WorldWideScience

Sample records for vicinity nez perce

  1. Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement Summary.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho)

    1996-06-01

    This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe`s culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle.

  2. Nez Perce Tribal Hatchery Program: Draft environmental impact statement. Summary

    International Nuclear Information System (INIS)

    1996-06-01

    This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe's culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle

  3. The Nez Perce Flight to Canada: An Analysis of the Nez Perce-US Cavalry Conflicts: Applying Historical Lessons Learned to Modern Counterinsurgency and Global War on Terrorism Operations

    National Research Council Canada - National Science Library

    Pfau, Scott E

    2006-01-01

    ... Cavalry pursuit of the Nez Perce. Many of the tactics, techniques, and procedures used by the modern day warriors often derive from lessons learned in early US military confrontations, such as the Nez Perce, and are applicable...

  4. Council of Energy Resources Tribes 1993 summer internship report: Nez Perce Tribe

    Energy Technology Data Exchange (ETDEWEB)

    Crow, J.S.

    1993-08-01

    This paper is designed to be a working part of a larger project which would deal with the topic of Tribal interests affected by the DOE Environmental Restoration and Waste Management program and the approaches by which those Tribal interests can be advanced. Topics discussed in this paper include: background history of the Nez Perce Tribe`s relations with the US government; a Nez Perce view of tribal interests affected by DOE activities at Hanford; and a Nez Perce framework for private/governmental/tribal interest.

  5. Monitoring and evaluation plan for the Nez Perce Tribal Hatchery

    Energy Technology Data Exchange (ETDEWEB)

    Steward, C.R.

    1996-08-01

    The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan, the 1995 Supplement to the Master Plan, and the Nez Perce Tribal Hatchery Program Environmental Impact Statement. The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts.

  6. Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho).

    1996-06-01

    Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management.

  7. Nez Perce Tribal Hatchery Program: Draft environmental impact statement

    International Nuclear Information System (INIS)

    1996-06-01

    Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management

  8. Nez Perce Tribal Hatchery Program. Draft environmental impact statement

    International Nuclear Information System (INIS)

    1996-06-01

    Bonneville Power Administration, the Bureau of Indian Affairs, and the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia river juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increased competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management. Impacts to cultural resources can be avoided so impacts would be low. Soil impacts would be localized and their effects would be local and temporary during construction. Impacts to water quality would be low. Mitigation would be used if impacts to groundwater or surface water are greater than anticipated. No impacts to floodplains are expected. Impacts to all categories of fish range from no to high impacts

  9. Nez Perce Tribal Hatchery Complex; Operations and Maintenance and 2005 Annual Operation Plan, 2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Harty, Harold R.; Lundberg, Jeffrey H.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)

    2005-02-01

    The Nez Perce Tribal Hatchery (NPTH) responds directly to a need to mitigate for naturally-reproducing salmon in the Clearwater River subbasin. The overall goal is to produce and release fish that will survive to adulthood, spawn in the Clearwater River subbasin and produce viable offspring that will support future natural production and genetic integrity. Several underlying purposes of fisheries management will be maintained through this program: (1) Protect, mitigate, and enhance Columbia River subbasin anadromous fish resources. (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater River subbasin. (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project completion. (4) Sustain long-term fitness and genetic integrity of targeted fish populations. (5) Keep ecological and genetic impacts to non-target populations within acceptable limits. (6) Promote Nez Perce Tribal Management of Nez Perce Tribal hatchery Facilities and production areas within Nez Perce Treaty lands. Nez Perce Tribal Hatchery is a supplementation program that will rear and release spring, fall, and early-fall stocks of chinook salmon. Two life stages of spring chinook salmon will be released: parr and presmolts. Fall and early-fall chinook salmon will be released as subyearling smolts. The intent of NPTHC is to use conventional hatchery and Natural Rearing Enhancement Systems (NATURES) techniques to develop, increase and restore natural populations of spring and fall chinook salmon in the Clearwater River subbasin.

  10. Forest resources of the Nez Perce National Forest

    Science.gov (United States)

    Michele Disney

    2010-01-01

    As part of a National Forest System cooperative inventory, the Interior West Forest Inventory and Analysis (IWFIA) Program of the USDA Forest Service conducted a forest resource inventory on the Nez Perce National Forest using a nationally standardized mapped-plot design (for more details see the section "Inventory methods"). This report presents highlights...

  11. Monitoring and Evaluation Plan for the Nez Perce Tribal Hatchery, 1996 Technical Report.

    Energy Technology Data Exchange (ETDEWEB)

    Steward, Cleveland R.

    1996-08-01

    The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan (Larson and Mobrand 1992), the 1995 Supplement to the Master Plan (Johnson et al. 1995), and the Nez Perce Tribal Hatchery Program Environmental Impact Statement (Bonneville Power Administration et al. 1996). The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine. whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts. Program success will be gauged primarily by changes in the abundance and distribution of supplemented chinook populations. The evaluation of project-related impacts will focus on the biological effects of constructing and operating NPTH hatchery facilities, introducing hatchery fish into the natural environment, and removing or displacing wild

  12. The Nez Perce Flight to Canada: An Analysis of the Nez Perce-US Cavalry Conflicts: Applying Historical Lessons Learned to Modern Counterinsurgency and Global War on Terrorism Operations

    Science.gov (United States)

    2006-06-16

    Battle in which US Regimental Commander, Captain David Perry, appeared in a US court of inquiry to explain his devastating loss to the Nez Perce. He...changed, however, with the massacre of a detachment of eighty men under the command of Captain William J. Fetterman on the morning of 21 December...University, Homepage; available from http://www.howard.edu; Internet; accessed on 26 April 2006. 14John H Eicher, and David J. Eicher, Civil War High

  13. Spring Chinook Salmon Oncorhynchus tshawytscha Supplementation in the Clearwater Subbasin ; Nez Perce Tribal Hatchery Monitoring and Evaluation Project, 2007 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Backman, Thomas; Sprague, Sherman; Bretz, Justin [Nez Perce Tribe

    2009-06-10

    The Nez Perce Tribal Hatchery (NPTH) program has the following goals (BPA, et al., 1997): (1) Protect, mitigate, and enhance Clearwater Subbasin anadromous fish resources; (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater Subbasin; (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project initiation; (4) Sustain long-term fitness and genetic integrity of targeted fish populations; (5) Keep ecological and genetic impacts to non-target populations within acceptable limits; and (6) Promote Nez Perce Tribal management of Nez Perce Tribal Hatchery Facilities and production areas within Nez Perce Treaty lands. The NPTH program was designed to rear and release 1.4 million fall and 625,000 spring Chinook salmon. Construction of the central incubation and rearing facility NPTH and spring Chinook salmon acclimation facilities were completed in 2003 and the first full term NPTH releases occurred in 2004 (Brood Year 03). Monitoring and evaluation plans (Steward, 1996; Hesse and Cramer, 2000) were established to determine whether the Nez Perce Tribal Hatchery program is achieving its stated goals. The monitoring and evaluation action plan identifies the need for annual data collection and annual reporting. In addition, recurring 5-year program reviews will evaluate emerging trends and aid in the determination of the effectiveness of the NPTH program with recommendations to improve the program's implementation. This report covers the Migratory Year (MY) 2007 period of the NPTH Monitoring & Evaluation (M&E) program. There are three NPTH spring Chinook salmon treatment streams: Lolo Creek, Newsome Creek, and Meadow Creek. In 2007, Lolo Creek received 140,284 Brood Year (BY) 2006 acclimated pre-smolts at an average weight of 34.9 grams per fish, Newsome Creek received 77,317 BY 2006 acclimated pre-smolts at an average of 24

  14. Response of ponderosa pine stands to pre-commercial thinning on Nez Perce and Spokane Tribal forests in the Inland Northwest, USA

    Science.gov (United States)

    Dennis E. Ferguson; John C. Byrne; William R. Wykoff; Brian Kummet; Ted Hensold

    2011-01-01

    Stands of dense, natural ponderosa pine (Pinus ponderosa var. ponderosa) regeneration were operationally, precommercially thinned at seven sites - four on Nez Perce Tribal lands in northern Idaho and three on Spokane Tribal lands in eastern Washington. Five spacing treatments were studied - control (no thinning), 5x5 ft, 7x7 ft, 10x10 ft, and 14x14 ft. Sample trees...

  15. Nez Perce Tribal Hatchery Project, Operations and Maintenance and Planning and Design, 2001 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)

    2006-03-01

    This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2001 annual report combines information from two contracts with a combined value of $2,336,491. They are identified by Bonneville Power Administration as follows: (1) Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and (2) Planning and Design--Project No. 1983-350-00, Contract No. 4035. The Operations and Maintenance (O&M) budget of $2,166,110 was divided as follows: Facility Development and Fish Production Costs--$860,463; and Equipment Purchases as capital cost--$1,305,647 for equipment and subcontracts. The Planning and Design (P&D) budget of $170,381 was allocated to development of a Coho master planning document in conjunction with Nez Perce Tribal Hatchery. The O&M budget expenditures represent personnel and fish production expenses; e.g., administration, management, coordination, facility development, personnel training and fish production costs for spring Chinook and Coho salmon. Under Objective 1: Fish Culture Training and Education, tribal staff worked at Clearwater Anadromous Hatchery (CAFH) an Idaho Department of Fish and Game (IDFG) facility to produce spring Chinook smolt and parr for release that are intended to provide future broodstock for NPTH. As a training exercise, BPA allowed tribal staff to rear Coho salmon at Dworshak National Fish Hatchery, a U.S. Fish and Wildlife Service (USFWS) facility. This statement of work allows this type of training to prepare tribal staff to later rear salmon at Nez Perce Tribal Hatchery under Task 1.6. As a subset of the O&M budget, the equipment purchase budget of $1,305,647 less $82,080 for subcontracts provides operational and portable equipment necessary for NPTH facilities after construction. The equipment budget for the year was $1,223,567; this year's purchases amounted $287,364.48 (see

  16. Nez Perce tribal hatchery project : combined-planning and design and operations and maintenance reports, annual report, 2000

    International Nuclear Information System (INIS)

    Larson, Roy Edward; Walker, Grant

    2002-01-01

    Nez Perce Tribal Hatchery (NPTH) Year-2000 Combined Maintenance and Operations (O and M) and Planning and Design (P and D) contract is hereby completed based on this annual report patterned after the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration. Primary project activities focused on completion of the Northwest Power Planning Council Step-3 process that: (1) Accepted final design, (2) Authorized a capital construction amount of $16,050,000, and (3) Authorized contractor selection, and (4) Provided construction site dedication, and (5) Implemented construction activities over an anticipated 2-year period of July 2000 through October 2002

  17. Nez Perce Tribal Hatchery Project; Operations and Maintenance and Planning and Design, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)

    2005-12-01

    This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2002 annual report combines information from two contracts with a combined value of $3,036,014. Bonneville Power Administration identifies them as follows; (1) Part I--Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and $2,682,635 which includes--Equipment costs of $1,807,105. (2) Part II--Planning and Design--Project No. 1983-35-04, Contract No. 4035, $352,379 for Clearwater Coho Restoration Master Plan development Based on NPPC authorization for construction and operation of NPTH, the annual contracts were negotiated for the amounts shown above under (1) and (2). Construction contracts were handled by BPA until all facilities are completed and accepted.

  18. A synthesis of ethnohistorical materials concerning the administration of Federal Indian policy among the Yakima, Umatilla, and Nez Perce Indian people: Working draft

    International Nuclear Information System (INIS)

    Liebow, E.B.; Younger, C.A.; Broyles, J.A.

    1987-11-01

    For the purposes of the Nuclear Waste Policy Act, the Confederated Tribes and Bands of the Yakima Indian Nation, the Confederated Tribes of the Umatilla Indian Reservation, and the Nez Perce Tribe have been accorded the status of ''Affected Indian Tribe'' and have become party to the proceedings to determine a suitable location for the nation's first commercial waste repository. Each of the Tribes has expressed concerns about the suitability of the Hanford Site in eastern Washington. These concerns, in general, address the proposed repository's effects on traditional spiritual beliefs and cultural practices, on tribal sovereignty and the Tribes' right to self-government, on the natural resources under tribal management jurisdiction, and on the health and socioeconomic characteristics of the Tribes' reservation communities. The Yakima, Umatilla, and Nez Perce have distinctive cultural traditions that may be adversely affected by activities related to the Basalt Waste Isolation Project (BWIP). Further, the Tribes enjoy a unique relationship with the federal government. Because of their distinctive cultures and governmental status, particular attention will be paid to expressed interests of the Tribes, and to ways in which these interests may be affected by the repository program. Monitoring is needed to describe current conditions among the Affected Tribes' populations, to describe BWIP site characterization activities affecting the Tribes, and to measure any changes in these conditions that may occur as a direct result of site characterization. This paper reports our first efforts at gathering historical information. It summarizes materials contained in two sources: the reports of field agents to the Commissioner of Indian Affairs (1854-1936), and the dockets of the Indian Claims Commission. 24 refs., 3 figs

  19. Biological and Physical Inventory of the Streams within the Nez Perce Reservation; Juvenile Steelhead Survey and Factors that Affect Abundance in Selected Streams in the Lower Clearwater River Basin, Idaho, 1983-1984 Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Kucera, Paul A.; Johnson, David B. (Nez Perce Tribe, Lapwai, ID)

    1986-08-01

    A biological and physical inventory of selected tributaries in the lower Clearwater River basin was conducted to collect information for the development of alternatives and recommendations for the enhancement of the anadromous fish resources in streams on the Nez Perce Reservation. Five streams within the Reservation were selected for study: Bedrock and Cottonwood Creeks were investigated over a two year period (1983 to 1984) and Big Canyon, Jacks and Mission Creeks were studied for one year (1983). Biological information was collected and analyzed on the density, biomass, production and outmigration of juvenile summer steelhead trout. Physical habitat information was collected on available instream cover, stream discharge, stream velocity, water temperature, bottom substrate, embeddedness and stream width and depth. The report focuses on the relationships between physical stream habitat and juvenile steelhead trout abundance.

  20. CERT tribal internship program. Final intern report: D`Lisa Penney, 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-09-01

    The purpose of this intern`s project was to: education the Nez Perce people of the Hanford situation; begin researching into past and present health effects from the Hanford site; and inform and educate the Nez Perce people of the Hanford site and past exposures. The specific objectives were to begin researching the history of Nez Perce people and Hanford; create an understanding for the importance of this research; define the radiation and risks and how they occur; inform the Nez Perce people of the issue; and write the paper so it is easy to understand. This intern report contains a copy of the final paper written for the Nez Perce people. Because the dose reconstruction for Hanford is not complete, the health effects section is informative, but not definitive.

  1. Neutron Decay with PERC: a Progress Report

    International Nuclear Information System (INIS)

    Konrad, G; Abele, H; Erhart, J; Fillunger, H; Gösselsberger, C; Horvath, M; Jericha, E; Klauser, C; Maix, R K; Nowak, S; Sauerzopf, C; Beck, M; Heil, W; Drescher, C; Dubbers, D; Märkisch, B; Mest, H; Rebrova, N; Roick, C; Klenke, J

    2012-01-01

    The PERC collaboration will perform high-precision measurements of angular correlations in neutron beta decay at the beam facility MEPHISTO of the Forschungs-Neutronenquelle Heinz Maier-Leibnitz in Munich, Germany. The new beam station PERC, a clean, bright, and versatile source of neutron decay products, is designed to improve the sensitivity of neutron decay studies by one order of magnitude. The charged decay products are collected by a strong longitudinal magnetic field directly from inside a neutron guide. This combination provides the highest phase space density of decay products. A magnetic mirror serves to perform precise cuts in phase space, reducing related systematic errors. The new instrument PERC is under development by an international collaboration. The physics motivation, sensitivity, and applications of PERC as well as the status of the design and preliminary results on uncertainties in proton spectroscopy are presented in this paper.

  2. Protect and Restore Red River Watershed, 2007-2008 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Bransford, Stephanie [Nez Perce Tribe Fisheries/Watershed Program

    2009-05-04

    The Nez Perce Tribe Department of Fisheries Resource Management, Watershed Division approaches watershed restoration with a ridge-top to ridge-top approach. The Nez Perce Tribe (NPT) and the Nez Perce National Forest (NPNF) have formed a partnership in completing watershed restoration activities, and through this partnership more work is accomplished by sharing funding and resources in our effort. The Nez Perce Tribe began watershed restoration projects within the Red River Watershed of the South Fork Clearwater River in 2001. Progress has been made in restoring the watershed through road decommissioning and culvert replacement. From completing a watershed assessment to two NEPA efforts and a final stream restoration design, we will begin the effort of restoring the mainstem channel of Red River to provide spawning and rearing habitat for anadromous and resident fish species. Roads have been surveyed and prioritized for removal or improvement as well as culverts being prioritized for replacement to accommodate fish passage throughout the watershed. Another major, and extremely, important component of this project is the Red River Meadow Conservation Easement. We have begun the process of pursuing a conservation easement on approximately 270 acres of prime meadow habitat (Red River runs through this meadow and is prime spawning and rearing habitat).

  3. 77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID

    Science.gov (United States)

    2012-11-15

    ... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...

  4. Association between Residential Proximity to PERC Dry Cleaning Establishments and Kidney Cancer in New York City

    Directory of Open Access Journals (Sweden)

    Jing Ma

    2009-01-01

    Full Text Available Perchloroethylene (PERC is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994–2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.

  5. Association between Residential Proximity to PERC Dry Cleaning Establishments and Kidney Cancer in New York City

    International Nuclear Information System (INIS)

    Ma, J.; Lessner, L.; Lessner, L.; Carpenter, D.O.; Schreiber, J.

    2010-01-01

    Perchloroethylene (PERC) is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994-2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.

  6. White Sturgeon Management Plan in the Snake River between Lower Granite and Hells Canyon Dams; Nez Perce Tribe, 1997-2005 Final Report.

    Energy Technology Data Exchange (ETDEWEB)

    Nez Perce Tribe Resources Management Staff, (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)

    2005-09-01

    White sturgeon in the Hells Canyon reach (HCR) of the Snake River are of cultural importance to the Nez Perce Tribe. However, subsistence and ceremonial fishing opportunities have been severely limited as a result of low numbers of white sturgeon in the HCR. Hydrosystem development in the Columbia River Basin has depressed numbers and productivity of white sturgeon in the HCR by isolating fish in impounded reaches of the basin, restricting access to optimal rearing habitats, reducing the anadromous forage base, and modifying early life-history habitats. Consequently, a proactive management plan is needed to mitigate for the loss of white sturgeon production in the HCR, and to identify and implement feasible measures that will restore and rebuild the white sturgeon population to a level that sustains viability and can support an annual harvest. This comprehensive and adaptive management plan describes the goals, objectives, strategies, actions, and expected evaluative timeframes for restoring the white sturgeon population in the HCR. The goal of this plan, which is to maintain a viable, persistent population that can support a sustainable fishery, is supported by the following objectives: (1) a natural, stable age structure comprising both juveniles and a broad spectrum of spawning age-classes; (2) stable or increasing numbers of both juveniles and adults; (3) consistent levels of average recruitment to ensure future contribution to reproductive potential; (4) stable genetic diversity comparable to current levels; (5) a minimum level of abundance of 2,500 adults to minimize extinction risk; and (6) provision of an annual sustainable harvest of 5 kg/ha. To achieve management objectives, potential mitigative actions were developed by a Biological Risk Assessment Team (BRAT). Identified strategies and actions included enhancing growth and survival rates by restoring anadromous fish runs and increasing passage opportunities for white sturgeon, reducing mortality rates

  7. Grande Ronde Basin Supplementation Program; Lostine River, 2000 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)

    2003-03-01

    The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.

  8. Grande Ronde Basin Supplementation Program; Lostine River, 2001 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)

    2003-03-01

    The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.

  9. Juan Ramón Jiménez and Nietzsche

    Directory of Open Access Journals (Sweden)

    John P. Devlin

    1983-01-01

    Full Text Available The young Juan Ramón Jiménez shared the enthusiasm for the writings of Nietzsche prevalent among his contemporaries. More significant are the interest in and affinity with Nietzsche which persisted into the poet's maturity. Jiménez found in Nietzsche not only a man of ideas but a poet who claimed to be a potent spiritual force. Both writers held that the modern age could recover a sense of spiritual integrity through the will of the individual to live and interpret human existence as an aesthetic phenomenon. Nietzsche's views on the nature of art and the role of the artist helped to sustain Jiménez' exalted and elitist view of poetry and the poet's mission. Jiménez felt an ethical kinship with the philosopher who asserted the absolute uniqueness of the creative individual, the end of whose existence was self-realization through his art. Nietzsche's doctrine of heroic vitalism as an antidote to chronic spiritual malaise corresponds to Jiménez' revitalized vision of the poetic word proclaimed in the Diario and elaborated in subsequent verse and prose writings.

  10. High precision neutron polarization for PERC

    International Nuclear Information System (INIS)

    Klauser, C.

    2013-01-01

    The decay of the free neutron into a proton, an electron and an anti-electron neutrino offers a simple system to study the semi-leptonic weak decay. High precision measurements of angular correlation coefficients of this decay provide the opportunity to test the standard model on the low energy frontier. The Proton Electron Radiation Channel PERC is part of a new generation of expriments pushing the accuracy of such an angular correlation coefficient measurement towards 10 -4 . Past experiments have been limited to an accuracy of 10 -3 with uncertainties on the neutron polarization as one of the leading systematic errors. This thesis focuses on the development of a stable, highly precise neutron polarization for a large, divergent cold neutron beam. A diagnostic tool that provides polarization higher than 99.99 % and analyzes with an accuracy of 10 -4 , the Opaque Test Bench, is presented and validated. It consists of two highly opaque polarized helium cells. The Opaque Test Bench reveals depolarizing effects in polarizing supermirrors commonly used for polarization in neutron decay experiments. These effects are investigated in detail. They are due to imperfect lateral magnetization in supermirror layers and can be minimized by significantly increased magnetizing fields and low incidence angle and supermirror factor m. A subsequent test in the crossed (X-SM) geometry demonstrated polarizations up to 99.97% from supermirrors only, improving neutron polarization with supermirrors by an order of magnitude. The thesis also discusses other neutron optical components of the PERC beamline: Monte-Carlo simulations of the beamline under consideration of the primary guide are carried out. In addition, calculation shows that PERC would statistically profit from an installation at the European Spallation source. Furthermore, beamline components were tested. A radio-frequency spin flipper was confirmed to work with an efficiency higher than 0.9999. (author) [de

  11. Innovative manufacturing technologies for low-cost, high efficiency PERC-based PV modules

    Energy Technology Data Exchange (ETDEWEB)

    Yelundur, Vijay [Suniva Inc., Norcross, GA (United States)

    2017-04-19

    The goal this project was to accelerate the deployment of innovative solar cell and module technologies that reduce the cost of PERC-based modules to best-in-class. New module integration technology was to be used to reduce the cost and reliance on conventional silver bus bar pastes and enhance cell efficiency. On the cell manufacturing front, the cost of PERC solar cells was to be reduced by introducing advanced metallization approaches to increase cell efficiency. These advancements will be combined with process optimization to target cell efficiencies in the range of 21 to 21.5%. This project will also explore the viability of a bifacial PERC solar cell design to enable cost savings through the use of thin silicon wafers. This project was terminated on 4/30/17 after four months of activity due financial challenges facing the recipient.

  12. 75 FR 28612 - Environmental Impact Statements; Notice of Availability

    Science.gov (United States)

    2010-05-21

    ... Counties, OR and Adams and Nez Perce Counties, ID, Wait Period Ends: 06/21/2010, Contact: Robert W. Rock.... EIS No. 20100181, Final EIS, DOE, MS, Kemper County Integrated Gasification Combined-Cycle (IGCC...

  13. Personalized Energy Reduction Cyber-Physical System (PERCS): A gamified end-user platform for energy efficiency and demand response.

    Energy Technology Data Exchange (ETDEWEB)

    Sintov, Nicole; Orosz, Michael; Schultz, P. Wesley

    2015-01-01

    The mission of the Personalized Energy Reduction Cyber-physical System (PERCS) is to create new possibilities for improving building operating efficiency, enhancing grid reliability, avoiding costly power interruptions, and mitigating greenhouse gas emissions. PERCS proposes to achieve these outcomes by engaging building occupants as partners in a user-centered smart service platform. Using a non-intrusive load monitoring approach, PERCS uses a single sensing point in each home to capture smart electric meter data in real time. The household energy signal is disaggregated into individual load signatures of common appliances (e.g., air conditioners), yielding near real-time appliance-level energy information. Users interact with PERCS via a mobile phone platform that provides household- and appliance-level energy feedback, tailored recommendations, and a competitive game tied to energy use and behavioral changes. PERCS challenges traditional energy management approaches by directly engaging occupant as key elements in a technological system.

  14. Optimization of Rear Local Al-Contacts on High Efficiency Commercial PERC Solar Cells with Dot and Line Openings

    Directory of Open Access Journals (Sweden)

    Peisheng Liu

    2014-01-01

    Full Text Available Crystalline silicon PERCs with dot or line openings on rear surface were studied here. By measuring the minor carrier lifetimes of the PERCs with dot and line openings, passivation effects of rear surface with dot and line openings were discussed. The performance affected by dot and line openings was analyzed in detail by testing the open-circuit voltages, short-circuit current densities, fill factors, and conversion efficiencies of the PERCs. The results show that the wider space resulted in better minor carrier lifetimes on the rear surface. And the cells with a line opening space of 0.5 mm had an average of 0.22% improvement of conversion efficiency, compared with the cells with full-area Al-BSF. On the other hand, the dot opening PERCs exhibited only a conversion efficiency of 17.4%, although there had been good rear surface reflectivity. The bad Al-Si alloy layer and large hollow densities in dot Al-contacts resulted in bad performance of the PERCs with dot openings.

  15. Plaidoyer pour le lavage de nez dans les pathologies naso ...

    African Journals Online (AJOL)

    Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

  16. Lower Red River Meadow Stream Restoration Project

    International Nuclear Information System (INIS)

    1996-05-01

    As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream

  17. Coho Salmon Master Plan, Clearwater River Basin.

    Energy Technology Data Exchange (ETDEWEB)

    Nez Perce Tribe; FishPro

    2004-10-01

    The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these

  18. The Native American Persistence in Higher Education: A Journey through Story to Identify the Family Support to Native American Graduates

    Science.gov (United States)

    Bisbee, Yolanda J. Guzman

    2013-01-01

    This Indigenous Framed Research will utilize counter-storytelling through shared collaborator stories provided by Nez Perce Native American Graduates. The methodology is shaped by an Indigenous Framework as this form of research promotes and develops a culturally resonant environment for constructing, analyzing and sharing information. The…

  19. 76 FR 44000 - Environmental Impact Statements; Notice of Availability

    Science.gov (United States)

    2011-07-22

    ..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...

  20. Cryopreservation of Adult Male Spring and Summer Chinook Salmon Gametes in the Snake River Basin, 1997 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Faurot, Dave; Kucera, Paul A.; Armstrong, Robyn D. (Nez Perce Tribe, Lapwai, ID)

    1998-06-01

    Chinook salmon populations in the Northwest are decreasing in number. The Nez Perce Tribe was funded in 1997 by the Bonneville Power Administration to coordinate and initiate gene banking of adult male gametes from Endangered Species Act (ESA) listed spring and summer chinook salmon in the Snake River basin.

  1. Trophic structure and mercury biomagnification in tropical fish assemblages, Iténez River, Bolivia.

    Directory of Open Access Journals (Sweden)

    Marc Pouilly

    Full Text Available We examined mercury concentrations in three fish assemblages to estimate biomagnification rates in the Iténez main river, affected by anthropogenic activities, and two unperturbed rivers from the Iténez basin, Bolivian Amazon. Rivers presented low to moderate water mercury concentrations (from 1.25 ng L(-1 to 2.96 ng L(-1 and natural differences in terms of sediment load. Mercury biomagnification rates were confronted to trophic structure depicted by carbon and nitrogen stable isotopes composition (δ(15N; δ(13C of primary trophic sources, invertebrates and fishes. Results showed a slight fish contamination in the Iténez River compared to the unperturbed rivers, with higher mercury concentrations in piscivore species (0.15 µg g(-1 vs. 0.11 µg g(-1 in the unperturbed rivers and a higher biomagnification rate. Trophic structure analysis showed that the higher biomagnification rate in the Iténez River could not be attributed to a longer food chain. Nevertheless, it revealed for the Iténez River a higher contribution of periphyton to the diet of the primary consumers fish species; and more negative δ(13C values for primary trophic sources, invertebrates and fishes that could indicate a higher contribution of methanotrophic bacteria. These two factors may enhance methylation and methyl mercury transfer in the food web and thus, alternatively or complementarily to the impact of the anthropogenic activities, may explain mercury differences observed in fishes from the Iténez River in comparison to the two other rivers.

  2. Universal Prevention Program Outcomes: Safe Schools Healthy Students in a Rural, Multicultural Setting

    Science.gov (United States)

    Harris, Elizabeth; McFarland, Joyce; Siebold, Wendi; Aguilar, Rafael; Sarmiento, Ana

    2007-01-01

    The Idaho Consortium for Safe Schools Healthy Students consists of three school districts in rural North Central Idaho and the Nez Perce Tribe's Students for Success Program. Universal prevention programs implemented in the elementary schools include Second Step and the middle schools implemented the Life Skills program. Each of the three…

  3. Northeast Oregon Hatchery Spring Chinook Master Plan, Technical Report 2000.

    Energy Technology Data Exchange (ETDEWEB)

    Ashe, Becky L.; Concannon, Kathleen; Johnson, David B.

    2000-04-01

    Spring chinook salmon populations in the Imnaha and Grande Ronde rivers are listed as threatened under the Endangered Species Act (ESA) and are at high risk of extirpation. The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and Oregon Department of Fish and Wildlife, are co-managers of conservation/restoration programs for Imnaha and Grande Ronde spring chinook salmon that use hatchery supplementation and conventional and captive broodstock techniques. The immediate goal of these programs is to prevent extirpation and provide the potential for restoration once factors limiting production are addressed. These programs redirect production occurring under the Lower Snake River Compensation Plan (LSRCP) from mitigation to conservation and restoration. Both the Imnaha and Grande Ronde conservation/restoration programs are described in ESA Section 10 permit applications and the co-managers refer to the fish production from these programs as the Currently Permitted Program (CPP). Recently, co-managers have determined that it is impossible to produce the CPP at Lookingglass Hatchery, the LSRCP facility intended for production, and that without additional facilities, production must be cut from these conservation programs. Development of new facilities for these programs through the Columbia Basin Fish and Wildlife Program is considered a new production initiative by the Northwest Power Planning Council (NPPC) and requires a master plan. The master plan provides the NPPC, program proponents and others with the information they need to make sound decisions about whether the proposed facilities to restore salmon populations should move forward to design. This master plan describes alternatives considered to meet the facility needs of the CPP so the conservation program can be fully implemented. Co-managers considered three alternatives: modify Lookingglass Hatchery; use existing facilities elsewhere in the Basin; and use new facilities in

  4. Salmonid Gamete Preservation in the Snake River Basin, 1998 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, Robyn; Kucera, Paul A. (Nez Perce Tribe, Lapwai, ID)

    1999-03-01

    Steelhead (Oncorhynchus mykiss) and salmon (Oncorhynchus tshawytscha)populations in the Northwest are decreasing. The Nez Perce Tribe (Tribe) was funded in 1998 by the Bonneville Power Administration to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin.

  5. Optimization of Controllable Factors in the Aluminum Silicon Eutectic Paste and Rear Silicon Nitride Mono-Passivation Layer of PERC Solar Cells

    Science.gov (United States)

    Park, Sungeun; Park, Hyomin; Kim, Dongseop; Yang, JungYup; Lee, Dongho; Kim, Young-Su; Kim, Hyun-Jong; Suh, Dongchul; Min, Byoung Koun; Kim, Kyung Nam; Park, Se Jin; Kim, Donghwan; Lee, Hae-Seok; Nam, Junggyu; Kang, Yoonmook

    2018-05-01

    Passivated emitter and rear contact (PERC) is a promising technology owing to high efficiency can be achieved with p-type wafer and their easily applicable to existing lines. In case of using p-type mono wafer, 0.5-1% efficiency increase is expected with PERC technologies compared to existing Al BSF solar cells, while for multi-wafer solar cells it is 0.5-0.8%. We addressed the optimization of PERC solar cells using the Al paste. The paste was prepared from the aluminum-silicon alloy with eutectic composition to avoid the formation of voids that degrade the open-circuit voltage. The glass frit of the paste was changed to improve adhesion. Scanning electron microscopy revealed voids and local back surface field between the aluminum electrode and silicon base. We confirmed the conditions on the SiNx passivation layer for achieving higher efficiency and better adhesion for long-term stability. The cell characteristics were compared across cells containing different pastes. PERC solar cells with the Al/Si eutectic paste exhibited the efficiency of 19.6%.

  6. Aurelio Martínez Mutis

    Directory of Open Access Journals (Sweden)

    Rafaél Maya

    1979-10-01

    Full Text Available La aparición de Aurelio Martínez Mutis en el escenario de las letras colombianas, hace unos treinta y cinco años, más o menos, fue súbita y fulgurante. Su "Epopeya del Cóndor", poesía premiada en el concurso abierto por la revista Mundial, que dirigía en París Rubén Darío, lo hizo célebre, de la noche a la mañana, entre los pueblos de habla hispana.

  7. A estratégia de pricing do Modelo Continente Hipermercados : perceção do consumidor

    OpenAIRE

    Sousa, Vasco Monteiro Carvalho de

    2016-01-01

    O objetivo da presente investigação é estudar a perceção dos consumidores sobre as estratégias de pricing do Modelo Continente Hipermercados, e surge no formato de uma tese de dissertação. O tema desta investigação abrange objetos predominantes da área de Marketing, nomeadamente o pricing, a distribuição e a perceção do consumidor. No estudo foi aplicado o método de estudo de caso incluindo a observação, análise e discussão. A investigação foi dividida por um lado na abordag...

  8. José Miguel Jiménez receives Order of Alfonso X the Wise

    CERN Multimedia

    CERN Bulletin

    2016-01-01

    On 12 July 2016, José Miguel Jiménez, Head of CERN Technology Department, has been awarded a spanish civil decoration — an encomienda — of the Order of Alfonso X the Wise (see here), for his outstanding experience in the field of research and scientific management in particle physics.   The ceremony took place at the National Library of Spain, in Madrid, on 12 July. From left: Marcial Marín Hellín, Secretary of State for Education, Professional training and Universities; José María Lassalle Ruiz, Secretary of State for Culture; Íñigo Méndez de Vigo y Montojo, Ministry of Education, Culture and Sport; José Miguel Jiménez, Head of CERN Technology Department; Carmen Vela Olmo, Secretary of State for Investigation, Development and Innovation. (Photo: ©Javier Martínez de la Torre, M...

  9. PERC 2 High-End Computer System Performance: Scalable Science and Engineering

    Energy Technology Data Exchange (ETDEWEB)

    Daniel Reed

    2006-10-15

    During two years of SciDAC PERC-2, our activities had centered largely on development of new performance analysis techniques to enable efficient use on systems containing thousands or tens of thousands of processors. In addition, we continued our application engagement efforts and utilized our tools to study the performance of various SciDAC applications on a variety of HPC platforms.

  10. Review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)

    DEFF Research Database (Denmark)

    Jensen, Kim Ebensgaard

    2014-01-01

    A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)......A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)...

  11. Simulation Tools for Forest Health Analysis: An Application in the Red River Watershed, Idaho

    Science.gov (United States)

    Andrew J. McMahan; Eric L. Smith

    2006-01-01

    Software tools for landscape analyses--including FVS model extensions, and a number of FVS-related pre- and post-processing “tools”--are presented, using an analysis in the Red River Watershed, Nez Perce National Forest as an example. We present (1) a discussion of pre-simulation data analysis; (2) the Physiographic Information Extraction System (PIES), a tool that can...

  12. Fish Passage Assessment: Big Canyon Creek Watershed, Technical Report 2004.

    Energy Technology Data Exchange (ETDEWEB)

    Christian, Richard

    2004-02-01

    This report presents the results of the fish passage assessment as outlined as part of the Protect and Restore the Big Canyon Creek Watershed project as detailed in the CY2003 Statement of Work (SOW). As part of the Northwest Power Planning Council's Columbia Basin Fish and Wildlife Program (FWP), this project is one of Bonneville Power Administration's (BPA) many efforts at off-site mitigation for damage to salmon and steelhead runs, their migration, and wildlife habitat caused by the construction and operation of federal hydroelectric dams on the Columbia River and its tributaries. The proposed restoration activities within the Big Canyon Creek watershed follow the watershed restoration approach mandated by the Fisheries and Watershed Program. Nez Perce Tribal Fisheries/Watershed Program vision focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects. We strive toward maximizing historic ecosystem productive health, for the restoration of anadromous and resident fish populations. The Nez Perce Tribal Fisheries/Watershed Program (NPTFWP) sponsors the Protect and Restore the Big Canyon Creek Watershed project. The NPTFWP has the authority to allocate funds under the provisions set forth in their contract with BPA. In the state of Idaho vast numbers of relatively small obstructions, such as road culverts, block thousands of miles of habitat suitable for a variety of fish species. To date, most agencies and land managers have not had sufficient, quantifiable data to adequately address these barrier sites. The ultimate objective of this comprehensive inventory and assessment was to identify all barrier crossings within the watershed. The barriers were then prioritized according to the

  13. El Profesor Académico, Dr. Pablo Gómez Martínez.

    Directory of Open Access Journals (Sweden)

    Zoilo Cuéllar-Montoya

    2007-12-01

    Más adelante, en la misma Presidencia de la Academia del Profesor Pedro José Almánzar Vargas (1963 – 1965, fue promovido Gómez Martínez a la categoría de Miembro de Número(2,10 con el trabajo “Ilio-cisto-plastia con colgajo sero-muscular invertido y reconstrucción de vejigas funcionales” (2,11. En la sesión ordinaria de la Academia del día 12 de marzo de 1964, el Académico Correspondiente Gómez Martínez presentó el trabajo mencionado(2,12 y, en la sesión ordinaria del día 14 de mayo de 1964, en virtud de haber quedado vacantes las sillas de los Señores Académicos de Número Jaime Jaramillo Arango, fallecido en Bogotá, el 31 de julio de 1962(2,13, Manuel José Luque Guevara, retirado por precarias condiciones de salud(2,14, y Fernando Torres Restrepo, trasladado definitivamente a los Estados Unidos(2,15, la Academia, en votación secreta, eligió, como Miembros de Número, a los Señores Académicos Correspondientes Pablo Gómez Martínez, Alfredo Artunduaga y J. Hernando Hernández Garay(2,16...

  14. Red River Stream Improvement Final Design Nez Perce National Forest.

    Energy Technology Data Exchange (ETDEWEB)

    Watershed Consulting, LLC

    2007-03-15

    This report details the final stream improvement design along the reach of Red River between the bridge below Dawson Creek, upstream for approximately 2 miles, Idaho County, Idaho. Geomorphic mapping, hydrologic profiles and cross-sections were presented along with existing fish habitat maps in the conceptual design report. This information is used to develop a stream improvement design intended to improve aquatic habitat and restore riparian health in the reach. The area was placer mined using large bucket dredges between 1938 and 1957. This activity removed most of the riparian vegetation in the stream corridor and obliterated the channel bed and banks. The reach was also cut-off from most valley margin tributaries. In the 50 years since large-scale dredging ceased, the channel has been re-established and parts of the riparian zone have grown in. However, the recruitment of large woody debris to the stream has been extremely low and overhead cover is poor. Pool habitat makes up more than 37% of the reach, and habitat diversity is much better than the project reach on Crooked River. There is little large woody debris in the stream to provide cover for spawning and juvenile rearing, because the majority of the woody debris does not span a significant part of the channel, but is mainly on the side slopes of the stream. Most of the riparian zone has very little soil or subsoil left after the mining and so now consists primarily of unconsolidated cobble tailings or heavily compacted gravel tailings. Knapweed and lodgepole pine are the most successful colonizers of these post mining landforms. Tributary fans which add complexity to many other streams in the region, have been isolated from the main reach due to placer mining and road building.

  15. South Fork Salmon River Watershed Restoration, 2008-2009 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Reaney, Mark D. [Nez Perce Tribe Department of Fisheries Resource Management

    2009-04-15

    The watershed restoration work elements within the project area, the South Fork Salmon River Watershed, follow the watershed restoration approach adopted by the Nez Perce Tribe Department of Fisheries Resource Management (DFRM) - Watershed Division. The vision of the Nez Perce Tribe DFRM-Watershed Division focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects and strategies that rely on natural fish production and healthy river ecosystems. The Nez Perce Tribe DFRM-Watershed Division strives towards maximizing historic ecosystem productivity and health for the restoration of anadromous and resident fish populations and the habitat on which all depend on for future generations Originally, this project was funded to create a step/pool stream channel that was appropriate to restore fish passage where the 'Glory Hole Cascade' is currently located at the Stibnite Mine. Due to unforeseen circumstances at the time, the project is unable to move forward as planned and a request for a change in scope of the project and an expansion of the geographic area in which to complete project work was submitted. No additional funds were being requested. The ultimate goal of this project is to work with the holistic, ridge top to ridge top approach to protect and restore the ecological and biological functions of the South Fork Salmon River Watershed to assist in the recovery of threatened and endangered anadromous and resident fish species. FY 2008 Work Elements included two aquatic organism passage (AOP) projects to restore habitat connectivity to two fish-bearing tributaries to the East Fork South Fork Salmon River, Salt and Profile Creeks. The Work Elements also included road survey and assessment

  16. Genetic diversity and conservation of Picea chihuahuana Martínez ...

    African Journals Online (AJOL)

    SAM

    2014-07-09

    Jul 9, 2014 ... individuals within a population and among populations within a species. Hence ... risks related to loss of species, populations and genetic resources; c) ... this spruce and two other congeners, Picea mexicana. Martínez and Picea .... high levels of self-fertilization and mating between closely related ...

  17. Loyola University distingue al Ing. Martínez

    OpenAIRE

    Lezcano, Liseth

    2011-01-01

    El Ing. Axel Martínez, Director de Recursos Humanos de la Universidad Tecnológica de Panamá (UTP), recibió un reconocimiento que le hizo el Instituto de Recursos Humanos y Relaciones Industriales de Loyola University Chicago (LUC), como egresado destacado del Programa de Maestría en Recursos Humanos, por la prestigiosa carrera académica y por sus éxitos profesionales en un importante ambiente académico.

  18. Genetic diversity and conservation of Picea chihuahuana Martínez ...

    African Journals Online (AJOL)

    The conservation of genetic diversity in tree populations is an essential component of sustainable forest management. Picea chihuahuana Martínez is an endemic conifer species in Mexico and is considered to be endangered. P. chihuahuana covers a total area of no more than 300 ha at the Sierra Madre Occidental, ...

  19. Več kot predgovor: "urednik" Pepite Jiménez:

    OpenAIRE

    Fock, Ignac

    2014-01-01

    The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) "editor". Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator - ficti...

  20. Controversy, Conflict and Compromise: A History of the Lower Snake River Development

    Science.gov (United States)

    1994-01-01

    river, farmers cultivated the loess-covered hills, and ranchers grazed sheep and cattle in the Channeled Scablands. Towns grew up to serve the...North America, the Nez Perce and Palouse practiced selective breeding. They castrated poorer stallions and traded inferior stock to neighboring...rains," making it impossible for "some kinds of grain [to] flourish," he noted that cattle and horses grew fat on the rich bunchgrass, and, like Lewis

  1. Tropic and race. Miguel Jiménez López and the Japanese Immigration in Colombia, 1920-1929

    Directory of Open Access Journals (Sweden)

    Abel Fernando Martínez Martín

    2017-01-01

    Full Text Available This article discusses the debate on immigration in Colombia, specifically focusing on Japanese immigration, an problem, by being so far from the desired European immigration. Likewise, the important role played by the psychiatrist and conservative Colombian politician Miguel Jiménez Lopez and his theory of degeneration of the Colombian race. Jiménez Lopez is the author of "The yellow immigration in the America", a publication of the National Academy of Medicine, written in response to the Ministry of Industries about the question for the possible impact of a Japanese immigration in the eastern plains. Jiménez Lopez maintains the problem from medicalization and biology, using more arguments from geographical determinism and racism that from eugenics, to justify that a Japanese immigration to Colombia was not advisable, because it jeopardizes the progressive bleaching managed —with the passage of time— by the Colombian race.

  2. The 'Mini-Perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath: 3-year results in 72 patients

    International Nuclear Information System (INIS)

    Sung, Yon Mi; Choo, Sung Wook; Jeon, Seong Soo; Shin, Sung Wook; Park, Kwang Bo; Do, Young Soo

    2006-01-01

    To assess the efficacy and safety of a 'mini-perc' technique of percutaneous nephrolithotomy using a 14-Fr peel-away sheath for the removal of pyelocaliceal stones, and to determine appropriate inclusion criteria. Form July 1999 to June 2002, the medical records and radiographic images of 72 patients who underwent the 'mini-perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath, were reviewed to determine clinical history, stone characteristics, immediate stone free rate, final stone free rate after additional procedures, complications, and hospital stay. We also analyzed the effect of the longest stone diameter, the cumulative longest diameter of stones, the cumulative stone burden, and the stone density on the immediate stone free rate using a Fisher exact test. The only major complication, arterial bleeding, occurred in a patient with Child A liver cirrhosis and was successfully treated by embolization with coils and a gelatin sponge. The immediate stone free rate was 80.6%, which was significantly influenced by stone diameter but not stone density. The mean hospital stay after the procedure was 3.97 days. The 'mini-perc' technique of percutaneous nephrolithotomy, which uses the 14-Fr peel-away sheath, is a safe and effective modality for treating renal calculi

  3. Review of García, Jiménez & Martínez (2010 Guía para incorporar la perspectiva de género a la investigación en salud

    Directory of Open Access Journals (Sweden)

    Teresa Cabruja-Ubach

    2014-12-01

    Full Text Available Se trata de una reseña de la “Guía para incorporar la perspectiva de género a la investigación en salud” de María del Mar García Calvente ,  María Luisa Jiménez rodrigo y Emilia Martínez Morante, de la Escuela Andaluza de Salud Pública, 2010, que consiste en un documento de ayuda a la investigación en salud pues a partir de exponer los sesgos androcéntricos y patriarcales de la investigación en salud, organiza un sistema de buenas prácticas para cada uno de los pasos en el proceso de investigación. Trabajo muy riguroso e indispensable para colaborar en una investigación y atención en la salud más justa e igualitaria.

  4. Transtorno de Estresse Pós-Traumático e Perceção da Doença em Jovens Sobreviventes de Cancro Infantil

    Directory of Open Access Journals (Sweden)

    Elisa Kern de Castro

    2015-07-01

    Full Text Available ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70 e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C e de perceção da doença – “Revised Illness Perception Questionnaire for Healthy People” (IPQ-RH.ResultadosA presença de sintomas de TEPT variade 9,2% a 18,5% na amostra, e a perceção da doença esteve correlacionada com os sintomas deste transtorno. As subescalas Representação Emocional e Coerência da Doença (IPQ-RH, foram preditoras dos sintomas de Reexperiência (β = 0,0370; p < 0,01; β = 0,261; p < 0,05, respetivamente. A subescala Representação Emocional (IPQ-RH também foi preditora de sintomas de Esquiva (β = 0,330; p < 0,001.ConclusãoConcluiu-se que a perceção da doença deve ser investigada para prevenir os sintomas de TEPT em sobreviventes de câncer infantil.

