyle activities were associated with subsequent declines in measures of verbal speed, episodic memory, and semantic memory. Second, poorer cognitive functioning was related to subsequent decrements in lifestyle engagement, especially in social activities. The results support the dual contention that (a) lifestyle engagement may buffer some of the cognitive changes observed in late life, and (b) persons who are exhibiting poorer cognitive performance may also relinquish some lifestyle activities.

  19. ESTABLISHMENT OF THE PENTECOSTALISM IN VICTORY OF LAS TUNAS CITY / ASENTAMIENTO DEL PENTECOSTALISMO EN VICTORIA DE LAS TUNAS

    Directory of Open Access Journals (Sweden)

    Enrique Antonio Lalana Torres

    2012-09-01

    Full Text Available The socioreligious studies are a topic that they have not been very managed at present. During the search of the information for this investigation, verified that in the word of investigations of the religious phenomenon that form the socio-religious specter in the country the approach to certain variants of the pentecostalism and its influence into the national cultural identity has been a topic not blown for the main investigating sociologists, ethnologists, and even the theologians have not blown the topic for considering it a little delicate. Therefore, in the environment of the religious investigations in our country, is the first time makes a study of this nature. In this work it makes, after a theoretical dissertation on the pentecostal movement, an approach to his settling in the territory of Las Tunas, by contributing a compendium of historiographical data that guarantees with an endorsement this prosecute developed in the decade of the 50´s of the XX century and the importance that has generated in the popular culture in the belonging territory to the then municipality of Victoria de Las Tunas.

  20. Fruit and seed biometry and germination of Victoria amazonica (Poepp. J.C. Sowerby (Nymphaeaceae from the Pantanal floodplain

    Directory of Open Access Journals (Sweden)

    Luiz Ricardo dos Santos Tozin

    2016-10-01

    Full Text Available Numerous plant species are easily established in the wide flood plains of the Pantanal wetlands due to the environmental heterogeneity. The aquatic macrophytes excel in permanently flooded areas, particularly Nymphaeaceae species. Victoria amazonica, popularly known as the vitória-régia, is hallmarked for its beauty. However, the biology and conditions necessary for the seed germination of this flowering plant remain unknown. In the present study, the fruit and seed morphology and biometry were described and the seed germination was evaluated under different abiotic conditions. To this end, mature fruits of V. amazonica were collected from the bays near Paraguay River in the south Pantanal floodplain. The fruits and seeds were described and measured using digital caliper. Intact and mechanically scarified seeds were germinated under different temperature, light and substratum conditions, and the initial development was described. The fruits measured 67.5 x 119.7 mm in size and contained 100-700 seeds. The average seed measured 10.6 mm in length and 9.8 mm in width. The highest germination occurred at 25oC, independent of the light condition. The seeds were considered neutral photoblastic. The seedlings showed heterophylly, and the main root was degenerated, forming adventitious roots. Morphological differences were observed in seedlings developed under different light conditions.

  1. Relationships among victoria symptom validity test indices and personality assessment inventory validity scales in a large clinical sample.

    Science.gov (United States)

    Haggerty, Kathryn A; Frazier, Thomas W; Busch, Robyn M; Naugle, Richard I

    2007-12-01

    The purpose of this study was twofold: (1) to examine the relationships among measures of cognitive symptom exaggeration (i.e., response accuracy and response latency) and (2) to examine the relationship between measures of cognitive and psychopathological symptom exaggeration. It was expected that Victoria Symptom Validity Test (VSVT) accuracy and latency measures would be significantly correlated, with invalid responders demonstrating longer response latencies. VSVT scores were also expected to correlate significantly with the Negative Impression Management (NIM) and Infrequency (INF) subscales of the Personality Assessment Inventory (PAI). VSVT and PAI data were collected from 300 patients during routine clinical neuropsychological evaluations. Results indicated that VSVT accuracy and latency measures were significantly and moderately correlated, and both types of VSVT scores were significantly, but modestly, related to NIM, but not INF. These findings suggest that VSVT response latencies may supplement accuracy scores in identifying patients who are exerting suboptimal effort on cognitive measures. These findings further suggest that measures of cognitive symptom validity only partially overlap with measures of psychopathological symptom exaggeration.

  2. An exploration of issues of management and intention to stay: allied health professionals in South West Victoria, Australia.

    Science.gov (United States)

    Stagnitti, Karen; Schoo, Adrian; Dunbar, James; Reid, Catherine

    2006-01-01

    Management of allied health staff and services often has implications for staff stability and retention. A survey of allied health staff in South West Victoria was conducted in 2003 to explore issues relating to recruitment and retention. Findings relating to management and retention of staff in their current job are addressed in this report. A total of 138 staff returned their questionnaires. Results were related to Maslow's hierarchy of needs, level of belonging, with professional needs identified as feeling supported, orientation to the position, clear job description, and able to recommend the position to others. Qualitative data showed that recommending the position was associated with job satisfaction, autonomy, flexibility, and variety of work. The immediate management structure was significantly related to retention. Reasons given for intending to leave were related to management categories. These were management structure, lack of career structure, and lack of professional support. Reasons given by respondents for not recommending their current position were as follows: not for long-term career, risk of deskilling if staying too long, and financially unrewarding. These reasons were also related to management. Positive reasons for staying, which were related to management, included flexible work conditions, variety of clinical and management experience, good working environment, good support, and autonomy. Recommendations are given for organizational development and training for managers.

  3. Service utilisation and costs of language impairment in children: The early language in Victoria Australian population-based study.

    Science.gov (United States)

    Le, Ha N D; Gold, Lisa; Mensah, Fiona; Eadie, Patricia; Bavin, Edith L; Bretherton, Lesley; Reilly, Sheena

    2017-08-01

    To examine (1) the patterns of service use and costs associated with language impairment in a community cohort of children from ages 4-9 years and (2) the relationship between language impairment and health service utilisation. Participants were children and caregivers of six local government areas in Melbourne participating in the community-based Early Language in Victoria Study (ELVS). Health service use was reported by parents. Costs were valued in Australian dollars in 2014, from the government and family perspectives. Depending on age, the Australian adapted Clinical Evaluation of Language Fundamentals - Pre-school, 2nd Edition (CELF-P2) or the CELF, 4th Edition (CELF4) was used to assess expressive and receptive language. At 5, 7 and 9 years respectively 21%, 11% and 8% of families reported using services for speech and/or language concerns. The annual costs associated with using services averaged A$612 (A$255 to government, A$357 to family) at 5 years and A$992 (A$317 to government, A$675 to family) at 7 years. Children with persistent language impairment had significantly higher service costs than those with typical language. Language impairment in 4-9-year-old children is associated with higher use of services and costs to both families and government compared to typical language.

  4. Barriers and facilitators to childhood obesity prevention among culturally and linguistically diverse (CALD) communities in Victoria, Australia.

    Science.gov (United States)

    Cyril, Sheila; Nicholson, Jan M; Agho, Kingsley; Polonsky, Michael; Renzaho, Andre M

    2017-06-01

    Childhood obesity is rising among culturally and linguistically diverse (CALD) groups who show poor engagement in obesity prevention initiatives. We examined the barriers and facilitators to the engagement of CALD communities in obesity prevention initiatives. We used the nominal group technique to collect data from 39 participants from Vietnamese, Burmese, African, Afghani and Indian origins living in disadvantaged areas of Victoria, Australia. Data analysis revealed ranked priorities for barriers and facilitators for CALD community engagement in obesity prevention initiatives. CALD parents identified key barriers as being: competing priorities in the post-migration settlement phase; language, cultural and program accessibility barriers; low levels of food and health literacy; junk food advertisement targeting children; and lack of mandatory weight checks for schoolchildren. Key facilitators emerged as: bicultural playgroup leaders; ethnic community groups; and school-based healthy lunch box initiatives. This study has identified several policy recommendations including: the implementation of robust food taxation policies; consistent control of food advertising targeting children; improving CALD health literacy using bicultural workers; and matching health promotional materials with CALD community literacy levels. Implications for Public Health: These recommendations can directly influence public health policy to improve the engagement of CALD communities in obesity prevention services and ultimately reduce the widening obesity disparities in Australia. © 2017 The Authors.

  5. [The congenital syphilis protocol used at the Instituto Materno Infantil-Hospital la Victoria, Bogotá].

    Science.gov (United States)

    Cifuentes-Cifuentes, Mery Y; Ojeda-Enríquez, Cindy V

    2013-01-01

    Examining a cohort of women having a reactive venereal disease research laboratory (VDRL) test on delivery (and their newborn) to describe adherence to the Colombian treatment regime to prevent congenital syphilis and identify adverse clinical outcomes. A descriptive study of 73 pregnant women and their new born was carried out at the Instituto Materno Infantil-Hospital La Victoria during 2008. Syphilis was detected in 50 women during their pregnancy and 23 when giving birth; 34 % became re-infected. 29 % were drug addicts, 19 % indigent and 23% had a history of syphilis. 7 cases were considered successful regarding antenatal treatment. Congenital syphilis frequency at the institution was 1 case per 46 births; there were 8 fetal deaths (12 %) and 58 cases of congenital syphilis in the newborn (27 symptomatic and 31 asymptomatic). 7 newborn had neurosyphilis, 17 suffered growth restriction and 6 were premature. Attending antenatal care, detecting syphilis during pregnancy and providing some type of treatment were related to decreased mortality, fewer symptomatic newborn and fewer infants having IUGR. Pregnant female drug addicts did not attend or lacked prenatal care and had a greater number of symptomatic newborn, involving growth restriction and being premature. It is recommended that pregnant women be encouraged to attend prenatal care and that health personnel should become involved in detecting the disease, verifying treatment in couples (i.e. including the sexual partner)and training in the institution's maternal and neonatal care programs.

  6. Bulinus globosus (Planorbidae; Gastropoda) populations in the Lake Victoria basin and coastal Kenya show extreme nuclear genetic differentiation.

    Science.gov (United States)

    Nyakaana, Silvester; Stothard, J Russell; Nalugwa, Allen; Webster, Bonnie L; Lange, Charles N; Jørgensen, Aslak; Rollinson, David; Kristensen, Thomas K

    2013-11-01

    Bulinus globosus, a key intermediate host for Schistosoma haematobium that causes urinary schistosomiasis, is a hermaphroditic freshwater Planorbid snail species that inhabits patchy and transient water bodies prone to large seasonal variations in water availability. Although capable of self-fertilizing, this species has been reported to be preferentially out crossing. In this study, we characterized the population genetic structure of 19 B. globosus populations sampled across the Lake Victoria basin and coastal Kenya using four polymorphic microsatellite loci. Population genetic structure was characterized and quantified using FST statistics and Bayesian clustering algorithms. The four loci used in this study contained sufficient statistical power to detect low levels of population genetic differentiation and were highly polymorphic with the number of alleles per locus across populations ranging from 16 to 22. Average observed and expected heterozygosities across loci in each population ranged from 0.13 to 0.69 and from 0.39 to 0.79, respectively. Twenty-five of the seventy-six possible population-locus comparisons significantly deviated from Hardy-Weinberg equilibrium proportions after Bonferroni corrections, mostly due to the deficiency of heterozygotes. Significant genetic differentiation was observed between populations and Bayesian inferences identified 15 genetic clusters. The excess homozygosity, significant inbreeding and population genetic differentiation observed in B. globosus populations are likely to be due to the habitat patchiness, mating system and the proneness to cyclic extinction and recolonization in transient habitats. Copyright © 2013 Elsevier B.V. All rights reserved.

  7. A mafic-ultramafic cumulate sequence derived from boninite-type melts (Niagara Icefalls, northern Victoria Land, Antarctica)

    Science.gov (United States)

    Tribuzio, Riccardo; Tiepolo, Massimo; Fiameni, Stefania

    2008-05-01

    The layered sequence from Niagara Icefalls (northern Victoria Land, Antarctica) is related to the Cambrian-Early Ordovician Ross Orogeny. The sequence consists of dunites, harzburgites, orthopyroxenites, melagabbronorites and gabbronorites of cumulus origin. The Mg# of olivine, spinel, orthopyroxene and clinopyroxene from these rocks yields positive correlations, thus indicating formation from melts that mainly evolved through fractional crystallisation. The following fractionation sequence was identified: olivine (up to 94 mol% forsterite) + Cr-rich spinel → olivine + orthopyroxene ± spinel → orthopyroxene → orthopyroxene + anorthite-rich plagioclase ± clinopyroxene. Clinopyroxenes retain the peculiar trace element signature of boninite melts, such as extremely low concentrations of HREE and HFSE, and LILE enrichment over REE and HFSE. U-Pb isotope data on zircons separated from a gabbronorite have allowed us to constrain the age of emplacement of the Niagara Icefalls sequence at ˜514 Ma. The occurrence of inherited zircons dated at ˜538 Ma indicates that the boninitic melts experienced, at least locally, crustal contamination. The Niagara Icefalls sequence can be related to a regional scale magmatic event that affected the eastern margin of the Gondwana supercontinent in the Middle Cambrian. We propose that the formation of the sequence was associated with the development of an embryonic back-arc basin in an active continental margin.

  8. Schistosomes of small mammals from the Lake Victoria Basin, Kenya: new species, familiar species, and implications for schistosomiasis control.

    Science.gov (United States)

    Hanelt, B; Mwangi, I N; Kinuthia, J M; Maina, G M; Agola, L E; Mutuku, M W; Steinauer, M L; Agwanda, B R; Kigo, L; Mungai, B N; Loker, E S; Mkoji, G M

    2010-06-01

    Recent schistosomiasis control efforts in sub-Saharan Africa have focused nearly exclusively on treatment of humans with praziquantel. However, the extent to which wild mammals act as reservoirs for Schistosoma mansoni and therefore as sources of renewed transmission following control efforts is poorly understood. With the objective to study the role of small mammals as reservoir hosts, 480 animals belonging to 9 rodent and 1 insectivore species were examined for infection with schistosomes in Kisumu, in the Lake Victoria Basin, Kenya. Animals were collected from 2 sites: near the lakeshore and from Nyabera Marsh draining into the lake. A total of 6.0% of the animals captured, including 5 murid rodent species and 1 species of shrew (Crocidura olivieri) were infected with schistosomes. Four schistosome species were recovered and identified using cox1 DNA barcoding: S. mansoni, S. bovis, S. rodhaini and S. kisumuensis, the latter of which was recently described from Nyabera Marsh. Schistosoma mansoni and S. rodhaini were found infecting the same host individual (Lophuromys flavopunctatus), suggesting that this host species could be responsible for the production of hybrid schistosomes found in the area. Although the prevalence of S. mansoni infection in these reservoir populations was low (1.5%), given their potentially vast population size, their impact on transmission needs further study. Reservoir hosts could perpetuate snail infections and favour renewed transmission to humans once control programmes have ceased.

  9. Species-Specific Relationships between Water Transparency and Male Coloration within and between Two Closely Related Lake Victoria Cichlid Species

    Directory of Open Access Journals (Sweden)

    Ruth F. Castillo Cajas

    2012-01-01

    Full Text Available Environmental variation in signalling conditions affects animal communication traits, with possible consequences for sexual selection and reproductive isolation. Using spectrophotometry, we studied how male coloration within and between populations of two closely related Lake Victoria cichlid species (Pundamilia pundamilia and P. nyererei covaries with water transparency. Focusing on coloration patches implicated in sexual selection, we predicted that in clear waters, with broad-spectrum light, (1 colours should become more saturated and (2 shift in hue away from the dominant ambient wavelengths, compared to more turbid waters. We found support for these predictions for the red and yellow coloration of P. nyererei but not the blue coloration of P. pundamilia. This may be explained by the species difference in depth distribution, which generates a steeper gradient in visual conditions for P. nyererei compared to P. pundamilia. Alternatively, the importance of male coloration in intraspecific sexual selection may differ between the species. We also found that anal fin spots, that is, the orange spots on male haplochromine anal fins that presumably mimic eggs, covaried with water transparency in a similar way for both species. This is in contrast to the other body regions studied and suggests that, while indeed functioning as signals, these spots may not play a role in species differentiation.

  10. Knowledge and practices of chronic hepatitis B virus testing by general practitioners in Victoria, Australia, 2014-15.

    Science.gov (United States)

    van Gemert, Caroline; Howell, Jess; Wang, Julie; Stoove, Mark; Cowie, Benjamin; Allard, Nicole; Enright, Chris; Dunn, Elisabeth; Towell, Vanessa; Hellard, Margaret

    2017-09-01

    More than one-third of people living with chronic hepatitis B virus (HBV) in Australia have not been diagnosed. The aim of this study was to assess general practitioners' (GPs') knowledge and practices regarding chronic HBV diagnosis, and identify opportunities to improve testing rates. A cross-sectional survey was conducted with GPs working in Victoria, Australia. Statistically significant adjusted odds ratios for high knowledge, and ordering two or more HBV tests per week were calculated. Of 1000 GPs who were invited to participate, 232 completed the survey. Chronic HBV knowledge, use of interpreters, and awareness of HBV testing guidelines were low. Chronic HBV knowledge and testing were associated with age and graduation from a medical school outside Australia. Testing was also associated with gender. This study identified gaps in GPs' knowledge about chronic hepatitis. Several barriers to improving testing rates among at-risk populations were identified. We recommend revision of the guidelines for prevention in general practice, and educational activities to improve knowledge of at-risk populations for chronic HBV in Australia.

  11. Assessment of cyanobacteria toxins in freshwater fish: a case study of Murchison Bay (Lake Victoria) and Lake Mburo, Uganda.

    Science.gov (United States)

    Nyakairu, George William Atwoki; Nagawa, Christine Betty; Mbabazi, Jolocam

    2010-05-01

    There is little information on the distribution of microcystins (MCs) in Oreochromis niloticus (ON) and Lates niloticus (LN) obtained from L. Mburo and Murchison Bay of L. Victoria. These fishes are harvested and sold both for local human consumption and for export. The presence of MC-RR, MC-LR and MC-YR in different organs (gut, muscle and liver) was determined using Liquid Chromatography coupled with a Mass Spectrometry Detector (LC/MS/MS). The total MCs in ON gut, muscle and liver were 1312.08, 208.65 and 73.10 ng g(-1) from L. Mburo and 1479.24, 9.65 and 48.07 ng g(-1) from Murchison Bay, respectively, while for LN from Murchison Bay they were 27.78, 1.86 and 3.74 ng g(-1). Generally, in both lakes, MC-RR was the most dominant followed by MC-YR and MC-LR, respectively. Gut showed a high MC content, followed by liver and muscle, in that order. The presence of MCs in muscle indicated possible fish contamination, which implied that it was possible to transfer the toxins to humans who are at the end of the food chain. This poses a risk to them since the MCs are heat stable. The local authorities should warn the public of the risk of possible poisoning by eating the contaminated fish. Copyright 2009 Elsevier Ltd. All rights reserved.

  12. Influenza A (H1N1 in Victoria, Australia: a community case series and analysis of household transmission.

    Directory of Open Access Journals (Sweden)

    Clare Looker

    Full Text Available BACKGROUND: We characterise the clinical features and household transmission of pandemic influenza A (pH1N1 in community cases from Victoria, Australia in 2009. METHODS: Questionnaires were used to collect information on epidemiological characteristics, illness features and co-morbidities of cases identified in the 2009 Victorian Influenza Sentinel Surveillance program. RESULTS: The median age of 132 index cases was 21 years, of whom 54 (41% were under 18 years old and 28 (21% had medical co-morbidities. The median symptom duration was significantly shorter for children who received antivirals than in those who did not (p = 0.03. Assumed influenza transmission was observed in 63 (51% households. Influenza-like illness (ILI developed in 115 of 351 household contacts, a crude secondary attack rate of 33%. Increased ILI rates were seen in households with larger numbers of children but not larger numbers of adults. Multivariate analysis indicated contacts of cases with cough and diarrhoea, and contacts in quarantined households were significantly more likely to develop influenza-like symptoms. CONCLUSION: Most cases of pH1N1 in our study were mild with similar clinical characteristics to seasonal influenza. Illness and case features relating to virus excretion, age and household quarantine may have influenced secondary ILI rates within households.

  13. Uncertainties in Flow-Duration-Frequency Relationships of High and Low Flow Extremes in Lake Victoria Basin

    Directory of Open Access Journals (Sweden)

    Charles Onyutha

    2013-09-01

    Full Text Available This paper focuses on uncertainty analysis to aid decision making in applications of statistically modeled flow-duration-frequency (FDF relationships of both daily high and low flows. The analysis is based on 24 selected catchments in the Lake Victoria basin in Eastern Africa. The FDF relationships were derived for aggregation levels in the range 1–90 days for high flows and 1–365 days for low flows. The validity of the projected FDF quantiles for high return periods T was checked using growth factor curves. Monte Carlo simulations were used to construct confidence intervals CI on both the estimated Ts for given flows and the estimated FDF quantiles for given T. The average bias of the modeled T of high and low flows are for all catchments and Ts up to 25 years lower than 8%. Despite this relatively small average bias in the modeled T, the limits of the CI on the modeled 25-year flows go up to more than 100% for high flows and more than 150% for low flows. The assessed FDF relationships and accompanied uncertainties are useful for various types of risk based water engineering and water management applications related to floods and droughts.

  14. Design of the shaft lining and shaft stations for deep polymetallic ore deposits: Victoria Mine case study

    Directory of Open Access Journals (Sweden)

    Sławomir Fabich

    2015-12-01

    Full Text Available In order to properly design a shaft it is necessary to acquire full information about the rock mass in the exploration area. It is especially crucial in the case of the deposit of an unusual vertical intrusion shape, occurring at a great depth. Such a situation implies that the shaft lining design must take into consideration not only the geomechanical properties of the rock mass but also the virgin stresses (often having significant values. In this paper, the methodology of the shaft lining and shaft station lining design for a deep shaft is presented based on the Victoria Mine located in Canada. Taking into consideration the geological structure as well as the results of the laboratory tests, the properties of the rock mass were derived. Next, the numerical calculation was performed based on the elasto-plastic model of the rock mass. The numerical analysis consisted of simulation of the multistage technology of the shaft excavation and lining execution. This allowed to estimate the forces in rock bolts of the temporary ground support as well as stresses in the final concrete lining of the shaft.

  15. Catholic Church Responses to Clergy-Child Sexual Abuse and Mandatory Reporting Exemptions in Victoria, Australia: A Discursive Critique

    Directory of Open Access Journals (Sweden)

    Michael Andre Guerzoni

    2015-12-01

    Full Text Available This article presents empirical findings from a critical discourse analysis of institutional responses by the Catholic Church to clergy-child sexual abuse in Victoria, Australia. A sample of 28 documents, comprising 1,394 pages, is analysed in the context of the 2012-2013 Victorian Inquiry into the Handling of Child Abuse by Religious and Other Organisations. Sykes and Matza’s (1957 and Cohen’s (1993 techniques of, respectively, neutralisation and denial are used to reveal the Catholic Church’s Janus-faced responses to clergy-child sexual abuse and mandatory reporting requirements. Paradoxical tensions are observed between Catholic Canonical law and clerical practices, and the extent of compliance with secular law and referral of allegations to authorities. Concerns centre on Church secrecy, clerical defences of the confessional in justification of inaction, and the Melbourne Response compensation scheme. Our research findings underscore the need for greater Church transparency and accountability; we advocate for mandatory reporting law reform and institutional reform, including adjustments to the confessional ritual.

  16. La memoria del último exilio español en la escritura de tres mujeres: Victoria Kent, Dolores Ibárruri y Carmen Parga

    Directory of Open Access Journals (Sweden)

    Bettina Pacheco

    2011-11-01

    Full Text Available Resumo: Este artigo realiza uma breve análise de três obras de testemunhos do exílio escritas por mulheres: Victoria Kent, destacada advogada socialista cromprometida com o governo da República Espanhola; Dolores Ibárruri, a mítica Pasionária; e Carmen Parga, republicana exilada na Rússia e México. As três dão sua visão, a sua maneira e através da escrita, sobre o drama vivido oferecendo sua concepção particular do exílio. Antes de entrar nas obras aludidas, examina-se brevemente as duas concepções sobre a dramática experiência do exilado que Cláudio Guillén reconheceu na escrita dos clássicos: Ovídio e Plutarco.Palavras-chave: Literatura comparada; literatura espanhola; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Resumen: Este artículo realiza um somero análisis de três obras testimoniales del exílio escritas por mujeres: Victoria Kent, destacada abogada socialista comprometida com el gobierno de la República Española; Dolores Ibárruri, la mítica Pasionaria; y Carmen Parga, republicana exiliada en Rusía y México. Las tres dan su visión, a su manera y a través de la escritura, sobre el drama vivido ofreciendo su concepción particular del exílio. Antes de entrar en las obras aludidas, se examina brevemente las dos concepiones sobre la dramática experiencia del exilado que Cláudio Guillén há reconocido em la escritura de dos clássicos: Ovídio y Plutarco.Palabras-clave: Literatura comparada; literatura española; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Keywords: Comparative literature; Spanish literature; Victoria Kent; Dolores Ibárruri; Carmen Parga; latin literature; Ovid; Plutarch; exile.

  17. Causes of Late Pleistocene water level change in Lake Victoria, Equatorial East Africa, derived from clumped isotopes of land snails and fresh water mollusks. (Invited)

    Science.gov (United States)

    Zaarur, S.; Affek, H. P.; Tryon, C.; Peppe, D. J.; Faith, J.