  5. Las “Historias ilustrativas de la violencia” de Edilberto Jiménez: narrativa, testimonio y memoria

    Directory of Open Access Journals (Sweden)

    Elisa Cairati

    2013-06-01

    Full Text Available This work aims to analyse the cultural contents and aesthetic position of Edilberto Jiménez Quispe’s illustrations of the age of violence, presented in Chungui: violencia y trazos de memoria (Lima, 2009. Jiménez, through the plastic and figurative traditional style, makes public the concealed and denied memory of the Internal Armed Conflict. The combination of testimonies and paintings is concerned as an emotional significance of memory: a space of re-established dialogue after the age of violence, in the direction of the elaboration of identity in the region of Ayacucho.

  6. Martínez Sanabria en un país de artesanos

    OpenAIRE

    Jimena Montaña Cuéllar

    2011-01-01

    De la arquitectura orgánica a la arquitectura del lugar en las casas Wilkie (1962) y Calderón (1963) de Fernando Martínez Sanabria. Germán Darío Rodríguez Botero. Universidad Nacional de Colombia (Sede Bogotá), Facultad de Artes, Colección Punto aparte, Bogotá, 2007, 232 págs.

  7. Transtorno de Estresse Pós-Traumático e Perceção da Doença em Jovens Sobreviventes de Cancro Infantil

    OpenAIRE

    Elisa Kern de Castro; Renata Klein Zancan; Lauro José Gregianin

    2015-01-01

    ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT) e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70) e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C) e de perceçã...

  8. Impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física

    Directory of Open Access Journals (Sweden)

    Diego Augusto Santos Silva

    2012-06-01

    Full Text Available Objetivou-se verificar o impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física. Participaram do estudo 217 acadêmicos, com média de 20.6 anos de idade (DP = 0.6, sendo 54.8% do sexo masculino. Coletaram-se informações sobre perceção da imagem corporal por meio da escala de silhuetas de Stunkard et al. (1983. O nível de escolaridade dos pais e dados sociodemográficos foram coletados por questionário autoadministrado. Empregaram-se a estatística descritiva e a regressão logística multinomial, adotando-se nível de significância de 5%. Em relação à perceção da imagem corporal, 41% dos alunos estavam insatisfeitos por magreza e 28.1% por excesso de peso. As chances de insatisfação por excesso de peso foram de sete a oito vezes maiores nos acadêmicos com escolaridade materna superiores a quatro anos de escolaridade, independentemente de sexo, idade, situação conjugal, nível econômico e curso. Não houve associação entre escolaridade paterna e imagem corporal. Conclui-se que há necessidade de uma educação básica e superior de qualidade com assuntos vinculados à perceção corporal e hábitos saudáveis, pois muitos acadêmicos apresentaram insatisfação com a imagem corporal e tal probabilidade foi maior em estudantes filhos de mães com mais de cinco anos de escolaridade.

  9. The PERC trademark process: Existing and potential applications for induction coupled plasma technology in hazardous and radioactive waste treatment

    International Nuclear Information System (INIS)

    Blutke, A.S.; Vavruska, J.S.; Serino, J.F.

    1996-01-01

    Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment

  10. Lago artificial de Martiánez Canarias – España

    Directory of Open Access Journals (Sweden)

    Amigó, Juan A.

    1980-06-01

    Full Text Available In this article a technical description is given of the works of the Artificial Lake of Martiánez. This work that was executed after gaining some 33,000 m2 from the sea mainly consisted of creating a small artificial lake of seawater surrounded by solariums, beaches and gardens. Inside the lake — that has an area of some 15,000 m2 — five natural islands were formed, most of which have tourist complexes built on them, consisting of: night club, restaurants, bars, terraces, etc.

    En este artículo se hace una descripción técnica de las obras del Lago Artificial de Martiánez. Esta obra, realizada tras ganar al mar unos 33.000 m2 consistió, principalmente, en la creación de un pequeño lago artificial de agua de mar rodeado de solarios, playas y jardines. En el interior del lago —cuya superficie es de unos 15.000 m2— se formaron cinco islas naturales, en la mayor de las cuales se construyó un complejo turístico que consta de: sala de fiestas, restaurantes, bares, terrazas, etc.

  11. Libertad e inconformismo: sobre la concepción del relato de José Jiménez Lozano

    Directory of Open Access Journals (Sweden)

    Moreno González, Santiago

    2010-12-01

    Full Text Available José Jiménez Lozano is a unique writer in the Hispanic literary scene of these last decades. His work is vast and diverse, and this initial observation does not escape his narrative, which genre the write demonstrates more prolifically. Despite the apparent diversity, there is outstanding unity underlying Jiménez Lozano´s entire work. This unity lies not only on the constant return to the same matters, but also on the approaches or the reasons, from which his literary work begins. The writer reflects over his work and lets his ideas expand through the diverse manifestations of his ideas on prose. It is a talk about the rhetorical writing of this article, valuing the coherent existence between reflection and literary practice.José Jiménez Lozano es un escritor singular dentro del panorama literario hispánico de las últimas décadas. Su obra es vasta y diversa y a esta observación inicial no escapa su narrativa, género en el que el escritor se muestra más prolífico. A pesar de la diversidad aparente, existe una notable unidad subyacente a toda la obra de Jiménez Lozano. Esta unidad reposa no sólo sobre el regreso constante a unos mismos asuntos sino también sobre los planteamientos o fundamentos de los que parte su creación literaria. El escritor reflexiona sobre su labor y deja diseminado, a través de las diversas manifestaciones de su prosa de ideas, un discurso sobre la escritura que este artículo sintetiza, valorando, asimismo, la coherencia existente entre esta reflexión y la praxis literaria.

  12. El acontecimiento en el cuento: nueva lectura de José Jiménez Lozano

    OpenAIRE

    Martínez-Illán, A. (Antonio)

    2010-01-01

    Se reseña un libro que estudia como un todo los cuentos de Jiménez Lozano publicados hasta la fecha (y, en particular, La Piel de los tomates) a la luz de una teoría del cuento desde la categoría del acontecimiento.

  13. Big Canyon Creek Ecological Restoration Strategy.

    Energy Technology Data Exchange (ETDEWEB)

    Rasmussen, Lynn; Richardson, Shannon

    2007-10-01

    He-yey, Nez Perce for steelhead or rainbow trout (Oncorhynchus mykiss), are a culturally and ecologically significant resource within the Big Canyon Creek watershed; they are also part of the federally listed Snake River Basin Steelhead DPS. The majority of the Big Canyon Creek drainage is considered critical habitat for that DPS as well as for the federally listed Snake River fall chinook (Oncorhynchus tshawytscha) ESU. The Nez Perce Soil and Water Conservation District (District) and the Nez Perce Tribe Department of Fisheries Resources Management-Watershed (Tribe), in an effort to support the continued existence of these and other aquatic species, have developed this document to direct funding toward priority restoration projects in priority areas for the Big Canyon Creek watershed. In order to achieve this, the District and the Tribe: (1) Developed a working group and technical team composed of managers from a variety of stakeholders within the basin; (2) Established geographically distinct sub-watershed areas called Assessment Units (AUs); (3) Created a prioritization framework for the AUs and prioritized them; and (4) Developed treatment strategies to utilize within the prioritized AUs. Assessment Units were delineated by significant shifts in sampled juvenile O. mykiss (steelhead/rainbow trout) densities, which were found to fall at fish passage barriers. The prioritization framework considered four aspects critical to determining the relative importance of performing restoration in a certain area: density of critical fish species, physical condition of the AU, water quantity, and water quality. It was established, through vigorous data analysis within these four areas, that the geographic priority areas for restoration within the Big Canyon Creek watershed are Big Canyon Creek from stream km 45.5 to the headwaters, Little Canyon from km 15 to 30, the mainstem corridors of Big Canyon (mouth to 7km) and Little Canyon (mouth to 7km). The District and the Tribe

  14. Production of high titer attenuated poliovirus strains on the serum-free PER.C6(®) cell culture platform for the generation of safe and affordable next generation IPV.

    Science.gov (United States)

    Sanders, Barbara P; Oakes, Isabel de los Rios; van Hoek, Vladimir; Liu, Ying; Marissen, Wilfred; Minor, Philip D; Wimmer, Eckard; Schuitemaker, Hanneke; Custers, Jerome H H V; Macadam, Andrew; Cello, Jeronimo; Edo-Matas, Diana

    2015-11-27

    As poliovirus eradication draws closer, alternative Inactivated Poliovirus Vaccines (IPV) are needed to overcome the risks associated with continued use of the Oral Poliovirus Vaccine and of neurovirulent strains used during manufacture of conventional (c) IPV. We have previously demonstrated the susceptibility of the PER.C6(®) cell line to cIPV strains; here we investigated the suspension cell culture platform for growth of attenuated poliovirus strains. We examined attenuated Sabin strain productivity on the PER.C6(®) cell platform compared to the conventional Vero cell platform. The suitability of the suspension cell platform for propagation of rationally-attenuated poliovirus strains (stabilized Sabin type 3 S19 derivatives and genetically attenuated and stabilized MonoCre(X) strains), was also assessed. Yields were quantified by infectious titer determination and D-antigen ELISA using either serotype-specific polyclonal rabbit sera for Sabin strains or monoclonal cIPV-strain-specific antibodies for cIPV, S19 and MonoCre(X) strains. PER.C6(®) cells supported the replication of Sabin strains to yields of infectious titers that were in the range of cIPV strains at 32.5°C. Sabin strains achieved 30-fold higher yields (pSabin strain productivity on the PER.C6(®) cell platform was maintained at 10l scale. Yields of infectious titers of S19 and MonoCre(X) strains were 0.5-1 log10 lower than seen for cIPV strains, whereas D-antigen yield and productivities in doses/ml using rationally-attenuated strains were in line with yields reported for cIPV strains. Sabin and rationally-attenuated polioviruses can be grown to high infectious titers and D-antigen yields. Sabin strain infection shows increased productivity on the PER.C6(®) cell platform as compared to the conventional Vero cell platform. Novel cell platforms with the potential for higher yields could contribute to increased affordability of a next generation of IPV vaccines needed for achieving and

  15. La historieta como transmisora de ideología: España Una, Grande y Libre (Carlos Giménez = Comic-strip in transmitting ideology: España Una, Grande y Libre (Carlos Giménez

    Directory of Open Access Journals (Sweden)

    Armiche Carrillo Delgado

    2015-06-01

    Full Text Available Aunque tradicionalmente se consideró a los cómics como un simple entretenimiento juvenil, lo cierto es que en realidad constituyen una herramienta para la transmisión de concepciones ideológicas y valores. A través del análisis de la obra de Carlos Giménez, publicada en El Papus, veremos como la historieta es perfectamente capaz de convertirse en una forma de lucha ideológica.Although traditionally considered to comics as a mere youth entertainment, the truth is that actually constitute a tool for the transmission of values and ideological concepts. Through the analysis of the work of Carlos Giménez, published in El Papus, we see how the comic-strip is perfectly capable of becoming a form of ideological struggle.

  16. CERT tribal internship program. Final intern report: David Conrad, 1993

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-09-01

    The intern`s report contains a Master`s thesis entitled, ``An implementation analysis of the US Department of Energy`s American Indian policy as part of its environmental restoration and waste management mission.`` This thesis examines the implementation of a working relationship between the Nez Perce Tribe and the US Department of Energy`s Office of Environmental Restoration and Waste Management at the Hanford reservation. It examines the relationship using a qualitative methodology and three generations of policy analysis literature to gain a clear understanding of the potential for successful implementation.

  17. Era Sanctorum: la beatificación inconclusa del padre Diego Martínez, SJ (1627-1634

    Directory of Open Access Journals (Sweden)

    Coello de la Rosa, Alexandre

    2009-06-01

    Full Text Available This essay analyzes the politics of sanctity of the Society of Jesus in Viceregal Peru (17th Century through the process of beatification of the Spanish Father Diego Martínez (1627-34. An unfinished process that has been filed in the Jesuit archives for centuries and was never introduced in the Sacred Congregation of Rites, in the Vatican.Este ensayo analiza las políticas de santidad de la Compañía de Jesús en el Perú virreinal (siglo XVII a través del proceso de beatificación del padre extremeño Diego Martínez (1627-34. Un proceso inconcluso que ha permanecido en los archivos jesuitas durante siglos y que nunca se introdujo en la Sagrada Congregación de Ritos, en el Vaticano.

  18. Synthetic virus seeds for improved vaccine safety: Genetic reconstruction of poliovirus seeds for a PER.C6 cell based inactivated poliovirus vaccine.

    Science.gov (United States)

    Sanders, Barbara P; Edo-Matas, Diana; Papic, Natasa; Schuitemaker, Hanneke; Custers, Jerome H H V

    2015-10-13

    Safety of vaccines can be compromised by contamination with adventitious agents. One potential source of adventitious agents is a vaccine seed, typically derived from historic clinical isolates with poorly defined origins. Here we generated synthetic poliovirus seeds derived from chemically synthesized DNA plasmids encoding the sequence of wild-type poliovirus strains used in marketed inactivated poliovirus vaccines. The synthetic strains were phenotypically identical to wild-type polioviruses as shown by equivalent infectious titers in culture supernatant and antigenic content, even when infection cultures are scaled up to 10-25L bioreactors. Moreover, the synthetic seeds were genetically stable upon extended passaging on the PER.C6 cell culture platform. Use of synthetic seeds produced on the serum-free PER.C6 cell platform ensures a perfectly documented seed history and maximum control over starting materials. It provides an opportunity to maximize vaccine safety which increases the prospect of a vaccine end product that is free from adventitious agents. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. “Todo lo que sigue es sencillamente estupendo”. Escritoras en las cartas de Ezequiel Martínez Estrada a Victoria Ocampo

    Directory of Open Access Journals (Sweden)

    Tania Diz

    2016-11-01

    Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.

  20. More than a Preface: the »Editor« of Pepita Jiménez

    OpenAIRE

    Ignac Fock

    2014-01-01

    The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) “editor”. Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator – ficti...

  1. 78 FR 24718 - Nez Perce-Clearwater National Forests; Idaho; Lolo Insect & Disease Project

    Science.gov (United States)

    2013-04-26

    ... Lolo Creek watershed. A total of 500 miles occurs within designated PACFISH buffers. Desired Condition... or displaced soil or loss of organic matter. Desired Condition: Soils are productive (functioning... riparian habitat conservation areas. Deferred maintenance opportunities (such as any needed reconstruction...

  2. Treatment of moderate hallux valgus by percutaneous, extra-articular reverse-L Chevron (PERC) osteotomy.

    Science.gov (United States)

    Lucas y Hernandez, J; Golanó, P; Roshan-Zamir, S; Darcel, V; Chauveaux, D; Laffenêtre, O

    2016-03-01

    The aim of this study was to report a single surgeon series of consecutive patients with moderate hallux valgus managed with a percutaneous extra-articular reverse-L chevron (PERC) osteotomy. A total of 38 patients underwent 45 procedures. There were 35 women and three men. The mean age of the patients was 48 years (17 to 69). An additional percutaneous Akin osteotomy was performed in 37 feet and percutaneous lateral capsular release was performed in 22 feet. Clinical and radiological assessments included the type of forefoot, range of movement, the American Orthopedic Foot and Ankle (AOFAS) score, a subjective rating and radiological parameters. The mean follow-up was 59.1 months (45.9 to 75.2). No patients were lost to follow-up. The mean AOFAS score increased from 62.5 (30 to 80) pre-operatively to 97.1 (75 to 100) post-operatively. A total of 37 patients (97%) were satisfied. At the last follow up there was a statistically significant decrease in the hallux valgus angle, the intermetatarsal angle and the proximal articular set angle. The range of movement of the first metatarsophalangeal joint improved significantly.. There was more improvement in the range of movement in patients who had fixation of the osteotomy of the proximal phalanx. Preliminary results of this percutaneous approach are promising. This technique is reliable and reproducible. Its main asset is that it maintains an excellent range of movement. The PERC osteotomy procedure is an effective approach for surgical management of moderate hallux valgus which combines the benefits of percutaneous surgery with the versatility of the chevron osteotomy whilst maintaining excellent first MTPJ range of motion. ©2016 The British Editorial Society of Bone & Joint Surgery.

  3. The philologist Pedro Martínez López: an imaginative liberal lampoonist | El filólogo Pedro Martínez López: un libelista liberal imaginativo

    Directory of Open Access Journals (Sweden)

    Aline Vauchelle-Haquet

    2006-12-01

    Full Text Available In 1830, the philologist Pedro Martínez López was forced to go into exile in France for political reasons. In 1832, he published Representación a Fernando VII, rey de España, a lampoon in which he made a whole string of accusations against the tyrant. At the end of the following year, he published España en 1833, al expirar Fernando VII, another lampoon in which he blamed the king's despotic reign for the country's disastrous situation and asserted that such abuses and injustices could only be remedied by re-establishing the Constitution of Cádiz of 1812. In 1834, he ceased to rail against his political enemies, changed strategy, and using his considerable imagination, wrote a kind of fable entitled Una noche en el infierno, vista entre sueños. With a mixture of humour and acid wit, it told of how all the devils in the Kingdom of Darkness, embracing the «sacred» cause of liberalism, vented their anger on the deceased Ferdinand and his followers, who were still in power. It would appear that the work was a success, since it was republished in 1836. In 1835, disillusioned with the tepid and conservative liberal regime of the Estatuto Real, Martínez López wrote another story, Las Brujas en Zugarramurdi, in which different satanic creatures, this time sorceresses, take it upon themselves to defeat moderantismo and establish a progressive regime. After this, he ceased to publish lampoons and political parables and devoted himself to producing learned works, bringing out various dictionaries and grammars which were republished several times. | En 1830, el filólogo Pedro Martínez López tuvo que exiliarse a Francia por motivos políticos. En 1832, sacó a luz en Burdeos una Representación a Fernando VII, rey de España, panfleto en el que espetaba toda una sarta de acusaciones contra el tirano. A finales del año siguiente, publicó La España en 1833, al expirar Fernando VII, otro libelo en que responsabilizaba al despotismo de la

  4. New Data on the Life of the Peruvian-Bolivian Composer Pedro Ximénez-Abrill Tirado (1784-1856

    Directory of Open Access Journals (Sweden)

    José Manuel Izquierdo König

    2017-07-01

    Full Text Available Since the mid-nineteenth century the name of Pedro Ximénez Abrill Tirado has been known in musicological and historiographical studies. However, his role and relevance as composer has been acknowledged only recently in the study of historical repertoires of South America, with the discovery of scores containing his music in a private collection in Bolivia, which was later acquired by various archives and individuals. In spite of this, biographical accounts on him have kept using the same information for decades, and mythical constructions have increased rapidly during the last decade. This paper presents a new biographical picture of Pedro Ximénez, with a broader understanding of the context surrounding his life and works along with the transition of his life between Peru and Bolivia, on the basis of important new sources gathered by both authors through research in various archives.

  5. La influencia de Javier Marías en la traducción española de Martínez-Lage de Absalom, Absalom!

    OpenAIRE

    Alpuente Civera, Miguel; Marco Borillo, Josep; Martínez Vilinsky, Bárbara

    2013-01-01

    En el posfacio a su traducción de Absalom, Absalom!, Miguel Martínez-Lage declara haber tomado como «modelos estilísticos» a aquellos narradores en lengua española cuya prosa muestra sin lugar a dudas la influencia de Faulkner. En el presente artículo nos proponemos identificar, en primer lugar, los rasgos de estilo comunes a la traducción de Martínez-Lage y a uno de los modelos estilísticos mencionados –la novela Fiebre y lanza, de Javier Marías– y, en segundo lugar, los aspectos de la tradu...

  6. Vida y obra de Luis Jiménez Moreno (1929-2007

    Directory of Open Access Journals (Sweden)

    Antonio Jiménez García

    2008-10-01

    Full Text Available Luis Jiménez Moreno passed away on 27 of October, 2007, 77 years old. For the last 30 years he was professor at Universidad Complutense de Madrid. He became Full Professor. He had studied in Salamanca, Roma, Valencia and München. He got a Ph. Degree whith a tesis about Nietzsche`s Antropological Thought by leading of José Luis López Aranguren. He was High School Teacher in Andujar, Ávila and Badalona; after he was professor at Universities of Barcelona and Madrid. This article develops information about his life and his works: books, articles, essays, conferences, papers to Congress, Symposios, Scientic meetings…

  7. Realismo, margen y fragmentariedad en la narrativa de Ezequiel Martínez Estrada

    OpenAIRE

    Gasillón, María Lourdes

    2012-01-01

    En primer lugar, este trabajo intenta analizar los ensayos escritos por Ezequiel Martínez Estrada sobre Franz Kafka (1967) para luego reconocer sus influencias en el concepto de lo real y realismo en sus propias narraciones ficcionales. En este caso, se abordará uno de sus cuentos más conocidos, “Marta Riquelme”, que construye discursivamente una imagen de lo/s otro/s en distintos planos textuales: autor, narrador, organización, género, personajes, etc. Tanto el ensayista argentino como el es...

  8. FACETS OF THE ICONOGRAPHY OF DON JUAN MARTÍNEZ SILÍCEO, ARCHBISHOP OF TOLEDO = ALGUNOS ASPECTOS EN TORNO A LA ICONOGRAFÍA DEL ARZOBISPO DE TOLEDO DON JUAN MARTÍNEZ SILÍCEO

    Directory of Open Access Journals (Sweden)

    María Alegra García García

    2014-02-01

    Full Text Available Juan Martínez Siliceo (c. 1477-1557 was a Roman Catholic cardinal and archbishop and a distinguished humanist and mathematician who played an important role in the History and culture of Toledo and Spain during the 16th century. Furthermore, he was admired and recognized even after his death thanks to different literary sources and historiography. This article aims to approach his iconography through a selection of the most important literary and artistic sources from the 16th and 17th Centuries.Juan Martínez Silíceo (c.1477-1557, además de cardenal y arzobispo de Toledo, fue un importante humanista y matemático que desempeñó un destacado papel en la historia y cultura del Toledo y la España del siglo XVI y que gozó de gran admiración y reconocimiento más allá de su muerte, tal como evidencian las fuentes literarias y la historiografía posterior. Sin embargo, aún quedan pendientes de estudio pormenorizado algunos aspectos relativos a su relación con las artes. Este artículo pretende plantear un primer acercamiento a la iconografía de Silíceo a través de una selección de las fuentes literarias y visuales de los siglos XVI al XVIII consideradas más relevantes.

  9. Enfermedad y muerte de Don Gonzalo Jiménez de Quesada

    Directory of Open Access Journals (Sweden)

    Fernando Serpa Florez

    1997-12-01

    Full Text Available

    La lepra es una enfermedad que se caracteriza por la insidia de su presencia, su lenta evolución y la progresiva incapacidad que en sus víctimas causa.

    Esto y el temor que ha infundido desde tiempos bíblicos, han hecho que ante ella se haya mantenido una actitud ambivalente de negación hasta donde es posible y de rechazo irracional a quien la padece, por temor al contagio.

    Ejemplo de ello es el aura de sagrado misterio que envuelve la leyenda de los padecimientos del Adelantado don Gonzalo Jiménez de Quesada (1509-1579, conquistador del Nuevo Reino de Granada y fundador de Santafé de Bogotá en el año de 1538, muerto a la edad, avanzada para la época, de setenta años.

    No se puede afirmar, en forma definitiva, que el conquistador fuera leproso. Se acepta, acogiendo el argumento de autoridad que tiene el primer historiador médico entre nosotros, don Pedro María Ibáñez, quien escribió en 1884, en las Memorias para la Historia de la Medicina en Santa Fe, que en “1579 falleció en la ciudad de Mariquita, y de mal de lepra o elefancía de los

    Coincide ello con lo que consigna don José María Vergara y Vergara en su Cuadro Cronológico de la Nueva Granada (hoi Estados Unidos de Colombia, desde los cipas hasta nuestros días (se ha conservado la ortografía usada a mediados del siglo XIX, preconizada por don Andrés Bello, estudio publicado en 1866, en que informa que a poco de posesionarse el tercer Presidente del Nuevo Reino, don Lope Díez Aux de Armendáriz: “ocurrió la muerte del adelantado Gonzalo Jiménez de Quesada que tuvo lugar en Mariquita el 16 de febrero de 1579, a la edad de ochenta años no cumplidos (sic, i de enfermedad de lepra (…” (2.

    Estos conceptos fueron debatidos por contemporáneos de Vergara y de Ibáñez como el doctor Juan de Dios Carrasquilla aduciendo, entre otros argumentos, que la lepra no fue mencionada por los coetáneos del conquistador. Y que la sífilis, com

  10. Knowledge Translation of the PERC Rule for Suspected Pulmonary Embolism: A Blueprint for Reducing the Number of CT Pulmonary Angiograms.

    Science.gov (United States)

    Drescher, Michael J; Fried, Jeremy; Brass, Ryan; Medoro, Amanda; Murphy, Timothy; Delgado, João

    2017-10-01

    Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA) for pulmonary embolism (PE) ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC) rule, multi-modal education using principles of knowledge translation (KT), and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9-11.2]) to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3-9.4]) pPatient characteristics were similar for both periods. Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.

  11. The reproduction of sea birds of La Hague and of the Nez-de-Jobourg: The search for reasons of decline (Manche)

    International Nuclear Information System (INIS)

    James, Jean-Baptiste

    2001-11-01

    Since 1965, the site of the Nez-de-Jobourg, in the Manche district and at the vicinity of the La Hague plant, has been a site of ornithological follow-up, notably because it harbours different population of nesting sea birds. Since 1990, it has been noticed that the population of European shags has been keeping on decreasing, with abnormally low birth rate, while the European herring gull has totally disappeared. If the relationship between this decline and the releases of the La Hague nuclear waste processing plant is easily and quickly suspected, other reasons are also plausible. The authors report a study of this decline and an investigation of its possible origins. After a presentation of the site, of its status regarding hunting and specie protection, and a presentation of other close sites (small islands, bay), the report addresses the case of the European shag. It gives information on its biology, characteristics, location and population, reproduction sites and nesting cycle. It presents the method adopted to test the various hypotheses of origin of the noticed decline: contamination by radioactive materials or by chemical substances, problems of disturbance by fishers, tourists or others, problems of predation, parasitism or lack of food resources. Samplings have been performed within the studied site and also within reference sites located some miles away. Based on data and observations, hypotheses are then discussed. An analytical report of measurement of artificial radio-elements performed by gamma spectrometry is provided

  12. Salmon and the Adaptive Capacity of Nimiipuu (Nez Perce) Culture to Cope with Change

    Science.gov (United States)

    Colombi, Benedict J.

    2012-01-01

    Change due to natural disturbances and disasters, population growth and decline, economic crises, and environmental and climate change creates significant cultural challenges. Rapid change and the transformation it brings also involve complex relationships between sovereign tribes, resources, and the global system. This article explores how salmon…

  13. 78 FR 9029 - Nez Perce-Clearwater National Forests; ID; Clear Creek Integrated Restoration Project

    Science.gov (United States)

    2013-02-07

    .... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and..., and big game species. Fire dependent wildlife species would benefit from landscape burning. Watershed...

  14. 77 FR 9621 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

    Science.gov (United States)

    2012-02-17

    .... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and... mammals, and big game species. Fire dependent wildlife species would benefit from landscape burning...

  15. 77 FR 775 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

    Science.gov (United States)

    2012-01-06

    .... Shifting tree species composition by retaining and planting early seral species (i.e. ponderosa pine... such as insect, disease, and fire. Historical logging practices and fire suppression have created a... habitats by retaining large trees and promoting establishment of tall shrubs and hardwood tree by using...

  16. 77 FR 6778 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project

    Science.gov (United States)

    2012-02-09

    ... patterns that more closely emulate natural mixed severity disturbance. Shifting tree species composition by... logging practices and fire suppression have created a landscape that is more highly fragmented than what... management would increase high quality early seral wildlife habitats by retaining large trees and promoting...

  17. Trayectos de lectura de Espacio, de Juan Ramón Jiménez

    OpenAIRE

    Luján Atienza, Ángel Luis

    2013-01-01

    El estudio de Espacio, de Juan Ramón Jiménez, a partir de la teoría cognitiva de las metáforas conceptuales y la fusión de dominios conceptuales (blending), en confluencia con la filosofía heideggeriana, descubre en el poema dos movimientos contradictorios: el de la fuga y de la búsqueda de un centro, que se pueden poner en relación con dos trayectos de lectura y dos tendencias hermenéuticas: la modernista y la post-modernista. En este contexto se tratan de explicar las paradojas y complejida...

  18. Leoncio Martínez Un personaje que marcó pauta en la disidencia

    OpenAIRE

    Omaira Zambrano Roa

    2014-01-01

    Cuando se analiza la historia política de un país, se observa énfasis en el estudio de sus períodos gubernamentales y en sus partidos políticos, en los cuales existen personajes que marcaron pauta en su desarrollo de la Nación. Durante la dictadura del general Juan Vicente Gómez (1908-1935)  uno de estos personajes característicos fue Leoncio Martínez, quien ostenta entre sus labores más conocidas la fundación del semanario humorístico Fantoches junto a Francisco Pimentel (Job Pim). En el año...

  19. Perceções de carreira e de sucesso em função do género

    OpenAIRE

    Tocalino, Renata Leone Pio Galveia

    2013-01-01

    Tese de mestrado, Psicologia (Secção de Psicologia da Educação e da Orientação), Universidade de Lisboa, Faculdade de Psicologia, 2013 A presente investigação visa explorar o efeito do fator género no desenvolvimento da carreira das mulheres e dos homens, analisando a distribuição das formações e das profissões, as perceções de género e de sucesso profissional, os modelos, as crenças de autoeficácia, as motivações no trabalho e as experiências profissionais significativas. A fundamentação ...

  20. Joaquín Ruiz-Giménez, the Catholic exemplar: notes for a political and intellectual biography up to 1963 | Joaquín Ruiz-Giménez o el católico total: apuntes para una biografía política e intelectual hasta 1963

    Directory of Open Access Journals (Sweden)

    Javier Muñoz Soro

    2006-12-01

    Full Text Available The biography of Joaquín Ruiz-Giménez is a virtual paradigm of two historical phenomena which distinguished the last two decades of the Franco regime and, to a large extent, paved the way for the future democracy: on the one hand, the rift between Catholic and Falangist intellectuals and the regime which they had enthusiastically helped to establish after the civil war; and on the other, the secularization of its political thinking and practice. Ruíz-Giménez, ambassador and minister under Franco, was an exception among the Catholic laity that collaborated with the dictatorship, in that he held high government positions and, despite all the reservations concerning his personal development, for many of his peers as well as many aspiring figures of the coming generations, he symbolized the definitive renunciation of all legitimacy of power based on victory in battle or on Catholic natural law, and the definitive adoption of the language of human rights and democracy. | La biografía de Joaquín Ruiz-Giménez representa casi de manera paradigmática dos fenómenos históricos que caracterizaron las dos últimas décadas del franquismo y sentaron, en buena medida las bases de la futura democracia: por un lado, el alejamiento de los intelectuales católicos y falangistas respecto al régimen que habían contribuido a levantar con entusiasmo tras la guerra civil; por otro, la secularización de su pensamiento y práctica política. Ruiz-Giménez, embajador y ministro de Franco, fue una excepción entre los seglares católicos que colaboraron con la dictadura desempeñando altas responsabilidades de gobierno y, pese a todas las cautelas de su evolución personal, simbolizó para bastantes compañeros de su generación, así como para muchos jóvenes alumnos de las nuevas generaciones, la renuncia definitiva a toda legitimación del poder basada en la victoria de las armas o en el iusnaturalismo católico y la adopción irreversible del lenguaje de

  1. An Indian tribal view of the back end of the nuclear fuel cycle: historical and cultural lessons

    International Nuclear Information System (INIS)

    Tano, M.L.; Powankee, D.; Lester, A.D.

    1995-01-01

    The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation and the Yakama Indian Nation have entered into cooperative agreements with the US Department of Energy to oversee the cleanup of the Hanford Reservation. The Mescalero Apache Tribe and the Meadow Lake Tribal Council have come under severe criticism from some ''ideological pure'' Indians and non-Indians for aiding and abetting the violation of Mother Earth by permitting the land to be contaminated by radioactive wastes. This paper suggests that this view of the Indian relationship to nature and the environment is too narrow and describes aspects of Indian religion that support tribal involvement in radioactive waste management. (O.M.)

  2. Fall Chinook Salmon Survival and Supplementation Studies in the Snake River Reservoirs, 1996 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Williams, John G.; Bjornn (Bjomn), Theodore C.

    1998-05-01

    In 1996, the National Marine Fisheries Service, the Nez Perce Tribe, and the U.S. Fish and Wildlife Service completed the second year of cooperative research to investigate migrational characteristics of subyearling fall chinook salmon in the Snake River Basin. In spring and early summer, we captured natural subyearling fall chinook salmon by beach seine, PIT tagged them, and released them in two reaches of the Snake River. Also, subyearling fall chinook salmon reared at Lyons Ferry Hatchery were PIT tagged at the hatchery, transported, and released weekly at Pittsburg Landing on the Snake River and Big Canyon Creek on the Clearwater River to collect data on survival detection probabilities, and travel time.

  3. Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River: March 1, 1994--June 15, 1994; TOPICAL

    International Nuclear Information System (INIS)

    Ashe, B.L.; Miller, A.C.; Kucera, P.A.; Blenden, M.L.

    1995-01-01

    In 1994, the Nez Perce Tribe began a smolt monitoring study on the Imnaha River in cooperation with the Fish Passage Center (FPC). A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from March 1 to June 15, 1994. We PIT tagged and released 956 wild chinook salmon, 661 hatchery chinook salmon, 1,432 wild steelhead trout and 2,029 hatchery steelhead trout. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 62.2% for wild chinook salmon, 45.2% for hatchery chinook salmon, 51.3% for wild steelhead trout, and 34.3% for hatchery steelhead trout

  4. Ces silences de la narration qui rapprochèrent Jean Giono et Juan Ramón Jiménez

    Directory of Open Access Journals (Sweden)

    Dominique Bonnet

    2010-01-01

    Full Text Available This article intends to show how JeanGiono discovered a purity of writing inJuan Ramón Jiménez that he practicedhimself in his elliptical narratives. Thus,this purifying desire that both sought intheir writings would be one of the commonpoints that would persuade Jean Giono todo the film adaptation of Platero y yo.

  5. En memoria de Michael Jiménez (1948-2001

    Directory of Open Access Journals (Sweden)

    Mauricio Archila Neira

    2001-01-01

    Full Text Available El 1 de septiembre de 2001 murió el historiador Michael Jiménez. Su apellido provenía de España de donde emigró su abuelo en busca de mejor suerte al otro lado del Atlántico. Nacido en el pequeño pueblo de Merced, California (Estados Unidos en agosto de 1948 en el seno de una familia obrera, Michael vivió su infancia en Colombia. A fines de ese año, su padre se desplazó a estas tierras para ser funcionario de la Texas, una multinacional petrolera que tenía sus reales en Puerto Boyacá. Michael estudió en el colegio Nueva Granada -becado por la Texas- hasta los catorce años. En dicho colegio fue compañero de pupitre de Herbert Braun, descendiente a su vez de una familia de emigrantes a Colombia, y con quien la vida lo juntaría de nuevo en las tierras del norte y en oficios similares.

  6. El Manuscrito Cerramientos y trazas de montea de Ginés Martínez de Aranda

    Directory of Open Access Journals (Sweden)

    Calvo López, José

    2009-03-01

    Full Text Available Ginés Martínez de Aranda, master mason in the cathedrals of Cádiz and Santiago de Compostela during the late 16th century, wrote a manuscript, Cerramientos y trazas de montea, concerning geometrical problems in stone construction. This article deals with the copy of Cerramientos in the Servicio Histórico Militar (Madrid, its copyist, dating, the existence of an earlier version and whether or not Aranda intended to publish it. Also examined are the connections between Cerramientos and other Spanish stonecutting texts of the period, such as those by Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia or Juan de Portor y Castro. Finally, an assessment is made of Martínez de Aranda’s original contributions to European stonecutting literatura.

    El arquitecto y cantero baezano Ginés Martínez de Aranda, que trabajó a finales del siglo XVI y ejerció la maestría de las catedrales de Cádiz y Santiago de Compostela, compuso un manuscrito llamado Cerramientos y trazas de montea, que trata de los problemas geométricos de la construcción pétrea. El artículo analiza la copia del manuscrito conservada en el Servicio Histórico Militar de Madrid, la identidad del copista, la fecha de la primera redacción de la obra y la de la copia conservada, y el destino de la obra; a continuación, se estudia la relación del manuscrito con otras obras españolas de cantería, en especial las de Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia y Juan de Portor y Castro, para finalizar tratando diversas aportaciones originales de Aranda a la literatura europea de la cantería.

  7. Knowledge Translation of the PERC Rule for Suspected Pulmonary Embolism: A Blueprint for Reducing the Number of CT Pulmonary Angiograms

    Directory of Open Access Journals (Sweden)

    Michael J. Drescher

    2017-09-01

    Full Text Available Introduction: Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA for pulmonary embolism (PE ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC rule, multi-modal education using principles of knowledge translation (KT, and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. Methods: We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. Results: CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9–11.2] to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3–9.4] p<0.001. The absolute reduction in PACT ordered was 1.72 per 1,000 visits (a 16% reduction. Patient characteristics were similar for both periods. Conclusion: Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.

  8. Perceção dos pais em relação à inclusão de crianças com Necessidades Educativas Especiais no ensino regular

    Directory of Open Access Journals (Sweden)

    Elisabete Matos Freitas

    2015-05-01

    Full Text Available http://dx.doi.org/10.5902/1984686X15273O papel dos pais no processo de inclusão de crianças com necessidades educativas especiais é fundamental, seja no apoio familiar, desmontando mitos e criando um contexto favorável à experiência e à proximidade. O objetivo deste trabalho é, assim, conhecer as perceções dos pais relativamente à inclusão, assim como os factores que as influenciam. Para isso, foi aplicado um inquérito a 300 pais, com e sem filhos com necessidades educativas especiais. Os resultados permitiram perceber atitudes genericamente positivas, sem diferenças relativamente ao género e ao fato de serem pais de crianças com necessidades educativas especiais. Contudo as variáveis idade, escolaridade e proximidade / contato pareceram influenciar a perceção em relação a inclusão de crianças NEE. Assim, os pais com atitudes mais favoráveis à inclusão tendem a ser os mais novos, que tiveram proximidade / contato com criança NEE. Os resultados são discutidos em função da literatura.

  9. Literatura y realidad histórica. Un reencuentro con Ezequiel Martínez Estrada y su interpretación del Martín Fierro

    Directory of Open Access Journals (Sweden)

    Amán Rosales Rodríguez

    2010-01-01

    Full Text Available The purpose of this paper is to critically review some of the main theoretical tenets in Ezequiel Martínez Estrada’s pessimistic stance about the Argentinean history and society of his time. Focusing on his critical remarks about the so-called «literatura o poesía gauchesca» as well as on his enthusiastic assessment of José Hernández’ Martín Fierro, the achievements and missing points in Martínez Estrada’s skeptical diagnosis will be underlined and put in broader philosophical context. For the Argentinean writer the controversial notion of a “superimposed reality” – as he infers its existence from the Martín Fierro – captures a kind of ambivalent metaphysical concurrence among the literary creation, the geographical setting and the sociopolitical state of the country.

  10. Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996

    International Nuclear Information System (INIS)

    Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

    1997-04-01

    For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

  11. Spring outmigration of wild and hatchery chinook salmon and steelhead trout smolts from the Imnaha River, Oregon, February 23--June 24, 1996. Annual report 1996; ANNUAL

    International Nuclear Information System (INIS)

    Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.

    1997-01-01

    For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts

  12. La presidencia de María Estela Martínez de Perón : la búsqueda de legitimidad y la descalificación del “otro” (1974-1976)

    OpenAIRE

    Napal, María Celeste

    2016-01-01

    Napal, M. C. (2016). La presidencia de María Estela Martínez de Perón: la búsqueda de legitimidad y la descalificación del “otro” (1974-1976). Divulgatio, 1(1). El presente artículo busca analizar, a través de los discursos presidenciales, la imagen que la presidente María Estela Martínez de Perón (Isabel) construye del “otro” no partidario en un contexto político en el que se ve cuestionada su propia legitimidad. Partimos de la idea de que el período de su presidencia (1° de julio de 1974...

  13. El Retrato de la última hija de Juan Bautista Martínez del Mazo, boceto para el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena

    Directory of Open Access Journals (Sweden)

    Gutiérrez Pastor, Ismael

    2005-09-01

    Full Text Available Por adquisición en el comercio de antigüedades francés se conserva en una colección particular de Bilbao el Retrato de una niña (fig. 2, pintura de carácter velazqueño, que puede ser clasificada perfectamente como obra indiscutible del pintor Juan Bautista Martínez del Mazo (¿Beteta?, Cuenca, 1611-Madrid, 1667, tanto por la característica soltura técnica, como por tratarse de uno de los modelos infantiles que aparecen en el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena (fig. 3, en relación con la cual se conoce otro Retrato de Luis Martínez del Mazo conservado en la Dulwich Picture Gallery de Londres (fig. 1. La importancia de la obra es notable no sólo porque incrementa el catálogo de Martínez del Mazo con una obra indudable, sino también por contribuir a precisar la cronología de la pintura conservada en Viena...

  14. Francisco Ibarra Martínez: renovador de la pedagogía cubana

    Directory of Open Access Journals (Sweden)

    Lic. Osmar Oliva-Crespo

    2015-10-01

    Full Text Available The article entitled Francisco Ibarra Martínez: reformer of Cuban Pedagogy, is first of all a well deserved homage to one of the most important pedagogues of the republican period. His thought and his work are approached, from his initial stage of academic formation to his contributions to the educational cuban thought. Stands out his social dimension of his pedagogic work, his integration to the civic life of the city, his reforming vision of the practice of sports and study of the history of his country. Likewise, we refer to his contributions to the historiography as a science, the journalism and his concern for the social and political destination of the country. For this reason this work has among its contributions the treatment to the local history from the specific fild of pedagogy and education, modestly contributing to the rescue of historic memory.

  15. Vicinal surfaces for functional nanostructures.

    Science.gov (United States)

    Tegenkamp, Christoph

    2009-01-07

    Vicinal surfaces are currently the focus of research. The regular arrangements of atomic steps on a mesoscopic scale reveal the possibility to functionalize these surfaces for technical applications, e.g. nanowires, catalysts, etc. The steps of the vicinal surface are well-defined defect structures of atomic size for nucleation of low-dimensional nanostructures. The concentration and therefore the coupling between the nanostructures can be tuned over a wide range by simply changing the inclination angle of the substrate. However, the coupling of these nano-objects to the substrate is just as important in controlling their electronic or chemical properties and making a functionality useable. On the basis of stepped insulating films, these aspects are fulfilled and will be considered in the first part of this review. Recent results for the epitaxial growth of wide bandgap insulating films (CaF(2), MgO, NaCl, BaSrO) on metallic and semiconducting vicinal substrates (Si(100), Ge(100), Ag(100)) will be presented. The change of the electronic structure, the adsorption behavior as well as the kinetics and energetics of color centers in the presence of steps is discussed. The successful bridging of the gap between the atomic and mesoscopic world, i.e. the functionalization of vicinal surfaces by nanostructures, is demonstrated in the second part by metal adsorption on semiconducting surfaces. For (sub)monolayer coverage these systems have in common that the surface states do not hybridize with the support, i.e. the semiconducting surfaces are insulating. Here I will focus on the latest results of macroscopic transport measurements on Pb quantum wires grown on vicinal Si(111) showing indeed a one-dimensional transport behavior.

  16. Vicinal surfaces for functional nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Tegenkamp, Christoph [Institut fuer Festkoerperphysik, Gottfried Wilhelm Leibniz Universitaet Hannover, Appelstrasse 2, D-30167 Hannover (Germany)], E-mail: tegenkamp@fkp.uni-hannover.de

    2009-01-07

    Vicinal surfaces are currently the focus of research. The regular arrangements of atomic steps on a mesoscopic scale reveal the possibility to functionalize these surfaces for technical applications, e.g. nanowires, catalysts, etc. The steps of the vicinal surface are well-defined defect structures of atomic size for nucleation of low-dimensional nanostructures. The concentration and therefore the coupling between the nanostructures can be tuned over a wide range by simply changing the inclination angle of the substrate. However, the coupling of these nano-objects to the substrate is just as important in controlling their electronic or chemical properties and making a functionality useable. On the basis of stepped insulating films, these aspects are fulfilled and will be considered in the first part of this review. Recent results for the epitaxial growth of wide bandgap insulating films (CaF{sub 2}, MgO, NaCl, BaSrO) on metallic and semiconducting vicinal substrates (Si(100), Ge(100), Ag(100)) will be presented. The change of the electronic structure, the adsorption behavior as well as the kinetics and energetics of color centers in the presence of steps is discussed. The successful bridging of the gap between the atomic and mesoscopic world, i.e. the functionalization of vicinal surfaces by nanostructures, is demonstrated in the second part by metal adsorption on semiconducting surfaces. For (sub)monolayer coverage these systems have in common that the surface states do not hybridize with the support, i.e. the semiconducting surfaces are insulating. Here I will focus on the latest results of macroscopic transport measurements on Pb quantum wires grown on vicinal Si(111) showing indeed a one-dimensional transport behavior. (topical review)

  17. Vicinal surfaces for functional nanostructures

    International Nuclear Information System (INIS)

    Tegenkamp, Christoph

    2009-01-01

    Vicinal surfaces are currently the focus of research. The regular arrangements of atomic steps on a mesoscopic scale reveal the possibility to functionalize these surfaces for technical applications, e.g. nanowires, catalysts, etc. The steps of the vicinal surface are well-defined defect structures of atomic size for nucleation of low-dimensional nanostructures. The concentration and therefore the coupling between the nanostructures can be tuned over a wide range by simply changing the inclination angle of the substrate. However, the coupling of these nano-objects to the substrate is just as important in controlling their electronic or chemical properties and making a functionality useable. On the basis of stepped insulating films, these aspects are fulfilled and will be considered in the first part of this review. Recent results for the epitaxial growth of wide bandgap insulating films (CaF 2 , MgO, NaCl, BaSrO) on metallic and semiconducting vicinal substrates (Si(100), Ge(100), Ag(100)) will be presented. The change of the electronic structure, the adsorption behavior as well as the kinetics and energetics of color centers in the presence of steps is discussed. The successful bridging of the gap between the atomic and mesoscopic world, i.e. the functionalization of vicinal surfaces by nanostructures, is demonstrated in the second part by metal adsorption on semiconducting surfaces. For (sub)monolayer coverage these systems have in common that the surface states do not hybridize with the support, i.e. the semiconducting surfaces are insulating. Here I will focus on the latest results of macroscopic transport measurements on Pb quantum wires grown on vicinal Si(111) showing indeed a one-dimensional transport behavior. (topical review)

  18. Perceção de falhas de memória, ansiedade e depressão em pacientes com dor crónica

    OpenAIRE

    Lobato, Filipa

    2012-01-01

    Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Diversos estudos têm mostrado que as alterações cognitivas e os estados de humor fazem parte dos quadros com pacientes com dor, o que acaba por limitar, ainda mais, a sua autonomia em termos funcionais das atividades do dia-a-dia. O principal objetivo do presente estudo foi analisar a perceção de falhas de memóri...