    2013-12-01

    Carbonate clumped isotope thermometry is based on the dependence of 13C-18O bond abundance in the carbonate lattice (measured as Δ47) on the carbonate formation temperature. Most marine and freshwater biogenic carbonates are found to be in agreement with the clumped isotopes - temperature calibration. Clumped isotope thermometry is particularly useful in terrestrial environments where the interpretation of carbonate δ18O is limited due to difficulty in estimating the paleo-water isotopic composition. Clumped isotope-derived temperatures from land snails are generally higher than the ambient environmental temperatures, but show no evidence for disequilibrium. We attribute these higher body temperatures to snail eco-physiological adaptations through shell color, morphology, and behavior. We use the clumped isotope-derived temperatures in combination with shell δ18O to calculate snail body water δ18O composition. This parameter is interpreted as a paleo-hydrological indicator that reflects the isotopic composition of local precipitation modified by local evaporation. Rusinga and Mfangano Islands in Lake Victoria provide a unique opportunity to compare extant species of modern and fossil freshwater mollusks and land snails from the same location to examine lake paleo-hydrology. This location is particularly interesting as Lake Victoria itself is the main source of rain-water in the region such that the isotopic composition of land snail body water can be related back to the source waters. We combine clumped isotope and oxygen isotope measurements of both freshwater mollusks and land snails to examine the water balance of the lake, testing hypotheses about the mechanism of a significant rise in lake level in Lake Victoria ~35 - 40 ka BP. Outcrops of paleo-beach deposits ~18 m above the modern day lake level indicate high water stands at ~35-40 ka BP. Based on water balance models for Lake Victoria, an increase in lake level of this magnitude could be driven by local

  18. SUGAR CANE GROWING AND CATTLE GRAZING AS DRIVERS TO WETLAND DEGRADATION IN UGANDA: A case of upper river Ruizi and Iguluibi catchments Lake Victoria basin

    Science.gov (United States)

    Nakiyemba Were, Alice; Isabirye, Moses; Mathijs, Erik; Deckers, Jozef; Poesen, Jean

    2010-05-01

    Introduction: This study was conducted with in the framework of the VLIR-OI project with the aim of making contributions to the Diagnosis and Remediation of Land Degradation Processes in the Riparian Zone of Lake Victoria Uganda in view of reducing sediment pollution of the Lake Waters with a special focus on the upper river Ruiz and Iguluibi catchments. The study seeks to investigate Sugarcane growing and cattle grazing as drivers to wetland degradation in light of the current farming systems and practices and their contributions to land degradation and pollution of the Lake Victoria waters. Vegetation especially wetlands improves the resistance to erosion. The removal of riparian vegetation tends to accelerate surface erosion as a result of human activities. Increased erosion with in the catchments due to clearing of wetlands for sugarcane growing and cattle grazing has caused adverse increased sedimentation, degraded the water quality, and reduced the water productivity of the Lake Victoria Basin. Methods: We conducted a qualitative and quantitative study to investigate Sugarcane growing and cattle grazing as drivers to wetland degradation in Uganda in light of the current farming systems and practices and their socio-economic contributions to wetland degradation and pollution of the Lake Victoria waters. Focus group discussions, key informant interviews, semi structured interviews and observations were undertaken with the relevant stakeholders in the community. Results: Findings reveal that in Iguluibi catchment, sugarcane growing is now a major activity indicating land use change since the 1990s. Community members said when planting sugarcane all vegetations including all trees are cut leaving the land bare to allow the tractor to clear the land for cultivation. This has left the land bare without any natural vegetation with increased erosion hence eventually loss of soil fertility and increased sediment pollution to the Lake Victoria waters. As a result of

  19. A geochemical study of lithospheric mantle beneath Northern Victoria Land (Antarctica): main evidences from volatile content in ultramafic xenoliths

    Science.gov (United States)

    Correale, Alessandra; Pelorosso, Beatrice; Rizzo, Andrea Luca; Coltorti, Massimo; Italiano, Francesco; Bonadiman, Costanza

    2017-04-01

    A geochemical study of ultramafic xenoliths from Northern Victoria Land (Green Point, GP and Handler Ridge, HR), is carried out in order to investigate the features of the lithosphere mantle beneath the Western Antarctic Ridge System (WARS). The majority of samples is spinel anhydrous lherzolite with rare presence of secondary phases (secondary cpx and glass). Geothermobarometric calculations, based on the Fe/Mg distribution among the peridotite minerals reveal that Sub Continental Lithospheric Mantle (SCLM) beneath Handler Ridge records temperatures and redox conditions higher then Greene Point (P fixed at 15 Kbar). Moreover, geochemical models evidence that, GP mantle domain represents a residuum after ˜7 to 21 % of partial melting in the spinel stability field, which was variably affected by interaction with infiltrating melts, acting in different times, from at least Jurassic to Cenozoic (Pelorosso et al., 2016). Fluid inclusions (FI) entrapped in olivine and pyroxene crystals were investigated for elemental and isotopic contents of both, noble gases (He, Ne, Ar) and CO2. He, Ar and Ne concentrations range from 1.52×10-14 to 1.07×10-12, from 4.09×10-13 to 3.47×10-11and from 2.84×10-16 to 7.57×10-14 mol/g, respectively, while the CO2amounts are between 7.08×10-10 and 8.12×10-7 mol/g. The 3He/4He varies between 5.95 and 20.18 Ra (where Ra is the 3He/4He ratio of air), being the lowest and the highest values measured in the He-poorer samples. Post-eruptive input of cosmogenic 3He and radiogenic 4He seems to influence mainly the samples associated to a lower He concentrations, increasing and decreasing respectively their primordial 3He/4He values, that for all the other samples range between 6.76 and 7.45 Ra. This range reasonably reflects the isotope signature of mantle beneath the investigated areas. The 4He/40Ar* ratio corrected for atmospheric-derived contamination ranges between 0.004 and 0.39. The lowest 4He/40Ar* values (4He/40Ar*<0.1) are

  20. An arbitrary Lagrangian-Eulerian formulation for the numerical simulation of flow patterns generated by the hydromedusa Aequorea victoria

    Science.gov (United States)

    Sahin, Mehmet; Mohseni, Kamran

    2009-07-01

    A new geometrically conservative arbitrary Lagrangian-Eulerian (ALE) formulation is presented for the moving boundary problems in the swirl-free cylindrical coordinates. The governing equations are multiplied with the radial distance and integrated over arbitrary moving Lagrangian-Eulerian quadrilateral elements. Therefore, the continuity and the geometric conservation equations take very simple form similar to those of the Cartesian coordinates. The continuity equation is satisfied exactly within each element and a special attention is given to satisfy the geometric conservation law (GCL) at the discrete level. The equation of motion of a deforming body is solved in addition to the Navier-Stokes equations in a fully-coupled form. The mesh deformation is achieved by solving the linear elasticity equation at each time level while avoiding remeshing in order to enhance numerical robustness. The resulting algebraic linear systems are solved using an ILU(k) preconditioned GMRES method provided by the PETSc library. The present ALE method is validated for the steady and oscillatory flow around a sphere in a cylindrical tube and applied to the investigation of the flow patterns around a free-swimming hydromedusa Aequorea victoria (crystal jellyfish). The calculations for the hydromedusa indicate the shed of the opposite signed vortex rings very close to each other and the formation of large induced velocities along the line of interaction while the ring vortices moving away from the hydromedusa. In addition, the propulsion efficiency of the free-swimming hydromedusa is computed and its value is compared with values from the literature for several other species.

  1. Plaqueta decorada de la cueva de El Horno (Ramales de la Victoria, Cantabria en su contexto local y regional

    Directory of Open Access Journals (Sweden)

    Fano, M.A.

    2010-01-01

    Full Text Available En la actualidad, uno de los retos más relevantes de la investigación sobre el Paleolítico es el de superar definitivamente el paradigma del yacimiento único, abordando el estudio de las sociedades de cazadores desde una perspectiva regional, tal y como demanda el carácter móvil de las mismas. De hecho, la movilidad debería ser considerada siempre en nuestras estrategias de investigación acerca de los grupos paleolíticos, y no sólo al abordar el estudio de materiales más o menos exóticos. El arte mueble, estudiado desde el punto de vista de las cadenas operativas, aporta datos relevantes para la compresión de las sociedades de cazadores en su territorio. Los resultados del análisis de una plaqueta de arenisca procedente del nivel 2 de El Horno (Ramales de la Victoria, Cantabria, atribuido al Magdaleniense superior-final, constituyen un buen ejemplo de lo comentado. La cara A de la plaqueta presenta el grabado de una cabeza de probable cierva, un tema poco común a finales del Magdaleniense, cuyo estudio tecnológico ha revelado que se trata de la obra de un artista inexperto. La cara B está grabada y pintada, y los estigmas identificados sugieren la utilización de la plaqueta como mortero para machacar algún material, quizá el propio ocre. En ese sentido, el material presentado aporta elementos de juicio a la reflexión actual acerca de la tradicional dicotomía establecida en el arte mobiliar entre los soportes utilitarios y no utilitarios.

  2. Impacts of population growth and economic development on water quality of a lake: case study of Lake Victoria Kenya water.

    Science.gov (United States)

    Juma, Dauglas Wafula; Wang, Hongtao; Li, Fengting

    2014-04-01

    Anthropogenic-induced water quality pollution is a major environmental problem in freshwater ecosystems today. As a result of this, eutrophication of lakes occurs. Population and economic development are key drivers of water resource pollution. To evaluate how growth in the riparian population and in the gross domestic product (GDP) with unplanned development affects the water quality of the lake, this paper evaluates Lake Victoria Kenyan waters basin. Waters quality data between 1990 and 2012 were analyzed along with reviews of published literature, papers, and reports. The nitrate-nitrogen (NO3-N), soluble phosphorus (PO4-P), chlorophyll a, and Secchi transparencies were evaluated as they are key water quality indicators. The NO3-N increased from 10 μg l(-1) in 1990 to 98 μg 1(-1) in 2008, while PO4-P increased from 4 μg l(-1) in 1990 to 57 μg l(-1) in 2008. The population and economic growth of Kenya are increasing with both having minimums in 1990 of 24.143 million people and 12.18 billion US dollars, to maximums in 2010 of 39.742 million people and 32.163 billion US dollars, respectively. A Secchi transparency is reducing with time, indicating an increasing pollution. This was confirmed by an increase in aquatic vegetation using an analysis of moderate resolution imaging spectroradiometer (MODIS) images of 2000 and 2012 of Kenyan waters. This study found that increasing population and GDP increases pollution discharge thus polluting lakes. One of major factors causing lake water pollution is the unplanned or poor waste management policy and service.

  3. Exploring the Reproductive Decision-making Process of HIV-positive Women in County Victoria, Trinidad and Tobago

    Directory of Open Access Journals (Sweden)

    E Joseph

    2015-07-01

    Full Text Available Objective: The community-based Prevention of Mother to Child Transmission (PMTCT programme in Trinidad and Tobago offers care and support to HIV-positive (HIV+ pregnant women and their families for their lifetime. This study explored the factors influencing repeat childbearing by PMTCT enrolees. Method: In-depth qualitative interviews were conducted with purposively selected and consenting HIV+ women who enrolled in the PMTCT programme (n = 10 in County Victoria and four healthcare workers (HCWs. Transcribed interviews were analysed and coded using thematic content analysis. Results: Though women desired children and motherhood, some did not intend to conceive fearing HIV, age-related ill-health and vertical transmission. Others had not considered pregnancy and conceived through accident and partners’ disregard for the women’s HIV status, particularly if such partners were inebriated. Partners’ desire for children, especially in new relationships, led to planned pregnancies. Nine of the 10 HIV+ women did not seek family planning advice; the one that did was advised about partner infection but not risk reduction, vertical transmission or reinfection. Though HCWs supported HIV+ women’s reproductive rights, they agreed that HCWs stigmatized and discriminated against HIV+ mothers. Both parties saw the PMTCT programme as an effective programme in vastly reducing HIV transmission from mother to child. Conclusion: The PMTCT programme and family planning services should be integrated with tailored services toward HIV+ women and their partners to help them safely achieve their reproductive goals. Healthcare workers should be given training and skillsets to address stigma and discrimination against persons infected with HIV/AIDS within Trinidad and Tobago’s health workforce.

  4. Monitoring basin-scale land cover changes in Kagera Basin of Lake Victoria using ancillary data and remote sensing

    Science.gov (United States)

    Wasige, John E.; Groen, Thomas A.; Smaling, Eric; Jetten, Victor

    2013-04-01

    The Kagera Basin is a high value ecosystem in the Lake Victoria watershed because of the hydrological and food services it provides. The basin has faced large scale human induced land use and land cover changes (LUCC), but quantitative data is to date lacking. A combination of ancillary data and satellite imagery were interpreted to construct LUCC dynamics for the last century. This study is an initial step towards assessing the impact of LUCC on sustainable agriculture and water quality in the watershed. The results show that large trends of LUCC have rapidly occurred over the last 100 years. The most dominant LUCC processes were gains in farmland areas (not detectable in 1901 to 60% in 2010) and a net reduction in dense forest (7% to 2.6%), woodlands (51% to 6.9%) and savannas (35% to 19.6%) between 1901 and 2010. Forest degradation rapidly occurred during 1974 and 1995 but the forest re-grew between 1995 and 2010 due to forest conservation efforts. Afforestation efforts have resulted in plantation forest increases between 1995 and 2010. The rates of LUCC observed are higher than those reported in Sub Saharan Africa (SSA) and other parts of the world. This is one of the few studies in SSA at a basin scale that combines multi-source spatio-temporal data on land cover to enable long-term quantification of land cover changes. In the discussion we address future research needs for the area based on the results of this study. These research needs include quantifying the impacts of land cover change on nutrient and sediment dynamics, soil organic carbon stocks, and changes in biodiversity.

  5. Balancing absolute and relative risk reduction in tobacco control policy: the example of antenatal smoking in Victoria, Australia.

    Science.gov (United States)

    Grills, Nathan; Bolam, Bruce; Piers, Leonard Sunil

    2010-08-01

    This descriptive epidemiological analysis aims to explore the benefits, risks and policy balance between a whole-of-population and high-risk reduction approach to reducing antenatal smoking prevalence. Using Victorian hospital antenatal statistics the rate-ratio for smoking in each hypothesised high prevalence group was calculated and combined with the absolute number of births in each high-risk group. The effect on smoking prevalence of whole-of-population reductions and high-risk group reductions was then modelled. In Victoria, there were higher rates of antenatal smoking among single [RR = 4.67 (3.46-4.42)], teenage women [RR (95%CI) = 3.26 (3.00-3.54)] of indigenous ethnicity [RR = 4.39 (3.94, 4.88)] with low income [RR = 4.67 (4.17-5.22)] and low education attainment [RR = 3.89 (3.47-4.36)] who lived in less accessible areas [RR = 2.14 (1.92-2.39)]. However, as each of these high-risk groups represents a relatively small proportion of mothers, most antenatal smokers are aged 25-34, educated, city-based, non-Indigenous and non-impoverished. The majority of Victorian women who smoke in pregnancy do not belong to traditional high-risk groups. Absolute reductions in smoking prevalence in high-risk groups can potentially be achieved by whole-of-population prevalence reductions, despite a potential continuance in high relative risk among these groups. Conversely, an exclusive focus on smoking reduction in high-risk groups may fail to reduce the whole-of-population antenatal smoking prevalence.

  6. A new Eemian record of Antarctic tephra layers retrieved from the Talos Dome ice core (Northern Victoria Land)

    Science.gov (United States)

    Narcisi, Biancamaria; Petit, Jean Robert; Langone, Antonio; Stenni, Barbara

    2016-02-01

    Polar ice sheets are remarkable repositories of tephra layers. The Talos Dome ice core (72°49‧S, 159°11‧E), drilled at the edge of the East Antarctic Plateau, close to Late Quaternary volcanoes, offers considerable potential to extend the current tephra time-stratigraphic framework. A tephrochronological study was undertaken of the ice core sections related to the Last Interglacial and the transition to the subsequent glacial period. Thirteen macroscopically visible layers, interpreted to be related to primary deposition of fallout tephra, have been analysed for quantitative grain size and glass shard geochemistry. The layers, precisely framed within the climate (δ18O) record for the core, span in age from 111.6 ± 1.9 to 123.3 ± 2.2 ka. Coarse particle size suggests origin from regional sources. Indeed, the vast majority of the samples display an alkaline affinity and trachytic composition that are both typical geochemical features of rifting Antarctic volcanism. Using subtle differences in the geochemical signatures and the comparison with data from previous studies, a few layers are attributed to known coeval Mt. Melbourne eruptions. Another sample subset is consistent with derivation from The Pleiades and Mt. Rittmann volcanoes. One peculiar trachytic glass population appears to be related to activity of the more distant Marie Byrd Land volcanoes. The newly detected tephras provide stratigraphic markers that could facilitate future synchronisation and dating of palaeoclimatic records. The Talos Dome tephra inventory also contributes significantly to the reconstruction of the Northern Victoria Land explosive volcanism, for which chronostratigraphic data for the Last Interglacial temporal segment are poor.

  7. The adoption of children from out-of-home care: The understandings of key decision makers in Victoria, Australia.

    Science.gov (United States)

    Butlinski, Anna; Rowe, Heather; Goddard, Christopher; Freezer, Nicholas

    2017-10-01

    Adoption is one of a range of options that can provide children in out-of-home care with permanency when they are unable to be reunified with their birth parents. This paper reports on how the adoption of children from out-of-home care is understood by professionals involved in making decisions about the permanent placement of children in out-of-home care in Victoria, Australia, where adoption is rarely used. Data were collected through a single, face-to-face semi-structured interview with 21 professionals; eight child welfare specialists, eight adoption and permanent care specialists and five judicial officers. The adoption of children from out-of-home care was primarily understood as a child-centered practice that can afford children stability and a sense of belonging. Adoption was largely viewed as a voluntary process dependent upon the consent of a child's birth parents. Adoption and permanent care specialists were the only group to refer to the dispensation of parental consent as a means of obtaining an adoption order. Most decision makers understood that contact between children and their birth parents is possible following adoption, but this was not understood by all judicial officers or all child welfare specialists. Children's connection to their cultural heritage was viewed as important to the consideration of adoption for children in out-of-home care. This research provides insight into the foundations upon which decision makers may appraise adoption, within a hierarchy of options, as a potential outcome for children in need of permanency. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Variables del juego que mejor discriminan la victoria y la derrota en los partidos igualados de rugby

    Directory of Open Access Journals (Sweden)

    Luís Miguel Teixeira Vaz

    2011-09-01

    Full Text Available El desarrollo actual y el nivel alcanzado por el rugby competitivo requiere cada vez más altos niveles de rendimiento, necesitando de análisis detallados tanto de las situaciones de entrenamiento como de la propia competición. El propósito de este estudio fue identificar las estadísticas que mejor representan las victorias y derrotas en los partidos de la International Rugby Board (IRB de grupos igualados y Super 12. En total, la muestra consistió en 159 partidos de rugby, divididos en dos grupos: (i uno que consta de 64 partidos IRB y (ii otro formado por 95 partidos de Super 12. Las variables que se analizaron se subdividen en acciones del juego (pases realizados, sanciones impuestas, recuperaciones de pelota, y variables de resultado (ensayos, onversiones, puntapiés de castigo. Los procedimientos estadísticos fueron i análisis exploratorio inicial, ii análisis de conglomerados y iii el análisis discriminante que permite asociar partidos entre sí, habiendo definido como criterio de agrupación la diferencia en la puntuación final de los partidos. Los resultados mostraron que los partidos igualados ocurrieron en mayor número y que la mayor contribución al resultado final de los partidos se debió a los ensayos. Los equipos que ganaron el partido igualado, defendieron más (haciendo más placajes, cometieron menos errores en posesión de la pelota y utilizaron mayor variedad de formas de juego (de juego a la ano y juego al pie. Entender las razones que contribuyen al éxito o el fracaso de los equipos en los partidos igualados permite orientar la formación del jugador de manera más específica y contribuye decisivamente a la mejora del rendimiento deportivo.

  9. Assessment of potentially toxic metal contamination in the soils of a legacy mine site in Central Victoria, Australia.

    Science.gov (United States)

    Abraham, Joji; Dowling, Kim; Florentine, Singarayer

    2018-02-01

    The environmental impact of toxic metal contamination from legacy mining activities, many of which had operated and were closed prior to the enforcement of robust environmental legislation, is of growing concern to modern society. We have carried out analysis of As and potentially toxic metals (Cd, Co, Cr, Cu, Hg, Mn, Ni, Pb, and Zn) in the surface soil of a legacy gold mining site in Maldon, Victoria, Australia, to reveal the status of the current metal concentration. The results revealed the median concentrations of metals from highest to lowest, in the order: Mn > Zn > As > Cr > Cu > Pb > Ni > Co > Hg > Cd. The status of site was assessed directly by comparing the metal concentrations in the study area with known Australian and Victorian average top soil levels and the health investigation levels set by the National Environmental Protection Measures (NEPM) and the Department of Environment and Conservation (DEC) of the State of Western Australia. Although, median concentrations of As, Hg, Pb, Cu and Zn exceeded the average Australian and Victorian top soil concentrations, only As and Hg exceeded the ecological investigation levels (EIL) set by DEC and thus these metals are considered as risk to the human and aquatic ecosystems health due to their increase in concentration and toxicity. In an environment of climate fluctuation with increased storm events and forest fires may mobilize these toxic metals contaminants, pose a real threat to the environment and the community. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Perceptions of HIV and Safe Male Circumcision in High HIV Prevalence Fishing Communities on Lake Victoria, Uganda.

    Directory of Open Access Journals (Sweden)

    Paul E Nevin

    Full Text Available In 2010, the Uganda Ministry of Health introduced its Safe Male Circumcision (SMC strategy for HIV prevention with the goal of providing 4.2 million voluntary medical male circumcisions by 2015. Fishing communities, where HIV prevalence is approximately 3-5 times higher than the national average, have been identified as a key population needing targeted HIV prevention services by the National HIV Prevention Strategy. This study aimed to understand perceptions of HIV and identify potential barriers and facilitators to SMC in fishing communities along Lake Victoria.We conducted 8 focus group discussions, stratified by sex and age, with 67 purposefully sampled participants in 4 communities in Kalangala District, Uganda.There was universal knowledge of the availability of SMC services, but males reported high uptake in the community while females indicated that it is low. Improved hygiene, disease prevention, and improved sexual performance and desirability were reported facilitators. Barriers included a perceived increase in SMC recipients' physiological libido, post-surgical abstinence, lost income during convalescence, and lengthier recovery due to occupational hazards. Both males and females reported concerns about spousal fidelity during post-SMC abstinence. Reported misconceptions and community-held cultural beliefs include fear that foreskins are sold after their removal, the belief that a SMC recipient's first sexual partner after the procedure should not be his spouse, and the belief that vaginal fluids aid circumcision wound healing.Previous outreach efforts have effectively reached these remote communities, where availability and health benefits of SMC are widely understood. However, community-specific intervention strategies are needed to address the barriers identified in this study. We recommend the development of targeted counseling, outreach, and communication strategies to address barriers, misconceptions, and community-held beliefs

  11. Wetland vegetation and nutrient retention in Nakivubo and Kirinya wetlands in the Lake Victoria basin of Uganda

    Science.gov (United States)

    Mugisha, P.; Kansiime, F.; Mucunguzi, P.; Kateyo, E.

    Wetlands form an important part of the catchment area of the African Great Lakes and protect water resources therein. One of the most important functions is the retention of nutrients from the inflowing water from the catchment, by wetland plants which store them in their phytomass. An assessment of the capacity in storing nutrients by dominant plants ( Cyeprus papyrus, Miscanthus violaceus, Phragmites mauritianus and Colocasia C. esculenta), of Nakivubo and Kirinya wetlands at the shores of Lake Victoria in Uganda, was studied through the determination of phytomass production and nutrient concentration in the plant parts at different stages of growth. The above ground phytomass production increased rapidly during the exponential growth for C. papyrus and P. mauritianus. In all the dominant plants, nitrogen concentration was highest in juvenile plants and decreased with increasing age. The most pronounced nitrogen level occurred in the young umbels of C. papyrus during the first month of growth with total nitrogen content of 1.95% DW which dropped to 0.62% DW after the fifth month in Nakivubo wetland. Corms (tubers) of yams had the highest nitrogen content in Kirinya and Nakivubo wetlands exhibiting respective values of 4.8% DW and 3.7% DW. There is a close relationship between nutrient content and increase in phytomass. In Nakivubo and Kirinya wetlands, the rapid increase in phytomass during the third and fourth month corresponded with high nutrient levels. Since plants store significant amounts of nitrogen during their growth, periodic harvesting of above ground plant parts can remove significant amounts of nutrients (during the first five months of growth) from the wastewater flowing into the two wetlands. Wetland plant species with high phytomass productivity and well developed root systems and ability to withstand flooding are the best in nutrient removal.

  12. Elevated temperature and acclimation time affect metabolic performance in the heavily exploited Nile perch of Lake Victoria.

    Science.gov (United States)

    Nyboer, Elizabeth A; Chapman, Lauren J

    2017-10-15

    Increasing water temperatures owing to anthropogenic climate change are predicted to negatively impact the aerobic metabolic performance of aquatic ectotherms. Specifically, it has been hypothesized that thermal increases result in reductions in aerobic scope (AS), which lead to decreases in energy available for essential fitness and performance functions. Consequences of warming are anticipated to be especially severe for warm-adapted tropical species as they are thought to have narrow thermal windows and limited plasticity for coping with elevated temperatures. In this study we test how predicted warming may affect the aerobic performance of Nile perch (Lates niloticus), a commercially harvested fish species in the Lake Victoria basin of East Africa. We measured critical thermal maxima (CTmax) and key metabolic variables such as AS and excess post-exercise oxygen consumption (EPOC) across a range of temperatures, and compared responses between acute (3-day) exposures and 3-week acclimations. CTmax increased with acclimation temperature; however, 3-week-acclimated fish had higher overall CTmax than acutely exposed individuals. Nile perch also showed the capacity to increase or maintain high AS even at temperatures well beyond their current range; however, acclimated Nile perch had lower AS compared with acutely exposed fish. These changes were accompanied by lower EPOC, suggesting that drops in AS may reflect improved energy utilization after acclimation, a finding that is supported by improvements in growth at high temperatures over the acclimation period. Overall, the results challenge predictions that tropical species have limited thermal plasticity, and that high temperatures will be detrimental because of limitations in AS. © 2017. Published by The Company of Biologists Ltd.

  13. Perceptions of HIV and Safe Male Circumcision in High HIV Prevalence Fishing Communities on Lake Victoria, Uganda.

    Science.gov (United States)

    Nevin, Paul E; Pfeiffer, James; Kibira, Simon P S; Lubinga, Solomon J; Mukose, Aggrey; Babigumira, Joseph B

    2015-01-01

    In 2010, the Uganda Ministry of Health introduced its Safe Male Circumcision (SMC) strategy for HIV prevention with the goal of providing 4.2 million voluntary medical male circumcisions by 2015. Fishing communities, where HIV prevalence is approximately 3-5 times higher than the national average, have been identified as a key population needing targeted HIV prevention services by the National HIV Prevention Strategy. This study aimed to understand perceptions of HIV and identify potential barriers and facilitators to SMC in fishing communities along Lake Victoria. We conducted 8 focus group discussions, stratified by sex and age, with 67 purposefully sampled participants in 4 communities in Kalangala District, Uganda. There was universal knowledge of the availability of SMC services, but males reported high uptake in the community while females indicated that it is low. Improved hygiene, disease prevention, and improved sexual performance and desirability were reported facilitators. Barriers included a perceived increase in SMC recipients' physiological libido, post-surgical abstinence, lost income during convalescence, and lengthier recovery due to occupational hazards. Both males and females reported concerns about spousal fidelity during post-SMC abstinence. Reported misconceptions and community-held cultural beliefs include fear that foreskins are sold after their removal, the belief that a SMC recipient's first sexual partner after the procedure should not be his spouse, and the belief that vaginal fluids aid circumcision wound healing. Previous outreach efforts have effectively reached these remote communities, where availability and health benefits of SMC are widely understood. However, community-specific intervention strategies are needed to address the barriers identified in this study. We recommend the development of targeted counseling, outreach, and communication strategies to address barriers, misconceptions, and community-held beliefs. Interventions

  14. The rise and fall of water hyacinth in Lake Victoria and the Kagera River basin, 1989-2001

    Science.gov (United States)

    Albright, Thomas P.; Moorhouse, T.G.; McNabb, T.J.

    2004-01-01

    Water hyacinth (Eichhornia crassipes (Mart.) Solms) is an invasive aquatic macrophyte associated with major negative economic and ecological impacts to the Lake Victoria region since the plant's establishment in Uganda in the 1980s. Reliable estimates of water hyacinth distribution and extent are required to gauge the severity of the problem through time, relate water hyacinth abundance to environmental factors, identify areas requiring management action, and assess the efficacy of management actions. To provide such estimates and demonstrate the utility of remote sensing for this application, we processed and analyzed remotely sensed imagery to determine the distribution and extent of water hyacinth. Maps were produced and coverage was quantified using a hybrid unsupervised image classification approach with manual editing for each of the riparian countries of Kenya, Tanzania, and Uganda, as well as for numerous gulfs and bays. A similar procedure was carried out for selected lakes in the Rwanda-Tanzania borderlands lakes region in the Kagera River basin. Results confirm the severity of the water hyacinth infestation, especially in the northern parts of the lake. A maximum lake-wide extent of at least 17,374 ha was attained in 1998. Following this, a combination of factors, including conditions associated with the 1997 to 1998 El Nin??o and biocontrol with water hyacinth weevils, appear to have contributed to a major decline in water hyacinth in the most affected parts of the lake. Some lakes in the Kagera basin, such as Lake Mihindi, Rwanda, were severely infested in the late 1990s, but the level of infestation in most of these decreased markedly by the early 2000s.

  15. AcEST: DK949817 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Drosophila melanogast... 34 0.58 sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria... m... 33 0.99 sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria m... 33 1.7 s... 32 3.8 sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 31 4.... 3956 >sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria marburgvirus (strain Popp-67) GN=VP30 ... NHH R+ ++T Sbjct: 11 RNHQTASSIYHETQLPSKPHYTNHHPRARSMSST 44 >sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria

  16. Visual adaptation in Lake Victoria cichlid fishes: depth-related variation of color and scotopic opsins in species from sand/mud bottoms.

    Science.gov (United States)

    Terai, Yohey; Miyagi, Ryutaro; Aibara, Mitsuto; Mizoiri, Shinji; Imai, Hiroo; Okitsu, Takashi; Wada, Akimori; Takahashi-Kariyazono, Shiho; Sato, Akie; Tichy, Herbert; Mrosso, Hillary D J; Mzighani, Semvua I; Okada, Norihiro

    2017-08-22

    For Lake Victoria cichlid species inhabiting rocky substrates with differing light regimes, it has been proposed that adaptation of the long-wavelength-sensitive (LWS) opsin gene triggered speciation by sensory drive through color signal divergence. The extensive and continuous sand/mud substrates are also species-rich, and a correlation between male nuptial coloration and the absorption of LWS pigments has been reported. However, the factors driving genetic and functional diversity of LWS pigments in sand/mud habitats are still unresolved. To address this issue, nucleotide sequences of eight opsin genes were compared in ten Lake Victoria cichlid species collected from sand/mud bottoms. Among eight opsins, the LWS and rod-opsin (RH1) alleles were diversified and one particular allele was dominant or fixed in each species. Natural selection has acted on and fixed LWS alleles in each species. The functions of LWS and RH1 alleles were measured by absorption of reconstituted A1- and A2-derived visual pigments. The absorption of pigments from RH1 alleles most common in deep water were largely shifted toward red, whereas those of LWS alleles were largely shifted toward blue in both A1 and A2 pigments. In both RH1 and LWS pigments, A2-derived pigments were closer to the dominant light in deep water, suggesting the possibility of the adaptation of A2-derived pigments to depth-dependent light regimes. The RH1 and LWS sequences may be diversified for adaptation of A2-derived pigments to different light environments in sand/mud substrates. Diversification of the LWS alleles may have originally taken place in riverine environments, with a new mutation occurring subsequently in Lake Victoria.

  17. “Todo lo que sigue es sencillamente estupendo”. Escritoras en las cartas de Ezequiel Martínez Estrada a Victoria Ocampo

    Directory of Open Access Journals (Sweden)

    Tania Diz

    2016-11-01

    Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.

  18. Anthropogenic Factors Are the Major Cause of Hospital Admission of a Threatened Species, the Grey-Headed Flying Fox (Pteropus poliocephalus), in Victoria, Australia.

    Science.gov (United States)

    Scheelings, Titus Franciscus; Frith, Sarah Elizabeth

    2015-01-01

    To determine the reasons for presentation and outcomes of hospitalised grey-headed flying foxes (Pteropus poliocephalus) in Victoria, Australia, a retrospective analysis was performed on 532 records from two wildlife hospitals. Cases were categorised based on presenting signs and outcomes determined. Anthropogenic factors (63.7%) were a major cause of flying fox admissions with entanglement in fruit netting the most significant risk for bats (36.8%). Overall the mortality rate for flying fox admissions was 59.3%. This study highlights the effects of urbanisation on wild animal populations and a need for continued public education in order to reduce morbidity and mortality of wildlife, especially threatened species.

  19. Reseña de libro: “Golpes. Relatos y memorias de la dictadura” de Dalmaroni, Miguel Ángel y Victoria Torres (ed)

    OpenAIRE

    Cabral, María Celeste

    2017-01-01

    ¿Puede la literatura argentina narrar una vez más la última dictadura? ¿Qué nuevas geografías, temporalidades y experiencias emergen a 40 años del golpe militar? Son las preguntas que trae Golpes. Relatos y memorias de la dictadura, con edición y prólogo de Miguel Dalmaroni y Victoria Torres. El volumen se compone de veinticuatro textos inéditos de autores/as con diferentes trayectorias, en orden de aparición: Gabriela Cabezón Cámara, Inés Garland, Fernanda García Lao, Paula Tomassoni, Carlos...

  20. Do religion and religiosity have anything to do with alcohol consumption patterns? Evidence from two fish landing sites on Lake Victoria Uganda.

    Science.gov (United States)

    Tumwesigye, Nazarius M; Atuyambe, Lynn; Kibira, Simon P S; Wabwire-Mangen, Fred; Tushemerirwe, Florence; Wagner, Glenn J

    2013-09-01

    Fish landing sites have high levels of harmful use of alcohol. This paper examines the role of religion and religiosity on alcohol consumption at two fish landing sites on Lake Victoria in Uganda. Questionnaires were administered to randomly selected people at the sites. Dependent variables included alcohol consumption during the previous 30 days, whereas the key independent variables were religion and religiosity. Bivariate and multivariate analysis techniques were applied. People reporting low religiosity were five times more likely to have consumed alcohol (95% confidence interval: 2.45-10.04) compared with those reporting low/average religiosity. Religion and religiosity are potential channels for controlling alcohol use.

  1. Creating a sustainable and effective mental health workforce for Gippsland, Victoria: solutions and directions for strategic planning.

    Science.gov (United States)

    Sutton, Keith P; Maybery, Darryl; Moore, Terry

    2011-01-01

    The Gippsland region of Victoria, in common with other Australian rural and regional areas, is experiencing a shortage of qualified mental health professionals. Attracting mental health professionals to work in such areas is a major concern for service providers, policy-makers and rural/regional communities. Previous studies have focused on identifying factors contributing to the maldistribution of the health workforce, principally medical practitioners. Recent reviews have highlighted the strengths and weaknesses of evidence for the effectiveness of initiatives designed to address workforce shortages in underserved locations. The reported study sought the views of mental health organisation leaders from Gippsland to identify current approaches and potential solutions to the challenges of workforce recruitment, retention and training. A key goal of the study was to inform a strategic regional approach to the development of a more sustainable and effective mental health workforce. Investigators conducted semi-structured individual interviews with 26 administrators, managers and senior clinicians from public and private sector mental health organisations throughout Gippsland. Thematic content analysis of the transcribed interviews identified current approaches and potential solutions to the recruiting, retaining and training problems in the region. The study categorised solutions as focusing on factors external or internal to organisations. Solutions external to organisations included efforts to enhance the pool of available workers, improve intra-sectoral collaboration and cross-sectoral linkages, make funding more flexible, and to institute a contemporary curriculum and take innovative pedagogical approaches to training. Internal solutions included the need for strong leadership and quality organisational culture, flexible and adaptable approaches to meeting individual worker and community needs, promoting the organisation and local area and adopting models of care

  2. Contraception matters: indicators of poor usage of contraception in sexually active women attending family planning clinics in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Ong Jason

    2012-12-01

    Full Text Available Abstract Background Unintended pregnancy (mistimed or unwanted remains an important health issue for women. The purpose of this study was to determine the prevalence of and factors associated with risk of unintended pregnancy in a sample of Victorian women attending family planning clinics. Methods This cross-sectional survey of three Family Planning Victoria Clinics from April to July 2011 recruited women aged 16-50 years with a male sexual partner in the last 3 months, and not intending to conceive. The questionnaire asked about contraceptive behaviours and important factors that influence contraception use (identified from a systematic literature review. Univariate analysis was calculated for the variables of interest for associations with contraceptive use. An overall multivariate model for being at risk for unintended pregnancy (due to inconsistent or ineffective contraceptive use or non-use was calculated through backward elimination with statistical significance set at Results 1006 surveys were analyzed with 96% of women reporting contraception use in the last 3 months. 37% of women were at risk for unintended pregnancy due to imperfect use (61% inconsistent users; 31% ineffective methods or never using contraception (8%. On multivariate analysis, women at risk for unintended pregnancy compared with women not at risk were 1 partner in the last 3 months (OR 3.2, 95% CI 2.3-4.6. These women were dissatisfied with current contraception (OR 2.5, 95% 1.8-3.5; felt “vulnerable” to pregnancy (OR 2.1, 95% CI 1.6-3.0; were not confident in contraceptive knowledge (OR 2.6, 95% CI 1.5-4.8; were unable to stop to use contraception when aroused (OR 2.1, 95% CI 1.5-2.9 but were comfortable in speaking to a doctor about contraception (OR 2.3, 95% CI 1.1-4.1. Conclusion Despite reported high contraceptive usage, nearly 40% of women were at risk for unintended pregnancy primarily due to inconsistent contraceptive use and use of ineffective

  3. The early postnatal period: Exploring women's views, expectations and experiences of care using focus groups in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Rayner Jo

    2008-07-01

    Full Text Available Abstract Background There is growing evidence from Australia and overseas that the care provided in hospital in the early postnatal period is less than ideal for both women and care providers. Many health services face increasing pressure on hospital beds and have limited physical space available to care for mothers and their babies. We aimed to gain a more in-depth understanding of women's views, expectations and experiences of early postnatal care. Methods We conducted focus groups in rural and metropolitan Victoria, Australia in 2006. Fifty-two people participated in eight focus groups and four interviews. Participants included eight pregnant women, of whom seven were pregnant with their first baby; 42 women who were in the postpartum period (some up to twelve months after the birth of their baby; and two partners. All participants were fluent in English. Focus group guides were developed specifically for the study and explored participants' experiences and/or expectations of early postnatal care in hospital and at home, with an emphasis on length of hospital stay, professional and social support, continuity of care, and rest. Discussions were audio-taped and transcribed verbatim. A thematic network was constructed to describe and connect categories with emerging basic, organizing, and global themes. Results Global themes that emerged were: anxiety and/or fear; and the transition to motherhood and parenting. The needs of first time mothers were considered to be different to the needs of women who had already experienced motherhood. The women in this study were generally concerned about the safety of their new baby, and lacked confidence in themselves as new mothers regarding their ability to care for their baby. There was a consistent view that the physical presence and availability of professional support helped alleviate these concerns, and this was especially the case for women having a first baby. Conclusion Women have anxieties and fears

  4. Contraception matters: indicators of poor usage of contraception in sexually active women attending family planning clinics in Victoria, Australia.

    Science.gov (United States)

    Ong, Jason; Temple-Smith, Meredith; Wong, William C W; McNamee, Kathleen; Fairley, Christopher

    2012-12-23

    Unintended pregnancy (mistimed or unwanted) remains an important health issue for women. The purpose of this study was to determine the prevalence of and factors associated with risk of unintended pregnancy in a sample of Victorian women attending family planning clinics. This cross-sectional survey of three Family Planning Victoria Clinics from April to July 2011 recruited women aged 16-50 years with a male sexual partner in the last 3 months, and not intending to conceive. The questionnaire asked about contraceptive behaviours and important factors that influence contraception use (identified from a systematic literature review). Univariate analysis was calculated for the variables of interest for associations with contraceptive use. An overall multivariate model for being at risk for unintended pregnancy (due to inconsistent or ineffective contraceptive use or non-use) was calculated through backward elimination with statistical significance set at women reporting contraception use in the last 3 months. 37% of women were at risk for unintended pregnancy due to imperfect use (61% inconsistent users; 31% ineffective methods) or never using contraception (8%). On multivariate analysis, women at risk for unintended pregnancy compared with women not at risk were 1 partner in the last 3 months (OR 3.2, 95% CI 2.3-4.6). These women were dissatisfied with current contraception (OR 2.5, 95% 1.8-3.5); felt "vulnerable" to pregnancy (OR 2.1, 95% CI 1.6-3.0); were not confident in contraceptive knowledge (OR 2.6, 95% CI 1.5-4.8); were unable to stop to use contraception when aroused (OR 2.1, 95% CI 1.5-2.9) but were comfortable in speaking to a doctor about contraception (OR 2.3, 95% CI 1.1-4.1). Despite reported high contraceptive usage, nearly 40% of women were at risk for unintended pregnancy primarily due to inconsistent contraceptive use and use of ineffective contraception. Strategies for improving consistency of effective contraception use or greater emphasis on long

  5. Paleoclimatic and paleoecological reconstruction of early Miocene terrestrial equatorial deposits, Rusinga and Mfangano Islands, Lake Victoria, Kenya

    Science.gov (United States)

    Michel, L. A.; Peppe, D. J.; McNulty, K. P.; Driese, S. G.; Lutz, J.; Nightingale, S.; Maxbauer, D. P.; Horner, W. H.; DiPietro, L. M.; Lehmann, T.; Dunsworth, H. M.; Harcourt-Smith, W. E.; Ogondo, J.

    2012-12-01

    Biological responses to climatic shifts are often studied to inform us on future anthropogenic-driven climate change. However, few of these climatic shifts occur over time scales appropriate to modern change and few occur with biota similar to modern. The Miocene Climatic Optimum is an ideal interval to study because of its rapid duration and because it occurred during the rise and proliferation of apes. The sediments on Rusinga and Mfangano Islands, Lake Victoria, Kenya were deposited between 18 and 20 Ma and record a changing equatorial climate just prior to the Miocene Climate Optimum. This location also offers an opportunity to use multiple proxies to constrain climate and landscape, including paleosol geochemistry, paleobotany and paleontology. Additionally, due to the rich fossil preservation on the islands, climatic shifts are framed within the context of early caterrhine evolution. Here, we report a climate shift recorded through three time slices spanning two formations over ~2 myr. The oldest unit, the Wayando Formation, records an arid, probably open ecosystem with pedogenic calcite rhizoliths, a high groundwater table, poorly-formed paleosols and permineralized sedges. The middle time slice, the Grit Member-Fossil Bed Member contact of the Hiwegi Formation, shows evidence of a local saline lake, with desiccation features, satin-spar after gypsum deposits and salt hoppers. Paleobotanical and sedimentological data from roughly contemporaneous strata indicate a warm, highly seasonal environment that supported a mixture of woodland and forested elements across the landscape. The youngest unit, which is within the Kibanga Member of the Hiwegi Formation, displays demonstrable evidence for a closed-canopy multistoried forest with the presence of tree-stump casts and permineralized root systems within a red-brown paleosol. Within the same paleosol horizon, the dental remains of the catarrhines Proconsul and Dendropithecus have been discovered in situ. This

  6. Fear of (reinjury and return to work following compensable injury: qualitative insights from key stakeholders in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Samantha Bunzli

    2017-04-01

    Full Text Available Abstract Background Return to work (RTW is important for recovery post-injury. Fear of (reinjury is a strong predictor of delayed RTW, and therefore much attention has been given to addressing injured workers’ fear beliefs. However, RTW is a socially-negotiated process and it may be important to consider the wider social context of the injured worker, including the beliefs of the key people involved in their RTW journey. Methods This paper involves data collected as part of a wider study in which semi-structured interviews explored RTW from the perspectives of 93 key stakeholders: injured workers, GPs, employers and insurance case managers in Victoria, Australia. Inductive analysis of interview transcripts identified fear of (reinjury as a salient theme across all stakeholder groups. This presented an opportunity to analyse how the wider social context of the injured worker may influence fear and avoidance behaviour. Two co-authors performed inductive analysis of the theme ‘fear of (reinjury’. Codes identified in the data were grouped into five categories. Between and within category analysis revealed three themes describing the contextual factors that may influence fear avoidance and RTW behaviour. Results Theme one described how injured workers engaged in a process of weighing up the risk of (reinjury in the workplace against the perceived benefits of RTW. Theme two described how workplace factors could influence an injured workers’ perception of the risk of (reinjury in the workplace, including confidence that the source of the injury had been addressed, the availability and suitability of alternative duties. Theme three described other stakeholders’ reluctance to accept injured workers back at work because of the fear that they might reinjure themselves. Conclusions Our findings illustrate the need for a contextualised perspective of fear avoidance and RTW behaviour that includes the beliefs of other important people surrounding

  7. Fear of (re)injury and return to work following compensable injury: qualitative insights from key stakeholders in Victoria, Australia.

    Science.gov (United States)

    Bunzli, Samantha; Singh, Nabita; Mazza, Danielle; Collie, Alex; Kosny, Agnieszka; Ruseckaite, Rasa; Brijnath, Bianca

    2017-04-11

    Return to work (RTW) is important for recovery post-injury. Fear of (re)injury is a strong predictor of delayed RTW, and therefore much attention has been given to addressing injured workers' fear beliefs. However, RTW is a socially-negotiated process and it may be important to consider the wider social context of the injured worker, including the beliefs of the key people involved in their RTW journey. This paper involves data collected as part of a wider study in which semi-structured interviews explored RTW from the perspectives of 93 key stakeholders: injured workers, GPs, employers and insurance case managers in Victoria, Australia. Inductive analysis of interview transcripts identified fear of (re)injury as a salient theme across all stakeholder groups. This presented an opportunity to analyse how the wider social context of the injured worker may influence fear and avoidance behaviour. Two co-authors performed inductive analysis of the theme 'fear of (re)injury'. Codes identified in the data were grouped into five categories. Between and within category analysis revealed three themes describing the contextual factors that may influence fear avoidance and RTW behaviour. Theme one described how injured workers engaged in a process of weighing up the risk of (re)injury in the workplace against the perceived benefits of RTW. Theme two described how workplace factors could influence an injured workers' perception of the risk of (re)injury in the workplace, including confidence that the source of the injury had been addressed, the availability and suitability of alternative duties. Theme three described other stakeholders' reluctance to accept injured workers back at work because of the fear that they might reinjure themselves. Our findings illustrate the need for a contextualised perspective of fear avoidance and RTW behaviour that includes the beliefs of other important people surrounding the injured worker (e.g. employers, family members, GPs). Existing models

  8. Monitoring Lake Victoria Water Quality from Space: Opportunities for Strengthening Trans-boundary Information Sharing for Effective Resource Management

    Science.gov (United States)

    Mugo, R. M.; Korme, T.; Farah, H.; Nyaga, J. W.; Irwin, D.; Flores, A.; Limaye, A. S.; Artis, G.

    2014-12-01

    Lake Victoria (LV) is an important freshwater resource in East Africa, covering 68,800 km2, and a catchment that spans 193,000km2. It is an important source of food, energy, drinking and irrigation water, transport and a repository for agricultural, human and industrial wastes generated from its catchment. For such a lake, and a catchment transcending 5 international boundaries, collecting data to guide informed decision making is a hard task. Remote sensing is currently the only tool capable of providing information on environmental changes at high spatio-temporal scales. To address the problem of information availability for LV, we tackled two objectives; (1) we analyzed water quality parameters retrieved from MODIS data, and (2) assessed land cover changes in the catchment area using Landsat data. We used L1A MODIS-Aqua data to retrieve lake surface temperature (LST), total suspended matter (TSM), chlorophyll-a (CHLa) and diffuse attenuation coefficient (KD490) in four temporal periods i.e. daily, weekly, monthly and seasonal scales. An Empirical Orthogonal Function (EOF) analysis was done on monthly data. An analysis of land cover change was done using Landsat data for 3 epochs in order to assess if land degradation contributes to water quality changes. Our results indicate that MODIS-Aqua data provides synoptic views of water quality changes in LV at different temporal scales. The Winam Gulf in Kenya, the shores of Jinja town in Uganda, as well as the Mwanza region in Tanzania represent water quality hotspots due to their relatively high TSM and CHLa concentrations. High levels of KD490 in these areas would also indicate high turbidity and thus low light penetration due to the presence of suspended matter, algal blooms, and/or submerged vegetation. The EOF analysis underscores the areas where LST and water color variability are more significant. The changes can be associated with corresponding land use changes in the catchment, where for instance wetlands are

  9. Cryogenic brines as diagenetic fluids: Reconstructing the diagenetic history of the Victoria Land Basin using clumped isotopes

    Science.gov (United States)

    Staudigel, Philip T.; Murray, Sean; Dunham, Daniel P.; Frank, Tracy D.; Fielding, Christopher R.; Swart, Peter K.

    2018-03-01

    The isotopic analyses (δ13C, δ18O, and Δ47) of carbonate phases recovered from a core in McMurdo Sound by ANtarctic geologic DRILLing (ANDRILL-2A) indicate that the majority of secondary carbonate mineral formation occurred at cooler temperatures than the modern burial temperature, and in the presence of fluids with δ18Owater values ranging between -11 and -6‰ VSMOW. These fluids are interpreted as being derived from a cryogenic brine formed during the freezing of seawater. The Δ47 values were converted to temperature using an in-house calibration presented in this paper. Measurements of the Δ47 values in the cements indicate increasingly warmer crystallization temperatures with depth and, while roughly parallel to the observed geothermal gradient, consistently translate to temperatures that are cooler than the current burial temperature. The difference in temperature suggests that cements formed when they were ∼260 ± 100 m shallower than at the present day. This depth range corresponds to a period of minimal sediment accumulation from 3 to 11 Myr; it is therefore interpreted that the majority of cements formed during this time. This behavior is also predicted by time-integrated modeling of cementation at this site. If this cementation had occurred in the presence of these fluids, then the cryogenic brines have been a longstanding feature in the Victoria Land Basin. Brines such as those found at this site have been described in numerous modern high-latitude settings, and analogous fluids could have played a role in the diagenetic history of other ice-proximal sediments and basins during glacial intervals throughout geologic history. The agreement between the calculated δ18Owater value and the measured values in the pore fluids shows how the Δ47 proxy can be used to identify the origin of negative δ18O values in carbonate rocks and that extremely negative values do not necessarily need to be a result of the influence of meteoric fluids or reaction at

  10. INDIAN INTERNATIONAL STUDENT SAFETY IN MELBOURNE AND THE VICTORIA POLICE – THE DEVELOPMENT OF A CRISIS AND THE PERCEPTIONS THAT PROPELLED IT

    Directory of Open Access Journals (Sweden)

    Maria Fleming

    2012-06-01

    Full Text Available The international education sector is a major export earning industry for the Australian economy according to the Australian Government. It is also central to the nation’s international relations ambitions. However, Australia’s reputation as a safe and welcoming environment has been questioned following a series of highly publicised assaults against international students, particularly Indian nationals studying in Melbourne. This study analyses the effects of the Victoria Police public communications response in 2009 and 2010 to the assaults. In particular, did the Victoria Police Commissioner’s communication response to the assaults positively influence attitudes and perceptions within the Indian international student community and the media? The tools applied in this study originate within a range of traditions in risk communication theory including heuristic and systematic information processing methods, public relations including best practice and dialogic theory, critical discourse analysis, and media content analysis. This study demonstrates that police communications failed to positively influence perceptions and can be seen to have amplified negative perceptions due to a combination of messages and messaging methods that discount theories of risk perception and information processing.

  11. Rehabilitation Utilization following a Work-Related Traumatic Brain Injury: A Sex-Based Examination of Workers' Compensation Claims in Victoria, Australia.