  19. Chemins de traverse d’Ignacio Martínez de Pisón, roman de l’absence, roman de l’amour

    Directory of Open Access Journals (Sweden)

    André-Alain Morello

    2012-08-01

    Full Text Available Chemins de traverse d’Ignacio Martínez de Pisón se présente comme la pseudo autobiographie d’un adolescent, Felipe, qui, à la mort de sa mère, est condamné à vivre avec un père marginal. Le texte est aussi la conversion d’un récit de type picaresque en un roman qui débouche sur la découverte mutuelle d’un père et d’un fils. L’errance des deux personnages, chemin de fuite destiné à compenser la disparition de Cecilia, conduit à une sorte d’assomption de l’amour.Caminos secundarios, de Ignacio Martínez de Pisón, se presenta como la supuesta autobiografía de un adolescente, Felipe, quien, a la muerte de su madre, se ve forzado a vivir con un padre marginal. El texto es también la evolución de una narración de carácter picaresco hacia una novela que desemboca en el descubrimiento mutuo entre padre e hijo. El vagabundeo de ambos personajes, escape y consuelo por la desaparición de Cecilia, lleva a una forma de exaltación amorosa.

  20. Nanowires and nanoneedles nucleation on vicinal substrate

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xu, E-mail: zhangxubetter@gmail.com [Henan Key Laboratory of Laser and Opto-electric Information Technology, School of Information Engineering, Zhengzhou University, Zhengzhou 450052 (China); Xie, Dan; Huang, Genling [Zhengzhou Railway Vocational and Technical College, Zhengzhou 450052 (China); Sun, Xiao-Hong [Henan Key Laboratory of Laser and Opto-electric Information Technology, School of Information Engineering, Zhengzhou University, Zhengzhou 450052 (China)

    2015-01-01

    An analytic stress-driven nucleation model of nanowires (NWs) and nanoneedles (NNs) growing on a mismatched vicinal substrate is proposed. It is demonstrated that the formation enthalpy of NWs and NNs is a function of three independent variables, the base radius, aspect ratio and miscut angle of the vicinal surface. Theoretical analysis shows that the minimum nucleation barrier of an island decreases with increment of substrate misorientation, which means the nucleation of islands on a vicinal substrate is more favorable than that on a flat substrate.

  1. 78 FR 41782 - Nez Perce-Clearwater National Forests; Idaho; Notice To Proceed With Forest Plan Revision

    Science.gov (United States)

    2013-07-11

    ... pursuant to the 2012 Forest Planning Rule. This process will ultimately result in a Forest Land Management... Planning Rule) which implements the NFMA. Forest Plans describe the strategic direction for management of... is the first phase of the planning process. Only informal public input is required at this stage (36...

  2. Changes in vicine, con vicine and oligosaccharides contents during germination of broad bean

    International Nuclear Information System (INIS)

    Al-Kaisey, T. M.; Al-Hadithi, R. T.; Sahead, A. B.

    1997-01-01

    Seeds of three cultivars of broad beans were subjected to germination at 25 deg. for 24, 48 and 72 hours. Also, three sets of experiments were germinated for 48 hour se and each one was subjected to different concentrations of gibberellin (100), 200 ppm) as growth regulator. Significant levels of variation were found in the contents of vicine and con vicine during seeds germination. Meanwhile, a complete disappearance of raffinose, scythe's and verbascose (the flatus factors in broad beans) were observed. No significant differences were found in the non-flatulent sugars, protein, ash and oil in the un germinated and germinated seed. (authors). 19 refs., 3 tabs

  3. Inventario de bienes de Juan Martínez, escribano público de Jerez de la Frontera en la primera mitad del siglo XV

    Directory of Open Access Journals (Sweden)

    M.ª Belén Piqueras García

    2013-12-01

    Full Text Available The present study is centered in the analysis of the Inventory of valuable objects of Juan Martínez, Jerez de la Frontera notary public during the first half of 15th century; Persecuting to bring to light this document from notarial type, until now unpublished, that approached its content and diplomatic analysis.

  4. Retorno de un cruzado, by José Jiménez Lozano. Creation, Intertextuality and Originality of a Writing Process

    Directory of Open Access Journals (Sweden)

    Guadalupe Arbona Abascal

    2017-01-01

    Full Text Available This paper analyzes the writing process of José Jiménez Lozano’s Retorno de un cruzado (2013, his 24th novel. First, taking into account the author’s comments about the creation of the text, it presents the different versions and the literary reasons for his final choice. Second, literary intertextualities found in the novel are examined. Finally, the condition of the main character as storyteller is identified as the novel’s major source of originality.

  5. Diiagnóstico económico y financiero de Electrónica Martínez de Cartagena

    OpenAIRE

    García García, Nuria

    2015-01-01

    Este Trabajo Fin de Máster está incluido en los estudios del Máster en Contabilidad y Finanzas Corporativas realizados en la Universidad Politécnica de Cartagena en el curso académico 2014-2015. El objetivo principal de este proyecto es realizar un análisis económico y financiero de la empresa Electrónica Martínez de Cartagena, S.L. en el periodo de 2008 a 2013, mediante la utilización de una serie de técnicas estudiadas a lo largo de la carrera y perfeccionadas durante el M...

  6. Effect of electroless nickel on the series resistance of high-efficiency inkjet printed passivated emitter rear contacted solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Lenio, Martha A.T. [REC Technology US, Inc., 1159 Triton Dr., Foster City, CA 94301 (United States); Lennon, A.J.; Ho-Baillie, A.; Wenham, S.R. [ARC Photovoltaics Centre of Excellence, University of NSW, Sydney, NSW 2052 (Australia)

    2010-12-15

    Many existing and emerging solar cell technologies rely on plated metal to form the front surface contacts, and aluminium to form the rear contact. Interactions between the metal plating solutions and the aluminium rear can have a significant impact on cell performance. This paper describes non-uniform nickel deposition on the sintered aluminium rear surface of passivated emitter and rear contacted (PERC) cells patterned using an inkjet printing technique. Rather than being plated homogeneously over the entire rear surface as is observed on an alloyed aluminium rear, the nickel is plated only in the vicinity of the point openings in the rear surface silicon dioxide dielectric layer. Furthermore, this non-uniform nickel deposition was shown to increase the contact resistance of the rear point contacts by an order of magnitude, resulting in higher series resistance values for these fabricated PERC cells. (author)

  7. (ReConstrução Mítica de Eva Perón no Romance Santa Evita (1996 – Tomás Eloy Martínez

    Directory of Open Access Journals (Sweden)

    Josiane Valcarenghi Ribeiro Nantes

    2017-06-01

    Full Text Available Eva Perón é um nome significativo na história política da Argentina, sua influência surtiu, e continua surtindo efeito, no povo desse país até os dias atuais. “Evita” foi odiada/amada em níveis extremos, tanto que foi considerada uma santa, um mito para muitas pessoas. Tomás Eloy Martínez escreveu o romance – Santa Evita (1995 – em que narra como viveu a esposa de Juan Domingo Perón. Nesta obra encontra-se muitos elementos que dão indícios da (remitificação de Eva, por isso tenta-se aqui, explorar como se deu a (reconstrução mitológica de Eva Perón, personagem histórica no romance Santa Evita (1996 de Tomás Eloy Martínez, e ainda, expor quais foram os procedimentos adotados pelo autor que (reconstruíram esse mito. Utiliza-se, como base teórica, Linda Hutcheon (1991 e Fleck (2007 no conceito de metaficção historiográfica, Mircea Eliade (1991 e Martín Cezar Feijó (1984 no que cabe à análise do Mito. Esta breve pesquisa se dará a partir da análise bibliográfica e de forma comparativa entre a história e a escrita ficcional do romance Santa Evita (1996 de Tomás Eloy Martínez, discute-se os elementos utilizados e o caminho percorrido para a (reconstrução do mito Eva Perón na obra citada.

  8. The Literary Criticism and Memoirs of Juan Ramón Jiménez

    Directory of Open Access Journals (Sweden)

    Allen W. Phillips

    1983-01-01

    Full Text Available Equally as demanding of others as he was of himself, Juan Ramón Jiménez conceived of literary criticism as a serious and exacting task. The critic and the poet, standing side by side, are devoted to complementary activities of mutual enrichment. However fragmentary and partial the critical opinions of Juan Ramón may be (also outspoken and polemical in nature, they are invaluable as a personal historical and aesthetic guide to about fifty or sixty years of Hispanic literary development (1900-1960. Not to take them into account is to fail to recognize a highly important aspect of his total artistic personality. These varied critical texts are a product of a first rate intelligence and the sensibility of a writer of consummate discrimination who was endowed not only with an excellent memory but also a very special talent for appreciating the authentic. Juan Ramón as a critic is quick to praise (San Juan, Bécquer, Dario, Unamuno and Machado and at the same time strong in his censure of certain contemporaries. Several recently collected volumes of miscellaneous critical materials have resolved the bibliographical muddle for the initial study of this fundamental aspect of the poet, but still particularly important are the expressionistic portraits of Españoles de tres mundos , longer tributes to Valle, Ortega and Villaespesa as well as the extensive lectures delivered in his latter years. Examination of these pages gives us an historical and creative overview of the period in which he lived and worked in addition to original considerations about the evolution of Hispanic poetry. Of course, one of the constant focal points of his literary criticism was the modernist epoch of his early days, a movement or attitude which he considered to be a modern twentieth century renaissance. Together with detailed study of these two areas of historical and aesthetic nature, in the ensuing pages some conclusions are pointed out as to the essence of poetry

  9. Francisco Martínez de la Rosa and church-state controversial relation in Spain (1834-1835

    Directory of Open Access Journals (Sweden)

    María José Vilar García

    2016-12-01

    Full Text Available This study aims to provide and analyze Francisco Martínez de la Rosa’s unpublished correspondence during his term as President of the Spanish Government in the 1834-1835 biennium, maintained with Amat di San Filippo Luigi, nuncio in Spain, and kept in the Vatican Secret Archives. Such correspondence consists of three letters with official mail format, although they could be considered rather confidential for their content. In these documents, the Spanish government strives, albeit unsuccessfully, to achieve recognition by Rome of Elizabeth II of Spain and his liberal regime. And last but not least, in this paper, it is also noteworthy to highlight the urgent need to fill the many vacant Dioceses in Spain.

  10. A prática de formação da câmara municipal de Setúbal: a perceção dos

    OpenAIRE

    Claré, Lúcia Sofia Balagueira

    2013-01-01

    Dissertação de Mestrado em Gestão Estratégica de Recursos Humanos O objetivo global desta investigação assenta na prática de formação da Câmara Municipal de Setúbal, a partir da perceção dos dirigentes entrevistados. Na Administração Pública e ao nível da Gestão de Recursos Humanos, a formação tem vindo a ser encarada como um elemento chave para a melhoria da performance organizacional, através da aquisição de novas qualificações dos seus trabalhadores, refletindo-se no aum...

  11. A military officer in Rif: Jesús Jiménez Ortoneda (1911-1936

    Directory of Open Access Journals (Sweden)

    José Luis Villanova

    2009-08-01

    Full Text Available This paper uses original and for the most part unpublished documentation in order to examine the career of Jesús Jiménez Ortoneda, a highly successful career officer who served in the Spanish Protectorate of Morocco between 1907 and 1936. He occupied important positions in the political administration of the Protectorate (as director of the political section of Melilla’s Oficina Central de Intervenciones and a senior official in the Department of Indigenous Affairs; he was fluent in Arab and Tamazight, and gained a sound knowledge of the geography of the Rif mountains. His military career, in which he achieved the rank of lieutenant colonel, was characterized by his strictly professional attitude. He was one of the few career officers in Africa who were faithful to Spain’s republican government and who did not participate in the military uprising of 1936. This discussion of his career brings into question some well-established ideas concerning Spanish colonial policy in Morocco.

  12. Kinetics and mechanism of the oxidation of some vicinal and non ...

    Indian Academy of Sciences (India)

    Kinetics of oxidation of five vicinal and four non-vicinal diols, and two of their monoethers, by tetrabutylammonium tribromide (TBATB) has been studied. The vicinal diols yield products arising out of glycol-bond fission, while the non-vicinal diols produce the hydroxycarbonyl compounds. The reaction is first-order with ...

  13. Modelling nanostructures with vicinal surfaces

    International Nuclear Information System (INIS)

    Mugarza, A; Schiller, F; Kuntze, J; Cordon, J; Ruiz-Oses, M; Ortega, J E

    2006-01-01

    Vicinal surfaces of the (111) plane of noble metals are characterized by free-electron-like surface states that scatter at one-dimensional step edges, making them ideal model systems to test the electronic properties of periodic lateral nanostructures. Here we use high-resolution, angle-resolved photoemission to analyse the evolution of the surface state on a variety of vicinal surface structures where both the step potential barrier and the superlattice periodicity can vary. A transition in the electron dimensionality is found as we vary the terrace size in single-phase step arrays. In double-phase, periodic faceted surfaces, we observe surface states that characterize each of the phases

  14. La légalisation de l’eugénisme en Espagne. Les théories de Jiménez de Asúa dans Libertad de amar y derecho a morir (1928

    Directory of Open Access Journals (Sweden)

    María Flores Rodríguez

    2013-03-01

    Full Text Available Cet article étudie les théories eugénistes du juriste et socialiste espagnol Luis Jiménez de Asúa, exposées dans son livre Libertad de amar y derecho a morir (1928, dont l’examen met en évidence l’importance des débats autour de la légalisation de l’eugénisme en Espagne. En démontrant sa viabilité juridique, fondée sur le respect du droit et des principes socialistes, Jiménez de Asúa ouvre de nouvelles perspectives au mouvement eugéniste espagnol, laissant entrevoir les contours d’un nouvel ordre, au détriment de la Dictature de Primo de Rivera, déjà sclérosée.

  15. Why interdisciplinary research enriches the study of crime. Comment on "Statistical physics of crime: A review" by M.R. D'Orsogna and M. Perc

    Science.gov (United States)

    Donnay, Karsten

    2015-03-01

    The past several years have seen a rapidly growing interest in the use of advanced quantitative methodologies and formalisms adapted from the natural sciences to study a broad range of social phenomena. The research field of computational social science [1,2], for example, uses digital artifacts of human online activity to cast a new light on social dynamics. Similarly, the studies reviewed by D'Orsogna and Perc showcase a diverse set of advanced quantitative techniques to study the dynamics of crime. Methods used range from partial differential equations and self-exciting point processes to agent-based models, evolutionary game theory and network science [3].

  16. Determining the energetics of vicinal perovskite oxide surfaces

    NARCIS (Netherlands)

    Wessels, W.A.; Bollmann, Tjeerd Rogier Johannes; Koster, Gertjan; Zandvliet, Henricus J.W.; Rijnders, Augustinus J.H.M.

    2017-01-01

    The energetics of vicinal SrTiO3(001) and DyScO3(110), prototypical perovskite vicinal surfaces, has been studied using topographic atomic force microscopy imaging. The kink formation and strain relaxation energies are extracted from a statistical analysis of the step meandering. Both perovskite

  17. TOPICAL REVIEW: Vicinal surfaces for functional nanostructures

    Science.gov (United States)

    Tegenkamp, Christoph

    2009-01-01

    Vicinal surfaces are currently the focus of research. The regular arrangements of atomic steps on a mesoscopic scale reveal the possibility to functionalize these surfaces for technical applications, e.g. nanowires, catalysts, etc. The steps of the vicinal surface are well-defined defect structures of atomic size for nucleation of low-dimensional nanostructures. The concentration and therefore the coupling between the nanostructures can be tuned over a wide range by simply changing the inclination angle of the substrate. However, the coupling of these nano-objects to the substrate is just as important in controlling their electronic or chemical properties and making a functionality useable. On the basis of stepped insulating films, these aspects are fulfilled and will be considered in the first part of this review. Recent results for the epitaxial growth of wide bandgap insulating films (CaF2, MgO, NaCl, BaSrO) on metallic and semiconducting vicinal substrates (Si(100), Ge(100), Ag(100)) will be presented. The change of the electronic structure, the adsorption behavior as well as the kinetics and energetics of color centers in the presence of steps is discussed. The successful bridging of the gap between the atomic and mesoscopic world, i.e. the functionalization of vicinal surfaces by nanostructures, is demonstrated in the second part by metal adsorption on semiconducting surfaces. For (sub)monolayer coverage these systems have in common that the surface states do not hybridize with the support, i.e. the semiconducting surfaces are insulating. Here I will focus on the latest results of macroscopic transport measurements on Pb quantum wires grown on vicinal Si(111) showing indeed a one-dimensional transport behavior.

  18. SÈNECA, L. A.: Tragèdies, edició crítica de Tomàs Martínez Romero, 2 volums, Barcelona, Barcino, 1995 («Els Nostres Clàssics», Col.lecció B, núm. 14-15)

    OpenAIRE

    Pujol i Gómez, Josep

    1998-01-01

    Obra ressenyada: L. A. SÈNECA; edició crítica de Tomàs MARTÍNEZ ROMERO, Tragèdies. Barcelona: Barcino, 1995. Tomàs Martínez fa una edició crítica de les traduccions catalanes medievals de les següents tragèdies de Sèneca: 'Hercules furens', 'Thyestes', 'Thebais (Phoenissiae)', 'Hippolytus (Phaedra)' 'Oedipus', 'Troades', 'Medea' i 'Agamemnon'. A banda de l'edició, tracta qüestions com la difusió tardomedieval de Sèneca a la corona d'Aragó, la bibliografia sobre la diversitat dels mètodes d...

  19. Vargas Jiménez, Dolores: Picasso: iconografías del baile.

    Directory of Open Access Journals (Sweden)

    José Jiménez Guerrero

    2016-01-01

    Full Text Available Fue en el año 1967. Bajo el mecenazgo de una institución ya desaparecida, el Liceo de Málaga, se convocó la primera edición del «Premio Málaga de Investigación». Esta loable iniciativa tuvo una continuidad temporal ininterrumpida hasta 1999. Tras ocho años de silencio, y gracias al respaldo de la Real Academia de Bellas Artes de San Telmo y de la Academia Malagueña de Ciencias, y al patrocinio de la entidad Cajamar, este prestigioso premio fue de nuevo convocado. A ello se sumó en el año 2012 la decisión adoptada por la Diputación de Málaga de publicar los trabajos premia dos en las dos modalidades del referido premio: Humanidades y Ciencias. Los libros editados forman parte de la colección que lleva por título «Premios Málaga de Investigación». En la convocatoria del año 2013, el premio de la sección humanística recayó en el trabajo presentado por Dolores Vargas Jiménez, doctora en Historia del Arte, bajo el título de Picasso: iconografías del baile. Y siguiendo lo preestablecido, su obra fue editada por la entidad supramunicipal.

  20. Linguistic Norms at the Crossover: The Verbal Tenses and Modes, and the Structure of the Predicate in «Libro decimosexto» from Comentarios de erudición by Bartolomé Jiménez Patón

    Directory of Open Access Journals (Sweden)

    Juan Miguel Monterrubio Prieto

    2013-11-01

    Full Text Available This study examines verb modes and tenses as well as the predicate structure in «Libro decimosexto» of Bartolomé Jiménez Patón’s Comentarios de erudición in an effort to demonstrate how the text straddles the line between Medieval and Golden Age norms. Jiménez Patón, thus, combines traits already considered archaic at the time, due perhaps to his solid training in grammar and his linguistic awareness, with those modern solutions which, towards the end of the 1500’s, were forging the new Spanish language (that of the «plain style», which he championed, one that was gradually being refined in order to take its place as the language of culture.

  1. Carlos Martínez Assad, coord. 2010. El camino de la rebelión del general Saturnino Cedillo. México: Editorial Océano ISBN 978-607-40034-7-5

    Directory of Open Access Journals (Sweden)

    Victor Rayon García

    2015-01-01

    Full Text Available Carlos Martínez Assad publicó Los rebeldes vencidos. Cedillo contra el Estado cardenista en 1990. En ese trabajo, el ahora investigador emérito por la Universidad Nacional Autónoma de México y el Sistema Nacional de Investigadores dio cuenta, mediante un meticuloso análisis de fuentes primarias, de la última rebelión que conmovió al México contemporáneo. La investigación de Martínez Assad tuvo muchos méritos, aunque tal vez el mayor de ellos fue el hecho de analizar el movimiento de Saturnino Cedillo en sus aspectos económicos, sociales, políticos e ideológicos. Con la seriedad académica que siempre lo caracteriza, el ahora también Premio Nacional de Ciencias y Artes 2013 examinó los momentos más importantes en la vida del cacique potosino: su incursión en el torbellino revolucionario (1912, su apoyo al Plan de Agua Prieta (1920, su alianza con los gobiernos de Álvaro Obregón (1920-1924 y Plutarco Elías Calles (1924-1928, y su enfrentamiento final con el gobierno de Lázaro Cárdenas (1934-1940. De esta manera, Martínez Assad demostró que Cedillo, al rechazar el socialismo, las huelgas y el ejido, fue expuesto por el Estado cardenista —empeñado en lograr una centralización política y administrativa— como aliado de las compañías petroleras expropiadas el 18 de marzo de 1938 y portavoz del fascismo alemán en México.

  2. Hebrew Hermeneutics and Inquisitorial Persecution: The Case of The Hebraist from Salamanca Martín Martínez de Cantalapiedra (XVIth Century

    Directory of Open Access Journals (Sweden)

    Ricardo Muñoz Solla

    2016-12-01

    Full Text Available

    Halfway through the 16th century in Spain the reading and interpretation of the Bible based on its original languages involved a very real danger for humanists who were seeking a better understanding of the Scriptures. The exclusive authority of the Latin Vulgate version declared by the Council of Trent in 1546 hindered the intellectual work of many Biblicists and Theologians, who were subjected to tight ideological control. In this context it must be considered the case of the Hebraist and scholar from the University of Salamanca, Martín Martínez de Cantalapiedra (1518-1579, who was prosecuted by the Inquisition of Valladolid in 1572 along with his colleagues Fray Luis de León and Gaspar de Grajal. All of them were accused of deviating from the genuine sense of the Vulgate in their more literal interpretations of the Masoretic text. The purpose of this article is to provide new evidence for the intellectual biography of Master Martínez de Cantalapiedra as well a to analyze the hermeneutical principles exposed during his inquisitorial in which he defended the Hebrew knowledge as an essential means of interpreting the Old Testament.

  3. Santa Efigenia / Ifigenia : hagiografía y mito en "San Mateo en Etiopía", de Felipe Godínez

    OpenAIRE

    Márquez, Esther

    2017-01-01

    Este artículo aborda el estudio de las fuentes de San Mateo en Etiopía, obra que lleva a las tablas la vida del apóstol San Mateo, centrándose en el episodio de la evangelización de Etiopía y la conversión al cristianismo de Santa Efigenia, la hija del rey Egipo. Mediante el examen de sus fuentes, tanto hagiográficas como mitológicas, se pretende demostrar la contaminación que lleva a cabo Godínez entre la historia de Santa Efigenia y el mito de Ifigenia, la hija de Agamenón. El estudio compa...

  4. Step patterns on vicinal reconstructed surfaces

    Science.gov (United States)

    Vilfan, Igor

    1996-04-01

    Step patterns on vicinal (2 × 1) reconstructed surfaces of noble metals Au(110) and Pt(110), miscut towards the (100) orientation, are investigated. The free energy of the reconstructed surface with a network of crossing opposite steps is calculated in the strong chirality regime when the steps cannot make overhangs. It is explained why the steps are not perpendicular to the direction of the miscut but form in equilibrium a network of crossing steps which make the surface to look like a fish skin. The network formation is the consequence of competition between the — predominantly elastic — energy loss and entropy gain. It is in agreement with recent scanning tunnelling microscopy observations on vicinal Au(110) and Pt(110) surfaces.

  5. Quantum-corrected geometry of horizon vicinity

    Energy Technology Data Exchange (ETDEWEB)

    Park, I.Y. [Department of Applied Mathematics, Philander Smith College, Little Rock, AR (United States)

    2017-12-15

    We study the deformation of the horizon-vicinity geometry caused by quantum gravitational effects. Departure from the semi-classical picture is noted, and the fact that the matter part of the action comes at a higher order in Newton's constant than does the Einstein-Hilbert term is crucial for the departure. The analysis leads to a Firewall-type energy measured by an infalling observer for which quantum generation of the cosmological constant is critical. The analysis seems to suggest that the Firewall should be a part of such deformation and that the information be stored both in the horizon-vicinity and asymptotic boundary region. We also examine the behavior near the cosmological horizon. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Quantum-corrected geometry of horizon vicinity

    International Nuclear Information System (INIS)

    Park, I.Y.

    2017-01-01

    We study the deformation of the horizon-vicinity geometry caused by quantum gravitational effects. Departure from the semi-classical picture is noted, and the fact that the matter part of the action comes at a higher order in Newton's constant than does the Einstein-Hilbert term is crucial for the departure. The analysis leads to a Firewall-type energy measured by an infalling observer for which quantum generation of the cosmological constant is critical. The analysis seems to suggest that the Firewall should be a part of such deformation and that the information be stored both in the horizon-vicinity and asymptotic boundary region. We also examine the behavior near the cosmological horizon. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. El converso sevillano Nicolás Martínez de Medina (o de Sevilla, contador mayor de Castilla. Apuntes para una biografía = Nicolás Martínez Medina (or de Sevilla, Sevilian Converso and Chief Accountant of Castile. Notes for a Biography

    Directory of Open Access Journals (Sweden)

    Isabel Montes Romero-Camacho

    2014-06-01

    Full Text Available A partir de la conquista de Sevilla, en 1248, fueron muchos los judíos, primero, y los conversos, después, que llegaron a ocupar una posición preeminente, tanto en la ciudad, como en la corte, desempeñando, casi siempre, importantes oficios, al servicio de la hacienda real castellana, en una secuencia prácticamente ininterrumpida que va desde Alfonso X (1252-1284 hasta la nueva dinastía Trastámara. Uno de estos importantes conversos fue Nicolás Martínez de Medina (o de Sevilla, cuya actuación pública se desarrolló durante los reinados y a la sombra de los primeros Trastámara, desde Enrique II (1369-1379 hasta Juan II (1406-1454 y que, tras una brillante carrera en Sevilla y en la corte, llegaría a ser contador mayor de Castilla y, por tanto, uno de los personajes más influyentes de su época.After the conquest of Seville in 1248, many Jews and later «Conversos» played a prominent role both in the city and in the Court. They occupied significant positions at the service of the Spanish royal treasury almost uninterruptedly from the reign of Alfonso X (1252-1284 to that of the new Trastámara dynasty. One of these important «Conversos» was Nicolás Martínez de Medina (or de Sevilla, who held public positions under the reigns of the first Trastámara kings, from Enrique II (1369-1379 to Juan II (1406-1454. After a brilliant career in Seville and in the Court, he would become chief accountant of Castile and, consequently, one of the most influential individuals of his time.

  8. An Indian tribal view of the back end of the nuclear fuel cycle: Historical and cultural lessons

    International Nuclear Information System (INIS)

    Tano, M.L.; Reuben, J.H.; Powaukee, D.; Lester, A.D.

    1996-01-01

    Indian tribes of the western United States, including the Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and the Yakama Indian Nation, have entered into cooperative agreements with the U.S. Department of Energy to oversee the cleanup of the Hanford Reservation, in Washington state. These and other tribes considering involvement in nuclear waste management programs have been subjected to severe criticism from some Indians and non-Indians, accusing them of aiding and abetting the violation of Mother Earth by acquiescing in the contamination of lands by radioactive wastes. We'd like to suggest that this view of the Indian relationship to nature and the environment is too narrow. While the purpose of this article is not to suggest that Indian beliefs support the location of waste management facilities on Indian lands, we will describe aspects of Indian religion and culture that support tribal involvement in radioactive waste management and environmental restoration, and participation in radioactive waste management decision making

  9. Homenaje de los Institutos de Derecho Constitucional y Derechos Humanos a Justino Jiménez de Aréchaga en el centenario de su nacimiento

    Directory of Open Access Journals (Sweden)

    Alberto Pérez Pérez

    2014-02-01

    Full Text Available Nació hace cien años, pero su pensamiento sigue plenamente vigente.Su gran obra – verdadero tratado de Derecho Constitucional Uruguayo aunque él no le haya dado ese nombre –terminó de publicarse hace casi seis décadas, pero sigue siendo imprescindible obra de consulta para todos los juristas de nuestro país.Falleció en 1980, pero aún hoy – y sin duda por mucho tiempo más – no hay estudio serio de su especialidad que no comience por indagar lo que él pensaba al respecto.Ése es Justino Jiménez de Aréchaga, la grande, inmensa personalidad uruguaya de cuyo nacimiento se cumplen hoy cien años.Los Institutos de Derecho Constitucional y Derechos Humanos, que me honro en dirigir, le rinden hoy un merecidísimo homenaje, que podemos sintetizar en cuatro afirmaciones:I.Justino Jiménez de Aréchaga hizo una obra maestraII.Fue un Maestro del Derecho y de la vida en democraciaIII.Como verdadero Maestro, también nos enseñó/incitó a tratar de continuar su obraIV.El homenaje que le debemos al Maestro Aréchaga consiste, precisamente, no en palabras sino en obras que lo honren.

  10. Uranium Mill Tailings Remedial Action Project Vicinity Property Program

    International Nuclear Information System (INIS)

    Little, L.E.; Potter, R.F.; Arpke, P.W.

    1988-01-01

    The Department of Energy Uranium Mill Tailings Remedial Action (UMTRA) Grand Junction Project Vicinity Property Program is a $165 million program for the removal and disposal of uranium mill tailings that were used in the construction of approximately 4,000 residences, commercial buildings, and institutional facilities in the City of Grand Junction and surrounding Mesa County, Colorado. This paper discusses the UMTRA Vicinity Property Program and the economic benefits of this program for the City of Grand Junction and Mesa County, Colorado. The Bureau of Reclamation Economic Assessment Model (BREAM) was used to estimate the increases in employment and increases in personal income in Mesa County that result from the Vicinity Property Program. The effects of program-related changes in income and taxable expenditures on local and state tax revenue are also presented

  11. Effect of the Antibiotic Neomycin on the Toxicity of the Glycoside Vicine in Rats

    Directory of Open Access Journals (Sweden)

    Mahmoud S. Arbid

    2013-01-01

    Full Text Available Vicine is hydrolyzed by microflora to highly reactive free radical generating compound divicine which causes mortality and other adverse effects. This study in the rats established the effect of a broad spectrum and poorly absorbed antibiotic, neomycin sulfate on the toxicity of vicine. The results showed extremely decrease in mortality rate in the group pretreated with neomycin. Hemoglobin (Hb concentration, hematocrit (Hct value, and red blood cells (RBCs count were significantly decreased after injection of vicine and the improvement of these values in the group pretreated with neomycin. The same results were observed in white blood cells (WBCs. The results showed a significant decrease in glucose level and returned to normal in group pretreated with neomycin. Glutathione (GSH was significantly decreased in the vicine group and returned to normal value in the group pretreated with neomycin. Lipid peroxide (TBARs was significantly increased in the group treated with vicine and neomycin pretreated group decreased to the normal level. Glucose-6-phosphate dehydrogenase (G6-PD activity was significantly decreased and returned to normal level in rats pretreated with neomycin. Serum protein and globulin were significantly decreased but serum albumin showed insignificant decrease in vicine and neomycin groups compared to control. Alanine aminotransferase (ALT and aspartate aminotransferase (AST were significantly decreased in the vicine group. The group pretreated with neomycin showed significantly increased activities of AST and ALT compared with vicine group. In conclusion, neomycin pretreatment of rats injected with glycoside vicine decreased to a great extent of its toxic and mortality effects and is useful in favism and hemolytic anemia.

  12. De mitos y realidades (respuesta a Luciano Martínez

    Directory of Open Access Journals (Sweden)

    José Luis Coraggio

    2009-10-01

    Full Text Available Este artículo constituye la respuesta del autor al comentario crítico realizado, en esta misma sección, por Luciano Martínez, en la pasada edición. El autor sostiene que la economía social y solidaria como un ámbito en construcción, que alberga a diversas vertientes que intentan avanzar hacia otra economía. Este carácter si bien puede albergar dudas, no debe transformase en un fatalismo inmovilizador, que permite la actualización constante del libre mercado como institución hegemónica. Antes que una utopía a denunciar desde una visión “realista”, se trata de construir una economía que combine mecanismos de mercado regulados socio-políticamente y relaciones de reciprocidad y redistribución. El texto explora, en pos de la argumentación, algunos de los elementos que conforman la economía social y solidaria.This article represents the author's response to critical commentary made in this section in the last edition by Luciano Martinez. The author maintains that the social and solidarity economy is a sphere under construction, in which several strands can be found. All of these approaches aim to move towards a different type of economy. This character as a developing realm can prompt doubts; this, however, should not lead to a paralyzing fatalism which allows the constant updating of the free market as a hegemonic institution. Far from a utopia to be denounced from a “realistic” viewpoint of economy, its concerns the construction of an economy that combines socio-politically regulated market mechanisms as well as relations of reciprocity and redistribution. The text also explores some of the elements that make up the solidarity and social economy.

  13. Gamma Radiation Assessment In Kartini Reactor And Its Vicinity

    International Nuclear Information System (INIS)

    Yazid, M.; Supriyatni, E.; Maryono; Bastianudin, Aris

    2000-01-01

    Measurement to calculate dose assesment for gamma radiation in Kartini Reactor and its vicinity has been done whether on operated or un operated condition. Measurement was performed using height pressured ionization chamber, Reuther Stokes RS-112 production. Measurement location was determined based on distance variation inwardly and outwardly of reactor building and its vicinity. The result showed that the average dose rate in the reactor building when un operated is in the range of 11.4-38.6 mu rad/hour and when the reactor operated is 166.4-1910.9 mu rad/hour. While the vicinity of the reactor on operated condition the average dose rate is 34.4-38.6 mu rad/hour in un operated condition is 6.9-7.0 mu rad/hour. This result showed that the reactor operated did not rise the radiation exposure level in its vicinity. From the personnel assesment dose rate of gamma radiation is 28.54 mrem/week on operated condition, 0.90 mrem.week on un operated condition. While dose rate outside the reactor is 0.44 and 0.27 mrem/week for operated and un operated condition consecutively. This dose rate is still below maximum permissible dose than recommended by the national regulation of radiation protection from BAPETEN No. 01/Ka.BAPETEN/V-99

  14. BPA riparian fencing and alternative water development projects completed within Asotin Creek Watershed ; 2000 and 2001 Asotin Creek fencing final report of accomplishments

    International Nuclear Information System (INIS)

    Johnson, B.J.Bradley J.

    2002-01-01

    The Asotin County Conservation District (ACCD) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington in Water Resource Inventory Area (WRIA) 35. According to Washington Department of Fish and Wildlife's (WDFW) Priority WRIA's by ''At-Risk Stock Significance Map'', it is the highest priority WRIA in southeastern Washington. Summer steelhead, bull trout, and Snake River spring chinook salmon which are listed under the Endangered Species Act (ESA), are present in the watershed. WDFW manages it as a Wild Steelhead Reserve; no hatchery fish have been released here since 1997. The ACCD has been working with landowners, Bonneville Power Administration (BPA), Washington State Conservation Commission (WCC), Natural Resource Conservation Service (NRCS), Washington Department of Fish and Wildlife (WDFW), U.S. Forest Service, Pomeroy Ranger District (USFS), Nez Perce Tribe, Washington Department of Ecology (DOE), National Marine Fisheries Service (NMFS), and U.S. Fish and Wildlife Service (USFWS) to address habitat projects in Asotin County. Local students, volunteers and Salmon Corps members from the Nez Perce Tribe have been instrumental in the success of the Model Watershed Program on Asotin Creek. ACCD began coordinating habitat projects in 1995 with the help of BPA funding. Approximately two hundred and seventy-six projects have been implemented as of 1999. The Washington State Legislature was successful in securing funding for endangered salmon and steelhead recovery throughout the State in 1998. While these issues were new to most of the State, the ACCD has been securing and administering funding for endangered salmonids since 1994. The ''Asotin Creek Riparian Planting 2000-053-00 and Asotin Creek Riparian Fencing 2000-054-00'' teamed BPA and the Governor's Salmon Recovery Funding to plant approximately 84

  15. L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo Ibérico e l’azionismo torinese.

    OpenAIRE

    Bottai, Alessio

    2016-01-01

    Síntesis L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo ibérico e l’azionismo torinese. Esta investigación tiene como objeto la historia de las relaciones que se mantuvieron durante más de dos décadas entre un grupo de intelectuales italianos, pertenecientes sobre todo a los azionisti, y algunos exponentes del antifranquismo español. Más específicamente, la tesis se centra en las relaciones activas de solidaridad humana y política que vincular...

  16. Estudo sobre a perceção individual de adolescentes no uso de aparatologia funcional removível e a sua predisposição no sucesso do tratamento ortodôntico

    OpenAIRE

    Figueira, Maria Margarida Góis

    2016-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Introdução: Esta investigação pretende explorar, estudar e descrever a perceção individual e adaptativa, relativamente ao tratamento com aparelhos funcionais removíveis, da população jovem a ser seguida na consulta assistencial de Ortodontia da Clínica Universitária Egas Moniz, percebendo-se um envolvimento positivo dos pacientes predispõe ao sucesso do seu tratamento. Materiais e Métodos: ...

  17. Towards a Poetry of Silence: Stéphane Mallarmé and Juan Ramón Jiménez

    Directory of Open Access Journals (Sweden)

    Mervyn Coke-Enguídanos

    1983-01-01

    Full Text Available In an era of apparent dissolution, "la Obra" of Juan Ramón Jiménez, like "l'Oeuvre" of Stéphane Mallarmé, has for its goal the attainment of timelessness. In both poets, the concept of absolute Time—the timelessness of eternal Time—is yoked with the ideal of silence. But this is no ordinary silence, and certainly not the kind that results from inadequacy of expression. It is the silence of perfection, the expression of the ineffable: pure Poetry. Since the poetic language is the silent language of thought, both Mallarmé and Juan Ramón seek to convey the pure idea. In so doing, both must stringently eliminate whatever is not essential in their poetry. The astonishing paradox, central to Mallarmé and Juan Ramón alike, is the urge to create an "unwritten" poetry.

  18. [Rural medical practice at the beginning of the 20th century. Martínez Saldise (1855-1937), honorary member of Paediatric Society of Madrid in 1927].

    Science.gov (United States)

    Zafra Anta, Miguel Ángel; Flores Martín, Carlos; Ponte Hernando, Fernando Julio; Gil García, Andrés; Gómez López, Ana; Fernández Durán, Carla

    2016-01-01

    On the centenary of the foundation of the Paediatrics Society of Madrid, a tribute is presented to rural medical practice of that time, although there are few documents on the history of rural medicine. The main objective is to describe the context of the rural medical practice in the late 19th and beginning 20th century, while presenting a historical biographical review of Manuel Martínez Saldise, who was medical specialist from Cazalegas (Toledo). He was appointed an Honorary Member by the Paediatrics Society of Madrid in 1927. A search was carried out in repositories of digitized media, web portals of history of medicine, PubMed, IME files of local councils and medical colleges. The family archives were reviewed with the collaboration of his descendants. The hiring of rural doctors was carried out by the municipalities, and the salary largely depended on private practice as well as "retainers". Specialist physicians took part in epidemics, legal medicine, and in hygiene measures. They also had disputes with mayors, chiefs, with colleagues and with protectionism. A summary of the biography and occupational activity of Manuel Martínez Saldise is presented. Rural doctors were subjected to the society of their time, with the issues that arose, denouncing the shortcomings of the local administrations, dedicated efforts to their family and the most disadvantaged. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.

  19. Surface energy and surface stress on vicinals by revisiting the Shuttleworth relation

    Science.gov (United States)

    Hecquet, Pascal

    2018-04-01

    In 1998 [Surf. Sci. 412/413, 639 (1998)], we showed that the step stress on vicinals varies as 1/L, L being the distance between steps, while the inter-step interaction energy primarily follows the law as 1/L2 from the well-known Marchenko-Parshin model. In this paper, we give a better understanding of the interaction term of the step stress. The step stress is calculated with respect to the nominal surface stress. Consequently, we calculate the diagonal surface stresses in both the vicinal system (x, y, z) where z is normal to the vicinal and the projected system (x, b, c) where b is normal to the nominal terrace. Moreover, we calculate the surface stresses by using two methods: the first called the 'Zero' method, from the surface pressure forces and the second called the 'One' method, by homogeneously deforming the vicinal in the parallel direction, x or y, and by calculating the surface energy excess proportional to the deformation. By using the 'One' method on the vicinal Cu(0 1 M), we find that the step deformations, due to the applied deformation, vary as 1/L by the same factor for the tensor directions bb and cb, and by twice the same factor for the parallel direction yy. Due to the vanishing of the surface stress normal to the vicinal, the variation of the step stress in the direction yy is better described by using only the step deformation in the same direction. We revisit the Shuttleworth formula, for while the variation of the step stress in the direction xx is the same between the two methods, the variation in the direction yy is higher by 76% for the 'Zero' method with respect to the 'One' method. In addition to the step energy, we confirm that the variation of the step stress must be taken into account for the understanding of the equilibrium of vicinals when they are not deformed.

  20. « Nez et langues électroniques » : bilan et perspectives pour les huiles alimentaires

    Directory of Open Access Journals (Sweden)

    Mielle Patrick

    2003-07-01

    Full Text Available Le « Nez électronique », et plus récemment la « Langue électronique » ont été fort médiatisés durant la dernière décennie. Aussi est-il nécessaire, avec le recul, de faire le point sur les bénéfices que ces technologies peuvent apporter dans le domaine des produits alimentaires, et en particulier pour huiles végétales. On trouve une littérature relativement abondante dans ce domaine, mais les applications qui ont réussi à franchir le cap de l’utilisation industrielle sont extrêmement restreintes. S’agit-il d’une frilosité des industriels pour des investissements de contrôle-qualité ou d’un manque de fiabilité des résultats de laboratoire ? Pourtant, la demande en outils rapides de contrôle-qualité (ou de contrôle d’origine n’a jamais été aussi pressante. Nous expliquerons ce point par la nature même du produit, principalement pour l’huile d’olive extra vierge. D’autres techniques faisant appel à l’enrichissement en composés volatils seront introduites, laissant espérer à l’avenir une amélioration de la fiabilité des analyses.

  1. Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed, Technical Report 2003-2006.

    Energy Technology Data Exchange (ETDEWEB)

    Rasmussen, Lynn

    2007-02-01

    The Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed is a multi-phase project to enhance steelhead trout in the Lapwai Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District (District). Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period December 1, 2003 through February 28, 2004 include; seven grade stabilization structures, 0.67 acres of wetland plantings, ten acres tree planting, 500 linear feet streambank erosion control, two acres grass seeding, and 120 acres weed control.

  2. José Martínez Millán y Carlos Javier de Carlos Morales. Religión, política y tolerancia en la Europa Moderna

    OpenAIRE

    Torres Corominas, Eduardo

    2013-01-01

    Como fruto maduro de una larga trayectoria docente e investigadora en la Universidad Autónoma de Madrid, José Martínez Millán y Carlos Javier de Carlos Morales ofrecen en Religión, política y tolerancia en la Europa Moderna una serena reflexión sobre la época del Antiguo Régimen que pretende superar, desde los estudios sobre la Corte, los límites y contradicciones de las escuelas y paradigmas precedentes, como la escuela de los Annales y el marxismo, por medio de un discurso renovador donde s...

  3. On the nature of electromagnetic waves in the vicinity of auroral archs

    International Nuclear Information System (INIS)

    Volokitin, A.S.; Mordovskaya, V.G.

    1988-01-01

    Excitation of kinetic Alfven waves by longitudinal current in the vicinity of auroral arcs is considered in the framework of quasilinear theory. It is shown that experimentally observed low-frequency electromagnetic waves with f<2Hz frequency in the vicinity of uniform auroral arcs represent the Alfven waves, excited at altitudes of three Earth radii and above by longitudinal electric current

  4. Some radiation measurements in the vicinity of TV and VDU screens

    International Nuclear Information System (INIS)

    Tuyn, J.W.N.; Roger, P.

    1985-01-01

    The dose rate due to X-rays in the vicinity of TV and VDU screens was determined using a xenon-filled proportional counter. The results confirm that the X-ray dose rate around such devices is extremely low. Of greater impact for the exposure of the population was found to be the influence of the electrostatic field in the vicinity of a TV or VDU screen on the local concentration of radon daughters. Such measurements were performed using air sampling at various distances from the screens on a filter-surface barrier detector unit to identify the radon daughters. The radon concentration in the room was simultaneously measured using TLD in a device based on electrostatic precipitation. It is shown that the presence of an electrostatic field during operation of a TV or VDU screen reduces the radon daughter concentration in its vicinity. (orig./HP)

  5. Are Vicinal Metal Surfaces Stable?

    DEFF Research Database (Denmark)

    Frenken, J. W. M.; Stoltze, Per

    1999-01-01

    We use effective medium theory to demonstrate that the energies of many metal surfaces are lowered when these surfaces are replaced by facets with lower-index orientations. This implies that the low-temperature equilibrium shapes of many metal crystals should be heavily faceted. The predicted...... instability of vicinal metal surfaces is at variance with the almost generally observed stability of these surfaces. We argue that the unstable orientations undergo a defaceting transition at relatively low temperatures, driven by the high vibrational entropy of steps....

  6. Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega - José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro

    Directory of Open Access Journals (Sweden)

    Enrico Di Pastena

    2012-12-01

    Full Text Available Review of Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega, Homo Legens (Bibliotheca Homolegens, 63, Madrid, 2011, 334 pp. ISBN: 978-84-92518-72-2 y José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro, PPU, Barcelona, 2011, 783 pp. ISBN: 978-84-477-1114-7.

  7. Inertia of rough and vicinal surfaces of helium-4 crystals

    International Nuclear Information System (INIS)

    Amrit, J.; Legros, P.; Poitrenaud, J.

    1995-01-01

    This paper reports a study of the inertia of rough and vicinal of 4 He crystals. We have measured the transmission coefficient of ultrasonic waves at frequencies 10, 30, 50 and 70 MHz, across the liquid-solid interface. The experiments are carried out at temperatures ranging between 0.4 and 1.0 K for four crystallographic orientations. Two important phenomena are put to evidence for the first time. We have found the first experimental evidence that the inertia of rough surfaces depends on temperature. For vicinal surfaces, we have shown the strong increase of the inertia as the tilt angle decreases. Our experimental results agree very well with the theoretical predictions

  8. Surface Science in an MOCVD Environment: Arsenic on Vicinal Ge(100)

    International Nuclear Information System (INIS)

    Olson, J.M.; McMahon, W.E.