    Directory of Open Access Journals (Sweden)

    E Niki Guerriero

    Full Text Available To report on and examine differences in the use of four types of rehabilitation services (occupational therapy, physiotherapy, psychology, and speech therapy by men and women following a work-related traumatic brain injury in Victoria, Australia; and to examine the importance of demographic, need, work-related and geographic factors in explaining these differences.A retrospective cohort design was used to analyze 1786 work-related traumatic brain injury workers' compensation claims lodged between 2004 and 2012 in Victoria, Australia. ZINB regressions were conducted for each type of rehabilitation service to examine the relationship between sex and rehabilitation use. Covariates included demographic, need-related, work-related, and geographic factors.Out of all claims (63% male, 37% female, 13% used occupational therapy, 23% used physiotherapy, 9% used psychology, and 2% used speech therapy at least once during the first year of service utilization. After controlling for demographic, need-related, work-related, and geographic factors, women were more likely to use physiotherapy compared to men. Men and women were equally likely to use occupational therapy and psychology services. The number of visits in the first year for each type of service did not differ between male and female users.Our findings support a sex-based approach to studying rehabilitation utilization in work-related populations. Future research is needed to examine other factors associated with rehabilitation utilization and to determine the implications of different rehabilitation utilization patterns on health and return-to-work outcomes.

  12. Photo-catalytic activity of Plasmonic Ag@AgCl nanoparticles (synthesized via a green route) for the effective degradation of Victoria Blue B from aqueous phase.

    Science.gov (United States)

    Devi, Th Babita; Begum, Shamima; Ahmaruzzaman, M

    2016-07-01

    This study reports a green process for the fabrication of Ag@AgCl (silver@silver chloride) nanoparticles by using Aquilaria agallocha (AA) leaves juice without using any external reagents. The effect of various reaction parameters, such as reaction temperature, reaction time and concentration of Aquilaria agallocha leaves juice in the formation of nanoparticles have also been investigated. From the FTIR spectra of leaves juice and phytochemicals test, it was found that flavonoids present in the leaves are responsible for the reduction of Ag(+) ions to Ag(0) species and leads to the formation of Ag@AgCl NPs. The synthesized Ag@AgCl NPs were utilized for the removal of toxic and hazardous dyes, such as Victoria Blue B from aqueous phase. Approximately, 99.46% degradation of Victoria Blue B dye were observed with Ag@AgCl NPs. Furthermore, the photocatalytic activity of the Ag@AgCl nanoparticles was unchanged after 5cycles of operation. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Hydro-climatic trends and water resource management implications based on multi-scale data for the Lake Victoria region, Kenya

    Science.gov (United States)

    Koutsouris, A. J.; Destouni, G.; Jarsjö, J.; Lyon, S. W.

    2010-07-01

    Unreliable rainfall may be a main cause of poverty in rural areas, such as the Kisumu district by Lake Victoria in Kenya. Climate change may further increase the negative effects of rainfall uncertainty. These effects could be mitigated to some extent through improved and adaptive water resource management and planning, which relies on our interpretations and projections of the coupled hydro-climatic system behaviour and its development trends. In order to identify and quantify the main differences and consistencies among such hydro-climatic assessments, this study investigates trends and exemplifies their use for important water management decisions for the Lake Victoria drainage basin (LVDB), based on local scale data for the Orongo village in the Kisumu district, and regional scale data for the whole LVDB. Results show low correlation between locally and regionally observed hydro-climatic trends, and large differences, which in turn affects assessments of important water resource management parameters. However, both data scales converge in indicating that observed local and regional hydrological discharge trends are primarily driven by local and regional water use and land use changes.

  14. Schistosoma kisumuensis n. sp. (Digenea: Schistosomatidae) from murid rodents in the Lake Victoria Basin, Kenya and its phylogenetic position within the S. haematobium species group.

    Science.gov (United States)

    Hanelt, B; Brant, S V; Steinauer, M L; Maina, G M; Kinuthia, J M; Agola, L E; Mwangi, I N; Mungai, B N; Mutuku, M W; Mkoji, G M; Loker, E S

    2009-08-01

    Schistosoma kisumuensis n. sp. is described based on 6 adult males and 2 adult females collected from the circulatory system of 3 murid rodent species, Pelomys isseli, Mastomys natalensis, and Dasymys incomtus. Specimens were collected from a single location, Nyabera Swamp, in Kisumu, Kenya in the Lake Victoria Basin. This new species is morphologically similar to members of the S. haematobium group, currently represented by 8 species parasitizing artiodactyls and primates, including humans. Schistosoma kisumuensis differs from these species by producing relatively small Schistosoma intercalatum-like eggs (135.2 x 52.9 microm) with a relatively small length to width ratio (2.55). Comparison of approximately 3000-base-pair sequences of nuclear rDNA (partial 28S) and mtDNA (partial cox1, nad6, 12S) strongly supports the status of S. kisumuensis as a new species and as a sister species of S. intercalatum. The cox1 genetic distance between these two species (6.3%) is comparable to other pairwise comparisons within the S. haematobium group. Separation of the Congo River and Lake Victoria drainage basins is discussed as a possible factor favoring the origin of this species.

  15. Determination of selected antibiotics in the Victoria Harbour and the Pearl River, South China using high-performance liquid chromatography-electrospray ionization tandem mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Xu Weihai [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou, Guangzhou 510640 (China); School of Chemistry and Chemical Engineering, Zhongshan University, Guangzhou 510250 (China); Department of Civil and Structural Engineering, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China); Post-graduate School of the Chinese Academy of Sciences, Beijing 100039 (China); Zhang Gan [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou, Guangzhou 510640 (China)]. E-mail: zhanggan@gig.ac.cn; Zou Shichun [School of Chemistry and Chemical Engineering, Zhongshan University, Guangzhou 510250 (China); Li Xiangdong [Department of Civil and Structural Engineering, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China); Liu Yuchun [School of Chemistry and Chemical Engineering, Zhongshan University, Guangzhou 510250 (China)

    2007-02-15

    Nine selected antibiotics in the Victoria Harbour of Hong Kong and the Pearl River at Guangzhou, South China, were analyzed using high-performance liquid chromatography-electrospray ionization tandem mass spectrometry. The results showed that the concentrations of antibiotics were mainly below the limit of quantification (LOQ) in the marine water of Victoria Harbour. However, except for amoxicillin, all of the antibiotics were detected in the Pearl River during high and low water seasons with the median concentrations ranging from 11 to 67 ng/L, and from 66 to 460 ng/L, respectively; and the concentrations in early spring were about 2-15 times higher than that in summer with clearer diurnal variations. It was suggested that the concentrations of antibiotics in the high water season were more affected by wastewater production cycles due to quick refreshing rate, while those in the low water season may be more sensitive to the water column dynamics controlled by tidal processes in the river. - Antibiotics were found at high concentrations in an urban reach of Pearl River in southern China with contrast diurnal variations between the high and low water seasons.

  16. Evolution of the Lake Victoria basin in the context of coeval rift initiation in East Africa: a 3D numerical model approach

    Science.gov (United States)

    Wichura, Henry; Quinteros, Javier; Melnick, Daniel; Brune, Sascha; Schwanghart, Wolfgang; Strecker, Manfred R.

    2015-04-01

    Over the last four years sedimentologic and thermochronologic studies in the western and eastern branches of the Cenozoic East African Rift System (EARS) have supported the notion of a broadly contemporaneous onset of normal faulting and rift-basin formation in both segments. These studies support previous interpretations based on geophysical investigations from which an onset of rifting during the Paleogene had been postulated. In light of these studies we explore the evolution of the Lake Victoria basin, a shallow, unfaulted sedimentary basin centered between both branches of the EARS and located in the interior of the East African Plateau (EAP). We quantify the fluvial catchment evolution of the Lake Victoria basin and assess the topographic response of African crust to the onset of rifting in both branches. Furthermore, we evaluate and localize the nature of strain and flexural rift-flank uplift in both branches. We use a 3D numerical forward model that includes nonlinear temperature- and stress-dependent elasto-visco-plastic rheology. The model is able to reproduce the flexural response of variably thick lithosphere to rift-related deformation processes such as lithospheric thinning and asthenospheric upwelling. The model domain covers the entire EAP and integrates extensional processes in a heterogeneous, yet cold and thick cratonic block (Archean Tanzania craton), which is surrounded by mechanically weaker Proterozoic mobile belts, which are characterized by thinner lithosphere ("thin spots"). The lower limits of the craton (170 km) and the mobile belts (120 km) are simulated by different depths of the 1300 °C lithosphere-asthenosphere boundary. We assume a constant extension rate of 4 mm/a throughout the entire simulation of 30 Ma and neglect the effect of dynamic topography and magmatism. Even though the model setup is very simple and the resolution is not high enough to calculate realistic rift-flank uplift, it intriguingly reveals important topographic

  17. Replacing Victoria's Scientific Culture

    Directory of Open Access Journals (Sweden)

    Iwan Morus

    2006-04-01

    Full Text Available Traditional views of nineteenth century science has viewed it in terms of a largely unproblematic institutional consolidation. More recently, the consensus view of the century as a period of leisurely progress towards scientific professionalization has been decisively broken. In particular the issues of what counted as science at all and what sorts of spaces counted as scientific have been rigorously contested. A variety of new accounts of Victorian science have now emerged, built around new sets of questions concerning science's place in culture and the emergence of new strategies of self-fashioning and legitimation. In this overview I survey promising trends in the cultural history of nineteenth-century science with a view to assessing the possibility of resurrecting a new grand narrative. I suggest in conclusion that the possibility of reconstructing such a big picture as an explicitly political account might be improved by rethinking the category of Victorian science and reorienting our understanding around the French Revolution and its immediate aftermath.

  18. Replacing Victoria's Scientific Culture

    OpenAIRE

    Iwan Morus

    2006-01-01

    Traditional views of nineteenth century science has viewed it in terms of a largely unproblematic institutional consolidation. More recently, the consensus view of the century as a period of leisurely progress towards scientific professionalization has been decisively broken. In particular the issues of what counted as science at all and what sorts of spaces counted as scientific have been rigorously contested. A variety of new accounts of Victorian science have now emerged, built around new ...

  19. Lake Victoria basin

    African Journals Online (AJOL)

    measured using a portable echo sounder prior to collecting samples. The net was lowered close to the bottom and then slowly hauled to allow the water to be ... counting chamber and examined under the microscope at x 40 magnification. Taxonomic identification was done using. identification keys as adopted by Ruttner-.

  20. Omanimeline peenar / Victoria Parmas

    Index Scriptorium Estoniae

    Parmas, Victoria

    2012-01-01

    Taimi võib istutusalasse valida erineval põhimõttel: värvi, otstarbe, ühe perekonna või liigi taimede järgi. Üks võimalus on teha aeda perekonna- või suguvõsapeenar, kus kasvavad pereliikmete või sugulaste nimedega taimed. Oma nimega taimi otsi järgmistelt lehekülgedelt: http://apps.rhs.org.uk/rhsplantfinder/; http://apps.rhs.uk/horticulturaldatabase.index.asp

  1. Holistic view to integrated climate change assessment and extreme weather adaptation in the Lake Victoria Basin East Africa

    Science.gov (United States)

    Mutua, F.; Koike, T.

    2013-12-01

    Extreme weather events have been the leading cause of disasters and damage all over the world.The primary ingredient to these disasters especially floods is rainfall which over the years, despite advances in modeling, computing power and use of new data and technologies, has proven to be difficult to predict. Also, recent climate projections showed a pattern consistent with increase in the intensity and frequency of extreme events in the East African region.We propose a holistic integrated approach to climate change assessment and extreme event adaptation through coupling of analysis techniques, tools and data. The Lake Victoria Basin (LVB) in East Africa supports over three million livelihoods and is a valuable resource to five East African countries as a source of water and means of transport. However, with a Mesoscale weather regime driven by land and lake dynamics,extreme Mesoscale events have been prevalent and the region has been on the receiving end during anomalously wet years in the region. This has resulted in loss of lives, displacements, and food insecurity. In the LVB, the effects of climate change are increasingly being recognized as a significant contributor to poverty, by its linkage to agriculture, food security and water resources. Of particular importance are the likely impacts of climate change in frequency and intensity of extreme events. To tackle this aspect, this study adopted an integrated regional, mesoscale and basin scale approach to climate change assessment. We investigated the projected changes in mean climate over East Africa, diagnosed the signals of climate change in the atmosphere, and transferred this understanding to mesoscale and basin scale. Changes in rainfall were analyzed and similar to the IPCC AR4 report; the selected three General Circulation Models (GCMs) project a wetter East Africa with intermittent dry periods in June-August. Extreme events in the region are projected to increase; with the number of wet days

  2. An Integrated Hydrological and Water Management Study of the Entire Nile River System - Lake Victoria to Nile Delta

    Science.gov (United States)

    Habib, Shahid; Zaitchik, Benjamin; Alo, Clement; Ozdogan, Mutlu; Anderson, Martha; Policelli, Fritz

    2011-01-01

    The Nile basin River system spans 3 million km(exp 2) distributed over ten nations. The eight upstream riparian nations, Ethiopia, Eretria, Uganda, Rwanda, Burundi, Congo, Tanzania and Kenya are the source of approximately 86% of the water inputs to the Nile, while the two downstream riparian countries Sudan and Egypt, presently rely on the river's flow for most of the their needs. Both climate and agriculture contribute to the complicated nature of Nile River management: precipitation in the headwaters regions of Ethiopia and Lake Victoria is variable on a seasonal and inter-annual basis, while demand for irrigation water in the arid downstream region is consistently high. The Nile is, perhaps, one of the most difficult trans-boundary water issue in the world, and this study would be the first initiative to combine NASA satellite observations with the hydrologic models study the overall water balance in a to comprehensive manner. The cornerstone application of NASA's Earth Science Research Results under this project are the NASA Land Data Assimilation System (LDAS) and the USDA Atmosphere-land Exchange Inverse (ALEXI) model. These two complementary research results are methodologically independent methods for using NASA observations to support water resource analysis in data poor regions. Where an LDAS uses multiple sources of satellite data to inform prognostic simulations of hydrological process, ALEXI diagnoses evapotranspiration and water stress on the basis of thermal infrared satellite imagery. Specifically, this work integrates NASA Land Data Assimilation systems into the water management decision support systems that member countries of the Nile Basin Initiative (NBI) and Regional Center for Mapping of Resources for Development (RCMRD, located in Nairobi, Kenya) use in water resource analysis, agricultural planning, and acute drought response to support sustainable development of Nile Basin water resources. The project is motivated by the recognition that

  3. Predominance of influenza A(H1N1)pdm09 virus genetic subclade 6B.1 and influenza B/Victoria lineage viruses at the start of the 2015/16 influenza season in Europe

    DEFF Research Database (Denmark)

    Broberg, Eeva; Melidou, Angeliki; Prosenc, Katarina

    2016-01-01

    Influenza A(H1N1)pdm09 viruses predominated in the European influenza 2015/16 season. Most analysed viruses clustered in a new genetic subclade 6B.1, antigenically similar to the northern hemisphere vaccine component A/California/7/2009. The predominant influenza B lineage was Victoria compared w...

  4. Predominance of influenza A(H1N1)pdm09 virus genetic subclade 6B.1 and influenza B/Victoria lineage viruses at the start of the 2015/16 influenza season in Europe

    DEFF Research Database (Denmark)

    Broberg, Eeva; Melidou, Angeliki; Prosenc, Katarina

    2016-01-01

    Influenza A(H1N1)pdm09 viruses predominated in the European influenza 2015/16 season. Most analysed viruses clustered in a new genetic subclade 6B.1, antigenically similar to the northern hemisphere vaccine component A/California/7/2009. The predominant influenza B lineage was Victoria compared...

  5. Estudio cap de dengue en los distritos de Cercado de Lima, La Victoria y San Luis. Lima, Perú. junio 2004

    Directory of Open Access Journals (Sweden)

    Ronal Jamanca S

    2005-03-01

    Full Text Available Objetivos: Determinar el nivel de conocimientos, actitudes y prácticas con respecto al dengue en la población de tres distritos de Lima, Perú: Lima Cercado, La Victoria y San Luis. Materiales y Métodos: Estudio descriptivo, transversal y prospectivo, basado en la población, el tamaño muestral calculado para un índice aédico de 1%, se usó un muestreo bietápico. Se usó una entrevista estructurada de 17 preguntas cerradas, aplicada por personal de saneamiento ambiental o promotores de salud capacitados, a la primera persona adulta que atendía en la vivienda seleccionada. Los datos fueron ingresados en Epi Info v.6 y analizados en SPSS v.11. Resultados: Se entrevistó a 5381 pobladores, el promedio de edad de lo participantes fue de 42±16 años, las dos terceras partes fueron mujeres y 76% tenían un nivel de educación secundaria o superior. El 69,2% manifestó conocer el dengue, sin embargo sólo 65,4% de los que declaraban conocerlo tenían un conocimiento aceptable. 121 entrevistados (2,1% refirieron picaduras matutinas en los miembros inferiores, sospechosas de Aedes aegypti. El 55,1% de los entrevistados practicaban almacenamiento de agua en sus viviendas, siendo La Victoria el lugar más frecuente con esta práctica (65,8%. En comparación con los que hicieron estudios escolares en el norte del país, los que estudiaron en la sierra tuvieron significativamente menor conocimiento del dengue (OR= 2,21; IC 95%: 1,72-2,83. Conclusiones: Es necesario implementar actividades intersectoriales de promoción, prevención y control del dengue, especialmente en la jurisdicción de la Victoria y en aquellas personas provenientes de la sierra; así como, fortalecer la vigilancia entomológica, sobretodo en aquellas viviendas donde se reporta picaduras sospechosas de Aedes aegypti.

  6. Drying out the Nile? Regional Climate Change and Water Resources in East Africa with a focus on Lake Victoria and Lake Tana

    Science.gov (United States)

    Mottram, Ruth; Fox Maule, Cathrine; Thejll, Peter; Stendel, Martin; Drews, Martin; Davies, Sarah; Lamb, Henry

    2014-05-01

    The East African lakes Victoria and Tana are important local water resources for agriculture, fisheries and hydropower; they are also the main sources of the Nile. In this study we focus on the evaporative and evapotranspirative regimes of the hydrological basins for Lakes Tana and Victoria to determine how regional climate change under the A1B scenario is likely to affect the local and regional hydrology. We show results from a very high resolution (10km) simulation, where the state-of-the-art regional climate model (RCM) HIRHAM5 was driven by the global circulation model (GCM) ECHAM5 under the A1B scenario. Three time-slices have been investigated for present day (1980-1999), mid-century (2046-2065) and end of the 21st century (2080-2099) periods. Our analysis includes a comparison with a coarser 0.44o (~50 km) resolution run which demonstrates the importance of using high resolution (10km or higher) in RCM studies of this type to correctly simulate the seasonal and geographical characteristics of the present day east African monsoon system. The projections also indicate that climate change under the intermediate SRES A1B scenario is expected to cause more frequent failures of the East African rains with important consequences for the region and for the hydrology of the East African Lakes. This work introduces the proposed DACEA (Drivers of Aridity Change in East Africa) project which aims to investigate regional and global teleconnections that affect aridity in East Africa. Future work will combine climate palaeoproxies from Lake Tana and Lake Victoria with model experiments carried out with the EC-Earth coupled Ocean-Atmosphere General Circulation Model and downscaled to very high resolution with the RCM HIRHAM5 to determine regional and global scale influences on the African monsoon system. The HIRHAM5 simulations will be dynamically coupled to a regional hydrological model based on MIKE SHE, to evaluate the consequences and the feedback from the regional

  7. Family Violence in Domestic Homicides: A Case Study of Women Who Killed Intimate Partners Post-Legislative Reform in Victoria, Australia.

    Science.gov (United States)

    Tyson, Danielle; Kirkwood, Deborah; Mckenzie, Mandy

    2016-05-18

    This article examines the impact of legislative reforms enacted in 2005 in Victoria, Australia, on legal responses to women charged with murder for killing their intimate partner. The reforms provided for a broader understanding of the context of family violence to be considered in such cases, but we found little evidence of this in practice. This is partly attributable to persistent misconceptions among the legal profession about family violence and why women may believe it necessary to kill a partner. We recommend specialized training for legal professionals and increased use of family violence evidence to help ensure women's claims of self-defense receive appropriate responses from Victorian courts. © The Author(s) 2016.

  8. An investigation into dentists' perceptions of barriers to providing care of dental trauma to permanent maxillary incisors in children in Victoria, Australia.

    Science.gov (United States)

    Yeng, T; Parashos, P

    2007-09-01

    Perceived barriers in the treatment of dental trauma may influence the optimum management of dental trauma. Any hesitation that dentists might have in managing dental trauma is important to investigate. The aim of this study was to investigate dentists' perceptions of barriers to providing care of dental trauma to permanent maxillary incisors in children. A self-completion questionnaire survey containing six questions on demographic data and 15 questions relating to barriers to treating dental trauma was mailed to 693 dentists in Victoria, Australia. The response rate achieved was 61 per cent. Of the respondents, 90 per cent had no hesitation in treating dental injuries and 80 per cent of these frequently agreed that dentists should treat all dental trauma. Approximately half the dentists (51.5 per cent) frequently found uncooperative children to be the main barrier to providing care. The overall consensus from the present study was that treating dental trauma is not unappealing for dentists in general practice.

  9. Victoria Ocampo – Thomas Merton Diálogos y búsqueda de Dios entre el Norte y Sur de América

    Directory of Open Access Journals (Sweden)

    María Cristina Viñuela

    2015-04-01

    Full Text Available Editorial Sur recientemente ha publicado el epistolario que se conserva entre Thomas Merton y Victoria Ocampo bajo el título Fragmentos de un regalo. El título responde a la forma en que Francisco R. de Pascual, monje cisterciense de la Abadía de Viaceli (España y prologuista del libro, presenta el texto. Considera esta experiencia lectiva un auténtico acontecimiento de gracia. Se apropia la expresión de Merton respecto de las cartas de Ocampo al llamarlas un “regalo de Dios”. En sus manos tiene fragmentos de este regalo, ya que el epistolario está incompleto, seguramente por voluntad de los propios autores al no conservar cartas de mayor confidencialidad.

  10. Water hyacinth Eichhornia crassipes (Mart.) Solms-Laubach dynamics and succession in the Nyanza Gulf of Lake Victoria (east Africa): implications for water quality and biodiversity conservation.

    Science.gov (United States)

    Gichuki, John; Omondi, Reuben; Boera, Priscillar; Okorut, Tom; Matano, Ally Said; Jembe, Tsuma; Ofulla, Ayub

    2012-01-01

    This study, conducted in Nyanza Gulf of Lake Victoria, assessed ecological succession and dynamic status of water hyacinth. Results show that water hyacinth is the genesis of macrophyte succession. On establishment, water hyacinth mats are first invaded by native emergent macrophytes, Ipomoea aquatica Forsk., and Enydra fluctuans Lour., during early stages of succession. This is followed by hippo grass Vossia cuspidata (Roxb.) Griff. in mid- and late stages whose population peaks during climax stages of succession with concomitant decrease in water hyacinth biomass. Hippo grass depends on water hyacinth for buoyancy, anchorage, and nutrients. The study concludes that macrophyte succession alters aquatic biodiversity and that, since water hyacinth infestation and attendant succession are a symptom of broader watershed management and pollution problems, aquatic macrophyte control should include reduction of nutrient loads and implementing multifaceted approach that incorporates biological agents, mechanical/manual control with utilization of harvested weed for cottage industry by local communities.

  11. Linking Land Use Changes to Surface Water Quality Variability in Lake Victoria: Some Insights From Remote Sensing (GC41B-1101)

    Science.gov (United States)

    Limaye, Ashutosh; Mugo, Robinson; Wanjohi, James; Farah, Hussein; Wahome, Anastasia; Flores, Africa; Irwin, Dan

    2016-01-01

    Various land use changes driven by urbanization, conversion of grasslands and woodlands into farmlands, intensification of agricultural practices, deforestation, land fragmentation and degradation are taking place in Africa. In Kenya, agriculture is the main driver of land use conversions. The impacts of these land use changes are observable in land cover maps, and eventually in the hydrological systems. Reduction or change of natural vegetation cover types increases the speed of surface runoff and reduces water and nutrient retention capacities. This can lead to high nutrient inputs into lakes, resulting in eutrophication, siltation and infestation of floating aquatic vegetation. To assess if changes in land use could be contributing to increased phytoplankton blooms and sediment loads into Lake Victoria, we analyzed land use land cover data from Landsat, as well as surface chlorophyll-a and total suspended matter from MODIS-Aqua sensor.

  12. A sensitive surface-enhanced Raman scattering method for chondroitin sulfate with Victoria blue 4R molecular probes in nanogold sol substrate.

    Science.gov (United States)

    Luo, Yanghe; Wang, Xiaoliang; Liu, Qingye; Liang, Aihui; He, Xingcun; Jiang, Zhiliang

    2017-08-11

    Using silver nanoparticles (AgNPs) as the nanocatalyst, l-cysteine rapidly reduced HAuCl4 to make a stable gold nanoparticle sol (Ag/AuNP) that had a high surface-enhanced Raman scattering (SERS) activity in the presence of Victoria blue 4R (VB4r) molecular probes. Under the selected conditions, chondroitin sulfate (Chs) reacted with the VB4r probes to form associated complexes that caused the SERS effect to decrease to 1618 cm(-1) . The decreased SERS intensity was linear to the Chs concentration in the range 3.1-500 ng/ml, with a detection limit of 1.0 ng/ml Chs. Accordingly, we established a simple and sensitive SERS quantitative analysis method to determine Chs in real samples, with a relative standard deviation of 1.47-3.16% and a recovery rate of 97.6-104.2%. Copyright © 2017 John Wiley & Sons, Ltd.