    1998-01-01

    Scanning tunneling microscope (STM) images of arsine-exposed vicinal Ge(100) surfaces show that most As/Ge steps are reconstructed, and that a variety of different step structures exist. The entire family of reconstructed As/Ge steps can be divided into two types, which we have chosen to call ''single-row'' steps and ''double-row'' steps. In this paper we propose a model for a double-row step created by annealing a vicinal Ge(100) substrate under an arsine flux in a metal-organic chemical vapor deposition (MOCVD) chamber

  9. Alarma sobre el aplastamiento de la persona en la sociedad contemporánea: José Jiménez Lozano en la prensa regional

    Directory of Open Access Journals (Sweden)

    María Merino Bobillo

    2011-11-01

    Full Text Available Las enfermedades de la sociedad contemporánea son descritas, con lucidez y brillantez literaria, por el periodista y escritor José Jiménez Lozano, en las entregas periodísticas al Grupo Promecal. Los nacionalismos, la movida y el botellón, la violencia de género, el lenguaje sexista, etc. son retazos de la actualidad que su mirada atraviesa y dimensiona. Sus artículos traspasan la contingencia de lo periodístico para convertirse en propuestas culturales con tonalidad universal. No se quedan en la crítica de los sucesos concretos sino que, apoyándose en ellos, derivan en reflexiones de corte antropológico y ofrecen pensamientos válidos para los lectores de hoy y de mañana.

  10. Ge growth on vicinal si(001) surfaces: island's shape and pair interaction versus miscut angle.

    Science.gov (United States)

    Persichetti, L; Sgarlata, A; Fanfoni, M; Balzarotti, A

    2011-10-01

    A complete description of Ge growth on vicinal Si(001) surfaces is provided. The distinctive mechanisms of the epitaxial growth process on vicinal surfaces are clarified from the very early stages of Ge deposition to the nucleation of 3D islands. By interpolating high-resolution scanning tunneling microscopy measurements with continuum elasticity modeling, we assess the dependence of island's shape and elastic interaction on the substrate misorientation. Our results confirm that vicinal surfaces offer an additional degree of control over the shape and symmetry of self-assembled nanostructures.

  11. "Equilibrium structure of monatomic steps on vicinal Si(001)

    NARCIS (Netherlands)

    Zandvliet, Henricus J.W.; Elswijk, H.B.; van Loenen, E.J.; Dijkkamp, D.

    1992-01-01

    The equilibrium structure of monatomic steps on vicinal Si(001) is described in terms of anisotropic nearest-neighbor and isotropic second-nearest-neighbor interactions between dimers. By comparing scanning-tunneling-microscopy data and this equilibrium structure, we obtained interaction energies of

  12. Cancer incidence in the vicinity of nuclear power plants in Taiwan: a population-based study.

    Science.gov (United States)

    Wang, Shiow-Ing; Yaung, Chih-Liang; Lee, Long-Teng; Chiou, Shang-Jyh

    2016-01-01

    Numerous antinuclear demonstrations reveal that the public is anxious about the potential health effects caused by nuclear power plants. The purpose of this study is to address the question "Is there a higher cancer incidence rate in the vicinity of nuclear power plants in Taiwan?" The Taiwan Cancer Registry database from 1979 to 2003 was used to compare the standardized incidence rate of the top four cancers with strong evidence for radiation risks between the "plant-vicinity" with those "non-plant-vicinity" groups. All cancer sites, five-leading cancers in Taiwan, and gender-specific cancers were also studied. We also adopted different observation time to compare the incidence rate of cancers between two groups to explore the impact of the observation period. The incidences of leukemia, thyroid, lung, and breast cancer were not significantly different between two groups, but cervix uteri cancer showed higher incidence rates in the plant-vicinity group. The incidence of cervical cancer was not consistently associated with the duration of plant operation, according to a multiyear period comparison. Although there was higher incidence in cervix cancer in the plant-vicinity group, our findings did not provide the crucial evidence that nuclear power plants were the causal factor for some cancers with strong evidence for radiation risks.

  13. Mount Zirkel Wilderness and vicinity, Colorado

    International Nuclear Information System (INIS)

    Snyder, G.L.; Patten, L.L.

    1984-01-01

    Several areas of metallic and nonmetallic mineralization have been identified from surface occurrences within the Mount Zirkel Wilderness and vicinity, Colorado. Three areas of probable copper-lead-zinc-silver-gold resource potential, two areas of probable chrome-platinum resource potential, four areas of probable uranium-thorium resource potential, two areas of probable molybdenum resource potential, and one area of probable fluorspar potential were identified by studies in 1965-1973 by the USGS and USBM. No potential for fossil fuel or geothermal resources was identified

  14. One-dimensional versus two-dimensional electronic states in vicinal surfaces

    International Nuclear Information System (INIS)

    Ortega, J E; Ruiz-Oses, M; Cordon, J; Mugarza, A; Kuntze, J; Schiller, F

    2005-01-01

    Vicinal surfaces with periodic arrays of steps are among the simplest lateral nanostructures. In particular, noble metal surfaces vicinal to the (1 1 1) plane are excellent test systems to explore the basic electronic properties in one-dimensional superlattices by means of angular photoemission. These surfaces are characterized by strong emissions from free-electron-like surface states that scatter at step edges. Thereby, the two-dimensional surface state displays superlattice band folding and, depending on the step lattice constant d, it splits into one-dimensional quantum well levels. Here we use high-resolution, angle-resolved photoemission to analyse surface states in a variety of samples, in trying to illustrate the changes in surface state bands as a function of d

  15. Measuring dose from radiotherapy treatments in the vicinity of a cardiac pacemaker.

    Science.gov (United States)

    Peet, Samuel C; Wilks, Rachael; Kairn, Tanya; Crowe, Scott B

    2016-12-01

    This study investigated the dose absorbed by tissues surrounding artificial cardiac pacemakers during external beam radiotherapy procedures. The usefulness of out-of-field reference data, treatment planning systems, and skin dose measurements to estimate the dose in the vicinity of a pacemaker was also examined. Measurements were performed by installing a pacemaker onto an anthropomorphic phantom, and using radiochromic film and optically stimulated luminescence dosimeters to measure the dose in the vicinity of the device during the delivery of square fields and clinical treatment plans. It was found that the dose delivered in the vicinity of the cardiac device was unevenly distributed both laterally and anteroposteriorly. As the device was moved distally from the square field, the dose dropped exponentially, in line with out-of-field reference data in the literature. Treatment planning systems were found to substantially underestimate the dose for volumetric modulated arc therapy, helical tomotherapy, and 3D conformal treatments. The skin dose was observed to be either greater or lesser than the dose received at the depth of the device, depending on the treatment site, and so care should be if skin dose measurements are to be used to estimate the dose to a pacemaker. Square field reference data may be used as an upper estimate of absorbed dose per monitor unit in the vicinity of a cardiac device for complex treatments involving multiple gantry angles. Copyright © 2016 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  16. Análisis e interpretación de la columna de opinión en la obra periodística del murciano José García Martínez

    OpenAIRE

    Castelo Blasco, Carmen

    2015-01-01

    Objetivos.- El presente trabajo analiza 300 columnas de opinión del periodista murciano José García Martínez publicadas en el periódico La Verdad entre los años 1975 y 2010. Para ello, se ha utilizado un análisis de contenido que ha permitido identificar las particularidades y características en cuanto a temas, enfoque, estructura y lenguaje que el autor utiliza. Se trata de un periodista singular por el hecho de haber desarrollado durante más de medio siglo su carrera profesional en un único...

  17. Grande Ronde Basin Chinook Salmon Captive Brood and Conventional Supplementation Programs, 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)

    2003-07-01

    Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2002. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, they are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, the Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation.

  18. Stability Analysis of Spacecraft Motion in the Vicinity of Asteroids

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective of my proposal is to determine the stability of a spacecraft when in the vicinity of an asteroid. Orbiting an asteroid is a difficult task. The unique...

  19. Historias y viñetas, una versión del pasado traumático. Carlos Giménez: variaciones entre España y Argentina

    Directory of Open Access Journals (Sweden)

    Néstor Bórquez

    2013-12-01

    Full Text Available The following paper shall focus especially on the work of Carlos Giménez, a comic author from Madrid who attempts to represent there Spanish daily life from Civil War times up to the end of the Francoist regime –and his own life experience displays there an unavoidable reference point: 36-39 Malos tiempos, but mostly Paracuellos and Barrio are part of his own life story during the Civil War and the Francoist regime. In Argentina, authors such as Mariano Grassi or María Delia Lozupone and Rafael Cippolini try a similar intimist gaze upon the representation of dictatorship times in Argentina. This paper shall seek to establish a dialogue between these manifestations, attempting thereby to analyze the intimate plot of history and representation in these comic books.

  20. The decoration of vicinal copper polycrystalline surface by Antimony

    CSIR Research Space (South Africa)

    Ndlovu, GF

    2011-07-01

    Full Text Available in the vicinity of the step edges illustrative of the Frank van der Merwe type of growth. Kinks provide for the adsorbates a site with a coordination that is higher than for sites at the straight step edge. Thus, kinks act as efficient nucleation sites...

  1. 77 FR 5398 - Safety Zone; Atlantic Intracoastal Waterway, Vicinity of Marine Corps Base, Camp Lejeune, NC

    Science.gov (United States)

    2012-02-03

    ...-AA00 Safety Zone; Atlantic Intracoastal Waterway, Vicinity of Marine Corps Base, Camp Lejeune, NC... zone on the Atlantic Intracoastal Waterway (AICW) adjacent to Marine Corps Base (MCB) Camp Lejeune..., Vicinity of Marine Corps Base, Camp Lejeune, NC in the Federal Register (77 FR 1431). We received no...

  2. ¿Es posible provocar la madurez del conflicto? A propósito de la correspondencia entre Medófilo Medina y Timoleón Jiménez

    Directory of Open Access Journals (Sweden)

    Adolfo León Atehortúa Cruz

    2012-08-01

    Full Text Available A partir del intercambio epistolar entre Medófilo Medina y Timoleón Jiménez, el presente artículo debate los puntos centrales de la correspondencia aludida: la vigencia de la lucha armada, la concepción de dominación y dependencia y las vías de la democracia en Colombia. Finalmente, explora la madurez del conflicto armado en nuestro país y las posibilidades de una salida negociada con participación de la sociedad. Como conclusión, ofrece respuesta a dos preguntas: ¿Será posible una salida negociada que preserve la dignidad de los combatientes? Más aún, ¿será posible inducir esa salida desde la sociedad?

  3. Perceções parentais sobre estado nutricional, imagem corporal e saúde em crianças com idade escolar Las percepciones de los padres sobre el estado nutricional, la imagen corporal y la salud en niños en edad escolar Parental perceptions of nutritional status, body image and health in school-aged children

    Directory of Open Access Journals (Sweden)

    Lúcia Macedo

    2012-03-01

    Full Text Available Objetivo: avaliar as perceções parentais sobre estado nutricional, imagem corporal e saúde nas crianças que frequentam o 1º ciclo do ensino básico. Material e métodos: foi avaliado o IMC e a perceção dos pais sobre a imagem corporal e saúde dos seus filhos, por questionários enviados a todos os pais das crianças matriculadas nas escolas pertencentes aos Agrupamentos Vertical de Anes de Cernache e de Vila d’Este, do Concelho de Vila Nova de Gaia, no início do ano letivo 2008/2009 (n=936 e incluídas 532 crianças e pais que aderiram (57% da população amostral. As perceções parentais foram comparadas com o percentil de IMC da criança para avaliar eventuais discrepâncias. Trata-se de um estudo descritivo-correlacional. Resultados: verificou-se que 49.9% dos pais apresentaram uma distorção da perceção relativamente ao estado nutricional e 37.9% relativamente à imagem corporal. Constatou-se que apenas a idade da criança tinha relação com a perceção parental sobre a imagem corporal. Os pais referiram ter “boa” perceção de saúde. Conclusão: estes resultados são congruentes com outros na área e alertam os profissionais para a necessidade de uma intervenção mais efetiva na educação para a saúde para prevenir e detetar precocemente casos de crianças em risco de se tornarem obesas.Objetivo: evaluar las percepciones de los padres sobre el estado nutricional, la imagen corporal, la salud de los niños que asisten al 1 º ciclo de la educación básica. Métodos: se evaluaron el IMC y la percepción de los padres sobre la imagen corporal y la salud de sus hijos por medio de cuestionarios, enviados a todos los padres de los niños matriculados en las escuelas pertenecientes a los “Agrupamentos Vertical” de Anes de Cernache y de Vila d’Este, del municipio de Vila Nova de Gaia, al inicio del curso 2008/2009 (n = 936 e incluyó a 532 niños y padres que a él adhirieron (57% de la población de muestreo. Las

  4. Impact of repeated exposure on toxicity of perchloroethylene in Swiss Webster mice

    International Nuclear Information System (INIS)

    Philip, Binu K.; Mumtaz, Moiz M.; Latendresse, John R.; Mehendale, Harihara M.

    2007-01-01

    The aim was to study the subchronic toxicity of perchloroethylene (Perc) by measuring injury and repair in liver and kidney in relation to disposition of Perc and its major metabolites. Male SW mice (25-29 g) were given three dose levels of Perc (150, 500, and 1000 mg/kg day) via aqueous gavage for 30 days. Tissue injury was measured during the dosing regimen (0, 1, 7, 14, and 30 days) and over a time course of 24-96 h after the last dose (30 days). Perc produced significant liver injury (ALT) after single day exposure to all three doses. Liver injury was mild to moderate and regressed following repeated exposure for 30 days. Subchronic Perc exposure induced neither kidney injury nor dysfunction during the entire time course as evidenced by normal renal histology and BUN. TCA was the major metabolite detected in blood, liver, and kidney. Traces of DCA were also detected in blood at initial time points after single day exposure. With single day exposure, metabolism of Perc to TCA was saturated with all three doses. AUC/dose ratio for TCA was significantly decreased with a concomitant increase in AUC/dose of Perc levels in liver and kidney after 30 days as compared to 1 day exposures, indicating inhibition of metabolism upon repeated exposure to Perc. Hepatic CYP2E1 expression and activity were unchanged indicating that CYP2E1 is not the critical enzyme inhibited. Hepatic CYP4A expression, measured as a marker of peroxisome proliferation was increased transiently only on day 7 with the high dose, but was unchanged at later time points. Liver tissue repair peaked at 7 days, with all three doses and was sustained after medium and high dose exposure for 14 days. These data indicate that subchronic Perc exposure via aqueous gavage does not induce nephrotoxicity and sustained hepatotoxicity suggesting adaptive hepatic repair mechanisms. Enzymes other than CYP2E1, involved in the metabolism of Perc may play a critical role in the metabolism of Perc upon subchronic exposure

  5. Environmental monitoring in the vicinity of nuclear facilities

    International Nuclear Information System (INIS)

    Jacomino, V.M.F.; Maduar, M.F.

    1992-02-01

    The purpose of this manual is to provide guidance for setting up programmes of environmental monitoring in the vicinity of establishments in a normal condition of operation. It intends to contribute for trainning of technicians working in the nuclear field. In order to illustrate the application of the basic principles described in this manual, the routine environmental monitoring programme carried out in the IPEN-CNEN/SP is presented. (author)

  6. Toxic trace elements in solid airborne particles and ecological risk assessment in the vicinity of local boiler house plants

    Science.gov (United States)

    Talovskaya, Anna V.; Osipova, Nina A.; Yazikov, Egor G.; Shakhova, Tatyana S.

    2017-11-01

    The article deals with assessment of anthropogenic pollution in vicinity of local boilers using the data on microelement composition of solid airborne particles deposited in snow. The anthropogenic feature of elevated accumulation levels of solid airborne particles deposited in snow in the vicinity of coal-fired boiler house is revealed in elevated concentrations (3-25 higher than background) of Cd, Sb, Mo, Pb, Sr, Ba, Ni, Mo, Zn and Co. In the vicinity oil-fired boiler house the specific elements as parts of solid airborne particles deposited in snow are V, Ni and Sb, as their content exceeds the background from 3 to 8 times. It is determined that the maximum shares in non-carcinogenic human health risk from chronic inhalation of trace elements to the human body in the vicinity of coal-fired boiler house belong to Al, Mn, Cu, Ba, Co, Pb, whereas in the vicinity of oil-fired boiler house - Al, Mn, Cu, Ni, V.

  7. Indoor tetrachloroethylene levels and determinants in Paris dwellings.

    Science.gov (United States)

    Roda, Célina; Kousignian, Isabelle; Ramond, Anna; Momas, Isabelle

    2013-01-01

    There is growing public health concern about indoor air quality. Tetrachloroethylene (PERC), a chlorinated volatile organic compound widely used as a solvent in dry cleaning facilities, can be a residential indoor air pollutant. As part of an environmental investigation included in the PARIS (Pollution and asthma Risk: an Infant Study) birth cohort, this study firstly aimed to document domestic PERC levels, and then to identify the factors influencing these levels using standardized questionnaires about housing characteristics and living conditions. Air samples were collected in the child's bedroom over one week using passive devices when infants were 1, 6, 9, and 12 months. PERC was identified and quantified by gas chromatography/mass spectrometry. PERC annual domestic level was calculated by averaging seasonal levels. PERC was omnipresent indoors, annual levels ranged from 0.6 to 124.2 μg/m3. Multivariate linear and logistic regression models showed that proximity to dry cleaning facilities, do-it-yourself activities (e.g.: photographic development, silverware), presence of air vents, and building construction date (<1945) were responsible for higher domestic levels of PERC. This study, conducted in an urban context, provides helpful information on PERC contamination in dwellings, and identifies parameters influencing this contamination. Copyright © 2012 Elsevier Inc. All rights reserved.

  8. Surface-water quality, Oneida Reservation and vicinity, Wisconsin, 1997-98

    Science.gov (United States)

    Schmidt, Morgan A.; Scudder, Barbara C.; Richards, Kevin D.

    2000-01-01

    Streamwater samples were collected at 19 sites in the vicinity of the Oneida Tribe of Indians of Wisconsin Reservation. Samples were collected during 5 sampling periods in 1997-98. Field measurements were made and samples were analyzed for nutrients, suspended sediment, major ions, and pesticides.

  9. Atmospheric dispersion estimates in the vicinity of buildings

    International Nuclear Information System (INIS)

    Ramsdell, J.V. Jr.; Fosmire, C.J.

    1995-01-01

    A model describing atmospheric dispersion in the vicinity of buildings was developed for the U.S. Nuclear Regulatory Commission (NRC) in the late 1980s. That model has recently undergone additional peer review. The reviewers identified four areas of concern related to the model and its application. This report describes revisions to the model in response to the reviewers concerns. Model revision involved incorporation of explicit treatment of enhanced dispersion at low wind speeds in addition to explicit treatment of enhanced dispersion at high speeds resulting from building wakes. Model parameters are evaluated from turbulence data. Experimental diffusion data from seven reactor sites are used for model evaluation. Compared with models recommended in current NRC guidance to licensees, the revised model is less biased and shows more predictive skill. The revised model is also compared with two non-Gaussian models developed to estimate maximum concentrations in building wakes. The revised model concentration predictions are nearly the same as the predictions of the non-Gaussian models. On the basis of these comparisons of the revised model concentration predictions with experimental data and the predictions of other models, the revised model is found to be an appropriate model for estimating concentrations in the vicinity of buildings

  10. Perceções dos(as) psicoterapeutas sobre a influência dos estereótipos de género e das relações íntimas, heterossexuais e não-heterossexuais, nas vivências da disfunção erétil

    OpenAIRE

    Cunha, Catarina Gradíssimo Dias da

    2012-01-01

    Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia Clínica) Esta dissertação constitui-se como um estudo exploratório e descritivo da perceção que os/as psicoterapeutas, com experiência de acompanhamento de casos de Disfunção Erétil, têm acerca do impacto que os estereótipos de género e o funcionamento das relações íntimas têm nas vivências desta disfunção. Para tal, realizaram-se entrevistas semiestruturadas a 9 psicoterapeutas (psicólogos/as...

  11. Modeling the Potential Distribution of Picea chihuahuana Martínez, an Endangered Species at the Sierra Madre Occidental, Mexico

    Directory of Open Access Journals (Sweden)

    Victor Aguilar-Soto

    2015-03-01

    Full Text Available Species distribution models (SDMs help identify areas for the development of populations or communities to prevent extinctions, especially in the face of the global environmental change. This study modeled the potential distribution of the tree Picea chihuahuana Martínez, a species in danger of extinction, using the maximum entropy modeling method (MaxEnt at three scales: local, state and national. We used a total of 38 presence data from the Sierra Madre Occidental. At the local scale, we compared MaxEnt with the reclassification and overlay method integrated in a geographic information system. MaxEnt generated maps with a high predictive capability (AUC > 0.97. The distribution of P. chihuahuana is defined by vegetation type and minimum temperature at national and state scales. At the local scale, both models calculated similar areas for the potential distribution of the species; the variables that better defined the species distribution were vegetation type, aspect and distance to water flows. Populations of P. chihuahuana have always been small, but our results show potential habitat greater than the area of the actual distribution. These results provide an insight into the availability of areas suitable for the species’ regeneration, possibly through assisted colonization.

  12. Toma de decisiones y actitudes emprendedoras en estudiantes del 5° grado de secundaria de la Institución Educativa 2015” Pública José Jiménez Borja – Cercado de Lima

    OpenAIRE

    Riva Novoa, Ronal

    2015-01-01

    Es una investigación descriptiva correlacional, orientada a estudiar la relación entre toma de decisión y la actitud emprendedora estudiantes del 5° grado de secundaria de la Institución Educativa Pública José Jiménez Borja del Cercado de Lima, Se seleccionó una población de 80 estudiantes de ambos sexos del 5° año de educación secundaria. A dicha población se les aplicó Cuestionario para evaluar la aptitud en la Toma de Decisiones, el cuestionario fue elaborado por Jonifer Benitez (2011) ...

  13. Ground water geochemistry in the vicinity of the Jabiluka deposits

    International Nuclear Information System (INIS)

    Deutscher, R.L.; Mann, A.W.; Giblin, A.

    1980-01-01

    Seventeen exploration drill holes in the vicinity of the Jabiluka One and Jabiluka Two deposits were logged for Eh-pH and conductivity at 5 metre intervals to depths of up to 195 metres below ground surface. Forty-seven water samples from exploration drill holes, augered holes on the Magela flood plain and from two billabongs in the vicinity of the deposits were collected and analyzed. Analyses for pH and Fe were conducted in the field, and further analyses for major ions Ca 2+ , Mg 2+ , Na + , K + , SO 4 2- , Cl - , HCO 3 - and Si and minorelements Zn, Cd, Pb, Cu and U were conducted in the laboratory. The in situ Eh-pH and conductivity measurements, and analyses for major and minor elements of ground waters suggest that deep-lying chlorite-graphite schists containing the uranium mineralization are well protected from, or do not react rapidly with, ground water under present-day conditions, i.e. the schists of the Cahill Formation are a stable host for uranium mineralization at depth. In the vicinity of the Magela flood plain where the Cahill Formation and the permanent water table are close to the surface, some samples were found to contain high concentrations of sulphate, zinc, lead and iron. These same samples were characterized by low pH's in the pH range 3.0-4.0. The anomalies suggest weathering of sulphides associated with the mineralized Cahill Formation, where the schists are at shallow depths and in an oxidizing environment. The anomalies are not, however, necessarily indicative of zones of uranium enrichment in this formation. (author)

  14. Faint nebulosities in the vicinity of the Magellanic H I Stream

    International Nuclear Information System (INIS)

    Johnson, P.G.; Meaburn, J.; Osman, A.M.I.

    1982-01-01

    Very deep Hα image tube photographs with a wide-field filter camera have been taken of the Magellanic H I Stream. A diffuse region of emission has been detected. Furthermore a mosaic of high contrast prints of IIIaJ survey plates taken with the SRC Schmidt, has been compiled over the same area. A complex region of faint, blue, filamentary nebulosity has been revealed. This appears to be reflection nebulosity either in the galactic plane or less probably, in the vicinity of the Large Magellanic Cloud. A deep Hα 1.2-m Schmidt photograph of these blue filaments reinforces the suggestion that they are reflection nebulae. The reflection and emission nebulosities in this vicinity have been compared to each other and the Magellanic H I Stream. The diffuse region of Hα emission is particularly well correlated with the Stream. (author)

  15. Finding and evaluating potential radiological problems in the vicinity of uranium milling sites

    International Nuclear Information System (INIS)

    Goldsmith, W.A.; Yates, W.G.

    1982-01-01

    Tailings at inactive milling sites usually have a low frequency of human occupancy but continuously generate 222 Rn into the atmosphere. Measurements of airborne 222 Rn and 222 Rn flux are made on the sites to define the tailings source term. Concurrently with these measurements, an ambient 222 Rn monitoring network is established off-site and a meteolrololgical station is established at or near the mill site. Radioactivity can migrate to areas outside of site boundaries by wind and water erosion, groundwater transport, spillage of incoming purposes. In order to identify and assess off-site radioactivity on properties in the vicinity of milling sites, a combination of aerial and ground-level radiological monitoring techniques are used. The ground mobile gamma-ray scan is conducted using a vehicle equipped with sensitive gamma-ray detectors. The detectors are shielded so that gamma radiation input is viewed through only one side of the vehicle. This system is capable of precisely locating properties which have anomalously high gamma radiation levels caused by the presence of tailings. Subsequently, these properties are identified as candidate vicinity properties and are scheduled for radiological surveys subject to the property owner's consent. The comprehensive radiological surveys conducted at these vicinity properties determine the amount, type, and location of tailings materials. Structures on a vicinity property are carefully surveyed to determine the presence or absence of construction-related uses of tailings. If structural uses of tailings are found, air samples are analyzed for 222 Rn progeny, short-term continuous 222 Rn monitoring is instituted, and 222 Rn flux rate from tailings are estimated. If warranted, long-term 222 Rn and progeny measurements are made

  16. NORM in the vicinity of the thermal power plant 'Nikola Tesla' B - experimental results

    International Nuclear Information System (INIS)

    Kisic, D.; Veselinovic, N.; Tokonami, S.; Celikovic, I.; Stojanovic, Z.; Cuknic, O.; Nemcevic, M.; Simovic, R.; Zunic, Z. S.

    2009-01-01

    The paper deals with the results related to identification of ionizing radiation from natural sources (NORM - Naturally Occurring Radioactive Materials) in the vicinity of the fly ash deposit of Thermal Power Plant 'Nikola Tesla B' (TENT B). The survey included such as follows: determination of distribution of naturally soil occurring gases radon ( 222 Rn) and thoron ( 220 Tn) in the vicinity of TENT B by means of passive discriminative solid state nuclear track detectors (CR 39) at the depth of 80 cm with defining its appropriate GPS coordinates. (author) [sr

  17. 17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.

    CERN Multimedia

    Pantelia, Anna

    2014-01-01

    17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.

  18. Effect of the Pulmonary Embolism Rule-Out Criteria on Subsequent Thromboembolic Events Among Low-Risk Emergency Department Patients: The PROPER Randomized Clinical Trial.

    Science.gov (United States)

    Freund, Yonathan; Cachanado, Marine; Aubry, Adeline; Orsini, Charlotte; Raynal, Pierre-Alexis; Féral-Pierssens, Anne-Laure; Charpentier, Sandrine; Dumas, Florence; Baarir, Nacera; Truchot, Jennifer; Desmettre, Thibaut; Tazarourte, Karim; Beaune, Sebastien; Leleu, Agathe; Khellaf, Mehdi; Wargon, Mathias; Bloom, Ben; Rousseau, Alexandra; Simon, Tabassome; Riou, Bruno

    2018-02-13

    The safety of the pulmonary embolism rule-out criteria (PERC), an 8-item block of clinical criteria aimed at ruling out pulmonary embolism (PE), has not been assessed in a randomized clinical trial. To prospectively validate the safety of a PERC-based strategy to rule out PE. A crossover cluster-randomized clinical noninferiority trial in 14 emergency departments in France. Patients with a low gestalt clinical probability of PE were included from August 2015 to September 2016, and followed up until December 2016. Each center was randomized for the sequence of intervention periods. In the PERC period, the diagnosis of PE was excluded with no further testing if all 8 items of the PERC rule were negative. The primary end point was the occurrence of a thromboembolic event during the 3-month follow-up period that was not initially diagnosed. The noninferiority margin was set at 1.5%. Secondary end points included the rate of computed tomographic pulmonary angiography (CTPA), median length of stay in the emergency department, and rate of hospital admission. Among 1916 patients who were cluster-randomized (mean age 44 years, 980 [51%] women), 962 were assigned to the PERC group and 954 were assigned to the control group. A total of 1749 patients completed the trial. A PE was diagnosed at initial presentation in 26 patients in the control group (2.7%) vs 14 (1.5%) in the PERC group (difference, 1.3% [95% CI, -0.1% to 2.7%]; P = .052). One PE (0.1%) was diagnosed during follow-up in the PERC group vs none in the control group (difference, 0.1% [95% CI, -∞ to 0.8%]). The proportion of patients undergoing CTPA in the PERC group vs control group was 13% vs 23% (difference, -10% [95% CI, -13% to -6%]; P < .001). In the PERC group, rates were significantly reduced for the median length of emergency department stay (mean reduction, 36 minutes [95% CI, 4 to 68]) and hospital admission (difference, 3.3% [95% CI, 0.1% to 6.6%]). Among very low-risk patients with suspected

  19. La Economía Política y las Motivaciones de Participación Socio-Política de Jóvenes Chilenos: Una Interpretación de los Hallazgos de Martínez, Silva y Hernández (2010 Political Economy and Youth Motivations of Socio-Political Participation: An Interpretation of the Findings From Martínez, Silva and Hernández (2010

    Directory of Open Access Journals (Sweden)

    Eduardo Silva

    2010-11-01

    Full Text Available El artículo de Martínez, Silva y Hernández (en este número argumenta que los jóvenes chilenos se han distanciado de la participación sociopolítica convencional, porque perciben una falta de validación de las personas en el sistema sociopolítico actual, debido a la vulneración de derechos, inequidad social y falta de voz y poder de los ciudadanos. Esto choca con sus valores de fraternidad y desarrollo justo y digno de las personas. En este ensayo se examina si ese sentir tiene fundamentos reales en la estructura y lógica del modelo político-económico que ellos critican. Se aborda el tema desde el marco analítico de la economía política, que parte del supuesto de que las estructuras económicas y políticas determinan sujetos sociales, sus intereses y su poder relativo. Se encontró una asociación directa entre la lógica del modelo político-económico y los sentimientos de exclusión que expresaron los entrevistados.The article by Martínez, Silva, and Hernández (in this issue argues that Chilean youth have disengaged from participation in conventional socio-political institutions because they believe that the sociopolitical system does not validate the persons, violates their rights, is highly inequitable, and excludes them from having a real voice in public decision-making. This perception clashes with their values of fraternity and a just and dignified development for everyone. This essay examines if these beliefs have a real basis in the structure and logic of the economic and political model they criticize. This issue is analyzed from a political economy perspective, built on the assumption that economic and political structures determine social subjects, their interests, and their relative power. A direct association was found between the logic of Chile's political-economic model and the feelings of exclusion that the interviewees expressed.

  20. Geologic history of the Slick Rock district and vicinity, San Miguel and Dolores Counties, Colorado

    International Nuclear Information System (INIS)

    Shawe, D.R.

    1976-01-01

    This report is a narrative summary and interpretation, in the form of a geologic history of the Slick Rock district and vicinity, of four previously published chapters in this series dealing with stratigraphy of the Slick Rock district and vicinity, petrography of sedimentary rocks of the district, structure of the district and vicinity, and altered sedimentary rocks of the district, and of other previously published reports on the district. It forms the background, with the earlier reports, for presentation of a final report in the series describing the uranium-vanadium ore deposits. A review of the origin of sedimentary rocks and geologic history of the region indicates that formation of uranium-vanadium deposits was a natural result of the deposition of th rocks, the occurrence of intrastratal waters therein, and the post-depositional movement of the waters resulting from evolution of the sedimentary rock environment. 31 refs

  1. Electromagnetic fields in the vicinity of DECT cordless telephones and mobile phones

    Directory of Open Access Journals (Sweden)

    Paweł Mamrot

    2015-12-01

    Full Text Available Background: Mobile telephones belong to the most frequently used personal devices. In their surroundings they produce the electromagnetic field (EMF, in which exposure range there are not only users but also nearby bystanders. The aim of the investigations and EMF measurements in the vicinity of phones was to identify the electric field levels with regard to various working modes. Material and methods: Twelve sets of DECT (digital enhanced cordless telecommunications cordless phones (12 base units and 15 handsets, 21 mobile telephones produced by different manufactures, and 16 smartphones in various applications, (including multimedia in the conditions of daily use in living rooms were measured. Measurements were taken using the point method in predetermined distances of 0.05–1 m from the devices without the presence of users. Results: In the vicinity of DECT cordless phone handsets, electric field strength ranged from 0.26 to 2.30 V/m in the distance of 0.05 m – 0.18–0.26 V/m (1 m. In surroundings of DECT cordless telephones base units the values of EMF were from 1.78–5.44 V/m (0.05 m to 0.19– 0.41 V/m (1 m. In the vicinity of mobile phones working in GSM mode with voice transmission, the electric field strength ranged from 2.34–9.14 V/m (0.05 m to 0.18–0.47 V/m (1 m while in the vicinity of mobile phones working in WCDMA (Wideband Code Division Multiple Access mode the electric field strength ranged from 0.22–1.83 V/m (0.05 m to 0.18–0.20 V/m (1 m. Conclusions: The mean values of the electric field strength for each group of devices, mobile phones and DECT wireless phones sets do not exceed the reference value of 7 V/m, adopted as the limit for general public exposure. Med Pr 2015;66(6:803–814

  2. [Electromagnetic fields in the vicinity of DECT cordless telephones and mobile phones].

    Science.gov (United States)

    Mamrot, Paweł; Mariańska, Magda; Aniołczyk, Halina; Politański, Piotr

    2015-01-01

    Mobile telephones belong to the most frequently used personal devices. In their surroundings they produce the electromagnetic field (EMF), in which exposure range there are not only users but also nearby bystanders. The aim of the investigations and EMF measurements in the vicinity of phones was to identify the electric field levels with regard to various working modes. Twelve sets of DECT (digital enhanced cordless telecommunications) cordless phones (12 base units and 15 handsets), 21 mobile telephones produced by different manufactures, and 16 smartphones in various applications, (including multimedia) in the conditions of daily use in living rooms were measured. Measurements were taken using the point method in predetermined distances of 0.05-1 m from the devices without the presence of users. In the vicinity of DECT cordless phone handsets, electric field strength ranged from 0.26 to 2.30 V/m in the distance of 0.05 m - 0.18-0.26 V/m (1 m). In surroundings of DECT cordless telephones base units the values of EMF were from 1.78-5.44 V/m (0.05 m) to 0.19- 0.41 V/m (1 m). In the vicinity of mobile phones working in GSM mode with voice transmission, the electric field strength ranged from 2.34-9.14 V/m (0.05 m) to 0.18-0.47 V/m (1 m) while in the vicinity of mobile phones working in WCDMA (Wideband Code Division Multiple Access) mode the electric field strength ranged from 0.22-1.83 V/m (0.05 m) to 0.18-0.20 V/m (1 m). The mean values of the electric field strength for each group of devices, mobile phones and DECT wireless phones sets do not exceed the reference value of 7 V/m, adopted as the limit for general public exposure. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.

  3. Series Resistance Analysis of Passivated Emitter Rear Contact Cells Patterned Using Inkjet Printing

    Directory of Open Access Journals (Sweden)

    Martha A. T. Lenio

    2012-01-01

    Full Text Available For higher-efficiency solar cell structures, such as the Passivated Emitter Rear Contact (PERC cells, to be fabricated in a manufacturing environment, potentially low-cost techniques such as inkjet printing and metal plating are desirable. A common problem that is experienced when fabricating PERC cells is low fill factors due to high series resistance. This paper identifies and attempts to quantify sources of series resistance in inkjet-patterned PERC cells that employ electroless or light-induced nickel-plating techniques followed by copper light-induced plating. Photoluminescence imaging is used to determine locations of series resistance losses in these inkjet-patterned and plated PERC cells.

  4. A real-time crash prediction model for the ramp vicinities of urban expressways

    Directory of Open Access Journals (Sweden)

    Moinul Hossain

    2013-07-01

    Full Text Available Ramp vicinities are arguably the known black-spots on urban expressways. There, while maintaining high speed, drivers need to respond to several complex events such as maneuvering, reading road signs, route planning and maintaining safe distance from other maneuvering vehicles simultaneously which demand higher level of cognitive response to ensure safety. Therefore, any additional discomfort caused by traffic dynamics may induce driving error resulting in a crash. This manuscript presents a methodology for identifying these dynamically forming hazardous traffic conditions near the ramp vicinities with high resolution real-time traffic flow data. It separates the ramp vicinities into four zones – upstream and downstream of entrance and exit ramps, and builds four separate real-time crash prediction models. Around two year (December 2007 to October 2009 crash data as well as their matching traffic sensor data from Shibuya 3 and Shinjuku 4 expressways under the jurisdiction of Tokyo Metropolitan Expressway Company Limited have been utilized for this research. Random multinomial logit, a forest of multinomial logit models, has been used to identify the most important variables. Finally, a real-time modeling method, Bayesian belief net (BBN, has been employed to build the four models using ramp flow, flow and congestion index in the upstream and flow and speed in the downstream of the ramp location as variables. The newly proposed models could predict 50%, 42%, 43% and 55% of the future crashes with around 10% false alarm for the downstream of entrance, downstream of exit, upstream of entrance and upstream of exit ramps respectively. The models can be utilized in combination with various traffic smoothing measures such as ramp metering, variable speed limit, warning messages through variable message signs, etc. to enhance safety near the ramp vicinities.

  5. Improving couples' quality of life through a Web-based prostate cancer education intervention.

    Science.gov (United States)

    Song, Lixin; Rini, Christine; Deal, Allison M; Nielsen, Matthew E; Chang, Hao; Kinneer, Patty; Teal, Randall; Johnson, David C; Dunn, Mary W; Mark, Barbara; Palmer, Mary H

    2015-03-01

    To evaluate the feasibility and acceptability of a newly developed web-based, couple-oriented intervention called Prostate Cancer Education and Resources for Couples (PERC). Quantitative, qualitative, mixed-methods approach. Oncology outpatient clinics at the University of North Carolina (UNC) Lineberger Comprehensive Cancer Center at UNC–Chapel Hill. 26 patients with localized prostate cancer (PCa) and their partners. Pre- and postpilot quantitative assessments and a postpilot qualitative interview were conducted. General and PCa-specific symptoms, quality of life, psychosocial factors, PERC’s ease of use, and web activities. Improvement was shown in some PCa-specific and general symptoms (small effect sizes for patients and small-to-medium effect sizes for partners), overall quality of life, and physical and social domains of quality of life for patients (small effect sizes). Web activity data indicated high PERC use. Qualitative and quantitative analyses indicated that participants found PERC easy to use and understand,as well as engaging, of high quality, and relevant. Overall, participants were satisfied with PERC and reported that PERC improved their knowledge about symptom management and communication as a couple. PERC was a feasible, acceptable method of reducing the side effects of PCa treatment–related symptoms and improving quality of life. PERC has the potential to reduce the negative impacts of symptoms and enhance quality of life for patients with localized PCa and their partners, particularly for those who live in rural areas and have limited access to post-treatment supportive care.

  6. Características tecnológicas de la madera de palo morado (Peltogyne mexicana Martínez de tierra colorada, Guerrero, México

    Directory of Open Access Journals (Sweden)

    J. Navarro-Martínez

    2005-01-01

    Full Text Available El presente trabajo contribuye al conocimiento de las características y propiedades tecnológicas de la madera de Palo morado (Peltogyne mexicana Martínez, mediante la caracterización anatómica, porcentaje de elementos y determinación de las propiedades físicas y tres mecánicas. Se colectaron dos árboles en Tierra Colorada Guerrero. El material se obtuvo de trozas a 1.30 m de altura. Para el estudio macroscópico se usaron muestras de 7 x 15 x 1 cm y para el microscópico se elaboraron preparaciones fijas de cortes y de material disociado. La madera presenta un color violeta intenso, porosidad difusa, parénquima en bandas y aliforme confluente con cristales, los elementos de vaso son cortos de diámetro medio, con inclusiones, rayos uniseriados, biseriados, triseriados y raramente multiseriados; las fibras son de tipo libriforme de longitud media, diámetro fino y pared gruesa, presenta densidad básica, contracciones y dureza alta.

  7. Nonradical Zinc-Barbier Reaction for Diastereoselective Synthesis of Vicinal Amino Alcohols

    DEFF Research Database (Denmark)

    Keinicke, Lise Edelmann; Fristrup, Peter; Norrby, Per-Ola

    2005-01-01

    A new protocol for the synthesis of vicinal amino alcohols is described. The method employs a Barbier-type reaction between an imine and 3-benzoyloxyallyl bromide in the presence of zinc metal. The addition products are debenzoylated to afford amino alcohols in good yields and with diastereomeric...

  8. Study of GRBs Hosts Galaxies Vicinity Properties

    Science.gov (United States)

    Bernal, S.; Vasquez, N.; Hoyle, F.

    2017-07-01

    The study of GRBs host galaxies and its vicinity could provide constrains on the progenitor and an opportunity to use these violent explosions to characterize the nature of the highredshift universe. Studies of GRB host galaxies reveal a population of starforming galaxies with great diversity, spanning a wide range of masses, star formation rate, and redshifts. In order to study the galactic ambient of GRBs we used the S. Savaglio catalog from 2015 where 245 GRBs are listed with RA-Dec position and z. We choose 22 GRBs Hosts galaxies from Savaglio catalog and SDSS DR12, with z range 0population characteristics. We calculate the volumetric density populatation of glalaxies around the GRB Hosts within a volume of an sphere whit radius of 10 h-1 Mpc and find a low density compared with a typical group of galaxies. In order to know the galaxies stellar formation state, in regions where GRBs are formed, we made an analysis of color index using SDSS data of μ [λ 3543], r[λ 6231] and calculate the indexes μ-r. We find a value μ-r=2.63, it means that the galactic ambient of GRBs Host regions are statistically redder than void and wall regions on a indirect way (Voids:μ-r=2.043; Walls:μ-r=2.162). Futhermore, we used a inverse concentration index analysis, ICI=R50/R90 and find that galaxies in GRBs Hosts vicinity are also of slightly early type than void and wall galaxies. With this work we provide characteristics on the regions for future works related with highredsift universe that using the GRBs.

  9. Linewidths and line shapes in the vicinity of graphene

    International Nuclear Information System (INIS)

    Bhattacharyya, Pallavi; Sebastian, K. L.

    2014-01-01

    It is well known that graphene, by virtue of its pi-cloud delocalization, has a continuum of electronic energy states and thus behaves nearly like a metal. Instances involving quenching of electronic energy excitation in fluorophores placed in the proximity of graphene sheets are well documented. In this paper, we perform theoretical investigations on the broadening of vibrational and electronic transitions in the vicinity of graphene. We find that for CO vibrations in the vicinity of undoped graphene, the broadening at a distance of 5 Å is ∼0.008 cm −1 (κ ~ =2, κ ~ being the effective dielectric constant). In comparison, for electronic transitions, the linewidth is much larger, being of the order of several cm −1 . Also, if the transition dipole were parallel to the graphene sheet, the linewidth would be reduced to half the value for the case where it is perpendicular, an observation which should be easy to check experimentally for electronic transitions. This should be observable for the f − f transitions (which are rather narrow) of Lanthanide complexes placed within a distance of a few nanometers from a graphene sheet. Further the linewidth would have a (distance) −4 dependence as one varies the distance from graphene

  10. 1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

    CERN Multimedia

    Pantelia, Anna

    2014-01-01

    1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

  11. Assessment of Indoor Radon (222Rn) Concentrations in the Vicinity of

    African Journals Online (AJOL)

    MLAY

    ABSTRACT. This study aimed to assess indoor radon concentrations in the vicinity of the Manyoni Uranium ... risk of lung cancer proportionally to the ... deposit, power plant, industrial radiation, etc. ... in foundations, walls, hollow concrete .... (AlphaGUARD User Manual 2007). ... used as control are presented in Table 4. The.

  12. A Origem dos Maus-Tratos: Revisão Sobre a Evolução Histórica das Perceções de Criança e Maus-Tratos

    Directory of Open Access Journals (Sweden)

    Raquel V. Oliveira

    2014-03-01

    Full Text Available ObjetivoNeste trabalho elabora-se, com base em revisão bibliográfica, a evolução histórica das perceções acerca de maus-tratos e de criança. Começa-se por abordar o constructo de maus-tratos, passando seguidamente pela Antiguidade e Idade Média, onde as crianças eram sujeitas a constantes maus-tratos, sendo prevalentes os maus-tratos físicos, abuso sexual e o trabalho infantil, progredindo até à Idade Moderna, onde a criança passa a ser vista como um ser com características particulares e merecedor de cuidados especiais. Aborda-se de forma breve as tipologias de maus-tratos na atualidade e as variações culturais.ConclusãoTorna-se fulcral compreender o impacto que os maus-tratos têm vindo ao longo da histórico e que continuam a ter na atualidade, sendo fundamental a considerar estes aspetos nas intervenções a serem desenvolvidas nesta área, tendo em particular consideração o amplo leque de variações culturais cada vez mais presentes e evidentes.

  13. Properties of Soils and Plants Uptake within the Vicinity of Selected ...

    African Journals Online (AJOL)

    Backyard farming is becoming popular among the auto mechanics near their workshops where spent engine oil and carcass of vehicles are continuously dumped in Nigeria. The properties of soil and maize plants sampled from the vicinity of selected auto mechanic workshops in Ile-Ife, Nigeria were investigated. The results ...

  14. Habitat Evaluation Procedures (HEP) Report; Precious Lands Wildlife Management Area, Technical Report 2000-2003.

    Energy Technology Data Exchange (ETDEWEB)

    Kozusko, Shana

    2003-12-01

    The Nez Perce Tribe (NPT) currently manages a 15,325 acre parcel of land known as the Precious Lands Wildlife Management Area that was purchased as mitigation for losses incurred by construction of the four lower Snake River dams. The Management Area is located in northern Wallowa County, Oregon and southern Asotin County, Washington (Figure 1). It is divided into three management parcels--the Buford parcel is located on Buford Creek and straddles the WA-OR state line, and the Tamarack and Basin parcels are contiguous to each other and located between the Joseph Creek and Cottonwood Creek drainages in Wallowa County, OR. The project was developed under the Pacific Northwest Electric Power Planning and Conservation Act of 1980 (P.L. 96-501), with funding from the Bonneville Power Administration (BPA). The acreage protected under this contract will be credited to BPA as habitat permanently dedicated to wildlife and wildlife mitigation. A modeling strategy known as Habitat Evaluation Procedure (HEP) was developed by the U.S. Fish and Wildlife Service and adopted by BPA as a habitat equivalency accounting system. Nine wildlife species models were used to evaluate distinct cover type features and provide a measure of habitat quality. Models measure a wide range of life requisite variables for each species and monitor overall trends in vegetation community health and diversity. One product of HEP is an evaluation of habitat quality expressed in Habitat Units (HUs). This HU accounting system is used to determine the amount of credit BPA receives for mitigation lands. After construction of the four lower Snake River dams, a HEP loss assessment was conducted to determine how many Habitat Units were inundated behind the dams. Twelve target species were used in that evaluation: Canada goose, mallard, river otter, downy woodpecker, song sparrow, yellow warbler, marsh wren, western meadowlark, chukar, ring-necked pheasant, California quail, and mule deer. The U.S. Army Corp of

  15. 78 FR 19985 - Modification of VOR Federal Airways V-68, V-76, V-194, and V-548 in the Vicinity of Houston, TX

    Science.gov (United States)

    2013-04-03

    ..., and V-548 in the Vicinity of Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... airways V-68, V-76, V-194, and V-548 in the vicinity of Houston, TX. The FAA is taking this action to... vicinity of Houston, TX. Specifically, the FAA amends V-68 and V-76 to reflect the Hobby VOR/DME 289[deg...

  16. Air quality assessment in the vicinity of nuclear and thermal power stations

    International Nuclear Information System (INIS)

    Sivaramasundaram, K.; Vijay Bhaskar, B.; Muthusubramanian, P.; Rajan, M.P.; Hegde, A.G.

    2007-01-01

    The status and ranking of any country, in the context of globalisation, is decided by its economic progress, which is directly linked into power generation. The power is generated by many routes and the nuclear and thermal routes are noteworthy among them. As the power production and its associated activities may cause qualitative deterioration, it is essential to study the impact of power production on atmospheric environment. In this connection, a comparative study has been carried out to assess the air quality with special reference to criteria pollutants in the vicinity of nuclear and thermal power stations. In the present investigation, the air samples are collected on weekly basis and the pollutants such as sulphur dioxide (SO 2 ), nitrogen oxides (NOx), carbon monoxide (CO), suspended particulate matter (SPM) and respirable particulate matter (RPM) are estimated by adopting standard procedures set by United States-Environmental Protection Agency (US-EPA) and Central Pollution Control Board (CPCB). As the micro meteorological parameters influence on the status of air quality, simultaneous measurements of these parameters are also carried, out during sampling. It is studied that estimated concentrations of all criteria pollutants in the vicinity of these power stations are within the permissible limits set by CPCB. On the basis of the generated database pertaining to the concentrations of criteria air pollutants in the vicinity of nuclear and thermal power stations, it is concluded that nuclear power production may be considered as a viable option in terms of environmental protection in our country. (author)

  17. Effect of the roughening transition on the vicinal surface in the step droplet zone

    Science.gov (United States)

    Akutsu, Noriko

    2017-06-01

    For vicinal surfaces around the (001) surface inclined towards the 〈 111 〉 direction, the influence of roughening transitions on the surface tension and on step droplets is studied numerically. The surface tension is calculated using a restricted solid-on-solid model with a point-contact type step-step attraction (p-RSOS model) on a square lattice. To ensure the reliability of the calculations, the density matrix renormalization group method is used. The growth rate of the vicinal surface near equilibrium is also calculated by the Monte Carlo method. It is found that the roughening transition changes the morphology around the (001) surface, and the roughening transition affects the size of locally merged steps (step droplets).

  18. The typical seismic behavior in the vicinity of a large earthquake

    Science.gov (United States)

    Rodkin, M. V.; Tikhonov, I. N.

    2016-10-01

    The Global Centroid Moment Tensor catalog (GCMT) was used to construct the spatio-temporal generalized vicinity of a large earthquake (GVLE) and to investigate the behavior of seismicity in GVLE. The vicinity is made of earthquakes falling into the zone of influence of a large number (100, 300, or 1000) of largest earthquakes. The GVLE construction aims at enlarging the available statistics, diminishing a strong random component, and revealing typical features of pre- and post-shock seismic activity in more detail. As a result of the GVLE construction, the character of fore- and aftershock cascades was examined in more detail than was possible without of the use of the GVLE approach. As well, several anomalies in the behavior exhibited by a variety of earthquake parameters were identified. The amplitudes of all these anomalies increase with the approaching time of the generalized large earthquake (GLE) as the logarithm of the time interval from the GLE occurrence. Most of the discussed anomalies agree with common features well expected in the evolution of instability. In addition to these common type precursors, one earthquake-specific precursor was found. The decrease in mean earthquake depth presumably occurring in a smaller GVLE probably provides evidence of a deep fluid being involved in the process. The typical features in the evolution of shear instability as revealed in GVLE agree with results obtained in laboratory studies of acoustic emission (AE). The majority of the anomalies in earthquake parameters appear to have a secondary character, largely connected with an increase in mean magnitude and decreasing fraction of moderate size events (mw5.0-6.0) in the immediate GLE vicinity. This deficit of moderate size events could hardly be caused entirely by their incomplete reporting and can presumably reflect some features in the evolution of seismic instability.

  19. In-beam γ-ray spectroscopy in the vicinity of 100Sn

    International Nuclear Information System (INIS)

    Seweryniak, D.

    1998-01-01

    In recent years, in-beam x-ray experiments supplied a vast amount of data on high-spin states in nuclei in the vicinity of 100 Sn. The present contribution reviews spectroscopic information obtained recently for N ≥ 50 nuclei around 100 Sn, with emphasis on isomer studies, and discusses selected results in the frame of the shell model

  20. Leukemia-related mortality in towns lying in the vicinity of metal production and processing installations.

    Science.gov (United States)

    García-Pérez, Javier; López-Cima, María Felicitas; Boldo, Elena; Fernández-Navarro, Pablo; Aragonés, Nuria; Pollán, Marina; Pérez-Gómez, Beatriz; López-Abente, Gonzalo

    2010-10-01

    Releases to the environment of toxic substances stemming from industrial metal production and processing installations can pose a health problem to populations in their vicinity. To investigate whether there might be excess leukemia-related mortality in populations residing in towns in the vicinity of Spanish metal industries included in the European Pollutant Emission Register. Ecologic study designed to examine mortality due to leukemia at a municipal level, during the period 1994-2003. Population exposure to pollution was estimated on the basis of distance from town of residence to pollution source. Using Poisson regression models, we analyzed: risk of dying from leukemia in a 5-kilometer zone around installations which had become operational prior to 1990; effect of pollution discharge route and type of industrial activity; and risk gradient within a 50-kilometer radius of such installations. Excess mortality (relative risk, 95% confidence interval) was detected in the vicinity of pre-1990 installations (1.07, 1.02-1.13 in men; 1.05, 1.00-1.11 in women), with this being more elevated in the case of installations that released pollution to air versus water. On stratifying by type of industrial activity, statistically significant associations were also observed among women residing in the vicinity of galvanizing installations (1.58, 1.09-2.29) and surface-treatment installations using an electrolytic or chemical process (1.34, 1.10-1.62), which released pollution to air. There was an effect whereby risk increased with proximity to certain installations. The results suggest an association between risk of dying due to leukemia and proximity to Spanish metal industries. Copyright 2010 Elsevier Ltd. All rights reserved.

  1. Cellular renewal and improvement of local cell effector activity in peritoneal cavity in response to infectious stimuli.

    Directory of Open Access Journals (Sweden)

    Alexandra dos Anjos Cassado

    Full Text Available The peritoneal cavity (PerC is a singular compartment where many cell populations reside and interact. Despite the widely adopted experimental approach of intraperitoneal (i.p. inoculation, little is known about the behavior of the different cell populations within the PerC. To evaluate the dynamics of peritoneal macrophage (MØ subsets, namely small peritoneal MØ (SPM and large peritoneal MØ (LPM, in response to infectious stimuli, C57BL/6 mice were injected i.p. with zymosan or Trypanosoma cruzi. These conditions resulted in the marked modification of the PerC myelo-monocytic compartment characterized by the disappearance of LPM and the accumulation of SPM and monocytes. In parallel, adherent cells isolated from stimulated PerC displayed reduced staining for β-galactosidase, a biomarker for senescence. Further, the adherent cells showed increased nitric oxide (NO and higher frequency of IL-12-producing cells in response to subsequent LPS and IFN-γ stimulation. Among myelo-monocytic cells, SPM rather than LPM or monocytes, appear to be the central effectors of the activated PerC; they display higher phagocytic activity and are the main source of IL-12. Thus, our data provide a first demonstration of the consequences of the dynamics between peritoneal MØ subpopulations by showing that substitution of LPM by a robust SPM and monocytes in response to infectious stimuli greatly improves PerC effector activity.

  2. Pablo Rodríguez Jiménez. Cartas de Amor en tiempos de guerra. Rafael Uribe Uribe. Selección de textos y prólogo. Bogotá: Editorial Universidad del Rosario, Escuela de Ciencias Humanas, 2014. 256 páginas

    OpenAIRE

    Eulalia Hernández Ciro

    2015-01-01

    Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprens...

  3. La conformación de la provincia jesuítica de Toledo en torno al generalato de Diego Laínez 1556-1565

    Directory of Open Access Journals (Sweden)

    Martín López, David

    2014-12-01

    Full Text Available The newest Jesuits soon began incardinated in the Iberian territory, home of its founder. As one of the most important territories of Catholic Christianity, soon saw the need to distribute what would soon become a large crown in a number of provinces for a more effective government and evangelization. After the first division, at the time of the Spanish general Lines were the final foundations of penta-provincialization between Portugal, Castile, Aragon, Andalusia and —novelty— Toledo.La novísima Compañía de Jesús empezó pronto a incardinarse en el territorio ibérico, patria de su fundador. Como uno de los territorios más importantes de la Cristiandad católica, pronto se vio la necesidad de distribuir lo que pronto sería una gran corona en una serie de provincias para unos más eficaces gobierno y evangelización. Después de una primera división, en la época del generalato del español Laínez se pusieron las bases de la pentaprovincialización definitiva entre Portugal, Castilla, Aragón, Bética y —la novedad— Toledo.

  4. Photonic density of states in the vicinity of a single-wall finite-length carbon nanotube

    International Nuclear Information System (INIS)

    Nemilentsau, A; Ya Slepyan, G; Maksimenko, S A

    2009-01-01

    Photonic density of states in the vicinity of a single-wall finite-length carbon nanotube (CNT) is investigated theoretically in this paper. The analysis is based on the fluctuation-dissipative theorem in the Callen-Welton form. The Dyson equation for the Green dyadic of the electromagnetic field in the presence of CNT is formulated and a method for its numerical solution is elaborated. We show that the photonic density of states spectrum has a nontrivial resonant structure in the terahertz range in the vicinity of the metallic single-wall CNT. The origin of these resonances is the surface plasmon resonances on the CNT's edges.

  5. Sugar Sweetened Beverage Consumption among Primary School Students: Influence of the Schools' Vicinity.

    Science.gov (United States)

    Lebel, Alexandre; Morin, Pascale; Robitaille, Éric; Lalonde, Benoit; Florina Fratu, Ramona; Bisset, Sherri

    2016-01-01

    The purpose of the research was to explore the associations between the characteristics of schools' vicinity and the risk of sugar sweetened beverage (SSB) consumption in elementary students. Findings exposed an important variation in student's SSB consumption between schools. Schools with a lower socioeconomic status or in a densely built environment tend to have higher proportion of regular SSB drinkers. These characteristics of the school's vicinity partly explained the variation observed between them. We estimated that a student moving to a school with a higher proportion of SSB drinkers may increase his/her chances by 52% of becoming a daily consumer. Important changes in dietary preferences can occur when children are in contact with a new social environment. Findings also support the idea that dietary behaviors among children result from the complex interactions between biological, social, and environmental factors.

  6. Health state of population in vicinity of the Mochovce nuclear power plant. Epidemiologic study

    International Nuclear Information System (INIS)

    Celko, M.; Durov, M.; Letkovicova, M.; Holy, R.; Sedliak, D.; Zrubec, M.; Kristufek, P.; Machata, M.; Prikazsky, V.; Rehak, R.; Stehlikova, B.; Vladar, M.

    1999-01-01

    Results of epidemiologic study of health state of population in vicinity of the Mochovce nuclear power plant (Slovak Republic) are presented. This report is reported under the headings: (1) Introduction; (2) Basic information about Mochovce NPP; (3) Assessment of population exposition by environmental factors; (4) Basic conceptions and principles of epidemiologic study; (5) Demography and health state of population; (6) Characterisation of databases and data; (7) Description of demographic and health indicators; (8) Calculation of demographic and health indicators in vicinity of the Mochovce NPP and in control areas; (9) Calculated indicators; (10) Statistical methods and evaluation of calculated indicators; (11) Summary and conclusions; (12) References; Appendixes: Literature review of similar epidemiologic studies; Quantities and units in radiation protection; Definitions of indicators calculation - specification of method

  7. Práticas de colaboração para inclusão de alunos com Necessidades Educativas Especiais nas escolas portuguesas : Perceções de professores e Equipa técnico pedagógica/ Collaboration practices for inclusion of students with special educational needs

    Directory of Open Access Journals (Sweden)

    Raquel Batista de Oliveira

    2017-12-01

    Full Text Available Data de submissão: 30-10-2017 Data de Aceitação: 22-12-2017Este estudo insere-se na temática da inclusão de alunos com Necessidades Educativas Especiais (NEE nas escolas da Região Centro em Portugal Continental,  tendo como objetivo conhecer as perceções dos diferentes atores sobre as práticas inclusivas de alunos com Necessidades Educativas Especiais nas escolas portuguesas com base no Decreto-Lei 3/2008. Neste sentido, procedeu-se a entrevista semiestruturada direcionada para professores da Educação Especial, professores do Ensino Regular, equipa técnico pedagógica, utilizando a técnica análise de conteúdo para as análises dos dados onde pode-se obter alguns resultados. Os resultados desta investigação revelam que no que se refere as perceções dos diferentes atores educativos face à práticas de colaboração, que há alguma convergência nas respostas destes atores, no entanto, emergem algumas divergências nas respostas destes no que se refere a presença dos recursos humanos e materiais, bem como o seu reconhecimento face utilização destes recursos no espaço escolar. Os resultados também revelam que há diferentes respostas dos participantes face a perceção sobre as práticas de colaboração o que remete a necessidade de um maior fortalecimento entre as culturas de escola que visem o desenvolvimento coeso entre todos os agentes educativos no tocante às práticas de colaboração desenvolvidas neste espaço.Collaboration practices for inclusion of students with special educational needs in Portuguese schools: Teacher perceptions and pedagogical technical teamThis study expands upon the theme of inclusion of students with special needs educational (ENE in schools of the Região Centro in Portugal Continental. It aims to know different practitioners’ perceptions of inclusion practices of pupils with special needs educational in Portuguese schools based on the Decree-Law 3/2008. In this respect, semi

  8. Programmatic Environmental Report for remedial actions at UMTRA [Uranium Mill Tailings Remedial Action] Project vicinity properties

    International Nuclear Information System (INIS)

    1985-03-01

    This Environmental Report (ER) examines the environmental consequences of implementing a remedial action that would remove radioactive uranium mill tailings and associated contaminated materials from 394 vicinity properties near 14 inactive uranium processing sites included in the Uranium Mill Tailings Remedial Action (UMTRA) Project pursuant to Public Law 95--604, the Uranium Mill Tailings Radiation Control Act (UMTRCA) of 1978. Vicinity properties are those properties in the vicinity of the UMTRA Project inactive mill sites, either public or private, that are believed to be contaminated by residual radioactive material originating from one of the 14 inactive uranium processing sites, and which have been designated under Section 102(a)(1) of UMTRCA. The principal hazard associated with the contaminated properties results from the production of radon, a radioactive decay product of the radium contained in the tailings. Radon, a radioactive gas, can diffuse through the contaminated material and be released into the atmosphere where it and its radioactive decay products may be inhaled by humans. A second radiation exposure pathway results from the emission of gamma radiation from uranium decay products contained in the tailings. Gamma radiation emitted from contaminated material delivers an external exposure to the whole body. If the concentration of radon and its decay products is high enough and the exposure time long enough, or if the exposure to direct gamma radiation is long enough, cancers (i.e., excess health effects) may develop in persons living and working at the vicinity properties. 3 refs., 7 tabs

  9. Population distribution, food production and other aspects in the vicinity of the Embalse Nuclear Power Station

    International Nuclear Information System (INIS)

    Cancio, D.; Ciallella, N.R.; Zunino, R.; Perez, T.; Jordan, O.

    1978-01-01

    The paper presents some of the results of the pre-operational studies carried out in the vicinity of the site of the Embalse Nuclear Power Station, which is being built in the Province of Cordoba, Rio Tercero, next to the lake Embalse. The studies cover population distribution, food production, and other local aspects. The low population in the vicinity of the site increases in summer due to tourism. Main use of the land is grazing and cereal production. Milk production is small, but some is produced near the site. Other aspects of the study are presented in other papers of the Seminar. (author)

  10. Nuclear threats in the vicinity of the Nordic countries

    International Nuclear Information System (INIS)

    Eikelmann, I.M.H.; Moeller, B.

    1999-01-01

    This project is one of the new cross-disciplinary studies in the NKS (Nordic Nuclear Safety) research program 1998-2001. The main task for the project is to aggregate knowledge of nuclear threats in the vicinity of the Nordic countries, a 'base of knowledge', and make this available for the Nordic authorities as a supplement for the national emergency preparedness work. The project will focus on potential events in nuclear installations and the consequences for the Nordic countries especially on: vulnerable food chains; doses to man; environmental contamination; the emergency preparedness system. (au)

  11. Electric and magnetic field testing in vicinity of 110/x kV substations

    Directory of Open Access Journals (Sweden)

    Grbić Maja

    2016-01-01

    Full Text Available The levels of non-ionizing radiation (electric and magnetic fields at power frequency, which occur near 110/x kV substations are analyzed in this paper. The results of electric field strength and magnetic flux density measurements in the vicinity of three typical substations of the aforementioned voltage level are shown. With the purpose of estimating the exposure of the population to these fields, the obtained results were compared to the reference maximum levels set for increased sensitivity areas, which amount to 2 kV/m for electric field and 40 μT for magnetic flux density. The objective of the conducted analysis is to reach general conclusions on the levels of electric and magnetic fields, which may occur in the vicinity of the substations mentioned above, and evaluate their compliance with the national regulations on the population protection from non-ionizing radiation.

  12. Temperature dependence of magnetic anisotropies in ultrathin Fe film on vicinal Si(111)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yong-Sheng; He, Wei; Ye, Jun; Hu, Bo; Tang, Jin; Zhang, Xiang-Qun [State Key Laboratory of Magnetism and Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Cheng, Zhao-Hua, E-mail: zhcheng@aphy.iphy.ac.cn [State Key Laboratory of Magnetism and Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100190 (China)

    2017-05-01

    The temperature dependence of magnetic anisotropy of ultrathin Fe film with different thickness epitaxially grown on vicinal Si(111) substrate has been quantitatively investigated using the anisotropic magnetoresistance(AMR) measurements. Due to the effect of the vicinal substrate, the magnetic anisotropy is the superposition of a four-fold, a two-fold and a weakly six-fold contribution. It is found that the temperature dependence of the first-order magnetocrystalline anisotropies coefficient follows power laws of the reduced magnetization m(T)(=M(T)/M(0)) being consistent with the Callen and Callen's theory. However the temperature dependence of uniaxial magnetic anisotropy (UMA) shows novel behavior that decreases roughly as a function of temperature with different power law for samples with different thickness. We also found that the six-fold magnetocrystalline anisotropy is almost invariable over a wide temperature range. Possible mechanisms leading to the different exponents are discussed.

  13. Magnetostrictive hypersound generation by spiral magnets in the vicinity of magnetic field induced phase transition

    Energy Technology Data Exchange (ETDEWEB)

    Bychkov, Igor V. [Chelyabinsk State University, 129 Br. Kashirinykh Str., Chelyabinsk 454001 (Russian Federation); South Ural State University (National Research University), 76 Lenin Prospekt, Chelyabinsk 454080 (Russian Federation); Kuzmin, Dmitry A., E-mail: kuzminda@csu.ru [Chelyabinsk State University, 129 Br. Kashirinykh Str., Chelyabinsk 454001 (Russian Federation); South Ural State University (National Research University), 76 Lenin Prospekt, Chelyabinsk 454080 (Russian Federation); Kamantsev, Alexander P.; Koledov, Victor V.; Shavrov, Vladimir G. [Kotelnikov Institute of Radio-engineering and Electronics of RAS, Mokhovaya Street 11-7, Moscow 125009 (Russian Federation)

    2016-11-01

    In present work we have investigated magnetostrictive ultrasound generation by spiral magnets in the vicinity of magnetic field induced phase transition from spiral to collinear state. We found that such magnets may generate transverse sound waves with the wavelength equal to the spiral period. We have examined two types of spiral magnetic structures: with inhomogeneous exchange and Dzyaloshinskii–Moriya interactions. Frequency of the waves from exchange-caused spiral magnetic structure may reach some THz, while in case of Dzyaloshinskii–Moriya interaction-caused spiral it may reach some GHz. These waves will be emitted like a sound pulses. Amplitude of the waves is strictly depends on the phase transition speed. Some aspects of microwaves to hypersound transformation by spiral magnets in the vicinity of phase transition have been investigated as well. Results of the work may be interesting for investigation of phase transition kinetics as well, as for various hypersound applications. - Highlights: • Magnetostrictive ultrasound generation by spiral magnets at phase transition (PT) is studied. • Spiral magnets during PT may generate transverse sound with wavelength equal to spiral period. • Amplitude of the sound is strictly depends on the phase transition speed. • Microwave-to-sound transformation in the vicinity of PT is investigated as well.

  14. Experimental Results and Issues on Equalization for Nonlinear Memory Channel: Pre-Cursor Enhanced Ram-DFE Canceler

    Science.gov (United States)

    Yuan, Lu; LeBlanc, James

    1998-01-01

    This thesis investigates the effects of the High Power Amplifier (HPA) and the filters over a satellite or telemetry channel. The Volterra series expression is presented for the nonlinear channel with memory, and the algorithm is based on the finite-state machine model. A RAM-based algorithm operating on the receiver side, Pre-cursor Enhanced RAM-FSE Canceler (PERC) is developed. A high order modulation scheme , 16-QAM is used for simulation, the results show that PERC provides an efficient and reliable method to transmit data on the bandlimited nonlinear channel. The contribution of PERC algorithm is that it includes both pre-cursors and post-cursors as the RAM address lines, and suggests a new way to make decision on the pre-addresses. Compared with the RAM-DFE structure that only includes post- addresses, the BER versus Eb/NO performance of PERC is substantially enhanced. Experiments are performed for PERC algorithms with different parameters on AWGN channels, and the results are compared and analyzed. The investigation of this thesis includes software simulation and hardware verification. Hardware is setup to collect actual TWT data. Simulation on both the software-generated data and the real-world data are performed. Practical limitations are considered for the hardware collected data. Simulation results verified the reliability of the PERC algorithm. This work was conducted at NMSU in the Center for Space Telemetering and Telecommunications Systems in the Klipsch School of Electrical and Computer Engineering Department.

  15. A Interface e as suas dimensões na perceção de credibilidade e confiança na e-Health. Proposta de uma estrutura para análise da Interface

    Directory of Open Access Journals (Sweden)

    Andreia Pinto de Sousa

    2015-07-01

    Full Text Available A Interface é incontornável quando se estudam os sistemas de informação. Com este artigo, pretendemos contribuir para o aumento do conhecimento sobre os processos de apresentação de informação de saúde online e, sobre as relações do utilizador com a Interface. A proposta aqui apresentada consiste na divisão da interface em cinco dimensões (visual, arquitetura da informação, interação, presença social e experiência de utilização para um maior conhecimento da relevância de cada uma das dimensões e dos seus elementos no estudo da credibilidade e confiança online. Apresenta-se também um modelo de análise que serve como base de construção dos instrumentos de análise para a recolha de dados que caraterizam os utilizadores, e os seus comportamentos relativamente ao acesso e participação e avaliam a sua perceção de credibilidade e de confiança em websites partindo da análise de cada uma das dimensões da Interface.

  16. Aviadores en el desierto. Aventura y viaje del capitán Rafael Martínez Esteve en el Ḥamad jordano-iraquí (1926

    Directory of Open Access Journals (Sweden)

    Córdoba, Joaquín Mª

    2005-04-01

    Full Text Available A comienzos del siglo XX, cuando el redescubrimiento de Oriente se había trocado en su colonización tras la I Guerra Mundial, la poesía del viaje y el reencuentro con gentes y paisajes parecían ya imposibles. De hecho, la literatura «clásica» del viaje a Oriente estaba ya más que acabada. Sin embargo, un accidente de la historia de la aviación española haría que el capitán Rafael Martínez Esteve, integrante de la patrulla que emprendió el viaje Madrid-Manila, viviera una trágica aventura en el desierto jordano- iraquí. Fruto de esa experiencia sería un libro que es, al mismo tiempo que emocionante relato, descripción poética del desierto y la vida de los beduinos, sarcástica mirada a los poderes coloniales, y un amable epígono en la historia de la literatura española de viajes a Oriente.…

  17. INHIBITORY EFFECTS OF PERCHLOROETHYLENE ON HUMAN NEURONAL NICOTINIC ACETYLCHOLINE RECEPTORS.

    Science.gov (United States)

    Perchloroethylene (PERC) is a volatile organic solvent with a variety of industrial uses. PERC exposure has been shown to cause adverse neurological effects including deficits in vision and memory in exposed individuals. Despite knowledge of these effects, the mechanisms by whi...

  18. Compilation of historical radiological data collected in the vicinity of the WIPP site

    International Nuclear Information System (INIS)

    Bradshaw, P.L.; Louderbough, E.T.

    1987-01-01

    The Radiological Baseline Program (RBP) at the Waste Isolation Pilot Plant (WIPP) has been implemented to characterize the radiological conditions at the site prior to receipt of radioactive wastes. Because southeastern New Mexico was the site of an underground nuclear test in 1961, various sampling programs have intermittently monitored background and elevated radiation levels in the vicinity of the WIPP. In addition, radiological characterization of the site region was performed during the 1970's in support of the WIPP Environmental Impact Statement. The historical data are drawn primarily from monitoring activities of the US Public Health Service (PHS), the Environmental Protection Agency (EPA), US Geological Survey (USGS) and Sandia National Laboratories, Albuquerque (SNLA). Information on air and water quality, meat, milk, biota and vegetation is included in the report. This survey is intended to provide a source of reference for historical data on radiological conditions in the vicinity of the WIPP site prior to the establishment of a systematic Radiological Baseline Program. 31 refs., 1 fig

  19. Analysis of Leukemia incidence (1997-2007) in vicinity area of a nuclear installation

    International Nuclear Information System (INIS)

    Jin Rong; Sun Quanfu; Liu Fen; Zhang Xu; Xing Ru; Xu Xinmei; Li Xiaoliang; Su Xu

    2012-01-01

    Objective: To investigate the leukemia incidence among residents in the vicinity area of a nuclear installation. Methods: The data were collected by the retrospective survey. Diagnosis is based on the medical records in all the relevant hospitals. The study area was those residential areas within 10 km of radium surrounding the installation. All residents who had lived in the study area for six months and over were recruited into the study group. Results: The survey ascertained 643 newly diagnosed leukemia cases in the study area during 1997 to 2007. The crude rate was 2.51/100000, and its standardized rate to national population structure was 2.53/100000. The incidence rate in the study area was slightly lower than that in the whole city. No increase trend was detected during the period. Conclusions: No significant difference of the leukemia incidence rate was found between the vicinity area of the nuclear installation and the whole city. (authors)

  20. Uranium Mill Tailings Remedial Action Program. Partial radiological survey of Shiprock vicinity property SH14 Shiprock, New Mexico, October-November 1982

    International Nuclear Information System (INIS)

    Flynn, K.F.; Justus, A.L.; Sholeen, C.M.; Smith, W.H.; Wynveen, R.A.

    1984-06-01

    As part of a detailed radiological assessment of the vicinity properties at Shiprock, a comprehensive survey of the vicinity property designated as SH14 was initiated during October and November 1982. At the time of the survey, vicinity property SH14 consisted of about 20 acres of open lands to the northeast of, and directly across the San Juan River from, the upper tailings pile at Shiprock. The lands consisted of a sandy soil, sparsley covered with trees and other vegetation. The partial assessment activities included determination of surface radiation levels on about a 2-meter grid spacing through direct instrument surveys and analysis of a soil sample collected from the area. The partial radiological assessment indicated elevated levels of radioactivity at several general areas within the open lands. Radiochemical analyses of the soil sample collected from one of these areas indicated a radium concentration of 18 +- 2 pCi/g, which is in excess of the limit of 5 pCi/g above background, averaged over the first 15 cm of soil below the surface, as specified in the EPA Standard (40 CFR 192). Subsurface soil sampling was not conducted, and thus the vertical extent of the radiological contamination is not known. Further measurements required to completely determine and accurately report the radiological status of this vicinity property, including additional direct instrument surveys, collection and analyses of soil samples, and the establishment of a 200-ft grid system, were planned for the final phase of this assessment. However, that phase of the program was cancelled before these measurements were accomplished. The total extent of the radiological contamination of vicinity property SH14 is presently unknown. Nonetheless, since the surface soil contamination levels exceeded the limits specified in the EPA Standard, remedial action for this vicinity site should be considered

  1. Finding and evaluating potential radiological problems in the vicinity of uranium milling sites

    International Nuclear Information System (INIS)

    Goldsmith, W.A.; Yates, W.G.

    1982-01-01

    The Oak Ridge National Laboratory (ORNL) has been performing radiological surveys at former uranium and thorium milling and processing sites since 1975. Tailings at inactive milling sites usually have a low frequency of human occupancy but continuously generate 222 Rn into the atmosphere. Thus, independent 222 Rn surveys are conducted at the inactive mill sites and their environs by the Mound Facility. Measurements of airborne 222 Rn and 222 Rn flux are made on the sites to define the tailings source term. Concurrently with these measurements, an ambient 222 Rn monitoring network is established off-site and a meteorological station is established at or near the mill site. Unfortunately, tailings are not always confined to the milling site. Radioactivity can migrate to areas outside of site boundaries by wind and water erosion, groundwater transport, spillage of incoming ore, and removal of tailings or other material for private purposes. In order to identify and assess off-site radioactivity on properties in the vicinity of milling sites, a combination of aerial and ground-level radiological monitoring techniques are used. The ground mobile gamma-ray scan is conducted using a vehicle equipped with sensitive gamma-ray detectors. The detectors are shielded so that gamma radiation input is viewed through only one side of the vehicle. This system is capable of precisely locating properties which have anomalously high gamma radiation levels caused by the presence of tailings. Subsequently, these properties are identified as candidate vicinity properties and are scheduled for radiological surveys subject to the property owner's consent. The comprehensive radiological surveys conducted at these vicinity properties determine the amount, type, and location of tailings materials

  2. Factors of Predicted Learning Disorders and their Interaction with Attentional and Perceptual Training Procedures.

    Science.gov (United States)

    Friar, John T.

    Two factors of predicted learning disorders were investigated: (1) inability to maintain appropriate classroom behavior (BEH), (2) perceptual discrimination deficit (PERC). Three groups of first-graders (BEH, PERC, normal control) were administered measures of impulse control, distractability, auditory discrimination, and visual discrimination.…

  3. 75 FR 14131 - Effect on Propane Consumers of the Propane Education and Research Council's Operations, Market...

    Science.gov (United States)

    2010-03-24

    ... Propane Education and Research Council's Operations, Market Changes and Federal Programs AGENCY... Education and Research Council (PERC), in conjunction with the cumulative effects of market changes and... requirements under the Propane Education and Research Act of 1996 that established PERC and requires the...

  4. Principal facts for about 16,000 gravity stations in the Nevada Test Site and vicinity

    International Nuclear Information System (INIS)

    Harris, R.N.; Ponce, D.A.; Oliver, H.W.; Healey, D.L.

    1989-01-01

    The Nevada Test Site (NTS) and vicinity includes portions of the Goldfield, Caliente, Death Valley, and Las Vegas. This report documents and consolidates previously published and recently compiled gravity data to establish a gravity data base of about 16,000 stations for the NTS and vicinity. While compiling data sets, redundant stations and stations having doubtful locations or gravity values were excluded. Details of compiling the gravity data sets are discussed in later sections. Where feasible, an accuracy code has been assigned to each station so that the accuracy or reliability of each station can be evaluated. This data base was used in preparing complete Bouguer and isostatic gravity maps of the NTS and vicinity. Since publication of the complete Bouguer gravity map, additional data were incorporated into the isostatic gravity map. Gravity data were compiled from five sources: 14,183 stations from the US Geological Survey (USGS), 326 stations from Exploration Data Consultants (EDCON) of Denver, Colorado, 906 stations from the Los Alamos National Laboratory (LANL), 212 stations from the University of Texas at Dallas (UTD), and 48 stations from the Defense Mapping Agency (DMA). This investigation is an effort to study several areas for potential storage of high-level radioactive waste. Gravity stations established under YMP are shown. The objective of this gravity survey was to explore for the presence of plutons. This volume contains only compiled data

  5. Principal facts for about 16,000 gravity stations in the Nevada Test Site and vicinity

    International Nuclear Information System (INIS)

    Harris, R.N.; Ponce, D.A.; Oliver, H.W.; Healey, D.L.

    1989-01-01

    The Nevada Test Site (NTS) and vicinity includes portions of the Goldfield, Caliente, Death Valley, and Las Vegas. This report documents and consolidates previously published and recently compiled gravity data to establish a gravity data base of about 16,000 stations for the NTS and vicinity. While compiling data sets, redundant stations and stations having doubtful locations or gravity values were excluded. Details of compiling the gravity data sets are discussed in later sections. Where feasible, an accuracy code has been assigned to each station so that the accuracy or reliability of each station can be evaluated. This data base was used in preparing complete Bouguer and isostatic gravity maps of the NTS and vicinity. Since publication of the complete Bouguer gravity map, additional data were incorporated into the isostatic gravity map. Gravity data were compiled from five sources: 14,183 stations from the US Geological Survey (USGS), 326 stations from Exploration Data Consultants (EDCON) of Denver, Colorado, 906 stations from the Los Alamos National Laboratory (LANL), 212 stations from the University of Texas at Dallas (UTD), and 48 stations from the Defense Mapping Agency (DMA). This investigation is an effort to study several areas for potential storage of high-level radioactive waste. Gravity stations established under YMP are shown. The objective of this gravity survey was to explore for the presence of plutons. 33 refs., 24 figs., 9 tabs

  6. Investigation Of The Origin Of Various Water Sources In The Vicinity Of Ngancar Dam, Wonogiri Using Natural Isotopes

    International Nuclear Information System (INIS)

    Sidauruk, Paston; Indrojoyo; Wibagoyo; Pratikno, Bungkus; Evarista Ristin, P.I.

    2000-01-01

    The investigation of the origin of various water sources in the vicinity of Ngancar Dam, Wonogiri, using natural isotopes technique has been conducted. The study includes collecting and analyzing water samples from various sources in the vicinity of the dam such as reservoir water, water discharges, springs, local water well, rain water, water from piezometer and observation wells. For this investigation, natural isotopes composition and hydro chemical ions of the samples have been analyzed and interpreted. From the data interpretation, it is concluded that most of the water in various sources originated from water reservoir

  7. Two fluid plasmas in the vicinity of a Schwarzschild black hole

    International Nuclear Information System (INIS)

    Buzzi, V.; Hines, K.C.

    1992-01-01

    The 3+1 split of general relativity has been used to investigate the dispersion relation for certain plasma waves, together with the two stream instability, in the vicinity of a Schwarzschild black hole horizon. In contrast to the special relativistic results, the dispersion relations discussed here contain additional terms involving the gravitational acceleration, a, and the lapse function α. Some of these terms are imaginary and should correspond to gravitational damping effects. 5 refs

  8. CONTABILIDAD CASTELLANA EN LA PRIMERA MITAD DEL SIGLO XIX: EL LIBRO DE CUENTAS DE MANUEL MARTÍNEZ LERMA

    Directory of Open Access Journals (Sweden)

    Juan José Martín García

    2016-07-01

    Full Text Available La aparición en un archivo particular de la localidad burgalesa de Pradoluengo, del libro de cuentas de Manuel Martínez Lerma, y su análisis desde los puntos de vista formal, conceptual y de contenidos, supone uno de los pocos casos sobre contabilidad privada, estudiados en el ámbito rural castellano de la primera mitad del siglo XIX.                   En su funcionamiento interno, este documento contable es deudor de la tradición castellana. Su fin es eminentemente práctico y su contexto cronológico le hace no estar sujeto a supervisiones de estamentos superiores, lo que le otorga una verosimilitud prácticamente absoluta. Sin lugar a dudas, supuso la piedra angular del trabajo de despacho de su redactor, quien, a pesar de declarar como actividad principal la de escribano, diversificó sus negocios en multitud de ámbitos: fabricación de tejidos, comercio al por menor, actividades financieras y de préstamo, compraventa de lanas, adquisición de tierras e inmuebles, etcétera.                  La versatilidad de nuestro personaje, se plasma en múltiples perspectivas que manan constantemente del libro de cuentas, cuyo análisis hemos apoyado con documentación notarial, parroquial y municipal. Manuel se situará progresivamente en lo más alto de la cúspide social, estableciendo relaciones clientelares con grandes comerciantes, convirtiéndose en un destacado fabricante local, accediendo a puestos de responsabilidad municipal, fijando alianzas matrimoniales ventajosas para sus hijos, o siendo pieza clave en el encumbramiento de uno de ellos como arzobispo de Manila.

  9. Radioecological survey in the vicinity of the EUREX reprocessing plant, Saluggia, Italy

    International Nuclear Information System (INIS)

    Cigna, A.A.; Fasolo, G.B.; Viazzo, G.

    1984-01-01

    The results of a revision of the first survey carried on in 1972 in the vicinity of the EUREX plant are reported. In the present report the radiation protection implications have been considered according to the last recommendations of ICRP. In particular the collective effective dose committment has been evaluated after the global liquid and gaseous discharge from the plant during its operations since 1970

  10. Asthma in the vicinity of power stations: II - outdoor air quality and symptoms

    International Nuclear Information System (INIS)

    Henry, R.L.; Bridgman, H.A.; Wlodarczyk, J.; Abramson, R.; Adler, J.A.; Hensley, M.J.

    1995-01-01

    After a study suggesting that children who live in the vicinity of a coal thermal power plant present a bronchial tubes hyper reactivity, more often than children of an other city far from this power plant, an other study was realized; it is presented here but the way of doing is controversial. (N.C.)

  11. The UKB prescription and the heavy atom effects on the nuclear magnetic shielding of vicinal heavy atoms.

    Science.gov (United States)

    Maldonado, Alejandro F; Aucar, Gustavo A

    2009-07-21

    Fully relativistic calculations of NMR magnetic shielding on XYH3 (X = C, Si, Ge and Sn; Y = Br, I), XHn (n = 1-4) molecular systems and noble gases performed with a fully relativistic polarization propagator formalism at the RPA level of approach are presented. The rate of convergence (size of basis set and time involved) for calculations with both kinetic balance prescriptions, RKB and UKB, were investigated. Calculations with UKB makes it feasible to obtain reliable results for two or more heavy-atom-containing molecules. For such XYH3 systems, the influence of heavy vicinal halogen atoms on sigma(X) is such that heavy atom effects on heavy atoms (vicinal plus their own effects or HAVHA + HAHA effects) amount to 30.50% for X = Sn and Y = I; being the HAHA effect of the order of 25%. So the vicinal effect alone is of the order of 5.5%. The vicinal heavy atom effect on light atoms (HALA effect) is of the order of 28% for X = C and Y = I. A similar behaviour, but of opposite sign, is observed for sigma(Y) for which sigmaR-NR (I; X = C) (HAHA effect) is around 27% and sigmaR-NR(I; X = Sn) (HAVHA + HAHA effects) is close to 21%. Its electronic origin is paramagnetic for halogen atoms but both dia- and paramagnetic for central atoms. The effect on two bond distant hydrogen atoms is such that the largest variation of sigma(H) within the same family of XYH3 molecules appears for X = Si and Y = I: around 20%. In this case sigma(H; X = Sn, Y = I) = 33.45 ppm and sigma(H; X = Sn, Y = H) = 27.82 ppm.

  12. 33 CFR 110.190 - Tortugas Harbor, in vicinity of Garden Key, Dry Tortugas, Fla.

    Science.gov (United States)

    2010-07-01

    ... Garden Key, Dry Tortugas, Fla. 110.190 Section 110.190 Navigation and Navigable Waters COAST GUARD..., in vicinity of Garden Key, Dry Tortugas, Fla. (a) The anchorage grounds. All of Bird Key Harbor, southwest of Garden Key, bounded by the surrounding reefs and shoals and, on the northeast, by a line...

  13. Atmospheric BTEX concentrations in the vicinity of the crude oil refinery of the Baltic region.

    Science.gov (United States)

    Baltrėnas, Pranas; Baltrėnaitė, Edita; Serevičienė, Vaida; Pereira, Paulo

    2011-11-01

    Among chemical industries, petroleum refineries have been identified as large emitters of a wide variety of pollutants. Benzene, toluene, ethylbenzene, and xylene (BTEX) form an important group of aromatic volatile organic compounds (VOCs) because of their role in the troposphere chemistry and the risk posed to human health. A very large crude oil refinery of the Baltic States (200,000 bbl/day) is situated in the northern, rural part of Lithuania, 10 km from the town of Mažeikiai (Lithuania). The objectives of this study were: (1) to determine of atmospheric levels of BTEX in the region rural and urban parts at the vicinity of the crude oil refinery; and (2) to investigate the effect of meteorological parameters (wind speed, wind direction, temperature, pressure, humidity) on the concentrations measured. The averaged concentration of benzene varied from 2.12 ppbv in the rural areas to 2.75 ppbv in the urban areas where the traffic was determined to be a dominant source of BTEX emissions. Our study showed that concentration of benzene, as strictly regulated air pollutant by EU Directive 2008/50/EC, did not exceed the limit of 5 ppbv in the region in the vicinity of the crude oil refinery during the investigated period. No significant change in air quality in the vicinity of the oil refinery was discovered, however, an impact of the industry on the background air quality was detected. The T/B ratio (0.50-0.81) that was much lower than 2.0, identified other sources of pollution than traffic.

  14. Guide related to the management of activities in the vicinity of INBs - Project

    International Nuclear Information System (INIS)

    2011-01-01

    This document aims at proposing a national framework for local dialogue on the management of activities in the vicinity of nuclear sites. According to official documents, this dialogue between local actors and public services, based on risk characterization, aims at examining peculiarities and challenges of the concerned territory, and at identifying the most adapted perspectives for economic development while taking risks related to nuclear activities into account. The document first gives an overview of modalities for the taking of the nuclear risk into account. It proposes some definitions related to these issues, indicates general principles of management of activities in the vicinity of basic nuclear installations, and presents some general rules regarding project vulnerability, current projects, road infrastructures, and outdoor temporary events. The next part of the report addresses issues related to local dialogue: roles and missions of the different actors, expected approach at the local level (risk characterization, definition of the area of activity management, territory pre-diagnosis, elaboration of the 'bringing to attention', exchanges with local actors). Appendices present the legal context related to risk management, and a model of requirements specification for a territory pre-diagnosis

  15. CARACTERIZACIÓN TECNOLÓGICA DE LA MADERA DE Juniperus flaccida VAR. POBLANA MARTÍNEZ

    Directory of Open Access Journals (Sweden)

    A. Borja de la Rosa

    2010-01-01

    Full Text Available El presente estudio se realizó con la finalidad de conocer las características y propiedades tecnológicas de la madera de Juniperus flaccida var. poblana Martínez, para lo cual se utilizó la metodología del Laboratorio de Anatomía y Tecnología de la Madera de la División de Ciencias Forestales de la Universidad Autónoma Chapingo. Las propiedades físicas se determinaron según la norma NOM-EE-167-83 y las mecánicas de acuerdo a las normas ASTM 143-83 en el Campo Experimental San Martinito, del Instituto de Investigaciones Forestales, Agrícolas y Pecuarias (INIFAP. Los resultados con relación a las características anatómicas fueron los siguientes: la madera presenta un color castaño claro en el duramen y amarillo pálido en la albura, brillo medio, veteado suave, textura fina, hilo recto, sabor característico y olor aromático. Las traqueidas son largas, de diámetro tangencial mediano y paredes delgadas; presentan una hilera de puntuaciones areoladas seriadas, las puntuaciones de los campos de cruzamiento son tipo cupresoide y el parénquima axial es escaso. Los rayos de tipo uniseriados numerosos, muy bajos y muy angostos; los rayos y las células parenquimatosas axiales presentan aceites. La proporción de elementos fue 92 % de traqueidas, 7.72 de parénquima de rayo y 0.18 % de parénquima axial. La densidad básica fue de 0.50 g·cm-3, las contracciones totales fueron: volumétrica de 8.42 %, tangencial de 4.26 % y radial de 3.02 %; y los hinchamientos totales: volumétrico de 9.17 %, tangencial de 4.45 % y radial de 3.12 %. El punto de saturación de la fibra fue de 33 %; el coeficiente de hinchamiento 0.278 %, y la relación de anisotropía de 1.41. Los valores promedio de las propiedades mecánicas al 12 % de contenido de humedad (CH y en condición verde, se clasificaron de medios a bajos en ambas condiciones de contenido de humedad. Considerando las características anatómicas y los valores de las propiedades f

  16. Cancer rate in children in the vicinity of nuclear power plants

    International Nuclear Information System (INIS)

    Grosche, B.; Jung, T.; Weiss, W.

    2008-01-01

    The recent epidemiological study on childhood cancer in the vicinity of nuclear power plants (KiKK) shows that the cancer risk, especially the leukaemia risk, for children below the age of five in Germany increases with increasing proximity to the site of a nuclear power plant. Earlier ecological studies had found an increased leukaemia risk in children under five within a five-kilometre radius. However, the KiKK study used a case-control design and thus the results are more reliable. A clear trend could be ascertained indicating that the risk increases with increasing proximity of the place of residence to the site of a nuclear power plant. Further, the elevated risk was observed in the entire region under study, i.e. also outside the 5-km radius. As it was not possible to determine individual radiation exposures of the more than 6,000 children included in the study, the distance between the nearest site of a nuclear power plant and the place of residence was used as a substitute both for cases and for controls. The study also took into account other risk factors with known or assumed carcinogenic effect. However, no indication was found that the result could be explained by other risk factors than by vicinity of a nuclear power plant. This clear dependence of risk on the distance from the sites is indicative for a potential causal relationship, but it is no proof. (orig.)

  17. Basalt microlapilli in deep sea sediments of Indian Ocean in the vicinity of Vityaz fracture zone

    Digital Repository Service at National Institute of Oceanography (India)

    Nath, B.N.; Iyer, S.D.

    Two cores recovered from the flanks of Mid-India oceanic ridge in the vicinity of Vityaz fracture zone consist of discrete pyroclastic layers at various depths. These layers are composed of coarse-grained, angular basaltic microlapilli in which...

  18. AcEST: DK950544 [AcEST

    Lifescience Database Archive (English)

    Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =

  19. AcEST: DK951699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

  20. Survey of high-velocity molecular gas in the vicinity of Herbig-Haro objects. I

    International Nuclear Information System (INIS)

    Edwards, S.; Snell, R.L.