  13. Cumulate xenoliths from Mt. Overlord, northern Victoria Land, Antarctica: A window into high pressure storage and differentiation of mantle-derived basalts

    Science.gov (United States)

    Perinelli, Cristina; Gaeta, Mario; Armienti, Pietro

    2017-01-01

    The alkaline basaltic magmas at Mt. Overlord (northern Victoria Land, Antarctica) entrained abundant ultramafic xenoliths (wehrlites, clinopyroxenites and hornblendites). Textures, bulk rock compositions, mineral chemistry and thermobarometric calculations indicate that the xenoliths represent cumulates that crystallised at the mantle-crust boundary. In particular, the major and trace element compositions of the bulk rocks and minerals indicate that the Mt. Overlord cumulates were formed through processes of crystal fractionation that affected hydrous basanitic magmas. Some of the xenoliths have textural features that suggest a lengthy (> 13 Myr) post-emplacement history at relatively low temperatures (1050-1100 °C) and high pressures (0.8 to 1.4 GPa) and that their primary parental melts were therefore related to the earliest phases of Cenozoic magmatism. These processes produced a ;wet and hot deep zone; that had a strong influence on the thermochemical evolution of the lower crust beneath Mt. Overlord.

  14. Characterization of Hymenobacter isolates from Victoria Upper Glacier, Antarctica reveals five new species and substantial non-vertical evolution within this genus.

    Science.gov (United States)

    Klassen, Jonathan L; Foght, Julia M

    2011-01-01

    We isolated several Hymenobacter-like strains from Victoria Upper Glacier, Antarctica, basal ice that diverged substantially from currently defined Hymenobacter species according to their 16S rRNA and gyrB gene phylogenies. All strains were psychrotolerant, heterotrophic aerobes which grew preferentially on low salt and low nutrient strength agar. Further phenotypic and chemotaxonomic characterization of these isolates supported their assignment as five novel species: H. algoricola sp. nov., H. antarcticus sp. nov., H. elongatus sp. nov., H. fastidiosus sp. nov., and H. glaciei sp. nov. Remarkable among these data was the prevalence of horizontal gene transfers and phenotypic variation, even between apparently closely related strains. These results suggest extensive non-vertical evolution within the genus Hymenobacter, and may reflect evolutionary trajectories resulting from dormancy, e.g., during interment in glacial ice.

  15. Trends in children's physical activity and weight status in high and low socio-economic status areas of Melbourne, Victoria, 1985-2001.

    Science.gov (United States)

    Salmon, Jo; Timperio, Anna; Cleland, Verity; Venn, Alison

    2005-08-01

    To examine trends in active transport to and from school, in school sport and physical education (PE), and in weight status among children from high and low socio-economic status (SES) areas in Melbourne, Victoria, between 1985 and 2001. Cross-sectional survey data and measured height and weight from 1985 (n=557) and 2001 (n=926) were compared for children aged between 9-13 years within high and low SES areas. From 1985 to 2001, the frequency of walking to or from school declined (4.38 +/- 4.3 vs. 3.61 +/- 3.8 trips/wk, ptrips/wk, ptime as increases in overweight and obesity among Australian children. Promoting active school transport and maintaining school sport and PE should be important public health priorities in Australia. Current inequities in school sport and PE and in prevalence of overweight and obesity by area-level SES also need to be addressed.

  16. Water Hyacinth Eichhornia crassipes (Mart. Solms-Laubach Dynamics and Succession in the Nyanza Gulf of Lake Victoria (East Africa: Implications for Water Quality and Biodiversity Conservation

    Directory of Open Access Journals (Sweden)

    John Gichuki

    2012-01-01

    Full Text Available This study, conducted in Nyanza Gulf of Lake Victoria, assessed ecological succession and dynamic status of water hyacinth. Results show that water hyacinth is the genesis of macrophyte succession. On establishment, water hyacinth mats are first invaded by native emergent macrophytes, Ipomoea aquatica Forsk., and Enydra fluctuans Lour., during early stages of succession. This is followed by hippo grass Vossia cuspidata (Roxb. Griff. in mid- and late stages whose population peaks during climax stages of succession with concomitant decrease in water hyacinth biomass. Hippo grass depends on water hyacinth for buoyancy, anchorage, and nutrients. The study concludes that macrophyte succession alters aquatic biodiversity and that, since water hyacinth infestation and attendant succession are a symptom of broader watershed management and pollution problems, aquatic macrophyte control should include reduction of nutrient loads and implementing multifaceted approach that incorporates biological agents, mechanical/manual control with utilization of harvested weed for cottage industry by local communities.

  17. High concentrations of polycyclic aromatic hydrocarbons found in water and sediments of car wash and Kisat areas of Winam Gulf, Lake Victoria-Kenya.

    Science.gov (United States)

    Kwach, B O; Lalah, J O

    2009-11-01

    Mean concentrations of selected USEPA priority polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water samples from Car Wash and Kisat areas of Winam Gulf, Lake Victoria in Kenya have been determined using GC-FID and GC-MS. Sampling was done during the rainy season in April 2006. The PAH concentrations in sediment and water ranged from 0.04 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively, depending upon the sampling location. The total concentration levels of PAHs in both the sediment and water phase in this study were found to be much higher compared with those reported from other regions worldwide, revealing significant PAH pollution of Car Wash and Kisat areas of Kisumu city bay as a consequent of anthropogenic activities as described in the text. The GC-detected PAHs were confirmed by GC-MS.

  18. Spartial and seasonal variations in concentrations of polycyclic aromatic hydrocarbons in water and sediment of Kisumu City bay of Winam Gulf, Lake Victoria-Kenya.

    Science.gov (United States)

    Kwach, Bowa O; Lalah, Joseph O; Shem, Wandiga O

    2009-11-01

    Seasonal and offshore concentration variations for selected sixteen priority pollutant polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water of Car Wash and Kisat areas of Winam Gulf, Lake Victoria, have been investigated. PAHs concentrations in sediments and water range from 0.4 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively. Statistical analysis of the PAHs concentrations showed that the most contaminated samples are found during rainy season (April, 2006), 5 m offshore for sediments and 10 m offshore for water. Dry season (October, 2005) generally recorded lower concentrations. The variations showed significant difference (p < or = 0.05) with season and distance of sampling from the shore.

  19. Are sociodemographic characteristics associated with spatial variation in the incidence of OHCA and bystander CPR rates? A population-based observational study in Victoria, Australia.

    Science.gov (United States)

    Straney, Lahn D; Bray, Janet E; Beck, Ben; Bernard, Stephen; Lijovic, Marijana; Smith, Karen

    2016-11-07

    Rates of out-of-hospital cardiac arrest (OHCA) and bystander cardiopulmonary resuscitation (CPR) have been shown to vary considerably in Victoria. We examined the extent to which this variation could be explained by the sociodemographic and population health characteristics of the region. Using the Victorian Ambulance Cardiac Arrest Registry, we extracted OHCA cases occurring between 2011 and 2013. We restricted the calculation of bystander CPR rates to those arrests that were witnessed by a bystander. To estimate the level of variation between Victorian local government areas (LGAs), we used a two-stage modelling approach using random-effects modelling. Between 2011 and 2013, there were 15 830 adult OHCA in Victoria. Incidence rates varied across the state between 41.9 to 104.0 cases/100 000 population. The proportion of the population over 65, socioeconomic status, smoking prevalence and education level were significant predictors of incidence in the multivariable model, explaining 93.9% of the variation in incidence among LGAs. Estimates of bystander CPR rates for bystander witnessed arrests varied from 62.7% to 73.2%. Only population density was a significant predictor of rates in a multivariable model, explaining 73% of the variation in the odds of receiving bystander CPR among LGAs. Our results show that the regional characteristics which underlie the variation seen in rates of bystander CPR may be region specific and may require study in smaller areas. However, characteristics associated with high incidence and low bystander CPR rates can be identified and will help to target regions and inform local interventions to increase bystander CPR rates. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  20. Paleoenvironmental context of the Middle Stone Age record from Karungu, Lake Victoria Basin, Kenya, and its implications for human and faunal dispersals in East Africa.

    Science.gov (United States)

    Faith, J Tyler; Tryon, Christian A; Peppe, Daniel J; Beverly, Emily J; Blegen, Nick; Blumenthal, Scott; Chritz, Kendra L; Driese, Steven G; Patterson, David

    2015-06-01

    The opening and closing of the equatorial East African forest belt during the Quaternary is thought to have influenced the biogeographic histories of early modern humans and fauna, although precise details are scarce due to a lack of archaeological and paleontological records associated with paleoenvironmental data. With this in mind, we provide a description and paleoenvironmental reconstruction of the Late Pleistocene Middle Stone Age (MSA) artifact- and fossil-bearing sediments from Karungu, located along the shores of Lake Victoria in western Kenya. Artifacts recovered from surveys and controlled excavations are typologically MSA and include points, blades, and Levallois flakes and cores, as well as obsidian flakes similar in geochemical composition to documented sources near Lake Naivasha (250 km east). A combination of sedimentological, paleontological, and stable isotopic evidence indicates a semi-arid environment characterized by seasonal precipitation and the dominance of C4 grasslands, likely associated with a substantial reduction in Lake Victoria. The well-preserved fossil assemblage indicates that these conditions are associated with the convergence of historically allopatric ungulates from north and south of the equator, in agreement with predictions from genetic observations. Analysis of the East African MSA record reveals previously unrecognized north-south variation in assemblage composition that is consistent with episodes of population fragmentation during phases of limited dispersal potential. The grassland-associated MSA assemblages from Karungu and nearby Rusinga Island are characterized by a combination of artifact types that is more typical of northern sites. This may reflect the dispersal of behavioral repertoires-and perhaps human populations-during a paleoenvironmental phase dominated by grasslands. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Estimation of type- and subtype-specific influenza vaccine effectiveness in Victoria, Australia using a test negative case control method, 2007-2008

    Directory of Open Access Journals (Sweden)

    Grant Kristina A

    2011-06-01

    Full Text Available Abstract Background Antigenic variation of influenza virus necessitates annual reformulation of seasonal influenza vaccines, which contain two type A strains (H1N1 and H3N2 and one type B strain. We used a test negative case control design to estimate influenza vaccine effectiveness (VE against influenza by type and subtype over two consecutive seasons in Victoria, Australia. Methods Patients presenting with influenza-like illness to general practitioners (GPs in a sentinel surveillance network during 2007 and 2008 were tested for influenza. Cases tested positive for influenza by polymerase chain reaction and controls tested negative for influenza. Vaccination status was recorded by sentinel GPs. Vaccine effectiveness was calculated as [(1 - adjusted odds ratio × 100%]. Results There were 386 eligible study participants in 2007 of whom 50% were influenza positive and 19% were vaccinated. In 2008 there were 330 eligible study participants of whom 32% were influenza positive and 17% were vaccinated. Adjusted VE against A/H3N2 influenza in 2007 was 68% (95% CI, 32 to 85% but VE against A/H1N1 (27%; 95% CI, -92 to 72% and B (84%; 95% CI, -2 to 98% were not statistically significant. In 2008, the adjusted VE estimate was positive against type B influenza (49% but negative for A/H1N1 (-88% and A/H3N2 (-66%; none was statistically significant. Conclusions Type- and subtype-specific assessment of influenza VE is needed to identify variations that cannot be differentiated from a measure of VE against all influenza. Type- and subtype-specific influenza VE estimates in Victoria in 2007 and 2008 were generally consistent with strain circulation data.

  2. The incidence and burden of hospital-treated sports-related injury in people aged 15+ years in Victoria, Australia, 2004-2010: a future epidemic of osteoarthritis?

    Science.gov (United States)

    Finch, C F; Kemp, J L; Clapperton, A J

    2015-07-01

    Previous sports injury is a known risk factor for subsequent osteoarthritis (OA), but population-based rates of sports injury are unknown. The aims of this study were to: (1) describe the trends in the population incidence and burden of all hospital-treated sports injury in Victoria, Australia in adults aged 15+ years; (2) determine the incidence of lower limb and knee injuries; and (3) quantify their population health burden as average direct hospital costs per injury and lengths of stay. Health sector data relating to adults aged 15+ years, for 2004-2010 inclusive, was extracted from the Victorian Admitted Episodes Dataset (VAED) and Victorian Emergency Minimum Dataset (VEMD). Data relating to sports injuries were identified using activity codes in each dataset Trends in injury frequency and rates were determined, and economic burden was calculated. The overall annual rate of hospital treated sports injuries increased by 24% (P = 0.001), and lower limb injuries by 26% (P = 0.001) over the 7 years. The associated accumulated economic burden was $265 million for all sports injuries and $110 million for lower limb injuries over the 7-years. The findings of this study show a significant increase in sports injuries in the state of Victoria, Australia over a 7-year period. As previous sports injury is a risk factor for the development of OA, the future incidence of OA will escalate, placing an even greater burden on health care systems. Population-wide preventative strategies that reduce the risk of sports injury are urgently required in order to reduce the future burden of OA. Copyright © 2015 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  3. Time series analysis of satellite multi-sensors imagery to study the recursive abnormal grow of floating macrophyte in the lake victoria (central Africa)

    Science.gov (United States)

    Fusilli, Lorenzo; Cavalli, Rosa Maria; Laneve, Giovanni; Pignatti, Stefano; Santilli, Giancarlo; Santini, Federico

    2010-05-01

    Remote sensing allows multi-temporal mapping and monitoring of large water bodies. The importance of remote sensing for wetland and inland water inventory and monitoring at all scales was emphasized several times by the Ramsar Convention on Wetlands and from EU projects like SALMON and ROSALMA, e.g. by (Finlayson et al., 1999) and (Lowry and Finlayson, 2004). This paper aims at assessing the capability of time series of satellite imagery to provide information suitable for enhancing the understanding of the temporal cycles shown by the macrophytes growing in order to support the monitor and management of the lake Victoria water resources. The lake Victoria coastal areas are facing a number of challenges related to water resource management which include growing population, water scarcity, climate variability and water resource degradation, invasive species, water pollution. The proliferation of invasive plants and aquatic weeds, is of growing concern. In particular, let us recall some of the problems caused by the aquatic weeds growing: Ø interference with human activities such as fishing, and boating; Ø inhibition or interference with a balanced fish population; Ø fish killing due to removal of too much oxygen from the water; Ø production of quiet water areas that are ideal for mosquito breeding. In this context, an integrated use of medium/high resolution images from sensors like MODIS, ASTER, LANDSAT/TM and whenever available CHRIS offers the possibility of creating a congruent time series allowing the analysis of the floating vegetation dynamic on an extended temporal basis. Although MODIS imagery is acquired daily, cloudiness and other sources of noise can greatly reduce the effective temporal resolution, further its spatial resolution can results not always adequate to map the extension of floating plants. Therefore, the integrated use of sensors with different spatial resolution, were used to map across seasons the evolution of the phenomena. The

  4. Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya

    Directory of Open Access Journals (Sweden)

    David Omondi

    2017-06-01

    Full Text Available Although diverse tick-borne pathogens (TBPs are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April–May; October–December of 2012–2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma, and Hyalomma tick species, ticks were pooled (≤8 individuals by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium, 9.06% Ehrlichia canis, anaplasmosis (6.32% Anaplasma ovis, 14.36% Anaplasma platys, and 3.08% Anaplasma bovis,, and rickettsiosis (6.15% Rickettsia africae, 2.22% Rickettsia aeschlimannii, 4.27% Rickettsia rhipicephali, and 4.95% Rickettsia spp., as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi, and 1.37% Babesia caballi among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7% and Amblyomma nuttalli (100

  5. Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya.

    Science.gov (United States)

    Omondi, David; Masiga, Daniel K; Fielding, Burtram C; Kariuki, Edward; Ajamma, Yvonne Ukamaka; Mwamuye, Micky M; Ouso, Daniel O; Villinger, Jandouwe

    2017-01-01

    Although diverse tick-borne pathogens (TBPs) are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April-May; October-December) of 2012-2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma, and Hyalomma tick species, ticks were pooled (≤8 individuals) by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium, 9.06% Ehrlichia canis), anaplasmosis (6.32% Anaplasma ovis, 14.36% Anaplasma platys, and 3.08% Anaplasma bovis,), and rickettsiosis (6.15% Rickettsia africae, 2.22% Rickettsia aeschlimannii, 4.27% Rickettsia rhipicephali, and 4.95% Rickettsia spp.), as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi, and 1.37% Babesia caballi) among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7%) and Amblyomma nuttalli (100%) sampled from tortoises

  6. A Lipskian analysis of child protection failures from Victoria Climbié to "Baby P": a street-level re-evaluation of joined-up governance.

    Science.gov (United States)

    Marinetto, Michael

    2011-01-01

    This paper explores the issue of joined-up governance by considering child protection failures, firstly, the case of Victoria Climbié who was killed by her guardians despite being known as an at risk child by various public agencies. The seeming inability of the child protection system to prevent Victoria Climbié's death resulted in a public inquiry under the chairmanship of Lord Laming. The Laming report of 2003 looked, in part, to the lack of joined-up working between agencies to explain this failure to intervene and made a number of recommendations to improve joined-up governance. Using evidence from detailed testimonies given by key personnel during the Laming Inquiry, the argument of this paper is that we cannot focus exclusively on formal structures or decision-making processes but must also consider the normal, daily and informal routines of professional workers. These very same routines may inadvertently culminate in the sort of systemic failures that lead to child protection tragedies. Analysis of the micro-world inhabited by professional workers would benefit most, it is argued here, from the policy-based concept of street-level bureaucracy developed by Michael Lipsky some 30 years ago. The latter half of the paper considers child protection failures that emerged after the Laming-inspired reforms. In particular, the case of ‘Baby P’ highlights, once again, how the working practices of street-level professionals, rather than a lack of joined-up systems, may possibly complement an analysis of, and help us to explain, failures in the child protection system. A Lipskian analysis generally offers, although there are some caveats, only pessimistic conclusions about the prospects of governing authorities being able to avoid future child protection disasters. These conclusions are not wholeheartedly accepted. There exists a glimmer of optimism because street-level bureaucrats still remain accountable, but not necessarily in terms of top-down relations of

  7. Roles and competencies of the Support Facilitator in Australia's recovery-oriented mental health initiative: a qualitative study from Gippsland, Victoria.

    Science.gov (United States)

    Sutton, Keith; Isaacs, Anton N; Dalziel, Kim; Maybery, Darryl

    2017-03-01

    Objective This study explored the roles and competencies of Support Facilitators (SFs) engaged in the implementation of the Partners in Recovery initiative in a rural region of Victoria. Methods Semi-structured interviews were conducted with 32 stakeholders involved in the initiative, of which 15 were SFs. Results Two main themes and 10 subthemes emerged from the data: (1) SF competencies (which included an understanding of local services as well as administrative and social skills); and (2) the SF role (which included them being a single point of contact, providing care coordination, assisting the client to become self-reliant, achieving good outcomes for clients with confronting behaviours, judiciously using flexible funding, clearly outlining their role with clients and maintaining boundaries and performing a different role from that of the mental health case manager). Conclusions The roles and competencies of the SF in the Partners in Recovery initiative in Gippsland were congruent with the defined characteristics of a care coordination approach. The results highlight how the SF role differs from that of traditional clinical case managers. These findings are important for future mental health service policy development, education and training of mental health practitioners and recruitment of personnel to care coordination roles. What is known about the topic? There is a growing body of literature highlighting the importance of care coordination in delivery of positive outcomes for people with chronic and complex health problems. However, little is documented about the care coordination role of SFs as part of the Partners in Recovery initiative in Australia. What does this paper add? This paper identifies the roles and competencies of SFs in the Partners in Recovery initiative in a rural region of Victoria. The paper highlights that the emergent competencies and role functions are congruent with the defined characteristics of a care coordination approach but

  8. Petrology, geochronology and emplacement model of the giant 1.37 Ga arcuate Lake Victoria Dyke Swarm on the margin of a large igneous province in eastern Africa

    Science.gov (United States)

    Mäkitie, Hannu; Data, Gabriel; Isabirye, Edward; Mänttäri, Irmeli; Huhma, Hannu; Klausen, Martin B.; Pakkanen, Lassi; Virransalo, Petri

    2014-09-01

    A comprehensive description of the petrography, geochemical composition, Sm-Nd data and intrinsic field relationships of a giant arcuate Mesoproterozoic mafic dyke swarm in SW Uganda is presented for the first time. The swarm is ∼100 km wide and mainly hosted in the Palaeoproterozoic Rwenzori Belt between the Mesoproterozoic Karagwe-Ankole Belt and the Archaean Uganda Block. The dykes trend NW-SE across Uganda, but can be correlated across Lake Victoria to another set of arcuate aeromagnetic anomalies that continue southwards into Tanzania, resulting in a remarkably large semi-circular swarm with an outer diameter of ∼500 km. We propose that this unique giant dyke structure be named the Lake Victoria Dyke Swarm (LVDS). The dykes are tholeiites with Mg numbers between 0.69 and 0.44, and with inherited marked negative Nb and P anomalies in spider diagrams. Two dykes provide Sm-Nd mineral ages of 1368 ± 41 Ma and 1374 ± 42 Ma, with initial εNd values of -2.3 and -3.2, and 87Sr/86Sr ratios of ∼0.706-0.709. Geotectonic discrimination diagrams for the swarm exhibit more arc type than within-plate tectonic signatures, but this is in accordance with systematic enrichments in LREE, U and Th in the dolerites, more likely due to the involvement of the continental lithosphere during their petrogenesis. The LVDS is coeval with a regional ∼1375 Ma bimodal magmatic event across nearby Burundi, Rwanda and NW Tanzania, which can collectively be viewed as a large igneous province (LIP). It also indicates that the nearby Karagwe-Ankole Belt sequences - bracketed between 1.78 and 1.37 Ga and assumed by some to have been deposited within intracratonic basins - were capped by flood basalts that have subsequently been removed by erosion. Different geochemical signatures (e.g. LaN/SmN) suggest that most of the arcuate swarm was derived from an enriched SCLM, whereas related intrusions in the centre of this semi-circular segment have more or less enriched asthenospheric mantle

  9. Trends in sport and active recreation injuries resulting in major trauma or death in adults in Victoria, Australia, 2001-2007.

    Science.gov (United States)

    Andrew, Nadine E; Gabbe, Belinda J; Wolfe, Rory; Cameron, Peter A

    2012-09-01

    The purpose of this study was to describe patterns and rates of sport and active recreation injuries that result in major trauma or death and to examine trends in these rates for all sport and active recreation activities and key sporting groups, for the period July 2001-June 2007, in Victoria, Australia. All sport and active recreation related major trauma cases and deaths were extracted from the Victorian State Trauma Registry (VSTR) and the National Coroners Information System, for the period July 2001-June 2007. Participation data from the Exercise Recreation and Sports Survey (ERASS) was used to establish incidence rates for the group as a whole and for key sporting groups. Poisson regression analysis was used to examine trends in major trauma and death due to participation in sport and active recreation across the six year study period. There were 1019 non-fatal major trauma cases and 218 deaths. The rate of major trauma or death from sport and active recreation injuries was 6.3 per 100,000 participants per year. There was an average annual increase of 10% per year in the major trauma rate (including deaths) across the study period, for the group as a whole (IRR 1.10, 95% CI, 1.06-1.14). There was no increase in the death rate (IRR=0.94, 95% CI, 0.87-1.02; p=0.12). Significant increases were also found for cycling (IRR 1.16, 95% CI, 1.09-1.24) off-road motor sports (IRR 1.10, 95% CI, 1.03-1.19), Australian football (IRR 1.21, 95% CI, 1.03-1.42) and swimming (IRR 1.16, 95% CI, 1.004-1.33). The rate of major trauma inclusive of deaths, due to participation in sport and active recreation has increased over recent years, in Victoria, Australia. Much of this increase can be attributed to cycling, off-road motor sports, Australian football and to a lesser extent swimming, highlighting the need for co-ordinated injury prevention in these areas. Copyright © 2011 Elsevier Ltd. All rights reserved.

  10. THE HUMAN OCCUPATIONS OF EL MIRÓN CAVE (RAMALES DE LA VICTORIA, CANTABRIA, SPAIN DURING THE LAST GLACIAL MAXIMUM/SOLUTREAN PERIOD

    Directory of Open Access Journals (Sweden)

    Lawrence Guy Straus

    2013-11-01

    Full Text Available El Mirón Cave (Ramales de la Victoria, Cantabria, Spain has evidence of brief visits (by hunting parties to the montane zone of the upper Asón valley in easternmost Cantabria during the Last Glacial Maximum with 14C dates ranging between 19.2-18.4 kya uncal BP. Landscapes were largely treeless (scattered pines, with varying degrees of humidity and some amelioration at the end of the sequence of seven levels. Armed with a variety of Solutrean foliate, concave base and shouldered stone points and antler sagaies, decorated with beads of shell, tooth, bone and stone, the visitors camped repeatedly at the rear of the cave vestibule, made informal hearths, hunted red deer and ibex and caught fish, and did some stone knapping of both local and high-quality non-local raw materials. This is one of relatively few montane Solutrean sites known in the Cantabrian region, where, in fact, all major Solutrean base camps are in the coastal zone.La cueva del Mirón (Ramales de la Victoria, Cantabria, España conserva el testimonio de breves visitas de grupos de cazadores al alto valle del Asón, en la zona más oriental de Cantabria, durante el Último Máximo Glacial, con fechas de radiocarbono que oscilan entre los 19200 y 18400 uncal BP. Durante este tiempo, el paisaje carecía casi por completo de árboles (acaso pinos dispersos, con diversos grados de humedad y una leve mejora climática al final de la secuencia de los siete niveles solutrenses. Armados con una variedad de puntas foliáceas, puntas de base cóncava y de muesca, azagayas de asta, y adornados con cuentas de concha, diente, hueso e incluso piedra, los visitantes acamparon repetidas veces al fondo del vestíbulo de la cueva, hicieron varias hogueras ocasionales, cazaron ciervos y cabras, pescaron salmones y realizaron actividades de talla con materias primas locales y con otras no locales de alta calidad. Este yacimiento es uno de los pocos yacimientos solutrenses de la región cant

  11. A "pre-seasonal" hospital outbreak of influenza pneumonia caused by the drift variant A/Victoria/361/2011-like H3N2 viruses, Hong Kong, 2011.

    Science.gov (United States)

    Chan, Martin C W; Lee, Nelson; Ngai, Karry L K; Wong, Bonnie C K; Lee, May K P; Choi, K W; Lai, Raymond W M; Chan, Paul K S

    2013-03-01

    Beginning from late 2011 and early 2012, increasing circulation of antigenically drifted influenza A/Victoria/361/2011-like H3N2 viruses within genotype 3 of the A/Victoria/208/2009 clade have been reported in multiple European countries and elsewhere. Whether these emerging viruses are associated with increased disease severity is unclear. To report the clinical and virological findings of a moderately severe hospital outbreak of A/Victoria/361/2011-like viruses that occurred in November 2011 in Hong Kong. Clinical and virological hospital outbreak investigation. The outbreak occurred in an adult psychiatric ward in November 2011, a time well before the usual local seasonal influenza winter peak. Altogether, 7 patients and 1 healthcare-worker were affected (mean age, 47 [range, 34-61] years). The attack rates among patients and healthcare-workers were 33% (7/21) and 7% (1/15), respectively. Pneumonia developed in 38% (3/8) of cases; none had underlying immunocompromised conditions. High nasopharyngeal viral loads were detected. All cases responded to antiviral treatment. Multiple amino acid mutations with reference to earlier A(H3N2) vaccine strains were mapped to key antigenic sites on hemagglutinin; however, no critical mutations on receptor binding sites were detected. Viral sequence variations jeopardized the performance of molecular diagnostic assays. Severe disease and pneumonia occurred in a substantial proportion of non-immunocompromised adults in a hospital outbreak attributed to the emerging antigenically drifted A/Victoria/361/2011-like H3N2 viruses. Close monitoring of the transmission of this drift variant is required. Further studies are also necessary to determine virus virulence. Copyright © 2012 Elsevier B.V. All rights reserved.

  12. Effects of early adolescent alcohol use on mid-adolescent school performance and connection: a longitudinal study of students in Victoria, Australia and Washington State, United States.

    Science.gov (United States)

    Hemphill, Sheryl A; Heerde, Jessica A; Scholes-Balog, Kirsty E; Herrenkohl, Todd I; Toumbourou, John W; Catalano, Richard F

    2014-11-01

    This article examines the effect of early adolescent alcohol use on mid-adolescent school suspension, truancy, commitment, and academic failure in Washington State, United States, and Victoria, Australia. Also of interest was whether associations remain after statistically controlling for other factors known to predict school outcomes. State-representative student samples were surveyed in 2002 (grade 7; N = 1858) and followed up annually to 2004 (grade 9) in both sites. Students completed a modified version of the Communities That Care survey to report alcohol use, school outcomes, and risk and protective factors. Response rates were above 74% and retention rates exceeded 98% in both places. Controlling for grade 7 risk factors, grade 7 current alcohol use, and heavy episodic drinking were associated with grade 8 school suspension. Grade 7 current and frequent alcohol use and heavy episodic drinking were linked to grade 9 truancy. In fully adjusted analyses, associations between early alcohol use and academic failure and low school commitment did not remain. Although alcohol use is one factor influencing school performance and connection, there are other risk factors that need to be targeted to improve school outcomes. © 2014, American School Health Association.

  13. Utilisation of Rep-PCR to track microbes in aerosols collected adjacent to their source, a saline lake in Victoria, Australia.

    Science.gov (United States)

    Munday, Chris I; O'Loingsigh, Tadhg; Tapper, Nigel J; De Deckker, Patrick; Allison, Gwen E

    2013-04-15

    Dust storms are a major source of aerosolized bacteria, especially in the drought conditions experienced in Australia in the decade to 2009. The major aims of this project were to identify the culturable bacteria in environmental samples and to genetically fingerprint all isolates using repetitive element PCR (Rep-PCR) to investigate the possibility of tracking isolates from their source into the atmosphere. Four field trips were conducted to a dry lake in western Victoria, Australia to sample aerosols and sediments. Aerosols were collected at heights up to 150 m using vacuum pumps with filters attached to a tethered helium balloon, while corresponding sediments were collected in sterile polypropylene tubes. Isolates were cultivated on Tryptic Soy Agar, R2 Agar and Marine Agar, and grown in dark conditions at ambient temperature. By sequencing the 16S rRNA gene of 270 isolates, fifteen different bacterial families were identified, with both the aerosols and sediments dominated by the Bacillaceae family. Four sets of Rep-PCR primers were tested, with the ERIC and (GTG)5 primers proving to be the most suitable for fingerprinting the cultured taxa. Rep-PCR revealed very high strain diversity in the samples collected, however some strains were still able to be tracked from sediments up to 150 m in height. This shows the potential of Rep-PCR, however very large reference databases would be required for the technique to be more useful. Copyright © 2013 Elsevier B.V. All rights reserved.

  14. A snapshot of the prevalence of physical activity amongst older, community dwelling people in Victoria, Australia: patterns across the 'young-old' and 'old-old'

    Directory of Open Access Journals (Sweden)

    Davidson Sandra

    2007-02-01

    Full Text Available Abstract Background Physical activity has a range of health benefits for older people. The aim of this study was to determine physical activity prevalence and attitudes amongst respondents to a trial screening survey. Methods A cross-sectional survey was conducted. Subjects were community dwelling older people aged ≥ 65 years, recruited via general practices in Victoria, Australia. Participants completed a mailed screening tool containing the Geriatric Depression Scale, the Active Australia survey and the Physical Activity Readiness Questionnaire. Results Of 330 participants, 20% were ≥ 80 years. Activity levels were similar to those reported in population studies. The proportion of participants reporting physical activity was greatest for the walking category, but decreased across categories of physical activity intensity. The oldest-old were represented at all physical activity intensity levels. Over half reported exercising at levels that, according to national criteria are, 'sufficient to attain health benefit'. A greater proportion of participants aged 85 years and older were unaware of key physical activity messages, compared to participants aged less than 85 years. Conclusion Most population surveys do not provide details of older people across age categories. This survey provided information on the physical activity of people up to 91 years old. Physical activity promotion strategies should be tailored according to the individual's needs. A better understanding of the determinants of physical activity behaviour amongst older sub-groups is needed to tailor and target physical activity promotion strategies and programs to maximise physical activity related health outcomes for older people.

  15. A Sr-Nd-Hf isotope characterization of dust source areas in Victoria Land and the McMurdo Sound sector of Antarctica

    Science.gov (United States)

    Blakowski, Molly A.; Aciego, Sarah M.; Delmonte, Barbara; Baroni, Carlo; Salvatore, Maria Cristina; Sims, Kenneth W. W.

    2016-06-01

    Determining the geographical provenance of dust provides crucial insight into the global dust cycle. For the East Antarctic Ice Sheet (EAIS), the importance of Southern hemisphere potential dust sources has been thoroughly investigated using radiogenic isotopes, whereas proximal dust source areas located on the periphery of the ice sheet remain poorly documented from a geochemical standpoint. In this work, we expand the existing isotopic (Srsbnd Nd) catalogue of dust and sand-sized sediments from Victoria Land and the McMurdo Sound sector, and incorporate Hf isotopic data to place additional constraints on dust source identification. The isotopic field for materials considered in this study is characterized by 87Sr/86Sr ratios ranging from 0.703 to 0.783, εNd between -12.01 and 6.36, and εHf from -16.77 to 6.89. As reported in previous works, the data reveal close relationships between Antarctic sediments and distinct parent lithologies; in addition, our findings emphasize the background presence of very fine dusts originating from dominant global sources and regional volcanic activity as barriers to direct source-to-sink comparison of isotopic signatures. Thus, geochemical characterizations of dust sources to the Antarctic ice sheet involving multiple size fractions, including coarser-grained particles more susceptible to short-range transport, can help us to rule out global sources of dust when examining local sediment cores and ice cores.

  16. Innovative 'Artificial Mussels' technology for assessing spatial and temporal distribution of metals in Goulburn-Murray catchments waterways, Victoria, Australia: effects of climate variability (dry vs. wet years).

    Science.gov (United States)

    Kibria, Golam; Lau, T C; Wu, Rudolf

    2012-12-01

    The "Artificial mussel" (AM), a novel passive sampling technology, was used for the first time in Australia in freshwater to monitor and assess the risk of trace metals (Cd, Cu, Hg, Pb, and Zn). AMs were deployed at 10 sites within the Goulburn-Murray Water catchments, Victoria, Australia during a dry year (2009-2010) and a wet year (2010-2011). Our results showed that the AMs accumulated all the five metals. Cd, Pb, Hg were detected during the wet year but below detection limits during the dry year. At some sites close to orchards, vine yards and farming areas, elevated levels of Cu were clearly evident during the dry year, while elevated levels of Zn were found during the wet year; the Cu indicates localized inputs from the agricultural application of copper fungicide. The impacts from old mines were significantly less compared 'hot spots'. Our study demonstrated that climate variability (dry, wet years) can influence the metal inputs to waterways via different transport pathways. Using the AMs, we were able to identify various 'hot spots' of heavy metals, which may pose a potential risk to aquatic ecosystems (sub-lethal effects to fish) and public (via food chain metal bioaccumulation and biomagnification) in the Goulburn-Murray Water catchments. The State Protection Policy exempted artificial channels and drains from protection of beneficial use (including protection of aquatic ecosystems) and majority of sites ('hot spots') were located within artificial irrigation channels. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Coverage of the Test of Memory Malingering, Victoria Symptom Validity Test, and Word Memory Test on the Internet: is test security threatened?

    Science.gov (United States)

    Bauer, Lyndsey; McCaffrey, Robert J

    2006-01-01

    In forensic neuropsychological settings, maintaining test security has become critically important, especially in regard to symptom validity tests (SVTs). Coaching, which can entail providing patients or litigants with information about the cognitive sequelae of head injury, or teaching them test-taking strategies to avoid detection of symptom dissimulation has been examined experimentally in many research studies. Emerging evidence supports that coaching strategies affect psychological and neuropsychological test performance to differing degrees depending on the coaching paradigm and the tests administered. The present study sought to examine Internet coverage of SVTs because it is potentially another source of coaching, or information that is readily available. Google searches were performed on the Test of Memory Malingering, the Victoria Symptom Validity Test, and the Word Memory Test. Results indicated that there is a variable amount of information available about each test that could threaten test security and validity should inappropriately interested parties find it. Steps that could be taken to improve this situation and limitations to this exploration are discussed.

  18. Seismic Performance Evaluation Framework Considering Maximum and Residual Inter-story Drift Ratios: Application to Non-code Conforming Reinforced Concrete Buildings in Victoria, British Columbia, Canada

    Directory of Open Access Journals (Sweden)

    Solomon eTesfamariam

    2015-10-01

    Full Text Available This paper presents a seismic performance evaluation framework using two engineering demand parameters, i.e. maximum and residual inter-story drift ratios, and with consideration of mainshock-aftershock (MSAS earthquake sequences. The evaluation is undertaken within a performance-based earthquake engineering framework in which seismic demand limits are defined with respect to the earthquake return period. A set of 2-, 4-, 8-, and 12-story non-ductile reinforced concrete buildings, located in Victoria, British Colombia, Canada, is considered as a case study. Using 50 mainshock and MSAS earthquake records (two horizontal components per record, incremental dynamic analysis is performed, and the joint probability distribution of maximum and residual inter-story drift ratios is modeled using a novel copula technique. The results are assessed both for collapse and non-collapse limit states. From the results, it can be shown that the collapse assessment of 4- to 12-story buildings is not sensitive to the consideration of MSAS seismic input, whereas for the 2-story building, a 13% difference in the median collapse capacity is caused by the MSAS. For unconditional probability of unsatisfactory seismic performance, which accounts for both collapse and non-collapse limit states, the life safety performance objective is achieved, but it fails to satisfy the collapse prevention performance objective. The results highlight the need for the consideration of seismic retrofitting for the non-ductile reinforced concrete structures.

  19. Closing the gap in maternal and child health: a qualitative study examining health needs of migrant mothers in Dandenong, Victoria, Australia.

    Science.gov (United States)

    Renzaho, Andre M N; Oldroyd, John C

    2014-08-01

    We conducted a qualitative study that explored the views and perceptions of migrant women in, Dandenong, Victoria, Australia about sociocultural barriers and health needs during pregnancy and in the postnatal period. The study was informed by the Social Identity Theory and the Acculturation Theory. It involved five focus group discussions with 35 migrant mothers from Afghanistan, Africa, China, Palestine, Lebanon, Syria, Iran and Jordan. Five themes emerged from the analysis: (1) the need for family support and complex social environments; (2) dealing with two cultural identities; (3) the health of mother and offspring; (4) access to the health system; and (5) life-skills for better health. Pregnancy and motherhood are challenges that are made more difficult by migration. The findings point towards the need for policies and interventions: (1) to reduce the negative impact of social isolation and lack of support during pregnancy and postnatally; (2) to support greater fathers' involvement in childcare; and (3) to reconcile different practices and expectations between traditional cultures and Australian norms. They also suggest a need to test culturally competent interventions that address health and lifestyle needs in migrant women and education programs for mothers that effectively address their concerns about maternal and child health.

  20. Pandemic influenza H1N1 2009 infection in Victoria, Australia: no evidence for harm or benefit following receipt of seasonal influenza vaccine in 2009.

    Science.gov (United States)

    Kelly, Heath A; Grant, Kristina A; Fielding, James E; Carville, Kylie S; Looker, Clare O; Tran, Thomas; Jacoby, Peter

    2011-08-26

    Conflicting findings regarding the level of protection offered by seasonal influenza vaccination against pandemic influenza H1N1 have been reported. We performed a test-negative case control study using sentinel patients from general practices in Victoria to estimate seasonal influenza vaccine effectiveness against laboratory proven infection with pandemic influenza. Cases were defined as patients with an influenza-like illness who tested positive for influenza while controls had an influenza-like illness but tested negative. We found no evidence of significant protection from seasonal vaccine against pandemic influenza virus infection in any age group. Age-stratified point estimates, adjusted for pandemic phase, ranged from 44% in persons aged less than 5 years to -103% (odds ratio=2.03) in persons aged 50-64 years. Vaccine effectiveness, adjusted for age group and pandemic phase, was 3% (95% CI -48 to 37) for all patients. Our study confirms the results from our previous interim report, and other studies, that failed to demonstrate benefit or harm from receipt of seasonal influenza vaccine in patients with confirmed infection with pandemic influenza H1N1 2009. Copyright © 2011 Elsevier Ltd. All rights reserved.

  1. Colossendeis species (Pycnogonida: Colossendeidae collected during the Italica XIX cruise to Victoria Land (Antarctica, with remarks on some taxonomic characters of the ovigers

    Directory of Open Access Journals (Sweden)

    Esperanza Cano

    2007-12-01

    Full Text Available The pycnogonid fauna of the genus Colossendeis collected during the Italica XIX cruise to Victoria Land (Ross Sea, Antarctica was studied. A total of 19 specimens of six species were collected: Colossendeis australis (6, C. wilsoni (3, C. scotti (2, C. robusta (3, C. lilliei (2 and C. megalonyx (3. In the present contribution the observed variability of all collected Colossendeis species is described and illustrated. The previously synonymised C. lilliei is considered a different species from C. robusta. The observations made in this study lead us to discuss a controversy about the total number of oviger segments in this genus. Despite the currently established 10-segmented status, a short basal element is here considered to be a possible 11th segment. A detailed SEM study of the last oviger segment is carried out in all collected species, showing some intraspecific and the interspecific variability in the structures examined (shape and number of rows of compound spines, morphology of terminal claw, etc.. Finally, we discuss the taxonomic value of these characters of the last strigilis segment for distinguishing the Colossendeis species, and their possible utility in establishing internal phylogenetic relationships in future contributions.

  2. Student and school factors associated with school suspension: A multilevel analysis of students in Victoria, Australia and Washington State, United States

    Science.gov (United States)

    Sheryl, A. Hemphill; Stephanie, M. Plenty; Herrenkohl, Todd I.; Toumbourou, John W.; Catalano, Richard F.

    2014-01-01

    One of the common issues schools face is how best to handle challenging student behaviors such as violent behavior, antisocial behavior, bullying, school rule violations, and interrupting other students’ learning. School suspension may be used to remove students engaging in challenging behaviors from the school for a period of time. However, the act of suspending students from school may worsen rather than improve their behavior. Research shows that suspensions predict a range of student outcomes, including crime, delinquency, and drug use. It is therefore crucial to understand the factors associated with the use of school suspension, particularly in sites with different policy approaches to problem behaviors. This paper draws on data from state-representative samples of 3,129 Grade 7 and 9 students in Washington State, United States and Victoria, Australia sampled in 2002. Multilevel modeling examined student and school level factors associated with student-reported school suspension. Results showed that both student (being male, previous student antisocial and violent behavior, rebelliousness, academic failure) and school (socioeconomic status of the school, aggregate measures of low school commitment) level factors were associated with school suspension and that the factors related to suspension were similar in the two states. The implications of the findings for effective school behavior management policy are that, rather than focusing only on the student, both student and school level factors need to be addressed to reduce the rates of school suspension. PMID:24860205

  3. A health-promoting community dental service in Melbourne, Victoria, Australia: protocol for the North Richmond model of oral health care.

    Science.gov (United States)

    Hall, Martin; Christian, Bradley

    2017-10-01

    Despite the best efforts and commitment of oral health programs, there is no evidence that the current surgical output-based model of oral health care is delivering better oral health outcomes to the community. In fact, Australian evidence indicates the oral health of the community could be getting worse. It is now well-understood that this traditional surgical model of oral health care will never successfully manage the disease itself. It is proposed that a health-promoting, minimally invasive oral disease management model of care may lead to a sustainable benefit to the oral health status of the individual and community groups. The aim of this paper is to describe such a model of oral health care (MoC) currently being implemented by the North Richmond Community Health Oral Health (NRCH-OH) program in Melbourne, Victoria, Australia; this model may serve as a template for other services to re-orient their healthcare delivery towards health promotion and prevention. The paper describes the guiding principles and theories for the model and also its operational components, which are: pre-engagement while on the waitlist; client engagement at the reception area; the assessment phase; oral health education (high-risk clients only); disease management; and reviews and recall.

  4. A retrospective assessment of gold mining in the Reedy Creek sub-catchment, northeast Victoria, Australia: residual mercury contamination 100 years later.

    Science.gov (United States)

    Churchill, R C; Meathrel, C E; Suter, P J

    2004-11-01

    The mining of gold can lead to toxic metals such as mercury (Hg) contaminating watercourses as by-products. The Reedy Creek sub-catchment, in northeast Victoria, Australia, was mined for gold in the 1850s. In 1998, samples were taken from six watercourses to measure any remaining toxic metal contamination in sediments and surface waters from two creeks with no previous gold mining (controls) and four that were mined. Although mean concentrations of Hg (measured using an ICP-OES) in sediments were below worldwide background levels, individual sites along Reedy Creek had slightly elevated Hg concentrations. In contrast, the Hg concentrations in the surface waters were above background levels. Temporal fluxes of very high Hg concentrations in the surface waters during periods of first flow and flood events revealed that Hg concentrations in the surface waters may, at certain times of the year, exceed all Australian and New Zealand Environment and Conservation Council (National Water Quality Management Strategy. Australian Water Quality Guidelines for Fresh and Marine Waters, ANZECC, 2000) guidelines for water use and the protection of the aquatic ecosystem. Copyright 2004 Elsevier Ltd.

  5. Community Genetics Reveal Elevated Levels of Sympatric Gene Flow among Morphologically Similar but Not among Morphologically Dissimilar Species of Lake Victoria Cichlid Fish

    Directory of Open Access Journals (Sweden)

    N. Konijnendijk

    2011-01-01

    Full Text Available We examined genetic structure among five species of Lake Victoria haplochromine cichlids in four island communities, using a full factorial sampling design that compared genetic differentiation between pairs of species and populations of varying morphological similarity and geographical proximity. We found that allopatric conspecific populations were on average significantly more strongly differentiated than sympatric heterospecific populations of morphologically similar species. Allopatric heterospecific populations of morphologically dissimilar species were most differentiated. Our work demonstrates that phenotypic divergence can be maintained and perhaps even evolve in sympatry despite considerable gene flow between species. Conversely, phenotypic resemblance among conspecific populations can be maintained despite geographical isolation. Additionally we show that anthropogenically increased hybridization does not affect all sympatric species evenly but predominantly affects morphologically similar and closely related species. This has important implications for the evolution of reproductive isolation between species These findings are also consistent with the hypothesis of speciation reversal due to weakening of divergent selection and reproductive isolation as a consequence of habitat homogenization and offers an evolutionary mechanistic explanation for the observation that species poor assemblages in turbid areas of the lake are characterized by just one or two species in each of a few morphologically distinct genera.

  6. Chromium Distribution and Spatial Variations in the Finer Sediment Grain Size Fraction and Unfractioned Surficial Sediments on Nyanza Gulf, of Lake Victoria (East Africa

    Directory of Open Access Journals (Sweden)

    Job Mwamburi

    2016-01-01

    Full Text Available Surficial sediments collected from the Nyanza Gulf of Lake Victoria (East Africa were used to determine spatial concentrations of Cr and determine differences in contents of the unfractioned (whole sediment and the finer grain size sediments, establishing any changes in Cr enrichment and potential ecological risks using sediment quality guidelines. A single pollution index was also used to evaluate level of Cr contamination. The spatial mean Cr contents in the <63 µm (silt-clay fraction were found to be significantly lower than those in the unfractioned sediments, but with a strong linear positive correlation. The study results show decreasing spatial amounts of Cr in surficial sediments of the Nyanza Gulf, when compared to a study done 20 years earlier. However, the 95% confidence limits of the overall mean Cr in unfractioned sediments exceed the threshold effect concentration (TEC, indicating the potential for Cr remobilization from sediments. In general the sediment enrichment is evidence of possible dominance of lithogenous sources of Cr in the surface lake sediments, with potential anthropogenic sources from the drainage system and nearshore urban areas. The sediments are unpolluted with respect to geoaccumulation index, and sediment enrichment factors suggest a minor to moderate enrichment of Cr in surficial sediments of three sites around the Nyanza Gulf zones and around the river mouth in the main lake.

  7. The geochemical effects of olivine slurry replenishment and dolostone assimilation in the plumbing system of the Franklin Large Igneous Province, Victoria Island, Arctic Canada

    Science.gov (United States)

    Hayes, Ben; Lissenberg, C. Johan; Bédard, Jean H.; Beard, Charlie

    2015-02-01

    The Neoproterozoic (~723-716 Ma) Franklin Large Igneous Province exposed on Victoria Island in the Canadian Arctic is comprised of a sill-dominated magma plumbing system overlain by the coeval Natkusiak flood basalts. We have investigated three sections, separated by a total of >50 km of distance, of a sill (the Fort Collinson Sill Complex) emplaced just above a prominent sedimentary marker unit. The sill is characterized by a basal olivine-enriched layer (OZ: up to 55 % olivine) and an upper gabbroic unit. The observed diversity of olivine compositions in the OZ implies that bulk-rock MgO versus FeO arrays reflect accumulation of a heterogeneous olivine crystal cargo. We suggest that the OZ was formed as a late olivine slurry replenishment in a partially crystallized gabbroic sill, propagating for over 50 km along strike. This interpretation is consistent with Pb-isotope data, which show that at least three geochemically distinct magmas were emplaced into the Fort Collinson Sill Complex. The OZs exhibit a gradual westward evolution toward more Fe-rich bulk compositions. This is best explained by progressive mixing of the replenishing olivine slurry with a resident gabbroic mush during westward flow. Pb-isotopic signatures suggest that magmas near the inferred conduit feeder assimilated small amounts (rock, which may have locally buffered olivine compositions to high-Fo contents.

  8. Combined effects of land reclamation, channel dredging upon the bioavailable concentration of polycyclic aromatic hydrocarbons (PAHs) in Victoria Harbour sediment, Hong Kong.

    Science.gov (United States)

    Chan, J T K; Leung, H M; Yue, P Y K; Au, C K; Wong, Y K; Cheung, K C; Li, W C; Yung, K K L

    2017-01-15

    The up-to-date concentration of polycyclic aromatic hydrocarbons (PAHs) in sediment materials of Victoria Harbour was investigated so as to evaluate the pollution potential associated with the reclamation projects in Hong Kong. A total of 100 sediment samples were collected at 20 locations. Except the control point in reservoir, the PAHs concentrations were detectable levels all sites (131-628.3ng/g, dw) and such values were higher than Dutch Target and Intervention Values (the New Dutch standard in 2016). The PAHs concentration indicating that construction waste and wastewater discharges were the main pollutant sources. Results of correlation in single cell gel electrophoresis assay (comet assay) studies also revealed that the PAHs concentration was highly correlated (PAHs. The above observation indicates that the PAHs present in the sediment may substantially effect the marine ecosystem. Although the dredged sediment can be a useful sea-filling material for land reclamation; however, the continuing leaching of PAHs and its impact on the aquatic environment need to be studied further. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. In the Heart of Victoria: the Emergence of Hong Kong’s Statue Square as a Symbol of Victorian Achievement Au Cœur de Victoria: la création du Statue Square à Hong Kong comme symbole de la réussite victorienne

    Directory of Open Access Journals (Sweden)

    Alain Le Pichon

    2009-05-01

    Full Text Available Depuis sa fondation au début des années 1840, plus de quarante ans s’écoulèrent sans que la cité coloniale de Victoria à Hong Kong ait disposé d’un vrai centre architectural ou d’une grande place centrale encadrée de bâtiments prestigieux. L’une des raisons tenait au fait que dans une colonie qui était à l’origine, et qui est restée depuis, essentiellement une cité portuaire construite sur le bord d’une île montagneuse, les étendues de terrain plat étaient quasi inexistantes. Cependant, en l’espace d’une quinzaine d’années, vers la fin du règne de Victoria, un vaste programme de poldérisation eut pour effet de faire reculer le front de mer. Et c’est au beau milieu de ces nouveaux terrains que, petit à petit, sans grande vision d’ensemble, le « Statue Square » vit le jour. Tout autour de la place, de splendides bâtiments de style colonial furent construits et complétèrent un ensemble architectural que l’on peut lire comme la fière signature de l’époque victorienne. Le présent article examine le processus qui donna naissance au « Statue Square » et les valeurs symboliques incarnées dans cette place.

  10. ANÁLISIS DE MACRORRESTOS VEGETALES EN EL SITIO ARQUEOLÓGICO LOS TRES CERROS 1 (ISLA LAS MORAS, VICTORIA, ENTRE RÍOS / Macroremains plant analysis on the Tres Cerros 1 archaeological site (Las Moras island, Victoria, Entre Ríos.