    1983-01-01

    A survey of high-velocity molecular gas toward 49 Herbig-Haro objects is presented. Observations of the 12 CO J = 1-0 transition obtained with the 14 m telescope of the Five College Radio Astronomy Observatory reveal three new spatially extended high-velocity molecular outflows. One is in the NGC 1333 region near HH 12, and two are in the NGC 7129 region, the first near LkHα 234 and the second near a far-infrared source. The relationship between optical Herbin-Haro emission knots and large-scale motions of the ambient molecular material is investigated, and the properties of high-velocity molecular outflows in the vicinity of Herbig-Haro objects are discussed. Of 11 energetic outflows in the vicinity of Herbig-Haro objects, eight are found in four pairs separated by 0.2-1.0 pc. We estimate that energetic outflows characterized by mass loss rates > or =10 -7 M/sub sun/ yr -1 occur for at least 10 4 yr once in the lifetime of all stars with masses greater than 1M/sub sun/

  1. A method for measuring the velocity flow field in the vicinity of a moving cascade

    International Nuclear Information System (INIS)

    Bammert, K.; Mobarak, A.

    1977-01-01

    Centrifugal compressors and blowers are often used for recycling the coolant gas in gas-cooled reactors. To achieve the required pressure ratios, highly loaded centrifugal compressors are built. The paper deals with a method of measuring the flow field in the vicinity of a moving impeller or cascade with hot wires. The relative flow pattern induced ahead of a cascade or impeller or the rotating wakes behind a moving cascade (which is important for loss evaluation) could be now measured with the help of a single hot wire. The wire should be rotated about the axis of the probe for 3 different inclinations with respect to the approaching flow. The method has been used for measuring the flow field in the vicinity of the inducer of a highly loaded centrifugal compressor. The results and the accuracy of the method are discussed and the mean values have been compared with the theoretically estimated velocities. (orig.) [de

  2. Nuisance Caused by Aircraft Noise in the Vicinity of Tehran International Airport

    Directory of Open Access Journals (Sweden)

    Stan Frost

    1999-03-01

    Full Text Available Noise measurement and social questionnaire surveys in three residential areas around Mehrabad International Airport (Tehran, Iran were based upon randomly selected dwellings in each area. A total of 193 individuals responded and many are annoyed and dissatisfied with aircraft noise and in consequence they would like to move. Aircraft noise is the strongest negative environmental factor affecting the residents in the vicinity of Mehrabad Airport and it could be a hazard for their health.

  3. Alkyl Bromides as Mechanistic Probes of Reductive Dehalogenation: Reactions of Vicinal Dibromide Stereoisomers with Zero-Valent Metals

    National Research Council Canada - National Science Library

    Totten, Lisa

    2000-01-01

    The mechanism through which zero-valent metals (most notably iron and zinc) reduce alkyl polyhalides in aqueous solution at room temperature was investigated using several stereoisomers of vicinal dibromides as probe compounds...

  4. M-Area Settling Basin and vicinity: Environmental information document

    International Nuclear Information System (INIS)

    Pickett, J.B.; Colven, W.P.; Bledsoe, H.W.

    1986-12-01

    This document provides environmental information on postulated closure options for the M-Area Settling Basin and vicinity at the Savannah River Plant and was developed as background technical documentation for the Department of Energy's proposed Environmental Impact Statement (EIS) on waste management activities for groundwater protection at the plant. The results of groundwater and atmospheric pathway analyses, accident analysis, and other environmental assessments discussed in this document are based upon a conservative analysis of all foreseeable scenarios as defined by the National Environmental Policy Act (40 CFR 1500-1508). The scenarios do not necessarily represent actual environmental conditions. This document is not meant to be used as a closure plan or other regulatory document to comply with required federal or state environmental regulations

  5. Heavy Metal Contamination and Health Risk Assessment in the Vicinity of a Tailing Pond in Guangdong, China

    Science.gov (United States)

    Liang, Yaya; Yi, Xiaoyun; Dang, Zhi; Wang, Qin; Luo, Houmei; Tang, Jie

    2017-01-01

    The purpose of this study was to assess heavy metal contamination and health risks for residents in the vicinity of a tailing pond in Guangdong, southern China. Water, soil, rice, and vegetable samples were collected from the area in the vicinity of the tailing pond. Results showed that surface water was just polluted by Ni and As, while groundwater was not contaminated by heavy metals. The concentrations of Pb, Zn, Cu, Cd, Ni, and As in the paddy soil exceeded the standard values but not those of Cr. In vegetable soils, the concentration of heavy metals was above the standard values except for Ni and As. Soil heavy metal concentrations generally decreased with increasing distance from the polluting source. Leafy vegetables were contaminated by Pb, Cr, Cd, and Ni, while the non-leafy vegetables were contaminated only by Cr. There was a significant difference in heavy metal concentrations between leafy vegetables and non-leafy vegetables. Almost all the rice was polluted by heavy metals. Diet was the most significant contributor to non-carcinogenic risk, which was significantly higher than the safe level of 1. The total cancer risk was also beyond the safe range (10−6–10−4). Results revealed that there is a risk of potential health problems to residents in the vicinity of the tailing pond. PMID:29231884

  6. Heavy Metal Contamination and Health Risk Assessment in the Vicinity of a Tailing Pond in Guangdong, China.

    Science.gov (United States)

    Liang, Yaya; Yi, Xiaoyun; Dang, Zhi; Wang, Qin; Luo, Houmei; Tang, Jie

    2017-12-12

    The purpose of this study was to assess heavy metal contamination and health risks for residents in the vicinity of a tailing pond in Guangdong, southern China. Water, soil, rice, and vegetable samples were collected from the area in the vicinity of the tailing pond. Results showed that surface water was just polluted by Ni and As, while groundwater was not contaminated by heavy metals. The concentrations of Pb, Zn, Cu, Cd, Ni, and As in the paddy soil exceeded the standard values but not those of Cr. In vegetable soils, the concentration of heavy metals was above the standard values except for Ni and As. Soil heavy metal concentrations generally decreased with increasing distance from the polluting source. Leafy vegetables were contaminated by Pb, Cr, Cd, and Ni, while the non-leafy vegetables were contaminated only by Cr. There was a significant difference in heavy metal concentrations between leafy vegetables and non-leafy vegetables. Almost all the rice was polluted by heavy metals. Diet was the most significant contributor to non-carcinogenic risk, which was significantly higher than the safe level of 1. The total cancer risk was also beyond the safe range (10 -6 -10 -4 ). Results revealed that there is a risk of potential health problems to residents in the vicinity of the tailing pond.

  7. Preliminary assessment of the electromagnetic environment in the immediate vicinity of the ETA accelerator

    International Nuclear Information System (INIS)

    Cabayan, H.S.; Bogdan, E.; Zicker, J.; Wythe, D.; Burke, G.J.

    1980-04-01

    The electromagnetic fields in the immediate vicinity of the Experimental Test Accelerator (ETA) at the Lawrence Livermore Laboratory have been characterized. Various EM sensors that cover the frequency band from the very low frequencies up into the GHz region have been used. The report describes in detail the probes, the test set-up and the data processing techniques

  8. Longtime radionuclide monitoring in the vicinity of Salaspils nuclear reactor

    International Nuclear Information System (INIS)

    Riekstina, D.; Berzins, J.; Krasta, T.; Skrypnik, O.; Alksnis, J.

    2016-01-01

    The research nuclear reactor in Salaspils was decommissioned in 1998. Now reactor is partially dismantled and its territory is used as a temporary storage of radioactivity contaminated materials and water. Environment radioactivity monitoring for presence of artificial radionuclides in the vicinity of Salaspils nuclear reactor is carried out since 1990. Data include Cs-137 concentration in soils, tritium concentration in ground water, as well as H-3, Cs-137, Co-60 concentration and gross beta-activity of reactors sewage and rainwater drainage. The systematic monitoring allowed to detect in December 2014 a leakage from the special wastewater basin and so to prevent a pollution of ground water outside reactors territory.

  9. Phytotoxicology section investigation in the vicinity of the Bruce Nuclear Power Development, the Pickering Nuclear Generating Station and the Darlington Nuclear Generating Station, in October, 1989

    International Nuclear Information System (INIS)

    1991-02-01

    The Phytotoxicology Section, Air Resources Branch is a participant in the Pickering and Bruce Nuclear Contingency Plans. The Phytotoxicology Emergency Response Team is responsible for collecting vegetation samples in the event of a nuclear emergency at any of the nuclear generating stations in the province. As part of its responsibility the Phytotoxicology Section collects samples around the nuclear generating stations for comparison purposes in the event of an emergency. Because of the limited frequency of sampling, the data from the surveys are not intended to be used as part of a regulatory monitoring program. These data represent an effort by the MOE to begin to establish a data base of tritium concentrations in vegetation. The Phytotoxicology Section has carried out seven surveys in the vicinity of Ontario Hydro nuclear generating stations since 1981. Surveys were conducted for tritium in snow in the vicinity of Bruce Nuclear Power Development (BNPD), February, 1981; tritium in cell-free water of white ash in the vicinity of BNPD, September, 1981; tritium in snow in the vicinity of BNPD, March, 1982; tritium in tree sap in the vicinity of BNPD, April, 1982; tritium in tree sap in the vicinity of BNPD, April, 1984, tritium in the cell-free water of white ash in the vicinity of BNPD, September, 1985; and, tritium in cell-free water of grass in the vicinity of Pickering Nuclear Generation Station (PNGS), October 1986. In all cases a pattern of decreasing tritium levels with increasing distance from the stations was observed. In October, 1989, assessment surveys were conducted around Bruce Nuclear Power Development, the Pickering Nuclear Generating Station and the new Darlington Nuclear Generating Station (DNGS). The purpose of these surveys was to provide baseline data for tritium in cell-free water of grass at all three locations at the same time of year. As none of the reactor units at DNGS had been brought on line at the time of the survey, this data was to be

  10. Roughness of the SiC/SiO{sub 2} vicinal interface and atomic structure of the transition layers

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Peizhi; Li, Guoliang; Duscher, Gerd, E-mail: gduscher@utk.edu [Department of Materials Science and Engineering, The University of Tennessee, Knoxville, Tennessee 37996 (United States); Sharma, Yogesh K.; Ahyi, Ayayi C.; Isaacs-Smith, Tamara; Williams, John R.; Dhar, Sarit [Department of Physics, Auburn University, Auburn, Alabama 36849 (United States)

    2014-11-01

    The SiC/SiO{sub 2} interface is generally considered to be the cause for the reduced electron mobility of SiC power devices. Previous studies have shown a correlation between the mobility and the transition layer width at the SiC/SiO{sub 2} interface. The authors investigated this interface with atomic resolution Z-contrast imaging and electron energy-loss spectroscopy, and discovered that this transition region was due to the roughness of the vicinal interface. The roughness of a vicinal interface consisted of atomic steps and facets deviating from the ideal off-axis cut plane. The authors conclude that this roughness is limiting the mobility in the channels of SiC MOSFETs.

  11. Idiopathic premature ventricular contractions and ventricular tachycardias originating from the vicinity of tricuspid annulus: Results of radiofrequency catheter ablation in thirty-five patients

    Directory of Open Access Journals (Sweden)

    Yue-Chun Li

    2012-07-01

    Full Text Available Abstract Background In recent years, catheter ablation has increasingly been used for ablation of idiopathic premature ventricular complexes (PVCs or ventricular tachycardias (IVTs. However, the mapping and catheter ablation of the arrhythmias originating from the vicinity of tricuspid annulus (TA may not be fully understood. This study aimed to investigate electrophysiologic characteristics and effects of radiofrequency catheter ablation (RFCA for patients with symptomatic PVCs and IVTs originating from the vicinity of TA. Methods Characteristics of body surface electrocardiogram (ECG and electrophysiologic recordings were analyzed in 35 patients with symptomatic PVCs/ IVTs originating from the vicinity of TA. RFCA was performed using pace mapping and activation mapping. Results Among the 35 patients with PVCs/IVTs arising from the vicinity of TA, complete elimination of PVCs/IVTs could be achieved by RFCA in 32 patients (success rate 91.43% during a median follow-up period of 21 months. PVCs/IVTs originating from the vicinity of TA had distinctive ECG characteristics that were useful for identifying the precise origin. An rS pattern was recorded in lead V1 in 93.1% of patients with PVCs/IVTs from the free wall of TA, vs 16.7% of patients with PVCs/IVTs from the septal TA, whereas a QS pattern in lead V1 occurred in 83.3% of patients with PVCs/IVTs from the septal TA vs 6.9% of patients with PVCs from the free wall of the TA. The precordial R wave transition occurred by lead V3 or earlier in all patients with PVCs/IVTs originating from the septal portion of the TA, as compared to transition beyond V3 in all patients with PVCs/IVTs from the free wall of the TA. Conclusions RFCA is an effective curative therapy for symptomatic PVCs/IVTs originating from the vicinity of TA. There are specific characteristics in ECG and the ablation site could be located by ECG analysis.

  12. A numerical analysis of aspects of absorbed dose in the vicinity of the interface of different materials

    Energy Technology Data Exchange (ETDEWEB)

    Tada, J [Tsukuba Univ., (Japan); Hirayama, H [National Lab. High Enregy Phys. (Japan); Katoh, K [Ibaraki Pref. Univ. Health Sci., (Japan)

    1997-12-31

    In the measurement and/or evaluation of the absorbed dose where the charged particle distribution is far from equilibrium, knowledge on the microscopic spatial distribution of the charged particle fluence is important. Spatial distribution of secondary electrons in the vicinity of an interface of materials and the values of the absorbed dose in these regions are investigated with a monte-Carlo simulation code EGS 4. There were experiments on spatial variation of the absorbed dose in the vicinity of an interface of materials. However, the behaviour of secondary electrons were discussed only broadly and qualitatively. In this study, behaviour of the secondary electrons was analysed to clarify contribution of ruling interactions to generate secondary electrons, and influence of the interface on the energy spectra of secondary electrons. 11 figs.

  13. Dance training intensity at 11–14 years is associated with femoral torsion in classical ballet dancers

    Science.gov (United States)

    Hamilton, D; Aronsen, P; Løken, J H; Berg, I M; Skotheim, R; Hopper, D; Clarke, A; Briffa, N K

    2006-01-01

    Objective To examine in a cross sectional study the influence of femoral torsion (FT) and passive hip external rotation (PER) on turnout (TO). Starting age, years of classical ballet training, and current and past dance training intensity were assessed to determine their influence on FT, PER, and TO in pre‐professional female dancers. Methods Sixty four dancers (mean (SD) age 18.16 (1.80) years) were recruited from four different dance training programmes. They completed a dance history questionnaire. FT was measured using a clinical method. PER was measured with the subjects prone, and TO was measured with the subjects standing. Results Mean TO was 136°, mean unilateral PER was 49.4°, and mean FT was 18.4°. A positive correlation was observed between PER combined (PERC) and TO (r  =  0.443, pballet training and FTC, PERC, or TO. Dancers who trained for six hours a week or more during the 11–14 year age range had less FT than those who trained less (mean difference 6°, 95% confidence interval 1.4 to 10.3). Students currently training for longer had higher levels of TO (p<0.001) but comparable PERC and FTC. Conclusion FT is significantly associated with PERC. Dancers who trained for six hours a week or more at 11–14 years of age had significantly less FT. FTC had a significant influence on PERC, but no influence on the execution of TO. PMID:16556782

  14. Investigation of AlN films grown by molecular beam epitaxy on vicinal Si(111) as templates for GaN quantum dots

    International Nuclear Information System (INIS)

    Benaissa, M.; Vennegues, P.; Tottereau, O.; Nguyen, L.; Semond, F.

    2006-01-01

    The use of AlN epitaxial films deposited on vicinal Si(111) as templates for the growth of GaN quantum dots is investigated by transmission electron microscopy and atomic force microscopy. It is found that the substrate vicinality induces both a slight tilt of the AlN (0001) direction with respect to the [111] direction and a step bunching mechanism. As a consequence, a dislocation dragging behavior is observed giving rise to dislocation-free areas well suited for the nucleation of GaN quantum dots

  15. Dehalogenation of vicinal dihalo compounds by 1,1'-bis(trimethylsilyl)-1H,1'H-4,4'-bipyridinylidene for giving alkenes and alkynes in a salt-free manner.

    Science.gov (United States)

    Rej, Supriya; Pramanik, Suman; Tsurugi, Hayato; Mashima, Kazushi

    2017-12-07

    We report a transition metal-free dehalogenation of vicinal dihalo compounds by 1,1'-bis(trimethylsilyl)-1H,1'H-4,4'-bipyridinylidene (1) under mild conditions, in which trimethylsilyl halide and 4,4'-bipyridine were generated as byproducts. The synthetic protocol for this dehalogenation reaction was effective for a wide scope of dibromo compounds as substrates while keeping the various functional groups intact. Furthermore, the reduction of vicinal dichloro alkanes and vicinal dibromo alkenes also proceeded in a salt-free manner to afford the corresponding alkenes and alkynes.

  16. Dust pollution of the atmosphere in the vicinity of coal-fired power plant (Omsk City, Russia)

    Science.gov (United States)

    Talovskaya, Anna V.; Raputa, Vladimir F.; Litay, Victoriya V.; Yazikov, Egor G.; Yaroslavtseva, Tatyana V.; Mikhailova, Kseniya Y.; Parygina, Irina A.; Lonchakova, Anna D.; Tretykova, Mariya I.

    2015-11-01

    The article shows the results of dust pollution level of air in the vicinity of coal-fired power plant of Omsk city on the base of study snow cover pollution. The samples were collected west-, east- and northeastwards at a distance of 0,75-6 km from the chimney for range-finding of dust emission transfer. The research findings have shown the dust load changes from 53 till 343 mg•(m2·day)-1 in the vicinity of power plant. The ultimate dust load was detected at a distance of 3-3,5 km. On the basis of asymptotics of equation solution for impurity transfer, we have made numerical analysis of dust load rate. With the usage of ground-based facilities and satellites we have determined the wind shifts in the atmospheric boundary layer have a significant impact on the field forming of long-term dustfall.

  17. Restoring Anadromous Fish Habitat in Big Canyon Creek Watershed, 2004-2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Rasmussen, Lynn (Nez Perce Soil and Conservation District, Lewiston, ID)

    2006-07-01

    The ''Restoring Anadromous Fish Habitat in the Big Canyon Creek Watershed'' is a multi-phase project to enhance steelhead trout in the Big Canyon Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District. Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period September 1, 2004 through October 31, 2005 include; 2.7 riparian miles treated, 3.0 wetland acres treated, 5,263.3 upland acres treated, 106.5 riparian acres treated, 76,285 general public reached, 3,000 students reached, 40 teachers reached, 18 maintenance plans completed, temperature data collected at 6 sites, 8 landowner applications received and processed, 14 land inventories completed, 58 habitat improvement project designs completed, 5 newsletters published, 6 habitat plans completed, 34 projects installed, 2 educational workshops, 6 displays, 1 television segment, 2 public service announcements, a noxious weed GIS coverage, and completion of NEPA, ESA, and cultural resources requirements.

  18. Santiago Martínez Delgado, pionero del diseño gráfico colombiano: una reseña de su vida y obra

    Directory of Open Access Journals (Sweden)

    Diego Giovanni Bermúdez Aguirre

    2017-06-01

    Full Text Available Hablar del diseño gráfico en Colombia como profesión autónoma es aproximarse a una historia todavía en construcción, dada la juventud de este espacio de conocimiento, el cual dio sus primeros pasos solo hasta principios del siglo XX, debido al desarrollo industrial que vino a definir un nuevo lenguaje de producción, estético y comunicativo que ahora se llama “diseño”. Este texto pretende acercarse a la vida de Santiago Martínez Delgado, uno de los primeros hombres que con su obra definió, en el contexto colombiano, los rumbos de una nueva forma de expresión y comunicación: el diseño gráfico. Se intenta comprender el carácter innovador presente en la vida y obra de este diseñador colombiano, desde la ciencia histórica a partir de la condición de lugar de producción, acercamiento al tiempo histórico como reconstrucción o representación de un presente por medio de un proceso de ficcionalización, el cual edifica y evidencia una ruptura temporal entre el pasado, asumido como espacio de experiencia, y el ahora (presente, constituido a partir de una visión prospectiva de la vida en el futuro, horizonte de expectativa.

  19. High-frequency pressure variations in the vicinity of a surface CO2 flux chamber

    Science.gov (United States)

    Eugene S. Takle; James R. Brandle; R. A. Schmidt; Rick Garcia; Irina V. Litvina; William J. Massman; Xinhua Zhou; Geoffrey Doyle; Charles W. Rice

    2003-01-01

    We report measurements of 2Hz pressure fluctuations at and below the soil surface in the vicinity of a surface-based CO2 flux chamber. These measurements were part of a field experiment to examine the possible role of pressure pumping due to atmospheric pressure fluctuations on measurements of surface fluxes of CO2. Under the moderate wind speeds, warm temperatures,...

  20. Distribution, Sources and Toxicity Potentials of Polycyclic Aromatic Hydrocarbons in Soil Around the Vicinity of Balogun-Birro Dumpsite of Oshogbo, Nigeria

    International Nuclear Information System (INIS)

    Adedosu, T.A.; Adeniyi, O.K.; Adedosu, H.O.

    2015-01-01

    Contamination of soil within the vicinity of dumpsites by toxic and persistent organic pollutants is of environmental concern because of their carcinogenic, genotoxic and environmental persistence. Waste disposal sites have been identified as potential source of PAHs accumulating in soil. Assessment of level, distribution and sources of PAHs in environmental media is important for evaluation of ecotoxicological and health effect. This study investigated the distribution, sources and level of PAHs in soil within the vicinity of Balogun-Birro Dumpsite in Osogbo, Nigeria and their potential impacts on human health. Soil samples were collected at ten points within the vicinity of the dumpsite. The level of the 16 USEPA PAHs in the soil samples were determined by gas chromatography - flame ionization detector (GC-FID). The total concentration of the 16PAHs ranged between 0.1137 mg/ kg to 5.6491 mg/ kg. Samples from the main dumpsite and the mechanic workshops had highest PAHs concentrations of 5.6491 mg/ kg and 3.6529 mg/ kg respectively. The distribution of PAHs ring size is in the order of 3>4>5>6>2. Carcinogenic fractions represent 34.74 % of the total PAHs. The total concentration of carcinogenic PAHs ranged from 0.06425 mg/ kg to 1.6775 mg/ kg. Diagnostic ratios of PAHs indicate that pyrogenic activities are major sources of PAHs. The study had revealed increasing accumulation of carcinogenic PAHs in soil within the vicinity of the dumpsite. (author)

  1. Developing the "Lunar Vicinity" Scenario of the Global Exploration Roadmap

    Science.gov (United States)

    Schmidt, G.; Neal, C. R.; Crawford, I. A.; Ehrenfreund, P.

    2014-04-01

    The Global Exploration Roadmap (GER, [1]) has been developed by the International Space Exploration Coordination Group (ISECG - comprised of 14 space agencies) to define various pathways to getting humans beyond low Earth orbit and eventually to Mars. Such pathways include visiting asteroids or the Moon before going on to Mars. This document has been written at a very high level and many details are still to be determined. However, a number of important papers regarding international space exploration can form a basis for this document (e.g. [2,3]). In this presentation, we focus on developing the "Lunar Vicinity" scenario by adding detail via mapping a number of recent reports/documents into the GER. Precedence for this scenario is given by Szajnfarber et al. [4] who stated "We find that when international partners are considered endogenously, the argument for a "flexible path" approach is weakened substantially. This is because international contributions can make "Moon first" economically feasible". The documents highlighted here are in no way meant to be all encompassing and other documents can and should be added, (e.g., the JAXA Space Exploration Roadmap). This exercise is intended to demonstrate that existing documents can be mapped into the GER despite the major differences in granularity, and that this mapping is a way to promote broader national and international buy-in to the Lunar Vicinity scenario. The documents used here are: the Committee on Space Research (COSPAR) Panel on Exploration report on developing a global space exploration program [5], the Strategic Knowledge Gaps (SKGs) report from the Lunar Exploration Analysis Group (LEAG) [6], the Lunar Exploration Roadmap developed by LEAG [7], the National Research Council report Scientific Context for the Exploration of the Moon (SCEM) [8], the scientific rationale for resuming lunar surface exploration [9], the astrobiological benefits of human space exploration [9,10].

  2. Alpha-emitting 'hot particles' in the vicinity of BNFL Sellafield, Cumbria

    International Nuclear Information System (INIS)

    Whittall, A.J.; Tossell, P.J.

    2000-01-01

    In a survey of environmental samples in the vicinity of BNFL Sellafield, two alpha-emitting radioactive particles were found in samples of grass. One particle appears to be of mineral origin, the other was not definitively identified, but may be a fragment of fuel cladding. Conservative estimates of the activities of these particles are very low. The abundance of radioactive particles in the terrestrial food chain appears to be low, with no evidence for any alpha-emitting hot particles in foodstuffs for consumption by humans. Results suggest that there is no significant dose to man through inhalation or ingestion pathways. (author)

  3. Fotogenia literaria en Carreteras secundarias, de Ignacio Martínez de Pisón: un viaje de ida y vuelta

    Directory of Open Access Journals (Sweden)

    García-Abad García, M. Teresa

    2005-06-01

    Full Text Available The cinema, his synthetic character, and the dialogue that it establishes from the origin with other arts as literature, has not stopped offering a wide space of synergies for the adaptation practice and for the study of confluence areas between image and word. New generations of writers and directors propiciate across their work an opening that, beside integrating the expressive resources of the literature and the screen, consider the text as a productive and plural activity, capable of being spread in a stereophony that postpones its meaning in every process of reading, making it coincide with a practice of writing and creation. Ignacio Martinez de Pisón's literature contains sugerent keys to advance in the dialogue between literature and cinema in current Spanish narrative.El cine, su carácter sintético, y el diálogo que desde el origen establece con otras artes como la literatura, no han dejado de ofrecer un espacio amplio de sinergias para la práctica adaptativa y para la reflexión acerca de los ámbitos de confluencia entre la imagen y la palabra. Las generaciones de escritores y de directores más jóvenes propician a través de su obra una apertura que, además de integrar los recursos expresivos de la literatura y la pantalla, considera al texto como una actividad productiva y plural capaz de diseminarse en una estereofonía que aplaza su significado en cada proceso de lectura haciéndolo coincidir con una práctica de escritura y de creación. La literatura de Martínez de Pisón contiene claves sugerentes para desentrañar este diálogo entre literatura y cine en la narrativa española actual.

  4. Critical phenomena of liquid 4He in the vicinity of the upper lambda point

    International Nuclear Information System (INIS)

    Takada, T.; Watanabe, T.

    1982-01-01

    We determined C/sub p/ along six isobars near T/sub lambda/ in the vicinity of the upper superfluid transition point (upper lambda point) from measurements of C/sub v/ and (partialP/partialT)/sub v/ along six isochores. C/sub p/ was analyzed with the function C/sub p/ = (A/α)epsilon/sup -alpha/(1+Depsilon/sup -Delta/)+B for T>T/sub lambda/, and the same function with primed coefficients for T 4 He near T/sub lambda/, that is, the correction term due to the irrelevant variable increases with pressure even in the small range epsilon - 3 . This indicates that the pressure depresses the true critical region. The universality of the amplitude ratio A/A' was confirmed even in the vicinity of the upper lambda point by specific heat measurements. With constraints α = α' = -0.02, δ = δ' = -0.5, and B = B' the pressure-independent amplitude ratios A/A' = 1.088 +- 0.007 and D/D' = 0.85 +- 0.2 were obtained. AD/A'D' = 0.93 +- 0.2 implies that the pressure has a similar effect on C/sub p/ in the normal fluid and superfluid regions, within experimental errors

  5. Flow- topography Interactions in the Vicinity of a Deep Ocean Island and a Ridge

    Science.gov (United States)

    2015-09-30

    1 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Flow- topography Interactions in the Vicinity of a Deep...flow around abrupt topography in operational Navy models. RELATED PROJECTS NRL FY17 6.2 New Start proposal (pending proposal), titled...Predictability of Flow Interacting with Abrupt Topography (FIAT)”; lead PI: Ana Rice, NRL-SSC. The objective of FIAT is to use observations to develop Navy

  6. Application of a LEED apparatus provided with a lens to the study of vicinal surfaces

    International Nuclear Information System (INIS)

    Laydevant, Louis; Dupuy, J.C.

    1979-01-01

    Steps presence on vicinal surfaces changes the low energy electron difraction (LEED) pattern: a system of regulary spaced steps is causing some spots to be splitted. Using a high voltage LEED apparatus allows an easy explanation of the patterns: the spot position does not depend about energy and so some cristallographic parameters can be easily measured [fr

  7. A method for detection of hydroxyl radicals in the vicinity of biomolecules using radiation-induced fluorescence of coumarin

    International Nuclear Information System (INIS)

    Makrigiorgos, G.M.; Baranowska-Kortylewicz, J.; Bump, E.; Sahu, S.K.; Berman, R.M.; Kassis, A.I.

    1993-01-01

    A novel method is described to quantitate radiation-induced hydroxyl radicals in the vicinity of biomolecules in aqueous solutions. Coumarin-3-carboxylic acid (CCA) is a non-fluorescent molecule that, upon interaction with radiation in aqueous solution, produces fluorescent products. CCA was derivatized to its succinimidyl ester (SECCA) and coupled to free primary amines of albumin, avidin, histone-H1, polylysine, and an oligonucleotide. When SECCA-biomolecule conjugates were irradiated, the relationship between induced fluorescence and dose was linear in the dose range examined (0.01-10 Gy). The data indicate that the induction of fluorescence on SECCA-biomolecule conjugates records specifically the presence of the hydroxyl radical in the immediate vicinity of the irradiated biomolecule. The method is rapid and sensitive, uses standard instrumentation, and the sample remains available for further studies. (Author)

  8. Radiolysis of water in the vicinity of passive surfaces

    International Nuclear Information System (INIS)

    Moreau, S.; Fenart, M.; Renault, J.P.

    2014-01-01

    Highlights: • HO° production through water radiolysis is enhanced near metal surfaces. • Hastelloy and Stainless steel surfaces can also produce HO° radicals through hydrogen peroxide activation. • There is a deficit in solvated electron production compared to hydroxyl radicals near metal surfaces. - Abstract: Porous metals were used to describe the water radiolysis in the vicinity of metal surfaces. The hydroxyl radical production under gamma irradiation was measured by benzoate scavenging in water confined in a 200 nm porous Ni base alloy or in Stainless steel. The presence of the metallic surfaces changed drastically the HO° production level and lifetime. The solvated electron production was measured via glycylglycine scavenging for Stainless steel and was found to be significantly smaller than hydroxyl production. These observations imply that interfacial radiolysis may deeply impact the corrosion behavior of the SS and Ni based alloys

  9. A review of potential neurotoxic mechanisms among three chlorinated organic solvents

    International Nuclear Information System (INIS)

    Bale, Ambuja S.; Barone, Stan; Scott, Cheryl Siegel; Cooper, Glinda S.

    2011-01-01

    The potential for central nervous system depressant effects from three widely used chlorinated solvents, trichloroethylene (TCE), perchloroethylene (PERC), and dichloromethane (DCM), has been shown in human and animal studies. Commonalities of neurobehavioral and neurophysiological changes for the chlorinated solvents in in vivo studies suggest that there is a common mechanism(s) of action in producing resultant neurotoxicological consequences. The purpose of this review is to examine the mechanistic studies conducted with these chlorinated solvents and to propose potential mechanisms of action for the different neurological effects observed. Mechanistic studies indicate that this solvent class has several molecular targets in the brain. Additionally, there are several pieces of evidence from animal studies indicating this solvent class alters neurochemical functions in the brain. Although earlier evidence indicated that these three chlorinated solvents perturb the lipid bilayer, more recent data suggest an interaction between several specific neuronal receptors produces the resultant neurobehavioral effects. Collectively, TCE, PERC, and DCM have been reported to interact directly with several different classes of neuronal receptors by generally inhibiting excitatory receptors/channels and potentiating the function of inhibitory receptors/channels. Given this mechanistic information and available studies for TCE, DCM, and PERC, we provide hypotheses on primary targets (e.g. ion channel targets) that appear to be most influential in producing the resultant neurological effects. - Research highlights: → Comparison of neurological effects among TCE, PERC, and DCM. → Correlation of mechanistic findings to neurological effects. → Data support that TCE, PERC, and DCM interact with several ion channels to produce neurological changes.

  10. Telling Tales of War to Teens: Ignacio Martínez de Pisón's Una guerra africana and Morocco as "Open Wound" in the Spanish National Imaginary

    Directory of Open Access Journals (Sweden)

    Silvia Bermúdez

    2006-01-01

    Full Text Available Exactly ten years after its traumatic defeat in the Spanish-American War of 1898, Spain appeared to find some compensation for the loss of its last colonies by undertaking the invasion of Morocco in 1908. The enterprise proved difficult when the forces of Abd-el-Krim defeated the Spanish army in the summer of 1921. This terrible loss was metaphorized as an "open wound" and entered the collective imagination by becoming a theme in novels such as José Díaz Fernández's El blocao (1928, Ramón Sender's Imán (1930, and Arturo Barea's series La forja de un rebelde (1941-1944. Known as the "Disaster of Annual," the defeat appeared to be almost forgotten until a series of narratives in the late twentieth and early twenty-first centuries obsessively returned to this particular moment of Spanish history. I focus on how one such narrative, Martínez de Pisón's Una guerra africana (2000, revisits this war as adolescent literature ("novelas juveniles" and within the literary genre of the "novels of the War in Africa," and by so doing, contributes to the articulation of a Spanish collective identity with the historical memory of the feared Moroccan Other.

  11. Voluntad de estilo en el muy joven José Martínez Ruiz: un aprendiz de crítico satírico (1893-1894

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Martín-Hervás Jiménez

    2017-02-01

    Full Text Available Este artículo se enmarca dentro la etapa de producción juvenil de José Martínez Ruiz, Azorín (1873-1967 y en él se analizan con un doble objetivo las tres primeras obras de su carrera literaria: La crítica literaria en España (1893, Moratín (1893 y Buscapiés (1894. El primer y principal objetivo consiste en utilizar como fundamento metodológico la teoría de la voluntad de estilo desarrollada por Juan Marichal en su libro Teoría e historia del ensayismo hispánico (1984 para analizar el tipo de personalidad literaria que aspiró a construirse el autor en sus tres primeras obras. En segundo lugar, se comprobará si es cierto o no que bebió en ellas de las fuentes de la ideología anarquista para forjar su imagen pública de escritor. Se concluirá que el futuro Azorín se encontraba en el periodo de 1893-1894 en una fase de aprendizaje y de búsqueda de maestros en la que quiso proyectar de sí mismo la imagen de Crítico Discordante o Crítico Satírico. Asimismo, se aclarará que hasta el momento todavía no había encontrado en el anarquismo el sustrato ideológico-estético que impregnará obras posteriores.

  12. Thermal plume behaviour and dispersion in the vicinity of Madras Atomic Power Station (east coast of India)

    International Nuclear Information System (INIS)

    Anup Kumar, B.; Rao, T.S.; Narasimhan, S.V.

    2002-01-01

    Thermal ecology studies were carried out in the vicinity of Madras Atomic Power Station (MAPS). During the course of the investigations (monthly cruises) both vertical and spatial distribution of temperature in the vicinity of the power plant out fall and mixing zone were measured using temperature probes (Accuracy ± 0.05 deg C.) The boat cruises covered an sea of 2.5 km 2 and in this region the sea surface temperature ranged from 28 to 34 deg C. At a depth of 2 m and below the temperature reaches ambient sea temperature levels (27-28 deg C). During the majority of cruises carried out, the sea current was towards north; hence most the sampling points were fixed towards north of the MAPS. The area occupied by the thermal plume was 1.3 sq. km. The sea surface temperature was found to be dependent on the seasonal current variations. (author)

  13. Predicted thermal and stress environments in the vicinity of repository openings

    International Nuclear Information System (INIS)

    Bauer, S.J.; Hardy, M.P.; Lin, M.

    1991-01-01

    An understanding of the thermal and stress environment in the vicinity of repository openings is important for preclosure performance considerations and worker health and safety considerations for the proposed high-level radioactive waste repository at Yucca Mountain. This paper presents the results of two and three dimensional numerical analyses which have determined the thermal and stress environments for typical repository openings. In general, it is predicted that openings close to heat sources attain high temperatures and experience a significant stress increase. Openings away from heat sources experience more uniform temperature changes and experience a stress change which results in part from a far-field thermal loading

  14. Using expansive grasses for monitoring heavy metal pollution in the vicinity of roads.

    Science.gov (United States)

    Vachová, Pavla; Vach, Marek; Najnarová, Eva

    2017-10-01

    We propose a method for monitoring heavy metal deposition in the vicinity of roads using the leaf surfaces of two expansive grass species which are greatly abundant. A principle of the proposed procedure is to minimize the number of operations in collecting and preparing samples for analysis. The monitored elements are extracted from the leaf surfaces using dilute nitric acid directly in the sample-collection bottle. The ensuing steps, then, are only to filter the extraction solution and the elemental analysis itself. The verification results indicate that the selected grasses Calamagrostis epigejos and Arrhenatherum elatius are well suited to the proposed procedure. Selected heavy metals (Zn, Cu, Pb, Ni, Cr, and Cd) in concentrations appropriate for direct determination using methods of elemental analysis can be extracted from the surface of leaves of these species collected in the vicinity of roads with medium traffic loads. Comparing the two species showed that each had a different relationship between the amounts of deposited heavy metals and distance from the road. This disparity can be explained by specific morphological properties of the two species' leaf surfaces. Due to the abundant occurrence of the two species and the method's general simplicity and ready availability, we regard the proposed approach to constitute a broadly usable and repeatable one for producing reproducible results. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Radiation hygienic annual report 2012. General environmental radioactivity and radiation surveillance in the vicinity of nuclear facilities in Bavaria

    International Nuclear Information System (INIS)

    Pfau, T.; Bernkopf, J.; Klement, R.; Bayerisches Landesamt fuer Umwelt, Augsburg

    2013-01-01

    The radiation hygienic annual report 2012 includes the following issues: (1) Introduction: Legal aspects of the surveillance, implementation of the radiation protection law, nuclear facility sites in Bavaria, interim storage facilities in Bavaria. (2) Natural radioactivity surveillance: measured data for the exposure paths air, water, food chain land, food chain water, residuals and waste. (3) Radiation surveillance in the vicinity of nuclear facilities in Bavaria: measures for air, precipitation, soils, plants, food chain land, milk and milk products, surface water, food chain water, drinking and ground water; measured data in the vicinity of NNP Isar 1 bd Isar 2 (KKI1/KKI2), NPP Gundremmingen (KGG), NPP Grafenrheinfeld (KKG), research neutron source Muenchen FRM II; emissions, meteorological conditions, spreading calculations.

  16. Polymer relaxations in thin films in the vicinity of a penetrant or a temperature induced glass transition

    NARCIS (Netherlands)

    Ogieglo, Wojciech; Wessling, Matthias; Benes, Nieck Edwin

    2014-01-01

    The transient properties of thin glassy polymer films in the vicinity of the glass transition are investigated. We compare the differences and similarities between sorption and temperature induced glass transitions, referred to as Pg and Tg, respectively. The experimental technique used is in situ

  17. Francisco A. Ortega Martínez y Yobenj Aucardo Chicangana-Bayona, eds. Conceptos fundamentales de la cultura política de la Independencia.

    Directory of Open Access Journals (Sweden)

    Margarita Garrido

    2016-07-01

    Full Text Available El libro editado por Francisco Ortega Martínez y Yobenj Aucardo Chicangana-Bayona es, en buena parte, producto de una investigación colectiva sobre los lenguajes políticos del período de la Independencia neogranadina, iniciada ya hace más de siete años con un grupo de estudiantes de maestría de la Universidad Nacional que, al ampliar sus fronteras, ha involucrado a otros investigadores nacionales y extranjeros, con quienes discute su propuesta metodológica y de principios con respecto a la historia conceptual. Lo interesante es que el libro no es la respuesta a un llamado a enviar artículos que más o menos se acomoden a unos temas y problemas, sino el resultado de lecturas conjuntas, debates y reflexiones que le permitió compartir a los autores lo que en su momento entendían por historia conceptual y por cultura política. Así, decidieron formular preguntas que no solo dieran cuenta de la semántica histórica sino que además, como lo plantean en la introducción, indagan por las experiencias que alimentaron los sentidos dados a un concepto y las expectativas que despertaron entre quienes lo usaron. Los conceptos a trabajar fueron escogidos, entendiendo que tenían esa calidad precisamente por haber estado en el centro de los debates por el sentido y el significado de los acontecimientos; porque fue con esos conceptos que los contemporáneos reflexionaron y elaboraron las experiencias vividas.

  18. Numerical simulation of blast wave propagation in vicinity of standalone prism on flat plate

    Science.gov (United States)

    Valger, Svetlana; Fedorova, Natalya; Fedorov, Alexander

    2018-03-01

    In the paper, numerical simulation of shock wave propagation in the vicinity of a standalone prism and a prism with a cavity in front of it was carried out. The modeling was based on the solution of 3D Euler equations and Fluent software was used as a main computational tool. The algorithm for local dynamic mesh adaptation to high gradients of pressure was applied. The initial stage of the explosion of condensed explosive was described with the help of "Compressed balloon method". The research allowed describing the characteristic stages of the blast in a semi-closed space, the structure of secondary shock waves and their interaction with obstacles. The numerical approach in Fluent based on combining inviscid gas dynamics methods and "Compressed balloon method" was compared with the method which had been used by the authors earlier with the help of AUTODYN and which is based on the use of the hydrodynamic model of a material to describe state of detonation products. For the problem of shock wave propagation in the vicinity of standalone prism the comparison of the simulation results obtained using both the methods with the experimental data was performed on the dependence of static pressure and effective momentum on time for the characteristic points located on prism walls.

  19. REHABILITACIÓN DE SUELOS SALINO-SÓDICOS: ESTUDIO DE CASO EN EL DISTRITO DE RIEGO 086, JIMÉNEZ, TAMAULIPAS, MÉXICO

    Directory of Open Access Journals (Sweden)

    Juana Irma Manzano Banda

    2014-07-01

    Full Text Available Se evaluó el efecto de la aplicación de estiércol bovino, yeso, ácido sulfúrico y lavado de suelos sobre la concentración de sales solubles y proporción de sodio en dos suelos salino-sódicos, provenientes del Distrito de Riego 086 de Jiménez, Tamaulipas, México. Se utilizaron macetas con 6 kg de suelo bajo condiciones de invernadero para ensayar dos niveles de salinidad-sodicidad (suelo Carretas con nivel moderado y suelo Macahuistle con nivel alto, dos mejoradores inorgánicos (yeso y ácido sulfúrico y un mejorador orgánico (estiércol. Se utilizó un diseño experimental completamente al azar con arreglo factorial 2 × 2 × 3. Las variables de respuesta fueron conductividad eléctrica (CE, porciento de sodio intercambiable (PSI y pH. La salinidad inicial en el suelo Carretas, con CE = 7.75 dS m-1 y Macahuistle con CE = 22.2 dS m-1, disminuyó a menos de 4 dS m-1. El PSI inicial del suelo Carretas fue 18.4 y el del suelo Macahuistle 34, valores que se abatieron a niveles menores de 8. El pH inicial de 7.8 en el suelo Carretas y 8 en el suelo Macahuistle, disminuyeron a un valor de 7.4 con la aplicación de estiércol y ácido sulfúrico. El lavado redujo la salinidad y sodicidad de ambos suelos hasta niveles satisfactorios para cultivos convencionales, con y sin de la aplicación de estiércol bovino, yeso y ácido sulfúrico.

  20. 77 FR 1973 - Environmental Impact Statement: In the Vicinity of the City and Borough of Juneau, AK

    Science.gov (United States)

    2012-01-12

    ... Vicinity of the City and Borough of Juneau, AK AGENCY: Alaska Department of Transportation and Public..., in cooperation with DOT&PF, will prepare a supplemental environmental impact statement (SEIS) for... from Juneau within the Lynn Canal corridor to provide travel flexibility, capacity to meet demand, and...

  1. A preliminary appraisal of sediment sources and transport in Kings Bay and vicinity, Georgia and Florida

    Science.gov (United States)

    McConnell, J.B.; Radtke, D.B.; Hale, T.W.; Buell, G.R.

    1983-01-01

    Water-quality, bottom-material, suspended-sediment, and current-velocity data were collected during November 1981 in Kings Bay and vicinity to provide information on the sources and transport of estuarine sediments. Kings Bay and Cumberland Sound , the site of the Poseidon Submarine Base in southeast Georgia, are experiencing high rates of sediment deposition and accumulation, which are causing serious navigational and operational problems. Velocity, bathymetry, turbidity, and bottom-material data suggest that the area in the vicinity of lower Kings Bay is accumulating deposits of suspended sediment transported from Cumberland Sound on the floodtide and from upper Kings Bay and the tidal marsh drained by Marianna Creek on the ebbtide. Suspended-sediment discharges computed for consecutive 13-hour ebbtides and floodtides showed that a net quantity of suspended sediment was transported seaward from upper Kings Bay and Marianna Creek. A net landward transport of suspended sediment computed at the St. Marys Entrance indicated areas seaward of St. Marys Entrance may be supplying sediment to the shoaling areas of the estuary, including lower Kings Bay. (USGS)

  2. Cancer mortality in towns in the vicinity of incinerators and installations for the recovery or disposal of hazardous waste.