    Directory of Open Access Journals (Sweden)

    María de los Milagros Colobig

    2015-06-01

    Full Text Available El presente trabajo es la primera aproximación al estudio de macrorrestos botánicos en el sitio Los Tres Cerros 1 (isla Las Moras, Victoria, Entre Ríos. Estos restos fueron recuperados mediante la técnica de flotación manual. A partir del material extraído, se exploró el rol de los recursos vegetales y su importancia en la subsistencia en los grupos humanos que habitaron el Delta Superior del río Paraná durante el Holoceno tardío. Se identificaron cinco familias: Solanaceae, Chenopodiaceae, Polygonaceae, Poaceae (Maideae y Oryzoideae y Amaranthaceae. Los estudios permitieron estimar que a partir de 700 ARCP hubo un incremento en la abundancia y variabilidad de recursos vegetales utilizados con respecto a períodos anteriores. La presencia de elementos oryzoides, y graminoides (específicamente Maideae evidenció la existencia de vegetales silvestres y domesticados, aportando nuevos registros sobre el aprovechamiento, manejo y cultivo de las plantas en el área de estudio en el Holoceno tardío.   Abstract  This paper entails the first approach to macrobotanical remains obtained from Los Tres Cerros 1 (Isla Las Moras, Victoria, Entre Ríos. The remains were recovered by means of manual flotation technique. The extracted material allowed us to explore the role played by vegetable resources role and their importance to the subsistence of human populations of Upper Paraná Delta during the late Holocene. Five botanical families were recognized: Solanaceae, Chenopodiaceae, Polygonaceae, Poaceae (Maideae and Ehrhartoideae and Amaranthaceae. Studies estimate that from 700 RCYBP, there was an increase in the abundance and variability of plant resources used, as compared to previous periods. The presence of oryzoides and graminoid elements (specifically Maideae showed the presence of wild and domesticated plants, providing new records on the use of plants in the area studied, in the late Holocene.

  11. Change of School in Early Adolescence and Adverse Obesity-Related Dietary Behavior: A Longitudinal Cohort Study, Victoria, Australia, 2013-2014.

    Science.gov (United States)

    Marks, Jennifer; Barnett, Lisa M; Allender, Steven

    2015-09-10

    Environments that facilitate energy-dense, nutrient-poor diets are associated with childhood obesity. We examined the effect of a change of school environment on the prevalence of obesity and related dietary behavior in early adolescence. Fifteen schools in Victoria, Australia, were recruited at random from the bottom 2 strata of a 5-level socioeconomic scale. In 9 schools, students in grade 6 primary school transitioned to different schools for grade 7 secondary school, whereas in 6 schools, students remained in the same school from grade 6 to grade 7. Time 1 measures were collected from students (N = 245) in grade 6 (aged 11-13 y). Time 2 data were collected from 243 (99%) of the original cohort in grade 7. Data collected were dietary recall self-reported by students via questionnaire, measured height and weight of students, and aspects of the school food environment via school staff survey. Comparative and mixed model regression analyses were conducted. Of 243 students, 63% (n = 152) changed schools from time 1 to time 2, with no significant difference in weight status. Students who changed schools reported an increase in purchases of after-school snack food, greater sweetened beverage intake, fewer fruit-and-vegetable classroom breaks, and less encouragement for healthy eating compared with students who remained in the same school. School staff surveys showed that more primary than secondary schools had written healthy canteen policies and fewer days of canteen or food services operation. A change of school environment has negative effects on children's obesity-related dietary behavior. Consistent policy is needed across school types to support healthy eating in school environments.

  12. Del desastre de Getares a la victoria del Salado : la crítica situación de la zona del Estrecho en 1340

    Directory of Open Access Journals (Sweden)

    Manuel López Fernández

    2007-01-01

    Full Text Available A comienzos de 1340 se presagiaba en el Estrecho de Gibraltar una ofensiva meriní. Castilla contaba con una flota insuficiente para frenar a los musulmanes y el reino de Aragón, que también colaboraba en la vigilancia de aquellas aguas, había reducido sus efectivos al mínimo. Así las cosas, en el mes de abril la flota castellano-aragonesa sufrió una aplastante derrota en la Ensenada de Getares, a la que siguió el traslado de un importante contingente marroquí a la Península y el posterior cerco a Tarifa. Alfonso XI, con la ayuda del rey de Portugal, acudió a descercar esta plaza y acabó imponiéndose en la batalla del Salado. Las consecuencias posteriores de esta victoria resultaron fundamentales para el dominio del Estrecho.At the beginning of 1340, a Merini attack was expected in the Straits of Gibraltar. The kingdom of Castile had an inadequate navy to stop the Muslims, and the Aragón’s kingdom, which also helped in the surveillance of that sea area, had reduced his troops to the minimum. In April, the Castilian - Aragonese navy suffered a crushing defeat in the Getares inlet, followed by the pass of one important Moroccans’ contingent to the Peninsula and the later siege to Tarifa. Alfonso XI, with the help of the King of Portugal, came to free the city from the siege, and later on he won the Salado Battle. The subsequent consequences of this victory were essential for the Straits control.

  13. A very high infection intensity of Schistosoma mansoni in a Ugandan Lake Victoria Fishing Community is required for association with highly prevalent organ related morbidity.

    Directory of Open Access Journals (Sweden)

    Edridah M Tukahebwa

    Full Text Available In schistosomiasis control programmes using mass chemotherapy, epidemiological and morbidity aspects of the disease need to be studied so as to monitor the impact of treatment, and make recommendations accordingly. These aspects were examined in the community of Musoli village along Lake Victoria in Mayuge district, highly endemic for Schistosoma mansoni infection.A cross sectional descriptive study was undertaken in a randomly selected sample of 217 females and 229 males, with a mean age of 26 years (SD ± 16, range 7-76 years. The prevalence of S. mansoni was 88.6% (95% CI: 85.6-91.5. The geometric mean intensity (GMI of S. mansoni was 236.2 (95% CI: 198.5-460.9 eggs per gram (epg faeces. Males had significantly higher GMI (370.2 epg than females (132.6 epg and age was also significantly associated with intensity of infection. Levels of water contact activities significantly influenced intensity of infection and the highest intensity of infection was found among people involved in fishing. However, organomegaly was not significantly associated with S. mansoni except for very heavy infection (>2000 epg. Liver image patterns C and D indicative of fibrosis were found in only 2.2% and 0.2%, respectively. S. mansoni intensity of infection was associated with portal vein dilation and abnormal spleen length. Anaemia was observed in 36.4% of the participants but it was not associated with S. mansoni infection intensity. Considering growth in children as one of the morbidity indicators of schistosomiasis, intensity of S. mansoni was significantly associated with stunting.Although organ-related morbidity, with the exception of periportal fibrosis, and S. mansoni infections were highly prevalent, the two were only associated for individuals with very high infection intensities. These results contrast starkly with reports from Ugandan Lake Albert fishing communities in which periportal fibrosis is more prevalent.

  14. Preventing alcohol harm: early results from a cluster randomised, controlled trial in Victoria, Australia of comprehensive harm minimisation school drug education.

    Science.gov (United States)

    Midford, Richard; Mitchell, Johanna; Lester, Leanne; Cahill, Helen; Foxcroft, David; Ramsden, Robyn; Venning, Lynne; Pose, Michelle

    2014-01-01

    In Australia, the burden of alcohol-attributable harm falls most heavily on young people. Prevention is important, and schools have long been seen as appropriate settings for pre-emptive interventions with this high risk group. This paper evaluates the effectiveness, in relation to alcohol harm prevention, of the Drug Education in Victorian Schools (DEVS) programme, nine months after implementation. This intervention dealt with both licit and illicit drugs, employed a harm minimisation approach that incorporated interactive, skill based, teaching methods and capitalised on parental influence through home activities. A cluster randomised, controlled trial of the first ten lessons of the DEVS drug education programme was conducted with year eight students, aged 13-14 years. Twenty-one secondary schools in Victoria, Australia were randomly allocated to receive the DEVS programme (14 schools, n=1163) or the drug education usually provided by their schools (7 schools, n=589). Self-reported changes were measured in relation to: knowledge and attitudes, communication with parents, drug education lessons remembered, proportion of drinkers, alcohol consumption (quantity multiplied by frequency), proportion of student drinkers engaging in risky consumption, and the number of harms experienced as a result of alcohol consumption. In comparison to the controls, there was a significantly greater increase in the intervention students' knowledge about drugs, including alcohol (p≤0.001); there was a significant change in their level of communication with parents about alcohol (p=0.037); they recalled receiving significantly more alcohol education (pharms associated with their drinking (p≤0.001). There were no significant differences between the two study groups in relation to changes in attitudes towards alcohol or in the proportion of drinkers or risky drinkers. There was, however, a notable trend of less consumption by risky drinkers in the intervention group. A comprehensive

  15. Estimation of design floods in ungauged catchments using a regional index flood method. A case study of Lake Victoria Basin in Kenya

    Science.gov (United States)

    Nobert, Joel; Mugo, Margaret; Gadain, Hussein

    Reliable estimation of flood magnitudes corresponding to required return periods, vital for structural design purposes, is impacted by lack of hydrological data in the study area of Lake Victoria Basin in Kenya. Use of regional information, derived from data at gauged sites and regionalized for use at any location within a homogenous region, would improve the reliability of the design flood estimation. Therefore, the regional index flood method has been applied. Based on data from 14 gauged sites, a delineation of the basin into two homogenous regions was achieved using elevation variation (90-m DEM), spatial annual rainfall pattern and Principal Component Analysis of seasonal rainfall patterns (from 94 rainfall stations). At site annual maximum series were modelled using the Log normal (LN) (3P), Log Logistic Distribution (LLG), Generalized Extreme Value (GEV) and Log Pearson Type 3 (LP3) distributions. The parameters of the distributions were estimated using the method of probability weighted moments. Goodness of fit tests were applied and the GEV was identified as the most appropriate model for each site. Based on the GEV model, flood quantiles were estimated and regional frequency curves derived from the averaged at site growth curves. Using the least squares regression method, relationships were developed between the index flood, which is defined as the Mean Annual Flood (MAF) and catchment characteristics. The relationships indicated area, mean annual rainfall and altitude were the three significant variables that greatly influence the index flood. Thereafter, estimates of flood magnitudes in ungauged catchments within a homogenous region were estimated from the derived equations for index flood and quantiles from the regional curves. These estimates will improve flood risk estimation and to support water management and engineering decisions and actions.

  16. Avicins, a family of triterpenoid saponins from Acacia victoriae (Bentham), suppress H-ras mutations and aneuploidy in a murine skin carcinogenesis model

    Science.gov (United States)

    Hanausek, Malgorzata; Ganesh, Pattabhiraman; Walaszek, Zbigniew; Arntzen, Charles J.; Slaga, Thomas J.; Gutterman, Jordan U.

    2001-01-01

    We tested the ability of avicins, a family of triterpenoid saponins obtained from Acacia victoriae (Bentham) (Leguminosae: Mimosoideae), to inhibit chemically induced mouse skin carcinogenesis. Varying doses of avicins were applied to shaved dorsal skin of SENCAR mice 15 min before application of 100 nmol of 7,12-dimethylbenz[a]anthracene (DMBA) twice a week for 4 weeks (complete carcinogenesis model). The dorsal skin of a second group of mice was treated with one dose of 10 nmol of DMBA. Avicins were then applied 15 min before repetitive doses of 2 μg of phorbol 12-tetradecanoate 13-acetate (TPA) twice a week for 8 weeks (initiation/promotion model). At 12 weeks, avicins produced a 70% decrease in the number of mice with papillomas and a greater than 90% reduction in the number of papillomas per mouse in both protocols. We also observed a 62% and 74% reduction by avicins in H-ras mutations at codon 61 in the DMBA and DMBA/TPA models, respectively, as well as a significant inhibition of the modified DNA base formation (8-OH-dG) in both protocols. Marked suppression of aneuploidy occurred with treatment at 16 weeks in the initiation/promotion experiment. These findings, when combined with the proapoptotic property of these compounds and their ability to inhibit hydrogen peroxide (H2O2) generation, nuclear factor-κB (NF-κB) activation, and inducible nitric oxide synthase (iNOS) induction reported elsewhere, suggest that avicins could prove exciting in reducing oxidative and nitrosative stress and thereby suppressing the development of human skin cancer and other epithelial malignancies. PMID:11572997

  17. Trial of labour and vaginal birth after previous caesarean section: A population based study of Eastern African immigrants in Victoria, Australia.

    Science.gov (United States)

    Belihu, Fetene B; Small, Rhonda; Davey, Mary-Ann

    2017-03-01

    Variations in caesarean section (CS) between some immigrant groups and receiving country populations have been widely reported. Often, African immigrant women are at higher risk of CS than the receiving population in developed countries. However, evidence about subsequent mode of birth following CS for African women post-migration is lacking. The objective of this study was to examine differences in attempted and successful vaginal birth after previous caesarean (VBAC) for Eastern African immigrants (Eritrea, Ethiopia, Somalia and Sudan) compared with Australian-born women. A population-based observational study was conducted using the Victorian Perinatal Data Collection. Pearson's chi-square test and logistic regression analysis were performed to generate adjusted odds ratios for attempted and successful VBAC. Victoria, Australia. 554 Eastern African immigrants and 24,587 Australian-born eligible women with previous CS having singleton births in public care. 41.5% of Eastern African immigrant women and 26.1% Australian-born women attempted a VBAC with 50.9% of Eastern African immigrants and 60.5% of Australian-born women being successful. After adjusting for maternal demographic characteristics and available clinical confounding factors, Eastern African immigrants were more likely to attempt (ORadj 1.94, 95% CI 1.57-2.47) but less likely to succeed (ORadj 0.54 95% CI 0.41-0.71) in having a VBAC. There are disparities in attempted and successful VBAC between Eastern African origin and Australian-born women. Unsuccessful VBAC attempt is more common among Eastern African immigrants, suggesting the need for improved strategies to select and support potential candidates for vaginal birth among these immigrants to enhance success and reduce potential complications associated with failed VBAC attempt. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  18. A Climatology of Wildfire Weather for Victoria, Australia: Based on a Hi-Resolution 40-year Mesoscale Gridded Fire Weather Dataset

    Science.gov (United States)

    Harris, S. L.

    2015-12-01

    Weather and climate are essential components in understanding wildfire characteristics and improving fire management. A high spatial and temporal resolution climatology of fire weather is vital for examining relationships, determining wildfire risks and basing fire management decisions upon. A homogeneous 41-year (1972-2012) hourly 4-km gridded climate dataset for the fire-prone state of Victoria, Australia has been generated using a combination of mesoscale modelling, global reanalysis data, surface observations, and historic observed rainfall analyses. Outputs include surface weather variables such as hourly temperature, relative humidity, wind speed and wind direction. In addition, daily drought indices have been calculated and these have been used to calculate a commonly used fire danger index. This new dataset allows for an almost limitless opportunity for hitherto unavailable analyses - such as fields of percentiles of fire danger indices values, analysis of periods exceeding thresholds at any location, inter-annual and regional variations of fire season characteristics, analysis of prescribed burning windows, and identifying trends over the 41-year period. Furthermore, the hourly mesoscale wind fields provide a homogeneous long-period data set with which to drive fire spread models. The opportunities to advance wildfire research for this region and thereby provide information to improve risk analysis and fire management are immense. This presentation describes the generation of the dataset, evaluation of the outputs and highlights its use and relevance for fire management. In particular, frequency of exceedance of both extreme values (for resource allocation planning), and also frequencies whereby multiple parameters mutually fall within the prescribed burning guidelines, and its interannual variation, will be discussed.

  19. Change of School in Early Adolescence and Adverse Obesity-Related Dietary Behavior: A Longitudinal Cohort Study, Victoria, Australia, 2013–2014

    Science.gov (United States)

    Barnett, Lisa M.; Allender, Steven

    2015-01-01

    Introduction Environments that facilitate energy-dense, nutrient-poor diets are associated with childhood obesity. We examined the effect of a change of school environment on the prevalence of obesity and related dietary behavior in early adolescence. Methods Fifteen schools in Victoria, Australia, were recruited at random from the bottom 2 strata of a 5-level socioeconomic scale. In 9 schools, students in grade 6 primary school transitioned to different schools for grade 7 secondary school, whereas in 6 schools, students remained in the same school from grade 6 to grade 7. Time 1 measures were collected from students (N = 245) in grade 6 (aged 11–13 y). Time 2 data were collected from 243 (99%) of the original cohort in grade 7. Data collected were dietary recall self-reported by students via questionnaire, measured height and weight of students, and aspects of the school food environment via school staff survey. Comparative and mixed model regression analyses were conducted. Results Of 243 students, 63% (n= 152) changed schools from time 1 to time 2, with no significant difference in weight status. Students who changed schools reported an increase in purchases of after-school snack food, greater sweetened beverage intake, fewer fruit-and-vegetable classroom breaks, and less encouragement for healthy eating compared with students who remained in the same school. School staff surveys showed that more primary than secondary schools had written healthy canteen policies and fewer days of canteen or food services operation. Conclusion A change of school environment has negative effects on children’s obesity-related dietary behavior. Consistent policy is needed across school types to support healthy eating in school environments. PMID:26355826

  20. China's first intermediate resolution multi-channel seismic survey in the northern Victoria Land Basin and Terror Rift, Ross Sea, Antarctica

    Science.gov (United States)

    Shen, Zhongyan; Gao, Jinyao; Zhang, Tao; Wang, Wei; Ding, Weifeng; Zhang, Sheng

    2017-04-01

    The West Antarctic Rift System (WARS) represents one of the largest active continental rift systems on Earth and is less well known than other rift systems because it is largely covered by thick ice. The Terror Rift (TR), superimposing on the Victoria Land Basin (VLB) in the western Ross Sea, is identified as the most recent deformational zone of the WARS, thus will provide knowledge of the active deformation process of the WARS. The structure and kinematics of the TR is under debate. Originally, the TR was thought to consist of two parts: the Discovery Graben and the magmatically-intruded Lee Arch. New denser seismic grid in the middle and southern segments of the TR revealed a different structure of the Lee Arch while the northern segment of the TR is not well studied. The glacial history of the VLB/TR region is another attractive issue to the geologists since this area records the behavior information of EAIS and WAIS. In the southern part of the VLB, especially in the McMurdo Sound, the framework of the glacial history is well established after several deep cores which recovery the whole stratigraphic sequences since the onset of the glaciation. However, the glacial history of the northern part of the VLB/TR is less well studied and here we emphasize its importance because the northern part of the VLB/TR is a link between the well-studied southern VLB and the sediment-well-preserved Northern Basin. During the 32nd Chinese National Antarctic Research Expedition, on the board of the RV XueLong, we collected intermediate resolution multi-channel seismic reflection data in the northern VLB/TR. These data will establish new constraints on the timing of deformation, structure and kinematics of the TR, and the history of the EAIS and WAIS.

  1. Social exclusion, deprivation and child health: a spatial analysis of ambulatory care sensitive conditions in children aged 0-4 years in Victoria, Australia.

    Science.gov (United States)

    Butler, Danielle C; Thurecht, Linc; Brown, Laurie; Konings, Paul

    2013-10-01

    Recent Australian policy initiatives regarding primary health care focus on planning services around community needs and delivering these at the local area. As in many other countries, there has also been a growing concern over social inequities in health outcomes. The aims of the analysis presented here were firstly to describe small area variations in hospital admissions for ambulatory care sensitive conditions (ACSC) among children aged 0-4 years between 2003 and 2009 in the state of Victoria, Australia, and secondly to explore the relationship of ACSC hospitalisations with socio-economic disadvantage using a comparative analysis of the Child Social Exclusion (CSE) index and the Composite Score of Deprivation (CSD). This is a cross sectional secondary data analysis, with data sourced from 2003 to 2009 ACSC data from the Victorian State Government Department of Health; the Australian Standard Geographical Classification of remoteness; the Australian 2006 Census of Population and Housing; and AMPCo General Practitioner data from 2010. The relationship between the indexes and child health outcomes was examined through bivariate analysis and visually through a series of maps. The results show there is significant variation in the geographical distribution of the relationship between ACSCs and socio-economic disadvantage, with both indexes capturing important social gradients in child health conditions. However, measures of access, such as geographical accessibility and workforce supply, detect additional small area variation in child health outcomes. This research has important implications for future primary health care policy and planning of services, as these findings confirm that not all areas are the same in terms of health outcomes, and there may be benefit in tailoring mechanisms for identifying areas of need depending on the outcome intended to be affected. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. No evidence for a genetic association between female mating preference and male secondary sexual trait in a Lake Victoria cichlid fish

    Directory of Open Access Journals (Sweden)

    Inke van der SLUIJS, Ole SEEHAUSEN, Tom J. M. Van DOOREN,Jacques J. M. van ALPHEN

    2010-02-01

    Full Text Available Sexual selection by female mating preference for male nuptial coloration has been suggested as a driving force in the rapid speciation of Lake Victoria cichlid fish. This process could have been facilitated or accelerated by genetic associations between female preference loci and male coloration loci. Preferences, as well as coloration, are heritable traits and are probably determined by more than one gene. However, little is known about potential genetic associations between these traits. In turbid water, we found a population that is variable in male nuptial coloration from blue to yellow to red. Males at the extreme ends of the phenotype distribution resemble a reproductively isolated species pair in clear water that has diverged into one species with blue-grey males and one species with bright red males. Females of the turbid water population vary in mating preference coinciding with the male phenotype distribution. For the current study, these females were mated to blue males. We measured the coloration of the sires and male offspring. Parents-offspring regression showed that the sires did not affect male offspring coloration, which confirms earlier findings that the blue species breeds true. In contrast, male offspring coloration was determined by the identity of the dams, which suggests that there is heritable variation in male color genes between females. However, we found that mating preferences of the dams were not correlated with male offspring coloration. Thus, there is no evidence for strong genetic linkage between mating preference and the preferred trait in this population [Current Zoology 56 (1: 57–64 2010].

  3. Aerial Photography Estimation of CH4 and N2O Emissions from Adelie Penguins During 1983-2012 in Victoria Land, Antarctic

    Science.gov (United States)

    He, H.; Li, X.; Cheng, X.

    2016-12-01

    Sea animals are the "bio-indicators" of the climate change in the Antarctic. The abundant nutrient components in their excreta such as carbon (C) and nitrogen (N) promote the emissions of greenhouse gases (GHGs) including methane (CH4) and nitrous oxide (N2O). Adélie Penguins are important sea animals, their colonies therefore become the potential "hotspots" of the GHGs emissions. Some field observations have been carried out to study the penguin excreta on CH4 and N2O emissions in the Antarctic peninsula. However, due to the lacking of the penguin population data, the total emissions of GHGs have not been estimated at regional scale. This study aimed to extract penguin information from two period aerial photographs respectively in 1983 and 2012 using object-oriented method in Victoria Land, Antarctic, and then estimate the Adélie penguin populations on Inexpressible Island combined with the shadow analysis. Meanwhile, a GHGs model was developed to estimate CH4 and N2O emissions from Adelie penguins based on the CH4 and N2O fluxes of penguin guanos, the number of penguins, and the fresh weight of penguin guanos and so on. The results indicated that object-oriented method was effective in penguin information extraction from high-resolution images, and there were 17120 and 21183 Adélie penguins respectively in 1983 and 2012, respectively. The main reasons for the increase in penguin populations from 1983 to 2012 might be explained from physical environment and biological environment, such as the rising temperatures and reduced Antarctic toothfishes. And the total CH4 and N2O emissions from penguins on Inexpressible Island during breeding season were 246 kg CH4 and 2.67 kg N2O in 1983, and 304 kg CH4 and 3.31 kg N2O in 2012. Our study aimed to provide important reference value for the estimation of GHG budget in Antarctic.

  4. Associations between major chain fast-food outlet availability and change in body mass index: a longitudinal observational study of women from Victoria, Australia.

    Science.gov (United States)

    Lamb, Karen E; Thornton, Lukar E; Olstad, Dana Lee; Cerin, Ester; Ball, Kylie

    2017-10-16

    The residential neighbourhood fast-food environment has the potential to lead to increased levels of obesity by providing opportunities for residents to consume energy-dense products. This longitudinal study aimed to examine whether change in body mass index (BMI) differed dependent on major chain fast-food outlet availability among women residing in disadvantaged neighbourhoods. Eighty disadvantaged neighbourhoods in Victoria, Australia. Sample of 882 women aged 18-46 years at baseline (wave I: 2007/2008) who remained at the same residential location at all three waves (wave II: 2010/2011; wave III: 2012/2013) of the Resilience for Eating and Activity Despite Inequality study. BMI based on self-reported height and weight at each wave. There was no evidence of an interaction between time and the number of major chain fast-food outlets within 2 (p=0.88), 3 (p=0.66) or 5 km (p=0.24) in the multilevel models of BMI. Furthermore, there was no evidence of an interaction between time and change in availability at any distance and BMI. Change in BMI was not found to differ by residential major chain fast-food outlet availability among Victorian women residing in disadvantaged neighbourhoods. It may be that exposure to fast-food outlets around other locations regularly visited influence change in BMI. Future research needs to consider what environments are the key sources for accessing and consuming fast food and how these relate to BMI and obesity risk. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  5. Performance of circulating cathodic antigen (CCA) urine-dipsticks for rapid detection of intestinal schistosomiasis in schoolchildren from shoreline communities of Lake Victoria.

    Science.gov (United States)

    Standley, C J; Lwambo, N J S; Lange, C N; Kariuki, H C; Adriko, M; Stothard, J R

    2010-02-05

    For disease surveillance and mapping within large-scale control programmes, RDTs are becoming popular. For intestinal schistosomiasis, a commercially available urine-dipstick which detects schistosome circulating cathodic antigen (CCA) in host urine is being increasingly applied, however, further validation is needed. In this study, we compared the CCA urine-dipstick test against double thick Kato-Katz faecal smears from 171 schoolchildren examined along the Tanzanian and Kenyan shorelines of Lake Victoria. Diagnostic methods were in broad agreement; the mean prevalence of intestinal schistosomiasis inferred by Kato-Katz examination was 68.6% (95% confidence intervals (CIs) = 60.7-75.7%) and 71.3% (95% CIs = 63.9-78.8%) by CCA urine-dipsticks. There were, however, difficulties in precisely 'calling' the CCA test result, particularly in discrimination of 'trace' reactions as either putative infection positive or putative infection negative, which has important bearing upon estimation of mean infection prevalence; considering 'trace' as infection positive mean prevalence was 94.2% (95% CIs = 89.5-97.2%). A positive association between increasing intensity of the CCA urine-dipstick test band and faecal egg count was observed. Assigning trace reactions as putative infection negative, overall diagnostic sensitivity (SS) of the CCA urine-dipstick was 87.7% (95% CIs = 80.6-93.0%), specificity (SP) was 68.1% (95% CIs = 54.3-80.0%), positive predictive value (PPV) was 86.1% (95% CIs = 78.8-91.7%) and negative predictive value (NPV) was 71.1% (95% CIs = 57.2-82.8%). To assist in objective defining of the CCA urine-dipstick result, we propose the use of a simple colour chart and conclude that the CCA urine-dipstick is a satisfactory alternative, or supplement, to Kato-Katz examination for rapid detection of intestinal schistosomiasis.

  6. Performance of circulating cathodic antigen (CCA urine-dipsticks for rapid detection of intestinal schistosomiasis in schoolchildren from shoreline communities of Lake Victoria

    Directory of Open Access Journals (Sweden)

    Kariuki HC

    2010-02-01

    Full Text Available Abstract For disease surveillance and mapping within large-scale control programmes, RDTs are becoming popular. For intestinal schistosomiasis, a commercially available urine-dipstick which detects schistosome circulating cathodic antigen (CCA in host urine is being increasingly applied, however, further validation is needed. In this study, we compared the CCA urine-dipstick test against double thick Kato-Katz faecal smears from 171 schoolchildren examined along the Tanzanian and Kenyan shorelines of Lake Victoria. Diagnostic methods were in broad agreement; the mean prevalence of intestinal schistosomiasis inferred by Kato-Katz examination was 68.6% (95% confidence intervals (CIs = 60.7-75.7% and 71.3% (95% CIs = 63.9-78.8% by CCA urine-dipsticks. There were, however, difficulties in precisely 'calling' the CCA test result, particularly in discrimination of 'trace' reactions as either putative infection positive or putative infection negative, which has important bearing upon estimation of mean infection prevalence; considering 'trace' as infection positive mean prevalence was 94.2% (95% CIs = 89.5-97.2%. A positive association between increasing intensity of the CCA urine-dipstick test band and faecal egg count was observed. Assigning trace reactions as putative infection negative, overall diagnostic sensitivity (SS of the CCA urine-dipstick was 87.7% (95% CIs = 80.6-93.0%, specificity (SP was 68.1% (95% CIs = 54.3-80.0%, positive predictive value (PPV was 86.1% (95% CIs = 78.8-91.7% and negative predictive value (NPV was 71.1% (95% CIs = 57.2-82.8%. To assist in objective defining of the CCA urine-dipstick result, we propose the use of a simple colour chart and conclude that the CCA urine-dipstick is a satisfactory alternative, or supplement, to Kato-Katz examination for rapid detection of intestinal schistosomiasis.

  7. Timing and causes of gully erosion in the riparian zone of the semi-arid tropical Victoria River, Australia: Management implications

    Science.gov (United States)

    McCloskey, G. L.; Wasson, R. J.; Boggs, G. S.; Douglas, M.

    2016-08-01

    Gully erosion in the seasonally wet tropics of Australia is a major source of sediment in rivers. Stabilization of gullies to reduce impacts on aquatic ecosystems and water storages is a focus for management. However, the cause of the gully erosion is poorly understood and so a critical context for soil conservation is missing. It is uncertain if they are the result of post-European cattle grazing or are they much older and related to non-human factors. The causes of riparian gully erosion along a reach of the Victoria River in the semi-arid tropics of Australia were investigated using several methods. Gully complexes were described and characterised by two major components: a Flood Drainage Channel (FDC) and upslope of this an Outer Erosion Feature (OEF) characterised by badlands set within an amphitheatre. The OEF is likely to be a major source of sediment that appears to be of recent origin. A review of historical records, combined with Optically Stimulated Luminescence (OSL) dating, showed that the FDCs were well established prior to the introduction of domestic stock. It also showed that the badlands began to develop about 90 years ago; that is, about 40 years after the arrival of domestic stock. In addition, an analysis of aerial photos coupled with an on-ground survey and analysis of fallout radionuclides revealed that erosion processes are still active within the gully complexes. While the FDCs are natural drainage channels, cattle grazing probably triggered the badland formation, with the expansion aided by increased rainfall in the past 40 years. Therefore, the OEFs are of human origin and protection from grazing of the riparian zone should slow badland erosion and reduce sediment input to the river.

  8. A tuff cone erupted under frozen-bed ice (northern Victoria Land, Antarctica): linking glaciovolcanic and cosmogenic nuclide data for ice sheet reconstructions

    Science.gov (United States)

    Smellie, J. L.; Rocchi, S.; Johnson, J. S.; Di Vincenzo, G.; Schaefer, J. M.

    2018-01-01

    The remains of a small volcanic centre are preserved on a thin bedrock ridge at Harrow Peaks, northern Victoria Land, Antarctica. The outcrop is interpreted as a monogenetic tuff cone relict formed by a hydrovolcanic (phreatomagmatic) eruption of mafic magma at 642 ± 20 ka (by 40Ar-39Ar), corresponding to the peak of the Marine Isotope Stage 16 (MIS16) glacial. Although extensively dissected and strewn with glacial erratics, the outcrop shows no evidence for erosion by ice. From interpretation of the lithofacies and eruptive mechanisms, the weight of the evidence suggests that eruptions took place under a cold-based (frozen-bed) ice sheet. This is the first time that a tuff cone erupted under cold ice has been described. The most distinctive feature of the lithofacies is the dominance of massive lapilli tuff rich in fine ash matrix and abraded lapilli. The lack of stratification is probably due to repeated eruption through a conduit blasted through the ice covering the vent. The ice thickness is uncertain but it might have been as little as 100 m and the preserved tephra accumulated mainly as a crater (or ice conduit) infill. The remainder of the tuff cone edifice was probably deposited supraglacially and underwent destruction by ice advection and, particularly, collapse during a younger interglacial. Dating using 10Be cosmogenic exposure of granitoid basement erratics indicates that the erratics are unrelated to the eruptive period. The 10Be ages suggest that the volcanic outcrop was most recently exposed by ice decay at c. 20.8 ± 0.8 ka (MIS2) and the associated ice was thicker than at 642 ka and probably polythermal rather than cold-based, which is normally assumed for the period.

  9. Além da lama e do lixo: movimentos de escolarização em São Pedro, Vitória/ES (1977-2007 Beyond the mud and the waste: schooling movements in San Pedro, Victoria/ES (1977-2007

    Directory of Open Access Journals (Sweden)

    Kezia Rodrigues Nunes

    2012-03-01

    Full Text Available Discute o processo histórico de escolarização da infância no bairro São Pedro I, em Vitória/ES. Relaciona-o com o movimento de constituição da região na década de 1970. Toma como lócus o CMEI da Amizade, instituição que acompanha a primeira referência de espaço educativo. Privilegia como fonte o relato dos sujeitos residentes no bairro, expressos em dois livros sobre o movimento de constituição da região, escritos por uma moradora, e uma obra produzida por pesquisadores, moradores e a Prefeitura de Vitória. Também destaca as narrativas de uma cozinheira e de uma auxiliar de serviços gerais, profissionais da instituição pesquisada. As fontes são analisadas como "testemunhos", como conhecimento através de "vestígios". Procura compreender os "usos táticos" e "estratégicos" praticados pelos sujeitos na mobilização popular, na organização das moradias e instituições educativas, bem como os reflexos dessa experiência para os que permanecem no CMEI educando crianças, atualmente.This paper discusses the historical process of schooling in childhood in the neighborhood of San Pedro I, in Victoria, E.S. It looks at the constitutional movement of the 1970s in the (E.S. region. As its focal point, it takes "CMEI da Amizade", an institution that follows the first reference to educational space. It has as a privileged source, the accounts of residents of the neighborhood. These subjects' accounts, are expressed in two books on the region's constitutional movement, one written by a resident, and another, a work produced by researchers, residents and the local government of Victoria. It also highlights the narratives of a cook and a general services assistant, professionals of the institution being investigated. The sources are analyzed as witness accounts providing remnants of knowledge and therefore comparative data. What it seeks to understand are the "practical strategies" and "tactics" employed by the subjects in these

  10. Predominance of influenza A(H1N1)pdm09 virus genetic subclade 6B.1 and influenza B/Victoria lineage viruses at the start of the 2015/16 influenza season in Europe.

    Science.gov (United States)

    Broberg, Eeva; Melidou, Angeliki; Prosenc, Katarina; Bragstad, Karoline; Hungnes, Olav

    2016-01-01

    Influenza A(H1N1)pdm09 viruses predominated in the European influenza 2015/16 season. Most analysed viruses clustered in a new genetic subclade 6B.1, antigenically similar to the northern hemisphere vaccine component A/California/7/2009. The predominant influenza B lineage was Victoria compared with Yamagata in the previous season. It remains to be evaluated at the end of the season if these changes affected the effectiveness of the vaccine for the 2015/16 season.

  11. Autoestima y agresividad en estudiantes de quinto grado de educación primaria de la institución educativa estatal "Pedro Adolfo Labarthe", distrito La Victoria, UGEL 03 San Miguel 2015.

    OpenAIRE

    Pariona Martínez, Magaly

    2015-01-01

    Este estudio responde al objeto determinar si existe relación significativa de la autoestima con la agresividad en estudiantes de quinto grado de educación primaria de la Institución Educativa estatal “Pedro Adolfo Labarthe”, distrito la Victoria, UGEL 03 San Miguel, 2015. El interés de la presente investigación es establecer la relación entre los factores emocionales – particularmente la autoestima- y la agresividad en estudiantes de quinto grado de educación primaria, describir cómo ha sido...

  12. The impact of socio-economic disadvantage on rates of hospital separations for diabetes-related foot disease in Victoria, Australia

    Directory of Open Access Journals (Sweden)

    Colman Peter G

    2011-06-01

    Full Text Available Abstract Background Information describing variation in health outcomes for individuals with diabetes related foot disease, across socioeconomic strata is lacking. The aim of this study was to investigate variation in rates of hospital separations for diabetes related foot disease and the relationship with levels of social advantage and disadvantage. Methods Using the Index of Relative Socioeconomic Disadvantage (IRSD each local government area (LGA across Victoria was ranked from most to least disadvantaged. Those LGAs ranked at the lowest end of the scale and therefore at greater disadvantage (Group D were compared with those at the highest end of the scale (Group A, in terms of total and per capita hospital separations for peripheral neuropathy, peripheral vascular disease, foot ulceration, cellulitis and osteomyelitis and amputation. Hospital separations data were compiled from the Victorian Admitted Episodes Database. Results Total and per capita separations were 2,268 (75.3/1,000 with diabetes and 2,734 (62.3/1,000 with diabetes for Group D and Group A respectively. Most notable variation was for foot ulceration (Group D, 18.1/1,000 versus Group A, 12.7/1,000, rate ratio 1.4, 95% CI 1.3, 1.6 and below knee amputation (Group D 7.4/1,000 versus Group A 4.1/1,000, rate ratio 1.8, 95% CI 1.5, 2.2. Males recorded a greater overall number of hospital separations across both socioeconomic strata with 66.2% of all separations for Group D and 81.0% of all separations for Group A recorded by males. However, when comparing mean age, males from Group D tended to be younger compared with males from Group A (mean age; 53.0 years versus 68.7 years. Conclusion Variation appears to exist for hospital separations for diabetes related foot disease across socioeconomic strata. Specific strategies should be incorporated into health policy and planning to combat disparities between health outcomes and social status.

  13. Scoping of models to support population-based regional health planning and management: comparison with the regional operating model in Victoria, Australia.

    Science.gov (United States)

    Levesque, Jean-Frederic; O'Dowd, John J M; Ní Shé, Éidín M; Weenink, Jan-Willem; Gunn, Jane

    2017-05-01

    Objective The aim of the present study was to try to understand the breadth and comprehensiveness of a regional operating model (ROM) developed within the Victorian Department of Health's North West Metropolitan Region office in Melbourne, Australia. Methods A published literature search was conducted, with additional website scanning, snowballing technique and expert consultation, to identify existing operating models. An analytical grid was developed covering 16 components to evaluate the models and assess the exhaustiveness of the ROM. Results From the 34 documents scoped, 10 models were identified to act as a direct comparator to the ROM. These concerned models from Australia (n=5) and other comparable countries (Canada, UK). The ROM was among the most exhaustive models, covering 13 of 16 components. It was one of the few models that included intersectoral actions and levers of influence. However, some models identified more precisely the planning tools, prioritisation criteria and steps, and the allocation mechanisms. Conclusions The review finds that the ROM appears to provide a wide coverage of aspects of planning and integrates into a single model some of the distinctive elements of the other models scoped. What is known about the topic? Various jurisdictions are moving towards a population-based approach to manage public services with regard to the provision of individual medical and social care. Various models have been proposed to guide the planning of services from a population health perspective. What does this paper add? This paper assesses the coverage of attributes of operating models supporting a population health planning approach to the management of services at the regional or local level. It provides a scoping of current models proposed to organise activities to ensure an integrated approach to the provision of services and compares the scoped models to a model recently implemented in Victoria, Australia. What are the implications for

  14. Landscape aridity, fire severity and rainfall intensity as controls on debris flow frequency after the 2009 Black Saturday Wildfires in Victoria

    Science.gov (United States)

    Nyman, Petter; Sherwin, Christopher; Sheridan, Gary; Lane, Patrick

    2015-04-01

    This study uses aerial imagery and field surveys to develop a statistical model for determining debris flow susceptibility in a landscape with variable terrain, soil and vegetation properties. A measure of landscape scale debris flow response was obtained by recording all debris flow affected drainage lines in the first year after fire in a ~258 000 ha forested area that was burned by the 2009 Black Saturday Wildfire in Victoria. A total of 12 500 points along the drainage network were sampled from catchments ranging in size from 0.0001 km2to 75 km2. Local slope and the attributes of the drainage areas (including the spatially averaged peak intensity) were extracted for each sample point. A logistic regression was used to model how debris flow susceptibility varies with the normalised burn ratio (dNBR, from Landsat imagery), rainfall intensity (from rainfall radar), slope (from DEM) and aridity (from long-term radiation, temperature and rainfall data).The model of debris flow susceptibility produced a good fit with the observed debris flow response of drainage networks within the burned area and was reliable in distinguishing between drainage lines which produced debris flows and those which didn't. The performance of the models was tested through multiple iterations of fitting and testing using unseen data. The local channel slope captured the effect of scale on debris flow susceptibility with debris flow probability approaching zero as the channel slope decreased with increasing drainage area. Aridity emerged as an important predictor of debris flow susceptibility, with increased likelihood of debris flows in drier parts of the landscape, thus reinforcing previous research in the region showing that post-fire surface runoff from wet Eucalypt forests is insufficient for initiating debris flows. Fire severity, measured as dNBR, was also a very important predictor. The inclusion of local channel slope as a predictor of debris flow susceptibility proved to be an

  15. Variations in first-time caesarean birth between Eastern African immigrants and Australian-born women in public care: A population-based investigation in Victoria.

    Science.gov (United States)

    Belihu, Fetene B; Small, Rhonda; Davey, Mary-Ann

    2017-06-01

    Caesarean section (CS) rates are known to vary by country, migration status and social group. However, little population-based, confounder adjusted evidence exists on caesarean rate for African immigrants in Australia. To investigate disparities in first-time caesarean, mainly unplanned caesarean in labour for women born in Eritrea, Ethiopia, Somalia and Sudan relative to Australian-born women in public care. A population-based study of 237 943 Australian and 4057 Eastern African singleton births between 1999 and 2007, was conducted using Victorian Perinatal Data Collection. Descriptive and multivariable logistic regression analysis by parity, adjusting for confounders selected a priori, was performed for first-time unplanned caesarean in labour and overall caesarean. Primiparae born in each of the Eastern African countries had elevated odds of unplanned caesarean in labour: Eritrea adjusted odds ratio (ORadj ) 2.04 95% CI (1.41, 2.97), Ethiopia ORadj 2.08 95% CI (1.62, 2.68), Somalia ORadj 1.62 95% CI (1.25, 2.10) and Sudan ORadj 1.39 95% CI (1.03, 1.87). Similarly, multiparae from Eastern African countries had elevated odds of unplanned caesarean in labour: Eritrea ORadj 2.13 95%CI(1.15, 3.97), Ethiopia ORadj 2.05 95% CI (1.38, 3.03), Somalia ORadj 2.16 95% CI (1.69, 2.77) and Sudan ORadj 1.81 95% CI (1.32, 2.49). The odds of any first-time caesarean (planned or unplanned) were elevated for primiparae born in all countries except Sudan and for multiparae born in Ethiopia and Somalia. We observed substantial variations in a first-time CS between Eastern African and Australian-born women in Victoria, Australia. However, these disparities were unexplained by socio-demographic and clinical risks, suggesting the potential importance of other factors such as communication difficulties, support systems for immigrant pregnant women and possible differences in care. © 2016 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.

  16. Orbital forcing of glacial/interglacial variations in chemical weathering within the White Nile basin: stable-isotope and biomarker evidence from Lakes Victoria and Edward

    Science.gov (United States)

    Cockerton, Helen E.; Alayne Street-Perrott, F.; Barker, Philip A.; Leng, Melanie J.; Sloane, Hilary J.; Horstwood, Matthew S. A.; Snelling, Andrea

    2014-05-01

    The continental Si cycle on Quaternary time scales has been largely neglected. Emphasis has been placed on long-term geochemical processes of silicate-rock weathering and the resulting drawdown of atmospheric CO2, rather than on shorter-term biogenic processes occurring along the land-ocean continuum. Si-accumulating plants (notably tropical rainforest hardwoods, savanna and wetland grasses, and Papyrus) and aquatic organisms (such as diatoms and sponges in lakes, rivers and swamps) have the potential to take up, store and recycle significant amounts of Si, thereby modifying the riverine flux of Si to the oceans, the productivity of siliceous marine organisms and the rate of atmospheric CO2 drawdown on an orbital time scale. The main aim of this study was to investigate spatial and temporal patterns of Si cycling along the Nile system during the last 20ka BP. Utilising sediment cores from Lakes Victoria and Edward, coupled measurements of stable Si and O isotopes on cleaned diatom separates were employed to reconstruct millennial-scale variations in biotic Si cycling and palaeohydrology, respectively. Abundance ratios of lipid biomarkers (n-alkanes) were used to track major changes in terrestrial and aquatic ecosystems. The results have been interpreted in the light of multi-isotope analyses (2H,18O,30Si) of modern water samples collected along the courses of the modern White and Blue Niles during both wet- and dry-season conditions. During drier intervals (the Last Glacial Maximum and the late Holocene: high 18Odiatom), Si cycling was greatly reduced. Diminished vegetation cover, reduced biotic rock weathering, a declining soil stock of amorphous silica (ASi) and decreased runoff resulted in reduced dissolved silica (DSi) supply to the lakes in relation to aquatic demand (high 30Sidiatom). In contrast, enhanced monsoon rainfall (low 18Odiatom) during the early to mid-Holocene promoted a substantial increase in terrestrial biomass within the White Nile headwaters

  17. The carbon cycle since the LGM in the University of Victoria Earth System Climate Model: Implications of marine ice shelves and late-Holocene deforestation

    Science.gov (United States)

    Simmons, C. T.; Mysak, L. A.; Matthews, D.

    2012-12-01

    The University of Victoria Earth System Climate Model (version v.9) is used to investigate carbon cycle dynamics from the Last Glacial Maximum (21000 years Before Present (BP)) to the beginning of the Industrial Revolution (150 BP). A series of simulations with prescribed and freely-evolving CO2 infer that a combination of two factors, a faster overturning of the oceans during the interglacial and a release of carbon from deep-sea sediments, are likely responsible for a substantial proportion of the glacial-interglacial CO2 increase from 190 (23000 BP) to 280 ppm (150 BP). The simulations also indicate that a realistic glacial-interglacial change in the meridional overturning circulation can be generated without accounting for runoff from melting ice sheets. A series of model experiments also investigated the mechanisms behind the Holocene increase in CO2 after 8000 BP. Without the explicit representation of peatlands, permafrost, coral reefs, or human land use, the UVic model simulation of the natural carbon cycle over the period produced a decline in the atmospheric CO2 from 260 to around 250 ppm, in contrast to the increase from 260 to 280 ppm actually observed. Surprisingly, sensitivity simulations with global deforestation actually yielded lower CO2 concentrations (249-254 ppm) at 150 BP than the same simulations with no deforestation; however, deforestation of certain vegetation types lead to higher concentrations (~270 ppm). Even without deforestation, the decrease in CO2 is highly sensitive to the configuration of land ice shelves near Antarctica, with more extensive land ice leading to deeper local circulation in the Southern Ocean, less Antarctic-generated bottom waters globally, and a higher atmospheric CO2 concentrations (260 ppm) at 150 BP. The 5-8 ppm contribution of ice shelf extent may well be an important contributor to the higher analogue CO2 levels during the Holocene interglacial, as current data and reconstructions suggests that these ice

  18. The near boiling reactor: Conceptual design of a small inherently safe nuclear reactor to extend the operational capability of the Victoria Class submarine

    Science.gov (United States)

    Cole, Christopher J. P.

    Nuclear power has several unique advantages over other air independent energy sources for nuclear combat submarines. An inherently safe, small nuclear reactor, capable of supply the hotel load of the Victoria Class submarines, has been conceptually developed. The reactor is designed to complement the existing diesel electric power generation plant presently onboard the submarine. The reactor, rated at greater than 1 MW thermal, will supply electricity to the submarine's batteries through an organic Rankine cycle energy conversion plant at 200 kW. This load will increase the operational envelope of the submarine by providing up to 28 continuous days submerged, allowing for an enhanced indiscretion ratio (ratio of time spent on the surface versus time submerged) and a limited under ice capability. The power plant can be fitted into the existing submarine by inserting a 6 m hull plug. With its simplistic design and inherent safety features, the reactor plant will require a minimal addition to the crew. The reactor employs TRISO fuel particles for increased safety. The light water coolant remains at atmospheric pressure, exiting the core at 96°C. Burn-up control and limiting excess reactivity is achieved through movable reflector plates. Shut down and regulatory control is achieved through the thirteen hafnium control rods. Inherent safety is achieved through the negative prompt and delayed temperature coefficients, as well as the negative void coefficient. During a transient, the boiling of the moderator results in a sudden drop in reactivity, essentially shutting down the reactor. It is this characteristic after which the reactor has been named. The design of the reactor was achieved through modelling using computer codes such as MCNP5, WIMS-AECL, FEMLAB, and MicroShield5, in addition to specially written software for kinetics, heat transfer and fission product poisoning calculations. The work has covered a broad area of research and has highlighted additional areas

  19. High prevalence of fasciolosis and evaluation of drug efficacy against Fasciola hepatica in dairy cattle in the Maffra and Bairnsdale districts of Gippsland, Victoria, Australia.

    Science.gov (United States)

    Elliott, T P; Kelley, J M; Rawlin, G; Spithill, T W

    2015-04-15

    Liver fluke (Fasciola hepatica) is a common parasite amongst grazing livestock in the south-eastern region of Australia and is responsible for significant production losses in the beef and dairy industries. Gippsland in Victoria is a major region for dairy production but no fluke prevalence data in livestock has been obtained in this region since the late 1970s prior to the introduction of Triclabendazole (TCBZ). TCBZ resistance is also now widespread in cattle in south east Australia. In this study, we evaluated the prevalence and intensity of liver fluke infections in dairy cattle in Gippsland and assessed the efficacy of TCBZ and other drenches against F. hepatica on one farm. We obtained 30 individual faecal samples from each of 15 different farms and, using the liver fluke coproantigen ELISA, tested bulk faecal samples pooled from each farm. Any farm that returned a positive bulk sample had all of the samples tested individually to assess the intra-herd prevalence. One farm in the Maffra district also had a coproantigen reduction test and faecal egg count reduction test to assess the efficacy of TCBZ, Clorsulon (CLOR) and Oxyclozanide (OXY). The coproantigen ELISA proved to be a highly sensitive test for liver fluke with a high correlation (R(2)=0.8849) observed between ELISA data from bulk samples and individual samples, suggesting that future larger scale screening on farms for fasciolosis could use the bulk analysis technique. The ELISA data revealed that animals on six of the 15 farms were infected with F. hepatica and the herd prevalence of the infected herds ranged from 47 to 100% (mean 81%) which exceeds the prevalence value for production losses of 25%. The intensity of fluke infection in cattle varied considerably both within and between herds with a proportion of animals exhibiting a positive control value in the coproantigen ELISA of 50-88%. We also confirmed that TCBZ resistance was present on one farm but that CLOR or OXY can be used to remove the

  20. The outcomes of health-promoting communities: being active eating well initiative-a community-based obesity prevention intervention in Victoria, Australia.

    Science.gov (United States)

    Bolton, K A; Kremer, P; Gibbs, L; Waters, E; Swinburn, B; de Silva, A

    2017-07-01

    schools (P<0.05). All effect sizes were in the small-to-moderate range. This was a complex and ambitious initiative, which attempted to expand a previously successful community-based intervention in Victoria into five new contexts and communities. Overall, project success was quite inconsistent, and some significant differences were in the unanticipated direction. However, there are many important learnings that should inform future health-promotion activities. The heterogeneity of outcomes of HPC:BAEW communities reflects the reality of life whereby effectiveness of intervention strategies is dependent on individual and community factors. Future health promotion should consider a systems approach whereby existing systems are modified rather than relying heavily on the addition of new activities, with longer time frames for implementation.