    Science.gov (United States)

    García-Pérez, Javier; Fernández-Navarro, Pablo; Castelló, Adela; López-Cima, María Felicitas; Ramis, Rebeca; Boldo, Elena; López-Abente, Gonzalo

    2013-01-01

    Waste treatment plants release toxic emissions into the environment which affect neighboring towns. To investigate whether there might be excess cancer mortality in towns situated in the vicinity of Spanish-based incinerators and installations for the recovery or disposal of hazardous waste, according to the different categories of industrial activity. An ecologic study was designed to examine municipal mortality due to 33 types of cancer, across the period 1997-2006. Population exposure to pollution was estimated on the basis of distance from town of residence to pollution source. Using Besag-York-Mollié (BYM) regression models with Integrated Nested Laplace approximations for Bayesian inference, and Mixed Poisson regression models, we assessed the risk of dying from cancer in a 5-kilometer zone around installations, analyzed the effect of category of industrial activity, and conducted individual analyses within a 50-kilometer radius of each installation. Excess cancer mortality (BYM model: relative risk, 95% credible interval) was detected in the total population residing in the vicinity of these installations as a whole (1.06, 1.04-1.09), and, principally, in the vicinity of incinerators (1.09, 1.01-1.18) and scrap metal/end-of-life vehicle handling facilities, in particular (1.04, 1.00-1.09). Special mention should be made of the results for tumors of the pleura (1.71, 1.34-2.14), stomach (1.18, 1.10-1.27), liver (1.18, 1.06-1.30), kidney (1.14, 1.04-1.23), ovary (1.14, 1.05-1.23), lung (1.10, 1.05-1.15), leukemia (1.10, 1.03-1.17), colon-rectum (1.08, 1.03-1.13) and bladder (1.08, 1.01-1.16) in the vicinity of all such installations. Our results support the hypothesis of a statistically significant increase in the risk of dying from cancer in towns near incinerators and installations for the recovery or disposal of hazardous waste. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. Corrosion of Steels in the Vicinity of a Sodium-Water Reaction

    Energy Technology Data Exchange (ETDEWEB)

    Davies, R. A.; Bray, J. A.; Lyons, J. M. [U.K. Atomic Energy Authority, Dounreay Experimental Reactor Establishment, Thurso, Caithness (United Kingdom)

    1967-06-15

    Rapid corrosion of steels in the vicinity of a sodium-water reaction could lead to a major reaction in a sodium-water heat exchanger. An investigation of the magnitude of the corrosion problem has been carried out under conditions simulating both a small water leak and a full size pipe burst, and further tube failures have been obtained. These experiments were carried out on a sodium rig which could accommodate simple full-scale models of sections of heat exchanger, and up to 70 lb of water was injected into 700 lb of sodium in 9.0s. The corrosion phenomena have also been investigated on a small scale under more controllable conditions by pumping water at normal pressures into a pot of sodium. With a flow-rate of 1 ml/min corrosion rates in excess of 0.005 in./min have been obtained. The effect of various parameters on the corrosion rate has been studied, and a comparison has been made of the corrosion rates obtained with a variety of steels. The corrosion appears to be a direct result of conditions during the reaction, and the appearance of the specimen and pattern of damage suggests that the main effect is concentrated where the sodium water reaction front impinges on the metal surface. The corrosion rates are very much lower with stainless steel and nickel alloys than with ferritic materials, and suggest that the phenomena are associated with the formation of (Na{sub 2}O){sub 2}FeO. Iron powder has also been observed in the vicinity of the reaction which would suggest that this is reduced at a later stage, either as a result of the hydrogen produced during reaction, or by thermal cycling. (author)

  4. 14 CFR 91.145 - Management of aircraft operations in the vicinity of aerial demonstrations and major sporting...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Management of aircraft operations in the... greater than the minimum airspace necessary for the management of aircraft operations in the vicinity of... be greater than the minimum airspace necessary for the management of aircraft operations in the...

  5. The HYLOCOMIUM SPLENDENS use for research of Ignalina NPP vicinity contamination by Cs 137 and Co 60

    International Nuclear Information System (INIS)

    Kiponas, D.; Marchiulenene, D.

    2002-01-01

    The superficial distribution of Cs 137 and Co 60 and specific activity of these radionuclides in Hylocomium splendens in Ignalina NPP vicinity was investigated. The increase of Cs 137 and Co 60 specific activity in Hylocomium splendens was linked with increasing of these radionuclides activity in atmospheric deposits

  6. EISCAT and Cluster observations in the vicinity of the dynamical polar cap boundary

    Directory of Open Access Journals (Sweden)

    A. T. Aikio

    2008-02-01

    Full Text Available The dynamics of the polar cap boundary and auroral oval in the nightside ionosphere are studied during late expansion and recovery of a substorm from the region between Tromsø (66.6° cgmLat and Longyearbyen (75.2° cgmLat on 27 February 2004 by using the coordinated EISCAT incoherent scatter radar, MIRACLE magnetometer and Cluster satellite measurements. During the late substorm expansion/early recovery phase, the polar cap boundary (PCB made zig-zag-type motion with amplitude of 2.5° cgmLat and period of about 30 min near magnetic midnight. We suggest that the poleward motions of the PCB were produced by bursts of enhanced reconnection at the near-Earth neutral line (NENL. The subsequent equatorward motions of the PCB would then represent the recovery of the merging line towards the equilibrium state (Cowley and Lockwood, 1992. The observed bursts of enhanced westward electrojet just equatorward of the polar cap boundary during poleward expansions were produced plausibly by particles accelerated in the vicinity of the neutral line and thus lend evidence to the Cowley-Lockwood paradigm.

    During the substorm recovery phase, the footpoints of the Cluster satellites at a geocentric distance of 4.4 RE mapped in the vicinity of EISCAT measurements. Cluster data indicate that outflow of H+ and O+ ions took place within the plasma sheet boundary layer (PSBL as noted in some earlier studies as well. We show that in this case the PSBL corresponded to a region of enhanced electron temperature in the ionospheric F region. It is suggested that the ion outflow originates from the F region as a result of increased ambipolar diffusion. At higher altitudes, the ions could be further energized by waves, which at Cluster altitudes were observed as BBELF (broad band extra low frequency fluctuations.

    The four-satellite configuration of Cluster revealed a sudden poleward expansion of the PSBL by 2° during

  7. La Seguridad Integral: España 2020

    OpenAIRE

    Pardo Buendía, Mercedes

    2009-01-01

    Dirección y co-redacción principal: Óscar Jaime Jiménez, Antonio M. Díaz Fernández. Expertos que han participado en la elaboración: Rogelio Alonso Pascual, Félix Arteaga Martín, Pedro Arrojo Agudo, Rut Bermejo Casado, Julio Bordas Martínez, Lorenzo Castro Moral, Andrés García Gómez, Raúl C. Mainar-Jaime, Rafael Martínez Martínez, Miguel Ángel Muñoz Rodríguez, Mercedes Pardo Buendía, René Pita Pita, Gonzalo Sáenz de Miera, Fernando Soteras Escartín, Diego Torrente Robles, F...

  8. Opinion survey among residents in the vicinity of wind farms, elected representatives, and general public. Synthesis of results

    International Nuclear Information System (INIS)

    Fourquet, Jerome; Gariazzo, Marie; Merceron, Adeline

    2016-09-01

    This document presents results of a survey comprising a qualitative survey among residents at the vicinity of wind farms, a quantitative survey among the same kind of residents and among a sample representing the French population older than 18, and a qualitative survey among elected representatives of local communities. Graphs illustrate results in terms of opinion on wind energies, of relationship between information and confidence in a wind farm project. Three sets of residents living everyday at the vicinity of wind farms are synthesised in terms of opinion: the convinced ones, the unconcerned ones, and the upset ones. The opinions in terms of impacts (income for local communities and for farmers, the proof of a commitment for a virtuous ecological policy, a way to impulse a dynamics, or local curiosity) are also assessed. The main levers for a higher acceptance of wind farms are identified

  9. Turbulent flow in a ribbed channel: Flow structures in the vicinity of a rib

    DEFF Research Database (Denmark)

    Wang, Lei; Salewski, Mirko; Sundén, Bengt

    2010-01-01

    PIV measurements are performed in a channel with periodic ribs on one wall. The emphasis of this study is to investigate the flow structures in the vicinity of a rib in terms of mean velocities, Reynolds stresses, probability density functions (PDF), and two-point correlations. The PDF distribution......-based visualization is applied to the separation bubble upstream of the rib. Salient critical points and limit cycles are extracted, which gives clues to the physical processes occurring in the flow....

  10. Ferrofluid magnetization in the bulk and in the vicinity of an interface to Si

    Energy Technology Data Exchange (ETDEWEB)

    Vorobiev, A.; Axelrod, L.; Gordeev, G.; Major, J.; Zabenkin, V.; Toperverg, B.P

    2003-07-01

    The process of ferrofluid (FF) magnetization in low magnetic field is investigated by polarized neutrons in the bulk of the sample and in the vicinity of its bottom interface with an Si wafer. The bulk magnetization is determined in experiments on the Larmor precession of the polarization vector of neutrons passing through the FF sample. The magnetization of the bottom layer is obtained with polarized neutron reflectometry. An appreciable difference between those two cases is shown.

  11. Visual impairment and blindness among the students of blind schools in Allahabad and its vicinity: A causal assessment.

    Science.gov (United States)

    Bhalerao, Sushank Ashok; Tandon, Mahesh; Singh, Satyaprakash; Dwivedi, Shraddha; Kumar, Santosh; Rana, Jagriti

    2015-03-01

    Information on eye diseases in blind school children in Allahabad is rare and sketchy. A cross-sectional study was performed to identify causes of blindness (BL) in blind school children with an aim to gather information on ocular morbidity in the blind schools in Allahabad and in its vicinity. A cross-sectional study was carried out in all the four blind schools in Allahabad and its vicinity. The students in the blind schools visited were included in the study and informed consents from parents were obtained. Relevant ocular history and basic ocular examinations were carried out on the students of the blind schools. A total of 90 students were examined in four schools of the blind in Allahabad and in the vicinity. The main causes of severe visual impairment and BL in the better eye of students were microphthalmos (34.44%), corneal scar (22.23%), anophthalmos (14.45%), pseudophakia (6.67%), optic nerve atrophy (6.67%), buphthalmos/glaucoma (3.33%), cryptophthalmos (2.22%), staphyloma (2.22%), cataract (2.22%), retinal dystrophy (2.22%), aphakia (1.11%), coloboma (1.11%), retinal detachment (1.11%), etc. Of these, 22 (24.44%) students had preventable causes of BL and another 12 (13.33%) students had treatable causes of BL. It was found that hereditary diseases, corneal scar, glaucoma and cataract were the prominent causes of BL among the students of blind schools. Almost 38% of the students had preventable or treatable causes, indicating the need of genetical counseling and focused intervention.

  12. Visual impairment and blindness among the students of blind schools in Allahabad and its vicinity: A causal assessment

    Directory of Open Access Journals (Sweden)

    Sushank Ashok Bhalerao

    2015-01-01

    Full Text Available Background/Aims: Information on eye diseases in blind school children in Allahabad is rare and sketchy. A cross-sectional study was performed to identify causes of blindness (BL in blind school children with an aim to gather information on ocular morbidity in the blind schools in Allahabad and in its vicinity. Study Design and Setting: A cross-sectional study was carried out in all the four blind schools in Allahabad and its vicinity. Materials and Methods: The students in the blind schools visited were included in the study and informed consents from parents were obtained. Relevant ocular history and basic ocular examinations were carried out on the students of the blind schools. Results: A total of 90 students were examined in four schools of the blind in Allahabad and in the vicinity. The main causes of severe visual impairment and BL in the better eye of students were microphthalmos (34.44%, corneal scar (22.23%, anophthalmos (14.45%, pseudophakia (6.67%, optic nerve atrophy (6.67%, buphthalmos/glaucoma (3.33%, cryptophthalmos (2.22%, staphyloma (2.22%, cataract (2.22%, retinal dystrophy (2.22%, aphakia (1.11%, coloboma (1.11%, retinal detachment (1.11%, etc. Of these, 22 (24.44% students had preventable causes of BL and another 12 (13.33% students had treatable causes of BL. Conclusion: It was found that hereditary diseases, corneal scar, glaucoma and cataract were the prominent causes of BL among the students of blind schools. Almost 38% of the students had preventable or treatable causes, indicating the need of genetical counseling and focused intervention.

  13. Nuclear threats in the vicinity of the Nordic countries. Supplementary final report of the Nordic Nuclear Safety research

    International Nuclear Information System (INIS)

    Eikelmann, I.M.H.

    2006-04-01

    The purpose of this project was to continue the cross-disciplinary study SBA-1 'base of knowledge' in the NKS research program 1998-2001 regarding possible nuclear threats in the vicinity of the Nordic countries. The main task for the project was to expand and envelope this database. Finding information to be placed in the database and identifying and filling gaps in knowledge were prioritised. This is a continuous process which extends beyond the end of this project, in order to have an operating and updated database also in the years to come. In this project work has been done making information systems in Norway that can take care of the database in the future. The scope of the preceding project was to prepare a base of knowledge regarding possible nuclear threats in the vicinity of the Nordic countries. The database, including a literature database, is presented on the website 'Nuclear threats in the vicinity of the Nordic Countries'. The utilisation of modern information technology gives the user of the database easy access to information on different types of nuclear installations and threats. The project focused on potential events at nuclear installations and the consequences for the Nordic countries, especially with regards to vulnerable food chains, doses to man, environmental contamination and emergency preparedness systems. The geographical area dealt with includes North-west Russia and the Baltic states and the nuclear installations investigated are nuclear power plants, ship reactors and storage and handling of used fuel and radioactive waste. (au)

  14. Emigration of Natural and Hatchery Chinook Salmon and Steelhead Smolts from the Imnaha River, Oregon, Progress Report 2000-2002.

    Energy Technology Data Exchange (ETDEWEB)

    Cleary, Peter; Kucera, Paul; Blenden, Michael

    2003-12-01

    This report summarizes the emigration studies of the Nez Perce Tribe in the Imnaha River subbasin during the 2001 and 2002 migration years. A migration year for the Imnaha River is defined here as beginning July 31 of the previous year and ending July 30 the following year. The conclusion of the studies at the end of migration year 2002 marked the 11th year of the Nez Perce Tribe's Lower Snake River Emigration Studies. The Nez Perce Tribe has participated in the Fish Passage Center's Smolt Monitoring Program for nine of the 11 years. These studies collect and tag juvenile chinook salmon and steelhead at two locations in the fall, rkm 74 and rkm 7, and at rkm 7 during the spring. Data from captured and tagged fish provide an evaluation of hatchery production and releases strategies, post release survival of hatchery chinook salmon, abundance of natural chinook salmon, and downstream survival and arrival timing of natural and hatchery chinook salmon and steelhead. The hydrologic conditions that migrating fish encountered in 2001 were characterized as a drought and conditions in 2002 were characterized as below average. Hatchery chinook salmon had a mean fork length that was 34 mm greater in 2001 and 35 mm greater in 2002 than the mean fork length of natural chinook smolts. Hatchery steelhead smolt mean fork lengths were 39 mm greater than natural steelhead smolts in 2001 and 44 mm greater than natural steelhead smolt fork lengths in 2002. A significant difference (p < 0.05) between hatchery and natural chinook salmon and steelhead fork lengths has been documented by these emigration studies from 1997 to 2002. Hatchery chinook salmon were volitionally released in 2001 and 2002 and the 90% arrivals for 2001 and 2002 at the lower rkm 7 trap were within the range of past observations of 22 to 38 days observed in 1999 and 2000. We estimated that 93.9% of the 123,014 hatchery chinook salmon released in 2001 survived to the lower trap and 90.2% of the 303

  15. Regional groundwater modeling of the saturated zone in the vicinity of Yucca Mountain, Nevada

    International Nuclear Information System (INIS)

    Ahola, M.; Sagar, B.

    1992-10-01

    Results of groundwater modeling of the saturated zone in the vicinity of Yucca Mountain are presented. Both a regional (200 x 200 km) and subregional (50 x 50 km) model were used in the analyses. Simulations were conducted to determine the impact of various disruptive that might take place over the life span of a proposed Yucca Mountain geologic conditions repository on the groundwater flow field, as well as changes in the water-table elevations. These conditions included increases in precipitation and groundwater recharge within the regional model, changes in permeability of existing hydrogeologic barriers, a:nd the vertical intrusion of volcanic dikes at various orientations through the saturated zone. Based on the regional analysis, the rise in the water-table under Yucca Mountain due to various postulated conditions ranged from only a few meters to 275 meters. Results of the subregional model analysis, which was used to simulate intrusive dikes approximately 4 kilometers in length in the vicinity of Yucca Mountain, showed water-table rises ranging from a few meters to as much as 103 meters. Dikes oriented approximately north-south beneath Yucca Mountain produced the highest water-table rises. The conclusions drawn from this analysis are likely to change as more site-specific data become available and as the assumptions in the model are improved

  16. Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez.

    Directory of Open Access Journals (Sweden)

    Francisco José Rodríguez Marín

    2013-01-01

    Full Text Available Revistas UMA Encabezado de página Usuaria/o Contraseña No cerrar sesión Notificaciones Vista Suscribirse Idioma Contenidos Examinar Por número Por autor/a Por título Otras revistas Información Para lectores/as Para autores/as Para bibliotecarios/as Open Journal Systems Inicio Acerca de Actual Archivos Avisos Inicio > Núm. 34 (2013 > Rodríguez Marín Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez. Francisco José Rodríguez Marín Resumen Ver Resumen El interés de Rosario Camacho por la multiplicidad de mensajes y la cultura simbólica de carácter funerario fue, inicialmente, una consecuencia natural de sus investigaciones sobre la arquitectura barroca. En uno de sus libros más reconocidos, Málaga barroca. Arquitectura religiosa de los siglos XVII y XVIII (1981 analizó el panteón de los condes de Buenavista en la iglesia del monasterio de la Victoria y su impresionante conjunto de relieves y esculturas en torno a la muerte, recogiendo algunas de las interpretaciones que hasta entonces se habían realizado, como las de Juan Temboury o Santiago Sebastián. El carácter excepcional del conjunto arquitectónico de la iglesia, el monasterio, y especialmente, de la rica y original superposición de espacios verticales integrado por el mencionado panteón, la sacristía y el camarín de la Virgen, justifican la atención pormenorizada que se le prestó en una de las carpetas que, incluyendo planimetría y dedicadas al Barroco, fueron publicadas por el Colegio de Arquitectos de Málaga. La titulada El Santuario de la Victoria de Málaga (1986 tuvo por autores a Rosario Camacho y al arquitecto José María Romero.

  17. [Assessment of cyto- and genotoxicity of natural waters in the vicinity of radioactive waste storage facility using Allium-test].

    Science.gov (United States)

    Udalova, A A; Geras'kin, S A; Dikarev, V G; Dikareva, N S

    2014-01-01

    Efficacy of bioassays of "aberrant cells frequency" and "proliferative activity" in root meristem of Allium cepa L. is studied in the present work for a cyto- and genotoxicity assessment of natural waters contaminated with 90Sr and heavy metals in the vicinity of the radioactive waste storage facility in Obninsk, Kaluga region. The Allium-test is shown to be applicable for the diagnostics of environmental media at their combined pollution with chemical and radioactive substances. The analysis of aberration spectrum shows an important role of chemical toxicants in the mutagenic potential of waters collected in the vicinity of the radioactive waste storage facility. Biological effects are not always possible to explain from the knowledge on water contamination levels, which shows limitations of physical-chemical monitoring in providing the adequate risk assessment for human and biota from multicomponent environmental impacts.

  18. Is There Any Relationship Between Making Fire Insurance With Persons ’Demog raphics Features And Otherwise With Persons’ Anxiety Level?

    Directory of Open Access Journals (Sweden)

    Fatih Burak Gümüş

    2014-12-01

    Full Text Available This study builds individual households on the reasons for taking or not taking out a fire insurance policy. The main purpose of this study was to determine either demographic characteristics or level of anxiety was effective in taking out fire insurance policy. However, information about individuals’ perception of fire insurance was tried to be reached. For this purpose a questionnaire involving some demographic characteristics of individuals and also an international –Beck A-anxiety scale which aims at the determination of individuals level of anxiety was designed. The survey about individuals’ perce ptions of fire insurance was conducted face-to-face to 619 homeowners after excluding incorrectly entered questionnaires. According to the survey results obtained from the analysis, there is a significant association between the anxiety levels and taking out fire insurance policy. In addition, value of the housing and witnessing a fire within the vicinity of the house affect the perception of fire insurance policy. Individuals have been acted in agreement with expected utility theory, at the same time have not been acted different from efficient market hypothesis

  19. Investigation of the electromagnetic radiation field level in the vicinity of Damascus international airport

    International Nuclear Information System (INIS)

    Abukassem, I.

    2011-07-01

    The aim of this work is to estimate the electromagnetic radiation exposure of Damascus international airport workers.Different kinds of electromagnetic wave sources exist in the vicinity of the airport, for example, mobile phone base stations. It was found that the exposure level in all studied points (offices, halls, traffic control tour, etc) is lower than the international restriction levels. Few recommendations were given for some work situation or places where the measured electromagnetic radiation levels were relatively high.(author)

  20. Alternativas y acciones en el tema de residuos sólidos planteadas por las municipalidades de Jiménez y Oreamuno y su relación con el desarrollo y la sostenibilidad (Artículo informativo Alternatives and actions regarding solid residues, presented by Jimenez and Oreamuno municipalities and their relation to development and sustainability (Informative

    Directory of Open Access Journals (Sweden)

    Rooel Campos-Rodríguez

    2013-06-01

    Full Text Available Los procesos productivos no son totalmente eficientes, lo cual contribuye a la generación de residuos.  En Costa Rica, son las municipalidades las responsables del manejo integral de los residuos sólidos. Es por eso que la problemática de esta investigación se centra en el manejo de tales desechos, que se ha convertido en uno de los principales problemas ambientales que enfrentan los municipios del país.  Es necesario hacerle frente desde la perspectiva del desarrollo sostenible, para lo cual se requiere una nueva visión y sensibilización de los gobiernos locales y de los habitantes ante esta problemática.  Un ejemplo de cómo encarar la problemática ambiental es la labor que están desarrollando los municipios de Jiménez y Oreamuno. Estas dos instituciones han trabajado en aspectos de educación ambiental, desarrollo y sostenibilidad y han logrado resultados favorables en el tratamiento y disposición adecuada de los residuos sólidos.  El municipio de Oreamuno cuenta con un plan de manejo integral de residuos sólidos, tanto orgánicos como inorgánicos. También tiene un centro de acopio y se está trabajando en la implementación de biorreactores que permitirán la producción de bioabonos, captación de gas metano, remoción de metales en los lixiviados, así como la recuperación, comercialización y transformación de los residuos reciclables y reutilizables. Por su parte, el municipio de Jiménez realiza un manejo adecuado de los residuos; los desechos inorgánicos reciclables son aprovechados por medio del centro de acopio del cantón y los residuos orgánicos son transformados en abono orgánico, el cual se utiliza en las fincas de la localidad. El objetivo de este artículo es analizar estos planteamientos, así como su relación con el desarrollo y la sostenibilidad.Currently, the production processes are not efficient, which contributes to the generation of waste. In Costa Rica the municipalities are responsible for

  1. El Vignola del Colegio de Arquitectos de Valencia y sus retablos de traza sevillana: Juan Martínez Montañés

    Directory of Open Access Journals (Sweden)

    Navarrete Prieto, Benito

    2005-09-01

    Full Text Available Three drawings of altarpieces executed by the Sevillian sculptor Juan Martinez Montañés, preserved in the copy of Vignola's architectural treatise in the Colegio de Arquitectos de Valencia are analyzed here. The first drawing is a preliminary study for the altarpiece of the Immaculate Conception in the Parrochial Church of El Pedroso (Seville. The second drawing, also a preliminary idea, is for the lost altarpiece of the Dominican monastery of Portacelli in Seville, from which only the figure of St Dominic of Guzman flagellating himself has survived (Museo de Bellas Artes de Sevilla. The third is the model for the type of altarpiece-tabernacle used by Montañés in the Convent of Santa Clara (Seville. The author also points out the origin of certain elements of Montañés's designs in the prints of Vignola's treatise.

    Presentamos un análisis de tres de los dibujos de retablos que se conservan en el ejemplar del Vignola del Colegio de Arquitectos de Valencia y que pertenecen al escultor sevillano Juan Martínez Montañés. El primero de ellos es preparatorio para el retablo de la Inmaculada de la iglesia parroquial del Pedroso (Sevilla, conservado in situ actualmente. El segundo es para el perdido Retablo de los dominicos de Portacoeli de Sevilla, del que se conserva el Santo Domingo de Guzman azotándose en el Museo de Bellas Artes de Sevilla, y el tercero es modelo para la tipología del Montañés del Retablo-Tabernáculo en la iglesia del convento de Santa Clara de Sevilla, estudiándose además el origen de algunos elementos de Montañés en los propios grabados del libro de Vignola.

  2. Massive binaries in the vicinity of Sgr A*

    Energy Technology Data Exchange (ETDEWEB)

    Pfuhl, O.; Gillessen, S.; Genzel, R.; Eisenhauer, F.; Fritz, T. K.; Ott, T. [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Alexander, T. [Faculty of Physics, Weizmann Institute of Science, P.O. Box 26, Rehovot 76100 (Israel); Martins, F., E-mail: pfuhl@mpe.mpg.de [LUPM, Université Montpelier 2, CNRS, Place Eugéne Bataillon, F-34095, Montpellier (France)

    2014-02-20

    A long-term spectroscopic and photometric survey of the most luminous and massive stars in the vicinity of the supermassive black hole Sgr A* revealed two new binaries: a long-period Ofpe/WN9 binary, IRS 16NE, with a modest eccentricity of 0.3 and a period of 224 days, and an eclipsing Wolf-Rayet binary with a period of 2.3 days. Together with the already identified binary IRS 16SW, there are now three confirmed OB/WR binaries in the inner 0.2 pc of the Galactic center. Using radial velocity change upper limits, we were able to constrain the spectroscopic binary fraction in the Galactic center to F{sub SB}=0.30{sub −0.21}{sup +0.34} at a confidence level of 95%, a massive binary fraction close to that observed in dense clusters. The fraction of eclipsing binaries with photometric amplitudes Δm > 0.4 is F{sub EB}{sup GC}=3%±2%, which is consistent with local OB star clusters (F {sub EB} = 1%). Overall, the Galactic center binary fraction seems to be similar to the binary fraction in comparable young clusters.

  3. Closure plan for the M-Area settling basin and vicinity at the Savannah River Plant

    International Nuclear Information System (INIS)

    Colven, W.P.; Pickett, J.B.

    1985-07-01

    The areas addressed in this closure plan include a process sewer line, surface impoundment (settling basin), overflow ditch, seepage area, and a Carolina Bay known as Lost Lake. Since it is proposed that the basin and vicinity be closed with the hazardous wastes placed and stabilized in the basin, it will be closed pursuant to regulations for closing a hazardous waste landfill. No free liquids will remain in the impoundment after closure is completed

  4. Spatially correlated heterogeneous aspirations to enhance network reciprocity

    Science.gov (United States)

    Tanimoto, Jun; Nakata, Makoto; Hagishima, Aya; Ikegaya, Naoki

    2012-02-01

    Perc & Wang demonstrated that aspiring to be the fittest under conditions of pairwise strategy updating enhances network reciprocity in structured populations playing 2×2 Prisoner's Dilemma games (Z. Wang, M. Perc, Aspiring to the fittest and promoted of cooperation in the Prisoner's Dilemma game, Physical Review E 82 (2010) 021115; M. Perc, Z. Wang, Heterogeneous aspiration promotes cooperation in the Prisoner's Dilemma game, PLOS one 5 (12) (2010) e15117). Through numerical simulations, this paper shows that network reciprocity is even greater if heterogeneous aspirations are imposed. We also suggest why heterogeneous aspiration fosters network reciprocity. It distributes strategy updating speed among agents in a manner that fortifies the initially allocated cooperators' clusters against invasion. This finding prompted us to further enhance the usual heterogeneous aspiration cases for heterogeneous network topologies. We find that a negative correlation between degree and aspiration level does extend cooperation among heterogeneously structured agents.

  5. Revisiting mouse peritoneal macrophages: heterogeneity, development and function

    Directory of Open Access Journals (Sweden)

    Alexandra Dos Anjos Cassado

    2015-05-01

    Full Text Available Tissue macrophages play a crucial role in the maintenance of tissue homeostasis and also contribute to inflammatory and reparatory responses during pathogenic infection and tissue injury. The high heterogeneity of these macrophages is consistent with their adaptation to distinct tissue environments and specialization to develop niche-specific functions. Although peritoneal macrophages are one of best-studied macrophage populations, only recently it was demonstrated the co-existence of two subsets in mouse PerC, which exhibit distinct phenotypes, functions and origins. These macrophage subsets have been classified according to their morphology as LPMs (large peritoneal macrophages and SPMs (small peritoneal macrophages. LPMs, the most abundant subset under steady-state conditions, express high levels of F4/80 and low levels of class II molecules of the major histocompatibility complex (MHC. LPMs appear to be originated from embriogenic precursors, and their maintenance in PerC is regulated by expression of specific transcription factors and tissue-derived signals. Conversely, SPMs, a minor subset in unstimulated PerC, have a F4/80lowMHC-IIhigh phenotype and are generated from bone-marrow-derived myeloid precursors. In response to infectious or inflammatory stimuli, the cellular composition of PerC is dramatically altered, where LPMs disappear and SPMs become the prevalent population together with their precursor, the inflammatory monocyte. SPMs appear to be the major source of inflammatory mediators in PerC during infection whereas LPMs contribute for gut-associated lymphoid tissue (GALT-independent and retinoic acid-dependent IgA production by peritoneal B-1 cells. In the last years, considerable efforts have been made to broaden our understanding of LPM and SPM origin, transcriptional regulation and functional profile. This review addresses these issues, focusing on the impact of tissue-derived signals and external stimulation in the complex

  6. Spatial effects of Fano resonance in local tunneling conductivity in vicinity of impurity on semiconductor surface

    OpenAIRE

    Mantsevich, V. N.; Maslova, N. S.

    2009-01-01

    We present the results of local tunneling conductivity spatial distribution detailed theoretical investigations in vicinity of impurity atom for a wide range of applied bias voltage. We observed Fano resonance in tunneling conductivity resulting from interference between resonant tunneling channel through impurity energy level and direct tunneling channel between the tunneling contact leads. We have found that interference between tunneling channels strongly modifies form of tunneling conduct...

  7. Aportaciones a la flora Granatense, III

    OpenAIRE

    Martínez Parras, J.Mª.; Molero Mesa, J.

    1983-01-01

    Se comentan algunas especies nuevas o críticas para la provincia de Granada. Se establecen las nuevas combinaciones siguientes: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa y Cerastium alpinum subsp. nevadense (Pau) Martínez Parras & Molero Mesa. In this paper, some plants from Granada province are studied. The following new combinations are stablished: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa and Cerastium alpinum subsp. ...

  8. SU-F-T-126: Microdosimetic Evaluation of Proton Energy Distributions in the Vicinity of Metal Implants

    Energy Technology Data Exchange (ETDEWEB)

    Heczko, S; McAuley, GA; Slater, JM [Loma Linda University, Loma Linda, CA (United States); Wroe, A [Loma Linda University, Loma Linda, CA (United States); Loma Linda University Medical Center, Loma Linda, CA (United States)

    2016-06-15

    Purpose: To evaluate the impact of titanium and surgical stainless steel implants on the microscopic dose distribution in proton treatment plans Methods: Geant4 Monte Carlo simulations were used to analyze the microdosimetric distribution of proton radiation in the vicinity of 3.1 mm thick CP Grade 4 titanium (Ti) or 316 stainless steel (SS316) plates in a water phantom. Additional simulations were performed using either water, or water with a density equivalent to the respective metals (Tiwater, SS316water) (to reflect common practice in treatment planning). Implants were placed at the COM of SOBPs of 157 MeV (range of ∼15 cm in water) protons with 30 or 60 mm modulation. Primary and secondary particle dose and fluence, frequency-weighted and dose-weighted average lineal energy, average radiation quality factor, dose equivalent and energy deposition histograms in the plate vicinity were compared. Results: Preliminary results show frequency-weighted (yf) and dose-weighted lineal energy (yd) was increased downstream of the Ti plate (yf = 3.1 keV/µm; yd = 5.5 keV/µm) and Tiwater (yf = 4.1 keV/µm; yd = 6.8 keV/µm) compared to that of water (ie, the absence of a plate) (yf = 2.5 keV/µm; yd = 4.5 keV/µm). In addition, downstream proton dose deposition was also elevated due to the presence of the Ti plate or Tiwater. The additional dose deposited at higher lineal energy implies that tissues downstream of the plate will receive a higher dose equivalent. Detailed analyses of the Ti, Tiwater, SS316, and SS316 water simulations will be presented. Conclusion: The presence of high-density materials introduces changes in the spatial distribution of radiation in the vicinity of an implant. Further work quantifying these effects could be incorporated into future treatment planning systems resulting in more accurate treatment plans. This project was sponsored with funding from the Department of Defense (DOD # W81XWH-10-2-0192).

  9. SU-F-T-126: Microdosimetic Evaluation of Proton Energy Distributions in the Vicinity of Metal Implants

    International Nuclear Information System (INIS)

    Heczko, S; McAuley, GA; Slater, JM; Wroe, A

    2016-01-01

    Purpose: To evaluate the impact of titanium and surgical stainless steel implants on the microscopic dose distribution in proton treatment plans Methods: Geant4 Monte Carlo simulations were used to analyze the microdosimetric distribution of proton radiation in the vicinity of 3.1 mm thick CP Grade 4 titanium (Ti) or 316 stainless steel (SS316) plates in a water phantom. Additional simulations were performed using either water, or water with a density equivalent to the respective metals (Tiwater, SS316water) (to reflect common practice in treatment planning). Implants were placed at the COM of SOBPs of 157 MeV (range of ∼15 cm in water) protons with 30 or 60 mm modulation. Primary and secondary particle dose and fluence, frequency-weighted and dose-weighted average lineal energy, average radiation quality factor, dose equivalent and energy deposition histograms in the plate vicinity were compared. Results: Preliminary results show frequency-weighted (yf) and dose-weighted lineal energy (yd) was increased downstream of the Ti plate (yf = 3.1 keV/µm; yd = 5.5 keV/µm) and Tiwater (yf = 4.1 keV/µm; yd = 6.8 keV/µm) compared to that of water (ie, the absence of a plate) (yf = 2.5 keV/µm; yd = 4.5 keV/µm). In addition, downstream proton dose deposition was also elevated due to the presence of the Ti plate or Tiwater. The additional dose deposited at higher lineal energy implies that tissues downstream of the plate will receive a higher dose equivalent. Detailed analyses of the Ti, Tiwater, SS316, and SS316 water simulations will be presented. Conclusion: The presence of high-density materials introduces changes in the spatial distribution of radiation in the vicinity of an implant. Further work quantifying these effects could be incorporated into future treatment planning systems resulting in more accurate treatment plans. This project was sponsored with funding from the Department of Defense (DOD # W81XWH-10-2-0192).

  10. Sediment porewater toxicity assessment studies in the vicinity of offshore oil and gas production in the Gulf of Mexico

    International Nuclear Information System (INIS)

    Carr, R. S.; Chapman, D. C.; Presley, B. J.; Biedenbach, J. M.; Robertson, L.

    1996-01-01

    Sediment chemical analyses and porewater toxicity tests were conducted in the vicinity of five offshore oil and gas platforms in the Gulf of Mexico to determine the potential long-term environmental impacts of offshore oil and gas exploration and production. Evidence of toxicity was obtained from four of the five platforms from data on sea urchin fertilization and embryonic development. The majority of toxic samples were collected within 150 m of the platform. Sediment concentrations of several metals were well in excess of sediment quality assessment guidelines at a number of stations. Porewater metal concentrations were found to be high enough to account for the observed toxicity. The general conclusion reached from these toxicity tests was that the contaminant-induced impacts from the offshore platforms were confined to a limited area in the immediate vicinity of the platform. 23 refs., 8 tabs., 2 figs

  11. Stress distribution characteristics in the vicinity of coal seam floor

    Science.gov (United States)

    Cui, Zimo; Chanda, Emmanuel; Zhao, Jingli; Wang, Zhihe

    2018-01-01

    Although longwall top-coal caving (LTCC) has been a popular, more productive and cost-effective method in recent years, roadway floor heave and rock bursts frequently appear when exploiting such coal seams with large dip angle. This paper proposes addressing this problem by adopting three-dimensional roadway layout of stagger arrangement (3-D RLSA). In this study, the first step was to analyse the stress distribution characteristics in the vicinity of coal seam floor based on the stress slip line field theory. In the second step, numerical calculation using FLAC3D was conducted. Finally, an evaluation of the 3-D RLSA for solving this particular issue was given. Results indicate that for this particular mine the proposed 3-D RLSA results in 24% increase in the coal recovery ratio and a modest reduction in excavation and maintenance costs compared to the conventional LTCC method.

  12. Doble difusión a partir de mediciones de microestructura en los canales Martínez y Baker, Patagonia chilena central (47,85°S

    Directory of Open Access Journals (Sweden)

    Iván Pérez-Santos

    2013-03-01

    Full Text Available Con un microperfilador SCAMP (Self Contained Autonomous MicroProfile se detectó un proceso de Doble Difusión Convectiva (DDC, en los canales Martínez y Baker de la Patagonia central, Chile. Este perfilador midió temperatura y salinidad en la columna de agua con una resolución del orden de milímetros. El muestreo se efectuó en diciembre 2011, en 19 estaciones oceanográficas de ~55 m de profundidad. Los registros del microperfilador permitieron detectar la formación de escaleras termohalinas que caracterizan la formación de la DDC. Por medio del ángulo de Turner se confirmó que debajo de una capa superficial fuertemente estratificada (7-10 m se registraron eventos de DDC a profundidades entre 15 y 45 m. La DDC fue débil en la mayoría de los registros pero se evidenciaron eventos fuertes entre 15 y 40 m. En la capa subsuperficial, su origen se debió al intercalamiento de las masas aguas estuarinas (aguas frías y menos saladas encima de las oceánicas (aguas más cálidas y saladas, mientras que en la superficie la interacción océano-atmósfera favoreció su ocurrencia. La DDC en conjunto con el viento, las mareas y las ondas internas, puede constituir un mecanismo importante para la mezcla vertical, influenciando los flujos de calor, el hábitat de las especies marinas en estas profundidades y la exportación de carbono hacia los sedimentos.

  13. Uranium Mill Tailings Remedial Action Program. Partial radiological survey of Shiprock vicinity property SH13 Shiprock, New Mexico, November 1982

    International Nuclear Information System (INIS)

    Flynn, K.F.; Justus, A.L.; Sholeen, C.M.; Smith, W.H.; Wynveen, R.A.

    1984-05-01

    As part of a detailed radiological assessment of the vicinity properties at Shiprock, a comprehensive survey of the vicinity property designated as SH13 was initiated on November 19, 1982. At that time, a single residential structure existed in the northwest corner of the property. The lands surrounding the structure were extensively cluttered with junk. The initial assessment activities were limited to measurements within the residential structure of the ambient external penetrating radiation level at a 1-meter height and analyses of indoor air samples for airborne radioactivity. The external penetrating radiation exposure rate (12.3 μR/h) was less than the 20 μR/h above background limit specified in the EPA Standard (40 CFR 192.12[b][2]). As determined by the air samples, the short-term radon daughter concentration within the structure (0.36 mWL) did not exceed the 0.02 WL (or 20 mWL) limit for average annual concentration including background as specified in the EPA Standard. Further measurements required to completely determine the radiological status of this vicinity property, such as measurements of surface radiation both indoors and outdoors and collection and analyses of soil samples, were planned for the final phase of this assessment. However, that phase of the program was terminated before these measurements were accomplished. Thus, the extent of outdoor radiological contamination is presently unknown, and the evaluation of indoor contamination (if any) is incomplete

  14. Limitations to private properties in the vicinity of nuclear power plants

    International Nuclear Information System (INIS)

    Martini, L.E.

    1978-01-01

    This study, based on Argentine legislation, analyses the limitations to private property in the surroundings of nuclear power plants, due to public interest. A nuclear power plant could demand different kinds of property limitation, that could vary from restrictions to the absolute nature of property, to expropriation. Limitation of property is a different concept from restriction of property, the concept of limitation is wider. The author analyses for both concepts: validy requirements, competent bodies, and jurisdiction in case of conflict. He also explains the conditions and process of expropriation. Article 14 of the Constitution constitutes the positive legal basis for limitations of property. In the hypotheses of limitations to property due to vicinity of nuclear power plants, national legislation takes precedence over provincial law, since it is a matter of public national interest. (author)

  15. 29 CFR 1915.95 - Ship repairing and shipbuilding work on or in the vicinity of radar and radio.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship repairing and shipbuilding work on or in the vicinity of radar and radio. 1915.95 Section 1915.95 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT General...

  16. Thorium-230 dating of thermal waters in the vicinity of the Nevada Test Site

    International Nuclear Information System (INIS)

    Holloway, R.W.; Carilli, J.T.; Faller, S.H.; Liu, C.K.; Kuroda, P.K.

    1989-01-01

    Radiochemical measurements of the concentrations of thorium and uranium isotopes were carried out for a total of 10 samples of hot springs, mineral springs, and lakes collected in the vicinity of the Nevada Test Site. The uranium-to-thorium ratios in the water samples were found to be generally much greater than those in soils and in rain water. The apparent (230)Th ages calculated from the (230)Th/(232)Th and (234)U/(238)U ratios for most of these water samples were less than 100 years

  17. From event analysis to global lessons: disaster forensics for building resilience

    Science.gov (United States)

    Keating, Adriana; Venkateswaran, Kanmani; Szoenyi, Michael; MacClune, Karen; Mechler, Reinhard

    2016-07-01

    With unprecedented growth in disaster risk, there is an urgent need for enhanced learning and understanding of disasters, particularly in relation to the trends in drivers of increasing risk. Building on the disaster forensics field, we introduce the post-event review capability (PERC) methodology for systematically and holistically analysing disaster events, and identifying actionable recommendations. PERC responds to a need for learning about the successes and failures in disaster risk management and resilience, and uncovers the underlying drivers of increasing risk. We draw generalisable insights identified from seven applications of the methodology to date, where we find that across the globe policy makers and practitioners in disaster risk management face strikingly similar challenges despite variations in context, indicating encouraging potential for mutual learning. These lessons highlight the importance of integrated risk reduction strategies. We invite others to utilise the freely available PERC approach and contribute to building a repository of learning on disaster risk management and resilience.

  18. A computational study of vicinal fluorination in 2,3-difluorobutane: implications for conformational control in alkane chains.

    Science.gov (United States)

    Fox, Stephen J; Gourdain, Stephanie; Coulthurst, Anton; Fox, Clare; Kuprov, Ilya; Essex, Jonathan W; Skylaris, Chris-Kriton; Linclau, Bruno

    2015-01-19

    A comprehensive conformational analysis of both 2,3-difluorobutane diastereomers is presented based on density functional theory calculations in vacuum and in solution, as well as NMR experiments in solution. While for 1,2-difluoroethane the fluorine gauche effect is clearly the dominant effect determining its conformation, it was found that for 2,3-difluorobutane there is a complex interplay of several effects, which are of similar magnitude but often of opposite sign. As a result, unexpected deviations in dihedral angles, relative conformational energies and populations are observed which cannot be rationalised only by chemical intuition. Furthermore, it was found that it is important to consider the free energies of the various conformers, as these lead to qualitatively different results both in vacuum and in solvent, when compared to calculations based only on the electronic energies. In contrast to expectations, it was found that vicinal syn-difluoride introduction in the butane and by extension, longer hydrocarbon chains, is not expected to lead to an effective stabilisation of the linear conformation. Our findings have implications for the use of the vicinal difluoride motif for conformational control. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. A Novel Role for C5a in B-1 Cell Homeostasis

    Directory of Open Access Journals (Sweden)

    Katharina Bröker

    2018-02-01

    Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells

  20. El espejismo nacional-socialista. La relación entre dos catedráticos de Prehistoria, Oswald Menghin y Julio Martínez Santa-Olalla (1935-1952

    Directory of Open Access Journals (Sweden)

    Mederos Martín, Alfredo

    2014-12-01

    , Claudio Sanchez-Albornoz. Menghin was not permitted to give lectures until 1953, and only consolidated his position when his criminal trial was cancelled in December 1956. In 1957 at the age of 69, he obtained the position of Acting Professor of Prehistory at the National University of La Plata. In 1958, Menghin was appointed Professor in General and Old World Prehistory at the University of Buenos Aires, where he retired in 1968, aged 80.Oswald Menghin, Catedrático de Prehistoria del Hombre de la Universidad de Viena entre 1922-1945, fue partidario de la unidad de Austria con Alemania y simpatizante con ideas del NSDAP sobre la necesidad de evitar una mezcla racial entre arios y judíos. Durante su etapa como Catedrático-Residente en la Universidad de Fouad en El Cairo entre 1930-1933, por contacto con Hermann Junker, radicalizó sus puntos de vista y redactó su libro Espíritu y sangre. Principios básicos de raza, lengua, cultura y nación. Su etapa como Rector en el curso 1935-1936 le catapultó a la política como miembro del consejo directivo del partido fascista austriaco, Vaterländische Front, entre 1936-1937 y su posterior nombramiento como Ministro de Educación entre marzo y mayo de 1938, justo después de la invasión de Hitler de Austria. Siendo Ministro, solicitó su ingreso en el NSDAP, que no se aceptó hasta junio de 1940, por su pertenencia previa a organizaciones católicas secretas. Menghin entró en contacto con Martínez Santa-Olalla, después de la celebración del Jubileo del Instituto de Morfología Cultural de Frankfurt en junio y julio de 1938. A raíz de una estancia de investigación de Almagro Basch en Alemania y Austria en enero y febrero de 1942, y la posterior visita a Barcelona de Menghin en junio de 1942, optó por distanciarse de Martínez Santa-Olalla, no visitando Madrid, cortando la relación epistolar e informando negativamente sobre él a las SS-Ahnenerbe. Prisionero en dos campos de concentración norteamericanos entre mayo de

  1. New evidence for prehistoric copper metallurgy in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2016-01-01

    Full Text Available The last three years of archaeological investigations at the site Ru`ana in Banjsko Polje, in the immediate vicinity of Bor, have provided new evidence regarding the role of non-ferrous metallurgy in the economy of the prehistoric communities of north-eastern Serbia. The remains of metallurgical furnaces and a large amount of metallic slags at two neighbouring sites in the mentioned settlement reveal that locations with many installations for the thermal processing of copper ore existed in the Bronze Age. We believe, judging by the finds of material culture, that metallurgical activities in this area also continued into the Iron Age and, possibly, into the 4th century AD. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Archaeology of Serbia: Cultural identity, integration factors, technological processes and the role of the central Balkans in the development of European prehistory

  2. Surveys of forest bird populations found in the vicinity of proposed geothermal project subzones in the district of Puna, Hawaii

    International Nuclear Information System (INIS)

    Jacobi, J.D.; Reynolds, M.; Ritchotte, G.; Nielsen, B.; Viggiano, A.; Dwyer, J.

    1994-10-01

    This report presents data on the distribution and status of forest bird species found within the vicinity of proposed geothermal resource development on the Island of Hawaii. Potential impacts of the proposed development on the native bird populations found in the project are are addressed

  3. Surveys of forest bird populations found in the vicinity of proposed geothermal project subzones in the district of Puna, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Jacobi, J.D.; Reynolds, M.; Ritchotte, G.; Nielsen, B.; Viggiano, A.; Dwyer, J.

    1994-10-01

    This report presents data on the distribution and status of forest bird species found within the vicinity of proposed geothermal resource development on the Island of Hawaii. Potential impacts of the proposed development on the native bird populations found in the project are are addressed.

  4. An Open Virtual Neighbourhood Network to Connect IoT Infrastructures and Smart Objects – VICINITY

    DEFF Research Database (Denmark)

    Guan, Yajuan; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2017-01-01

    The lack of interoperability is considered as the most important barrier to achieve the global integration of Internet-of-Things (IoT) ecosystems across borders of different disciplines, vendors and standards. Indeed, the current IoT landscape consists of a large set of isolated islands that do...... not constitute a real Internet, preventing the exploitation of the huge potential expected by Information and communications technology (ICT) visionaries and unfolding business opportunities facilitated by digitalization and automation. The VICINITY project will build and demonstrate a platform linking various...

  5. Theoretical analysis of the influence of chelate-ring size and vicinal effects on electronic circular dichroism spectra of cobalt(III) EDDA-type complexes.

    Science.gov (United States)

    Wang, Ai; Wang, Yuekui; Jia, Jie; Feng, Lixia; Zhang, Chunxia; Liu, Linlin

    2013-06-20

    To assess the contributions of configurational and vicinal effects as well as chelate-ring size to rotational strengths, the geometries of a series of cobalt(III) complexes [Co(EDDA-type)(L)](±) with the tetradentate EDDA-type ligands, EDDA (ethylenediamine-N,N'-diacetate), DMEDDA (N,N'-dimethylethylenediamine-N,N'-diacetate), DEEDDA (N,N'-diethylethylenediamine-N,N'-diacetate), and a bidentate ancillary ligand L (L = ethylenediamine, oxalate, carbonate, (S)-alanine, and malonate) in aqueous solution have been optimized at the DFT/B3LYP/6-311++G(2d,p) level of theory. Based on the optimized geometries, the excitation energies and oscillator and rotational strengths have been calculated using the time-dependent density functional theory (TDDFT) method with the same functional and basis set. The calculated circular dichroism (CD) curves are in excellent agreement with the observed ones except for some small red or blue shifts in peak wavelengths. For the influence of chelate-ring size of the bidentate ligands on the CD intensities, a qualitative analysis together with the quantitative TDDFT calculation reveal that it depends on the symmetry of the cobalt-EDDA backbone. For the s-cis-isomers, the influence is negligible due to the perturbation is symmetric. For the uns-cis-isomers, the perturbation is unsymmetric. Since a small ring size means a large perturbation, this leads to the integral CD intensities decreasing with increasing the chelate ring size. The vicinal effects of asymmetric nitrogens incorporate both the substitutent effects and conformational relaxation effects, with the former being dominant. By analyzing the contributions of chiral arrays to rotational strengths, we found that the part of contributions dominated by the S-type chiral nitrogens could be considered as a good measure for the vicinal effects of chiral nitrogens. In addition, we found that the twist form (δ/λ) of the backbone ethylenediamine ring (E-ring) of the coordinated EDDA

  6. Power peak in vicinity of WWER-440 control rod at end of fuel cycle

    International Nuclear Information System (INIS)

    Mikus, J.

    2003-01-01

    This paper presents some results of the axial power distribution measurements carried out in a WWER-440 type core on the light-water, zero-power reactor LR-O in the vicinity of the WWER-440 control rod model at zero boron concentration in moderator. Further presented information concern the description of the control rod model, LR-0 core arrangement, specification of the fuel assemblies and measurement conditions. The aim of performed experiment is enlargement of the available 'power peaking database' to enable the calculation codes validation also by means of data that correspond to the end of WWER-440 fuel cycle (Authors)

  7. Lessons Learned from Creating the Public Earthquake Resource Center at CERI

    Science.gov (United States)

    Patterson, G. L.; Michelle, D.; Johnston, A.

    2004-12-01

    The Center for Earthquake Research and Information (CERI) at the University of Memphis opened the Public Earthquake Resource Center (PERC) in May 2004. The PERC is an interactive display area that was designed to increase awareness of seismology, Earth Science, earthquake hazards, and earthquake engineering among the general public and K-12 teachers and students. Funding for the PERC is provided by the US Geological Survey, The NSF-funded Mid America Earthquake Center, and the University of Memphis, with input from the Incorporated Research Institutions for Seismology. Additional space at the facility houses local offices of the US Geological Survey. PERC exhibits are housed in a remodeled residential structure at CERI that was donated by the University of Memphis and the State of Tennessee. Exhibits were designed and built by CERI and US Geological Survey staff and faculty with the help of experienced museum display subcontractors. The 600 square foot display area interactively introduces the basic concepts of seismology, real-time seismic information, seismic network operations, paleoseismology, building response, and historical earthquakes. Display components include three 22" flat screen monitors, a touch sensitive monitor, 3 helicorder elements, oscilloscope, AS-1 seismometer, life-sized liquefaction trench, liquefaction shake table, and building response shake table. All displays include custom graphics, text, and handouts. The PERC website at www.ceri.memphis.edu/perc also provides useful information such as tour scheduling, ask a geologist, links to other institutions, and will soon include a virtual tour of the facility. Special consideration was given to address State science standards for teaching and learning in the design of the displays and handouts. We feel this consideration is pivotal to the success of any grass roots Earth Science education and outreach program and represents a valuable lesson that has been learned at CERI over the last several

  8. 33 CFR 334.40 - Atlantic Ocean in vicinity of Duck Island, Maine, Isles of Shoals; naval aircraft bombing target...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Atlantic Ocean in vicinity of Duck Island, Maine, Isles of Shoals; naval aircraft bombing target area. 334.40 Section 334.40... Shoals; naval aircraft bombing target area. (a) The danger zone. A circular area with a radius of 500...

  9. Lead and cadmium in mushrooms from the vicinity of two large emission sources in Slovenia

    International Nuclear Information System (INIS)

    Petkovšek, Samar Al Sayegh; Pokorny, Boštjan

    2013-01-01

    Cd and Pb contents were determined in 699 samples of fruiting bodies of 55 mushrooms species, collected in the period 2000–2007 in the vicinity of the largest Slovenian thermal power plant (the Šalek Valley) and near an abandoned lead smelter (the Upper Meža Valley). The present study is the first regarding lead and cadmium in mushrooms from those exposed areas. Therefore, there was a significant lack of prior data. Among 55 studied mushroom species 36 species are edible and important from an ecotoxicological perspective. However, the remaining non-edible species are important for bioindication and allowed us to compare our results with other studies carried out in other polluted areas in Europe. The highest contents of Cd were found in Agaricus arvensis Schff.: Fr. (117 mg/kg dw) and Agaricus silvicola L.: Fr. (67.9 mg/kg dw), while the highest contents of Pb were found in Macrolepiota procera (Scop.) Singer (53.8 mg/kg dw) and Lycoperdon perlatum Pers. (50 mg/kg dw), respectively. Considering the high contents of both metals in fruiting bodies of edible fungi, together with FAO/WHO directives on tolerable levels of weekly intake of Pb/Cd by humans, it is evident that consumption of some mushroom species originating from both study areas may pose a significant human health risk. A. arvensis Schff.: Fr., A. silvicola L.: Fr. and Cortinarius caperatus (Pers.) Fr. originating from the Šalek Valley, and Armillaria mellea Vahl. P. Kumm., Boletus edulis Bull., L. perlatum Pers., Leccinum versipelle (Fr. and Hök) Snell, and M. procera (Scop.) Singer originating from the Upper Meža Valley should not be consumed at all. Our findings are consistent with some other studies, which emphasized that mushrooms from heavily polluted areas, such as in the vicinity of smelters, accumulate extremely high amounts of metals, and should therefore be omitted from human consumption. - Highlights: ► The Pb contents were higher in saprophytic fungi in comparison with mycorrhizal

  10. The introduction of a double bond on the steroid skeleton - the preparation of enol silyl ether derivatives from vicinal diols

    Czech Academy of Sciences Publication Activity Database

    Marek, Aleš; Klepetářová, Blanka; Elbert, Tomáš

    2011-01-01

    Roč. 76, č. 5 (2011), s. 443-456 ISSN 0010-0765 R&D Projects: GA AV ČR IAA400550801 Institutional research plan: CEZ:AV0Z40550506 Keywords : enol silyl ether * vicinal diol * steroids Subject RIV: CC - Organic Chemistry Impact factor: 1.283, year: 2011

  11. Elemental composition of Chesapeake Bay oyster Crassostrea virginica in the vicinity of Calvert Cliffs Nuclear Power Plant

    International Nuclear Information System (INIS)

    Gavrilas, M.; Munno, F.J.

    1984-01-01

    The stable element composition of the American oyster Crassostrea virginica collected between June 1978 and August 1983 in the Chesapeake Bay in the vicinity of Calvert Cliffs Nuclear Power Plant was analyzed by neutron activation. The minimum, maximum and the mean values of the elemental concentrations are given. The seasonal effect and the linear correlation between elements entering the oyster composition are shown. 7 references, 1 figure, 4 tables

  12. Risk perception of the public living in vicinity of nuclear power plant

    International Nuclear Information System (INIS)

    Li Xiaojuan; Hou Changsong; Wang Chunyan; Liu Ying; Sun Quanfu; Yu Ningle; Li Ningning; Zhou Rihui; Zhuang Jiayi

    2008-01-01

    Objective: To investigate the attitude toward and perception of the risk of nuclear power plant among the public residing in vicinity of nuclear power plant, as well as the related factors. Methods: A face-to-face interview on perceived radiation risks was conducted among 1408 individuals in Liangyungang City, Jiangsu Province, where the Tianwan nuclear power plant was under construction. The four groups was defined according to the distance between the residence of the subjects and the Tianwan nuclear power plant: <4 km, 4- 8 km, 8-30 km and 30-50 km. A was used to collect information on education, working history, religion, perception of major industries hazards especially nuclear power plant, and major factors may influence their perceptions. Ordinal logistic regression model was used to analyze the data. Results: About 91.18% of the interviewee heard about the nuclear power plant, 35.36% of them had knowledge about Chernobyl nuclear power plant accident, 71.05% of them believed that the nuclear power plant had no negative effects on environments, 37.03% of them believed that the nuclear energy was safe, 74.27% of them believed that it was necessary for China to develop nuclear energy, 63.29% of them supported the construction of the nuclear power plant in local area. Ordinal logistic regression analysis revealed that the higher education, higher family annual income, male, economic benefits from the nuclear power plant construction, and trust in local government having competency to handling emergencies were positive factors; otherwise, impression on nuclear power plant of bad influences on environment and health were negative factors. An inverted U-shaped with a right tailing relationship between negative attitudes toward nuclear power plant and distance to the plant was found. Conclusions: Education, gender, family annual income and expectation of economic benefit returns were the major factors influencing the perception of and attitudes toward nuclear power

  13. Analysis of snow-cap pollution for air quality assessment in the vicinity of an oil refinery.

    Science.gov (United States)

    Krastinyte, Viktorija; Baltrenaite, Edita; Lietuvninkas, Arvydas

    2013-01-01

    Snow-cap can be used as a simple and effective indicator of industrial air pollution. In this study snow-cap samples were collected from 11 sites located in the vicinity of an oil refinery in Mazeikiai, a region in the north-west of Lithuania, in the winter of 2011. Analysis of snowmelt water and snow-dust was used to determine anthropogenic pollutants such as: sulphates and chlorides, nitrites, nitrates, ammonium nitrogen, total carbon, total nitrogen; heavy metals: lead (Pb), copper (Cu), chromium (Cr), cadmium (Cd). Concentrations of heavy metals in snow-dust were detected thousands of times higher than those in the snowmelt water. In this study, analysis of heavy metal concentration was conducted considering different distances and the wind direction within the impact zone of the oil refinery. The sequence of heavy metals according to their mean concentrations in the snow-dust samples was the following: Pb > Cr > Cu > Cd. Heavy metals highly correlated among each other. The load of snow-dust was evaluated to determine the pollution level in the study area. The highest daily load of snow-dust was 45.81 +/- 12.35 mg/m2 in the north-western direction from the oil refinery. According to classification of the daily load of snow-dust a lower than medium-risk level of pollution was determined in the vicinity of the oil refinery.

  14. Establishing indices for groundwater contamination risk assessment in the vicinity of hazardous waste landfills in China

    International Nuclear Information System (INIS)

    Li Ying; Li Jinhui; Chen Shusheng; Diao Weihua

    2012-01-01

    Groundwater contamination by leachate is the most damaging environmental impact over the entire life of a hazardous waste landfill (HWL). With the number of HWL facilities in China rapidly increasing, and considering the poor status of environmental risk management, it is imperative that effective environmental risk management methods be implemented. A risk assessment indices system for HWL groundwater contamination is here proposed, which can simplify the risk assessment procedure and make it more user-friendly. The assessment framework and indices were drawn from five aspects: source term, underground media, leachate properties, risk receptors and landfill management quality, and a risk assessment indices system consisting of 38 cardinal indicators was established. Comparison with multimedia models revealed that the proposed indices system was integrated and quantitative, that input data for it could be easily collected, and that it could be widely used for environmental risk assessment (ERA) in China. - Highlights: ► No comprehensive environmental risk assessment method for hazardous waste management is proposed in China. ► An assessment indices system is established for groundwater contamination in the vicinity of hazardous waste landfill. ► All indicators are quantitative and applicable in China. - Capsule: This research identified critical indices and established a system for environmental risk assessment for groundwater contamination in the vicinity of HWLs in China.

  15. Community Structure of Fish and Macrobenthos at Selected Sites in the Vicinity of Mokapu Ocean Outfall, Oahu, Hawaii, 1998 (NODC Accession 0000173)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This report provides the results of the first quantitative survey of the coral reef communities in the vicinity of the Mokapu Ocean Outfall in Kailua Bay, Oahu,...

  16. A floristic survey of Yucca Mountain and vicinity, Nye County, Nevada

    International Nuclear Information System (INIS)

    Niles, W.E.; Leary, P.J.; Holland, J.S.; Landau, F.H.

    1995-12-01

    A survey of the vascular flora of Yucca Mountain and vicinity, Nye County, Nevada, was conducted from March to June 1994, and from March to October 1995. An annotated checklist of recorded taxa was compiled. Voucher plant specimens were collected and accessioned into the Herbarium at the University of Nevada, Las Vegas. Collection data accompanying these specimens were entered into that herbarium's electronic data base. Combined results from this survey and the works of other investigators reveal the presence of a total of 375 specific and intraspecific taxa within the area these allocated to 179 genera and 54 families. No taxon currently listed as threatened or endangered under the Endangered Species Act was encountered during this study. Several candidate species for listing under this Act were present, and distributional data for these were recorded. No change in the status of these candidate species is recommended as the result of this study

  17. A model of chemical etching of olivine in the vicinity of the trajectory of a swift heavy ion

    Energy Technology Data Exchange (ETDEWEB)

    Gorbunov, S.A., E-mail: s.a.gorbunov@mail.ru [Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr. 53, 119991 Moscow (Russian Federation); Rymzhanov, R.A. [Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation); Starkov, N.I. [Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr. 53, 119991 Moscow (Russian Federation); Volkov, A.E. [Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr. 53, 119991 Moscow (Russian Federation); Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation); National Research Centre ‘Kurchatov Institute’, Kurchatov Sq. 1, 123182 Moscow (Russian Federation); Malakhov, A.I. [Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation)

    2015-12-15

    Searching of superheavy elements, the charge spectra of heavy nuclei in Galactic Cosmic Rays was investigated within the OLYMPIA experiment using the database of etched ion tracks in meteorite olivine. Etching results in the formation of hollow syringe-like channels with diameters of 1–10 μm along the trajectories of these swift heavy ions (SHI). According to the activated complex theory, the local chemical activity is determined by an increase of the specific Gibbs energy of the lattice stimulated by structure transformations, long-range elastic fields, and interatomic bonds breaking generated in the vicinity of the ion trajectory. To determine the dependencies of the Gibbs free energy increase in SHI tracks in olivine on the mass, energy and charge of a projectile, we apply a multiscale model of excitation and relaxation of materials in the vicinity of the SHI trajectory (SHI tracks). Effect of spreading of fast electrons from the ion trajectory causing neutralization of metallic atoms resulting in an increase of the chemical activity of olivine at long distances from the ion trajectory (up to 5 μm) is estimated and discussed.

  18. Lung structure and function relation in systemic sclerosis: Application of lung densitometry

    Energy Technology Data Exchange (ETDEWEB)

    Ninaber, Maarten K., E-mail: m.k.ninaber@lumc.nl [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Stolk, Jan; Smit, Jasper; Le Roy, Ernest J. [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Kroft, Lucia J.M. [Department of Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Els Bakker, M. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Vries Bouwstra, Jeska K. de; Schouffoer, Anne A. [Department of Rheumatology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Staring, Marius; Stoel, Berend C. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands)

    2015-05-15

    Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides

  19. Lung structure and function relation in systemic sclerosis: Application of lung densitometry

    International Nuclear Information System (INIS)

    Ninaber, Maarten K.; Stolk, Jan; Smit, Jasper; Le Roy, Ernest J.; Kroft, Lucia J.M.; Els Bakker, M.; Vries Bouwstra, Jeska K. de; Schouffoer, Anne A.; Staring, Marius; Stoel, Berend C.

    2015-01-01

    Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides

  20. Detection of nitro-based and peroxide-based explosives by fast polarity-switchable ion mobility spectrometer with ion focusing in vicinity of Faraday detector.

    Science.gov (United States)

    Zhou, Qinghua; Peng, Liying; Jiang, Dandan; Wang, Xin; Wang, Haiyan; Li, Haiyang

    2015-05-29

    Ion mobility spectrometer (IMS) has been widely deployed for on-site detection of explosives. The common nitro-based explosives are usually detected by negative IMS while the emerging peroxide-based explosives are better detected by positive IMS. In this study, a fast polarity-switchable IMS was constructed to detect these two explosive species in a single measurement. As the large traditional Faraday detector would cause a trailing reactant ion peak (RIP), a Faraday detector with ion focusing in vicinity was developed by reducing the detector radius to 3.3 mm and increasing the voltage difference between aperture grid and its front guard ring to 591 V, which could remove trailing peaks from RIP without loss of signal intensity. This fast polarity-switchable IMS with ion focusing in vicinity of Faraday detector was employed to detect a mixture of 10 ng 2,4,6-trinitrotoluene (TNT) and 50 ng hexamethylene triperoxide diamine (HMTD) by polarity-switching, and the result suggested that [TNT-H](-) and [HMTD+H](+) could be detected in a single measurement. Furthermore, the removal of trailing peaks from RIP by the Faraday detector with ion focusing in vicinity also promised the accurate identification of KClO4, KNO3 and S in common inorganic explosives, whose product ion peaks were fairly adjacent to RIP.

  1. Dielectric effect on electric fields in the vicinity of the metal–vacuum–dielectric junction

    International Nuclear Information System (INIS)

    Chung, M.S.; Mayer, A.; Miskovsky, N.M.; Weiss, B.L.; Cutler, P.H.

    2013-01-01

    The dielectric effect was theoretically investigated in order to describe the electric field in the vicinity of a junction of a metal, dielectric, and vacuum. The assumption of two-dimensional symmetry of the junction leads to a simple analytic form and to a systematic numerical calculation for the field. The electric field obtained for the triple junction was found to be enhanced or reduced according to a certain criterion determined by the contact angles and dielectric constant. Further numerical calculations of the dielectric effect show that an electric field can experience a larger enhancement or reduction for a quadruple junction than that achieved for the triple junction. It was also found that even though it changes slowly in comparison with the shape effect, the dielectric effect was noticeably large over the entire range of the shape change. - Highlights: ► This work explains how a very strong electric field can be produced due to the dielectric in the vicinity of metal–dielectric contact. ► This work deals with configurations which enhance electric fields using the dielectric effect. The configuration is a type of junction at which metal, vacuum and dielectric meet. ► This work suggests the criterion to determine whether field enhancement occurs or not in the triple junction of metal, vacuum and dielectric. ► This work suggests that a quadruple junction is more effective in enhancing the electric field than a triple junction. The quadruple junction is formed by an additional vacuum portion to the triple junction. ► This work suggests that a triple junction can be a breakthrough candidate for a cold electron source

  2. Floodplain/wetlands assessment for the remediation of Vicinity Property 9 at the Weldon Spring Site, Weldon Spring, Missouri

    International Nuclear Information System (INIS)

    Lonkhuyzen, R.A. Van

    1995-11-01

    The US Department of Energy (DOE) proposes to excavate contaminated soil at Vicinity Property 9 (VP9), a 0.64-ha (1.6-acre) parcel near the Weldon Spring Site in Missouri. A palustrine wetland approximately 0.10 ha (0.25 acre) in size within VP9 would be excavated. Site restoration should allow palustrine wetland to become reestablished. No long-term impacts to floodplains are expected

  3. Site characterization plan overview: reference repository location, Hanford Site, Washington: Consultation draft: Nuclear Waste Policy Act (Section 113)

    International Nuclear Information System (INIS)

    1988-01-01

    As part of the process for siting the nation's first geologic repository for radioactive waste, the Department of Energy (DOE) is preparing a site characterization plan for the Hanford site in Benton County, Washington. As a step in the preparation of that plan, the DOE has provided, for information and review, a consultation draft of the plan to the State of Washington, the affected Indian Tribes - the Confederated Tribes of the Umatilla Indian Reservation, the Nez Perce Indian Tribe, and the Yakima Indian Nation - and the US Nuclear Regulatory Commission. The Hanford site is one of three sites that the DOE currently plans to characterize;the other sites are the Deaf Smith County site in Texas and the Yucca Mountain site in Nevada. After site characterization has been completed and its results evaluated, the DOE will identify from among the three characterized sites the site that is preferred for the repository. The overview presented here consists of brief summaries of important topics covered in the consulation draft of the site characterization plan;it is not a substitute for the site characterization plan. The arrangement of the overview is similar to that of the plan itself, with breif descriptions of the dispoal system - the site, the repository, and the waste package - preceding the discussion of the characterization program to be carried out at the Hanford site. It is intended primarily for the management staff of organizations involved in the DOE's repository program or other persons who might wish to understand the general scope of the site-characterization program, the activities to be conducted, and the facilities to be constructed rather than the technical details of site characterization

  4. Johnson Creek Artificial Propagation and Enhancement Project Operations and Maintenance Program; Brood Year 1998: Johnson Creek Chinook Salmon Supplementation, Biennial Report 1998-2000.

    Energy Technology Data Exchange (ETDEWEB)

    Daniel, Mitch; Gebhards, John

    2003-05-01

    The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek through artificial propagation. Adult chinook salmon collection and spawning began in 1998. A total of 114 fish were collected from Johnson Creek and 54 fish (20 males and 34 females) were retained for Broodstock. All broodstock were transported to Lower Snake River Compensation Plan's South Fork Salmon River adult holding and spawning facility, operated by the Idaho Department of Fish and Game. The remaining 60 fish were released to spawn naturally. An estimated 155,870 eggs from Johnson Creek chinook spawned at the South Fork Salmon River facility were transported to the McCall Fish Hatchery for rearing. Average fecundity for Johnson Creek females was 4,871. Approximately 20,500 eggs from females with high levels of Bacterial Kidney Disease were culled. This, combined with green-egg to eyed-egg survival of 62%, resulted in about 84,000 eyed eggs produced in 1998. Resulting juveniles were reared indoors at the McCall Fish Hatchery in 1999. All of these fish were marked with Coded Wire Tags and Visual Implant Elastomer tags and 8,043 were also PIT tagged. A total of 78,950 smolts were transported from the McCall Fish Hatchery and released directly into Johnson Creek on March 27, 28, 29, and 30, 2000.

  5. Evaluation of available MHD seed-regeneration processes on the basis of energy considerations

    International Nuclear Information System (INIS)

    Sheth, A.C.; Johnson, T.R.

    1978-09-01

    Of the several processes described in the literature that are capable of separating sulfur from alkali-metal sulfates, seven processes were selected as candidates for regenerating seed material for reuse in open-cycle MHD. After a brief assessment of each process, two were selected for a detailed analysis, namely, a process developed by the Pittsburgh Energy Research Center (PERC) and a modified version of the Tampella process. The processes were compared on the bases of energy requirements and the amount of research work needed to develop a seed-regeneration process for MHD systems. The energy requirements given should be considered as rough values, because factors such as heat losses and component efficiency were not included in the analysis. On the basis of energy consumption, the PERC process has a slight advantage over the Tampella process; on the basis of the present state of development of various components, the Tampella process has a clear advantage. Accordingly, it was recommended that developmental programs be carried out for both the PERC and Tampella processes

  6. Discovery of deep and shallow trap states from step structures of rutile TiO2 vicinal surfaces by second harmonic and sum frequency generation spectroscopy

    International Nuclear Information System (INIS)

    Takahashi, Hiroaki; Watanabe, Ryosuke; Miyauchi, Yoshihiro; Mizutani, Goro

    2011-01-01

    In this report, local electronic structures of steps and terraces on rutile TiO 2 single crystal faces were studied by second harmonic and sum frequency generation (SHG/SFG) spectroscopy. We attained selective measurement of the local electronic states of the step bunches formed on the vicinal (17 18 1) and (15 13 0) surfaces using a recently developed step-selective probing technique. The electronic structures of the flat (110)-(1x1) (the terrace face of the vicinal surfaces) and (011)-(2x1) surfaces were also discussed. The SHG/SFG spectra showed that step structures are mainly responsible for the formation of trap states, since significant resonances from the trap states were observed only from the vicinal surfaces. We detected deep hole trap (DHT) states and shallow electron trap (SET) states selectively from the step bunches on the vicinal surfaces. Detailed analysis of the SHG/SFG spectra showed that the DHT and SET states are more likely to be induced at the top edges of the step bunches than on their hillsides. Unlike the SET states, the DHT states were observed only at the step bunches parallel to [1 1 1][equivalent to the step bunches formed on the (17 18 1) surface]. Photocatalytic activity for each TiO 2 sample was also measured through methylene blue photodegradation reactions and was found to follow the sequence: (110) < (17 18 1) < (15 13 0) < (011), indicating that steps along [0 0 1] are more reactive than steps along [1 1 1]. This result implies that the presence of the DHT states observed from the step bunches parallel to [1 1 1] did not effectively contribute to the methylene blue photodegradation reactions.

  7. Radiation field calculation in the vicinity of Russian radioisotope generator sources

    Energy Technology Data Exchange (ETDEWEB)

    Pretzsch, Gunter; Hummelsheim, Klemens; Bogorinski, Peter [Gesellschaft fuer Anlagen- und Reaktorsicherheit (GRS) mbH, Kurfuerstendamm 200, 10719 Berlin (Germany)

    2005-07-01

    Germany supports the Russian Federation in the framework of the G8 Global Partnership programme to secure nuclear and radioactive materials against misuse and proliferation. In this context, GRS, on behalf of the German Foreign Office, is coordinating activities to remove disused radioisotope thermoelectric generators (RITEG) from the Baltic Sea which serve as power supply for marine lighthouses and their replacement by alternative energy sources. Further the planned project includes transportation to an interim storage, the storage equipped with radiation monitoring and physical protection measures, later transportation for reprocessing to the Mayak Production Association, where the RITEG will be dismantled in a hot cell and encapsulated radioactive source will be vitrified and stored as radioactive waste. For the whole project safety analyses are to be performed e.g. to meet radiation protection requirements. In the present paper modelling and calculation of radiation fields in the vicinity of RITEG as a basis for safety analyses is reported. (authors)

  8. A floristic survey of Yucca Mountain and vicinity, Nye County, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Niles, W.E.; Leary, P.J.; Holland, J.S.; Landau, F.H.

    1995-12-01

    A survey of the vascular flora of Yucca Mountain and vicinity, Nye County, Nevada, was conducted from March to June 1994, and from March to October 1995. An annotated checklist of recorded taxa was compiled. Voucher plant specimens were collected and accessioned into the Herbarium at the University of Nevada, Las Vegas. Collection data accompanying these specimens were entered into that herbarium`s electronic data base. Combined results from this survey and the works of other investigators reveal the presence of a total of 375 specific and intraspecific taxa within the area these allocated to 179 genera and 54 families. No taxon currently listed as threatened or endangered under the Endangered Species Act was encountered during this study. Several candidate species for listing under this Act were present, and distributional data for these were recorded. No change in the status of these candidate species is recommended as the result of this study.

  9. Soil to plant transfer factor in the vicinity of coal fired power plants

    International Nuclear Information System (INIS)

    Nikolic, J.; Todorovic, D.; Jankovic, M.; Radenkovic, M.; Joksic, J.

    2009-01-01

    In this paper, the monitoring of working and living environment results in 5 coal fired powered plants, for the period from 2004. to 2009. are presented. Soil-plant transfer factor, suitable for estimation of possible contamination of food chain was chosen, as a measure of influence of power plants on the environment. The results gathered over the years of monitoring of working and living environment in the vicinity of the coal fired power plant were analyzed, and it was determined that no significant discrepancy exists comparing to the results reported in world literature. Also, the basic mathematical analysis was conducted, in order to assess the model of the behavior of the results in respect to the frequency count. (author) [sr

  10. Health state of the population residing in the vicinity of Eleshnitsa Uranium Deposits

    International Nuclear Information System (INIS)

    Bliznakov, V.; Panova, D.; Bakalov, M.; Stateva, E.; Nuryan, L.; Sultanov, E.; Ivanov, Z.; Tomov, P.; Krystev, D.; Madoleva, S.; Bulev, A.

    1993-01-01

    Disease prevalence rate was studied in residents of Eleshnitsa village, Bulgaria, situated in an immediate vicinity of two uranium mines and one uranium flotation plant. Determinations were made of gamma radiation dose rate in the open and within some premises, and of the level of 'hidden energy' at some outdoor sites. The investigation was performed by physicians and assistant personnel specialized in eight different medical fields. A total of 186 children and 257 adults residing in Eleshnitsa were examined. The control group included residents of the 'clear' Dobrinishte village, Razlog district. The evidence from statistical data processing indicated the health impairments to be more frequent among the control group population. No disorders that might be related to exposure to environmental radiation factors were revealed. (author)

  11. Water-quality data for aquifers, streams, and lakes in the vicinity of Keechi, Mount Sylvan, Oakwood, and Palestine salt domes, northeast Texas salt-dome basin

    International Nuclear Information System (INIS)

    Carr, J.E.; Halasz, S.J.; Liscum, F.

    1980-11-01

    This report contains water-quality data for aquifers, streams, and lakes in the vicinity of Keechi, Mount Sylvan, Oakwood, and Palestine Salt Domes in the northeast Texas salt-dome basin. Water-quality data were compiled for aquifers in the Wilcox Group, the Carrizo Sand, and the Queen City Sand. The data include analyses for dissolved solids, pH, temperature, hardness, calcium, magnesium, sodium, bicarbonate, chloride, and sulfate. Water-quality and streamflow data were obtained from 63 surface-water sites in the vicinity of the domes. These data include water discharge, specific conductance, pH, water temperature, and dissolved oxygen. Samples were collected at selected sites for analysis of principal and selected minor dissolved constituents

  12. Analysis of trace neptunium in the vicinity of underground nuclear tests at the Nevada National Security Site.

    Science.gov (United States)

    Zhao, P; Tinnacher, R M; Zavarin, M; Kersting, A B

    2014-11-01

    A high sensitivity analytical method for (237)Np analysis was developed and applied to groundwater samples from the Nevada National Security Site (NNSS) using short-lived (239)Np as a yield tracer and HR magnetic sector ICP-MS. The (237)Np concentrations in the vicinity of the Almendro, Cambric, Dalhart, Cheshire, and Chancellor underground nuclear test locations range from nuclear tests at very low but measureable concentrations. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  13. The Impact of Tourism on the Socio-Cultural Environment in the Gorce National Park and its Vicinity

    OpenAIRE

    Luberda, Małgorzata

    2014-01-01

    The paper presents the problems of tourism in terms of its relationship with the social as well as cultural environment. The purpose of the article was to examine how tourism affects the socio-cultural environment in the Gorce National Park and its vicinity. I examined whether tourist traffic in the Park brings about more benefits or problems, and whether changes taking place in communities visited by tourists are positive or negative? The impact of tourism on the socio-cult...

  14. 77 FR 42425 - Amendment of Air Traffic Service (ATS) Routes in the Vicinity of Vero Beach, FL

    Science.gov (United States)

    2012-07-19

    ...This action amends the legal descriptions of Jet Routes J-45 and J-79, and VHF omnidirectional range (VOR) Federal airways V-3, V-51, V-159, V-225, V-295 and V-537, in the vicinity of Vero Beach, FL. The FAA is taking this action because the name of the Vero Beach, FL, VOR Tactical Air Navigation (VORTAC) facility, which is included in the descriptions of the above routes, is being changed to the Treasure VORTAC.

  15. Levels of PCDDs/DFs in soil in the vicinity of an industrial waste incinerator, Korea

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kyoung-Soo [Institute of Environmental Chemistry, Jeonju (Korea); Song, Byung-Joo; Park, Seok-Un; Jeong, Mi-Jeong [Chonbuk National Univ., Chonju (Korea). Dept. of Environmental Engineering

    2004-09-15

    In recent years, sources of PCDDs/DFs have been well characterized based on various researches. There are mainly combustion processes and reservoirs. Soil and sediment are known to be the main reservoirs of PCDDs/DFs. Masunaga et al (2001) recently reported that some agrochemicals such as PCP and CNP used in the past also contained certain amount of PCDDs/DFs as impurities. In this study, PCDDs/DFs were measured in soil collected around the vicinity of an industrial waste incinerator (IWI). This study was aimed to estimate relation to above sources using information of congener patterns of PCDDs/DFs in soil samples.

  16. A coexistence curve equation for refrigerant-F-113 within the vicinity of the critical point

    International Nuclear Information System (INIS)

    Al'okhyin, O.D.; Bezruchko, Yi.V.; Bulavyin, L.A.

    2003-01-01

    The experimental data on the dependence of the density on temperature have been presented for refrigerant F-113 along the coexistence curve within the wide temperature range including the close vicinity of the critical temperature. The extended equation of state for freon-113 along this direction has been proposed on the base of the van der Waals model of a fluctuation gas. Parameters of the equation is determined by the interaction of molecules inside density fluctuations at the distances r>R c and by the interaction between fluctuations at the distances r>R c (R c is the correlation radius of the system)

  17. Complex magnetic monopoles, geometric phases and quantum evolution in the vicinity of diabolic and exceptional points

    International Nuclear Information System (INIS)

    Nesterov, Alexander I; Aceves de la Cruz, F

    2008-01-01

    We consider the geometric phase and quantum tunneling in the vicinity of diabolic and exceptional points. We show that the geometric phase associated with the degeneracy points is defined by the flux of complex magnetic monopoles. In the limit of weak coupling, the leading contribution to the real part of the geometric phase is given by the flux of the Dirac monopole plus a quadrupole term, and the expansion of the imaginary part starts with a dipole-like field. For a two-level system governed by a generic non-Hermitian Hamiltonian, we derive a formula to compute the non-adiabatic, complex, geometric phase by integrating over the complex Bloch sphere. We apply our results to study a dissipative two-level system driven by a periodic electromagnetic field and show that, in the vicinity of the exceptional point, the complex geometric phase behaves like a step-function. Studying the tunneling process near and at the exceptional point, we find two different regimes: coherent and incoherent. The coherent regime is characterized by Rabi oscillations, with a one-sheeted hyperbolic monopole emerging in this region of the parameters. The two-sheeted hyperbolic monopole is associated with the incoherent regime. We show that the dissipation results in a series of pulses in the complex geometric phase which disappear when the dissipation dies out. Such a strong coupling effect of the environment is beyond the conventional adiabatic treatment of the Berry phase

  18. Enhanced asymmetry in few-cycle attosecond pulse ionization of He in the vicinity of autoionizing resonances

    International Nuclear Information System (INIS)

    Djiokap, J M Ngoko; Starace, Anthony F; Hu, S X; Jiang Weichao; Peng Liangyou

    2012-01-01

    By solving the two-active-electron, time-dependent Schrödinger equation in its full dimensionality, we investigate the carrier-envelope phase (CEP) dependence of single ionization of He to the He + (1s) state triggered by an intense few-cycle attosecond pulse with carrier frequency ω corresponding to the energy ℏω = 36 eV. Effects of electron correlations are probed by comparing projections of the final state of the two-electron wave packet onto field-free highly correlated Jacobi matrix wave functions with projections onto uncorrelated Coulomb wave functions. Significant differences are found in the vicinity of autoionizing resonances. Owing to the broad bandwidths of our 115 and 230 as pulses and their high intensities (1–2 PW cm −2 ), asymmetries are found in the differential probability for ionization of electrons parallel and antiparallel to the linear polarization axis of the laser pulse. These asymmetries stem from interference of the one- and two-photon ionization amplitudes for producing electrons with the same momentum along the linear polarization axis. Whereas these asymmetries generally decrease with increasing ionized electron kinetic energy, we find a large enhancement of the asymmetry in the vicinity of two-electron doubly excited (autoionizing) states on an energy scale comparable to the widths of the autoionizing states. The CEP dependence of the energy-integrated asymmetry agrees very well with the predictions of time-dependent perturbation theory (Pronin et al 2009 Phys. Rev. A 80 063403). (paper)

  19. Paleohydrologic investigations in the vicinity of Yucca Mountain: Late Quaternary paleobotanical and polynological records

    International Nuclear Information System (INIS)

    Spaulding, W.G.

    1994-01-01

    The primary objective of this research in the vicinity of the proposed Yucca Mountain Nuclear Waste Repository is the detection of episodes of increased runoff and groundwater discharge in this presently arid area. Ancient, inactive spring deposits in nearby valley bottoms (Haynes, 1967; Quade, 1986; Quade and Pratt, 1989), evidence for perennial water in presently dry canyons (Spaulding, 1992), and recent claims for extraordinary increases in precipitation during the last glacial age (Forester, 1994), provide good reason to further investigate both lowland spring-discharge habitats, and upland drainages. The ultimate purpose is to assess the long-term variability of the hydrologic system in the vicinity of Yucca Mountain in response to naturally occurring climatic changes. The data generated in the course of this study are derived from radiocarbon dated packrat (Neotoma) middens. This report presents the results of an initial assessment of the hydrologic stability of the candidate area based on a limited suite of middens from localities that, on geomorphic and hydrologic grounds, could have been close to ancient stream-side or spring environments. Paleoclimatic reconstructions are another means of studying the long-term climatic hydrologic stability of the Candidate Area include, and are also generated from packrat midden data. A different flora characterized the Candidate Area during the last glacial age in response to a cooler and wetter climate, and the plant species that comprised this flora can be used to reconstruct specific components of past climatic regimes. Thus, a secondary objective of this study is to compare the plant macrofossil data generated in this study to other records from the Candidate Area (Spaulding, 1985; Wigand, 1990) to determine if these new data are consistent with prior reconstructions. 66 refs., 4 figs., 13 tabs

  20. Thermomechanical analysis of underground excavations in the vicinity of a nuclear waste isolation panel

    International Nuclear Information System (INIS)

    St John, C.M.

    1987-06-01

    This report summarizes the results of a series of analyses of excavations in the vicinity of waste emplacement panels. Specific consideration is given to the access drifts running between adjacent emplacement panels, the drift intersection at the entrance to the emplacement panels, and the waste emplacement excavations. Both horizontal and vertical emplacement models are considered, but greater emphasis is placed on the former. Three numerical modeling procedures were used in this study: a finite-element model was used for three-dimensional stress analysis of the tunnel intersection, a model based on the closed-form solution for point heat sources was used to predict temperatures and stresses in the vicinity of the emplacement panel, and simple two-dimensional boundary-element models were used to predict temperatures and stresses around excavations of various shapes. The results of two-dimensional stress analyses were postprocessed to determine the extent to which the strength of a rock mass, containing a set of vertical joints, was exceeded. The results presented in this report do not indicate that there will be any particular stability problems at the tunnel intersection investigated. Further, the effect of waste emplacement within the adjacent panels is to decrease the vertical rock stresses and increase the horizontal rock stresses at the intersection. These stress changes will tend to enhance the stability of larger-span excavations, including the tunnel intersection and the alcoves necessary for horizontal emplacement of waste canisters. The relatively high horizontal stresses experienced by the access were identified as a potential concern. However, evaluation of recent data on the thermomechanical properties of the rock mass modeled here has indicated that the stress changes will not be as severe as stated herein

  1. Paleohydrologic investigations in the vicinity of Yucca Mountain: Late Quaternary paleobotanical and polynological records

    Energy Technology Data Exchange (ETDEWEB)

    Spaulding, W.G.

    1994-10-05

    The primary objective of this research in the vicinity of the proposed Yucca Mountain Nuclear Waste Repository is the detection of episodes of increased runoff and groundwater discharge in this presently arid area. Ancient, inactive spring deposits in nearby valley bottoms (Haynes, 1967; Quade, 1986; Quade and Pratt, 1989), evidence for perennial water in presently dry canyons (Spaulding, 1992), and recent claims for extraordinary increases in precipitation during the last glacial age (Forester, 1994), provide good reason to further investigate both lowland spring-discharge habitats, and upland drainages. The ultimate purpose is to assess the long-term variability of the hydrologic system in the vicinity of Yucca Mountain in response to naturally occurring climatic changes. The data generated in the course of this study are derived from radiocarbon dated packrat (Neotoma) middens. This report presents the results of an initial assessment of the hydrologic stability of the candidate area based on a limited suite of middens from localities that, on geomorphic and hydrologic grounds, could have been close to ancient stream-side or spring environments. Paleoclimatic reconstructions are another means of studying the long-term climatic hydrologic stability of the Candidate Area include, and are also generated from packrat midden data. A different flora characterized the Candidate Area during the last glacial age in response to a cooler and wetter climate, and the plant species that comprised this flora can be used to reconstruct specific components of past climatic regimes. Thus, a secondary objective of this study is to compare the plant macrofossil data generated in this study to other records from the Candidate Area (Spaulding, 1985; Wigand, 1990) to determine if these new data are consistent with prior reconstructions. 66 refs., 4 figs., 13 tabs.

  2. Toward lifetime and g factor measurements of short-lived states in the vicinity of 208Pb

    International Nuclear Information System (INIS)

    Ralet, D; Georgiev, G; Stuchbery, A E; Clément, E; Lemasson, A; Michelagnoli, C; Rejmund, M; France, G de; Atanasova, L; Balabanski, D L; Bocchi, G; Carroll, R; Dewald, A; Fransen, C; Müller-Gatermann, C; Dudouet, J; Fornal, B; Franchoo, S; Goasduff, A; Gadea, A

    2017-01-01

    The multi-nucleon transfer reaction mechanism was used to produce and study nuclei in the vicinity of 208 Pb. This mass region is a test case for the nuclear shell model. The mass identification of the fragments was performed with the large acceptance magnetic spectrometer VAMOS++ coupled to the AGATA γ -tracking array. This experiment aimed to determine both lifetimes and gyromagnetic ratios of excited states with the Cologne plunger device. The analysis indicates promising results with the possibility to determine several new lifetimes in this region. (paper)

  3. Subjective symptoms reported by people living in the vicinity of cellular phone base stations: A review of the studies

    International Nuclear Information System (INIS)

    Bortkiewicz, A.; Szyjkowska, A.; Gadzicka, E.; Zmyslony, M.

    2004-01-01

    The problem of health effects of electromagnetic fields (EMF) emitted by cellular phone base stations evokes much interest in view of the fact that people living in their vicinity are fated to continuous exposure to EMF. None of the studies carried out throughout the world have revealed excessive values of standards adopted by the International Commission on Non-Ionizing Radiation Protection (ICNIRP). A questionnaire was used as a study tool. The results of the questionnaire survey reveal that people living in the vicinity of base stations report various complaints mostly of the circulatory system, but also of sleep disturbances, irritability, depression, blurred vision, concentration difficulties, nausea, lack of appetite, headache and vertigo. The performed studies showed the relationship between the incidence of individual symptoms, the level of exposure, and the distance between a residential area and a base station. This association was observed in both groups of persons, those who linked their complaints with the presence of the base station and those who did not notice such a relation. Further studies, clinical and those based on questionnaires, are needed to explain the background of reported complaints. (author)

  4. PERCEÇÕES SOBRE AS ABORDAGENS À APRENDIZAGEM – ESTUDO DE VARIÁVEIS PSICOLÓGICAS

    OpenAIRE

    Lourenço, Abílio Afonso; Nogueira, Carla Maria Leite

    2014-01-01

    Esta investigação, realizada numa escola básica no norte de Portugal, tem como objetivo analisar as perceções que os alunos apresentam sobre algumas variáveis relativas à forma como desenvolvem a sua aprendizagem, nomeadamente: a autorregulação para a aprendizagem; os processos de estudo utilizados; o controlo volitivo; a planificação da gestão do tempo; e a procrastinação. Outra finalidade deste estudo éverificar se existe uma relação significativa entre estas variáveis e a perceção de autoe...

  5. Influência da auto-percepção do envelhecimento e dos traços de personalidade na satisfação com a reforma

    OpenAIRE

    Fragoso, Nuno Miguel do Rosário Mendes

    2013-01-01

    Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2013 O presente trabalho foca-se no estudo da influência da auto-perceção do envelhecimento e dos traços de personalidade na satisfação com a reforma, numa amostra de idosos oriundos da comunidade e sem psicopatologia diagnosticada. Tem como objetivos: (1) analisar a auto-perceção do envelhecimento, os traços de personalidade e a s...

  6. Comparison of structural re-organisations observed on pre-patterned vicinal Si(1 1 1) and Si(1 0 0) surfaces during heat treatment

    International Nuclear Information System (INIS)

    Kraus, A.; Neddermeyer, H.; Wulfhekel, W.; Sander, D.; Maroutian, T.; Dulot, F.; Martinez-Gil, A.; Hanbuecken, M.

    2004-01-01

    The creation of distinct, periodically structured vicinal Si(1 1 1) and (1 0 0) substrates has been studied using scanning tunnelling microscopy at various temperatures. The vicinal Si(1 1 1) and (1 0 0) surfaces transform under heat treatment in a self-organised way into flat and stepped regions. Optical and electron beam lithography is used to produce a regular hole pattern on the surfaces, which interferes with the temperature-driven morphological changes. The step motions are strongly influenced by this pre-patterning. Pre-patterned Si(1 1 1) surfaces transform into regular one-dimensional (1D) and two-dimensional (2D) morphologies, which consist of terraces and arrangements of step bunches and facets. On pre-patterned Si(1 0 0) substrates different re-organisations were observed where checkerboard-like 2D structures are obtained

  7. The Swiss ''CANUPIS'' study on childhood cancer in the vicinity of nuclear power stations

    International Nuclear Information System (INIS)

    Voelkle, Hansruedi

    2011-01-01

    A nationwide cohort study on leukaemia and any other childhood cancer in the vicinity of Swiss nuclear power stations (CANUPIS) was supported by the Krebsliga Schweiz and the Swiss Federal Office of Public Health. The results, covering the years 1985 to 2009 and including some 21 million person years, was published in July 2011. Three zones around nuclear installations were investigated: 0 to 5 km, 5 to 10 km and 10 to 15 km distance. The CANUPIS study found no evidence for a statistically significant increased cancer risk among 0 to 15 year old children living near Swiss nuclear power stations, compared to children living in other regions of the country. (orig.)

  8. Element composition of solid airborne particles deposited in snow in the vicinity of gas-fired heating plant

    OpenAIRE

    Talovskaya, Anna Valerievna; Yazikov, Yegor (Egor) Grigoryevich; Filimonenko, Ekaterina Anatolievna; Samokhina, Nataljya Pavlovna; Shakhova, Tatiana Sergeevna; Parygina, Irina Alekseevna

    2016-01-01

    Local heating plants are the main pollution source of rural areas. Currently, there are few studies on the composition of local heating plants emissions. The article deals with the research results of air pollution level with solid airborne particles in the vicinity of local gas-fired heating plants of some districts of Tomsk region. The snow sampling was conducted for the purpose of solid airborne particles extraction from snow cover. The content of 28 chemical elements (heavy metals, rare e...

  9. The Relaxation of Vicinal (001) with ZigZag [110] Steps

    Science.gov (United States)

    Hawkins, Micah; Hamouda, Ajmi Bh; González-Cabrera, Diego Luis; Einstein, Theodore L.

    2012-02-01

    This talk presents a kinetic Monte Carlo study of the relaxation dynamics of [110] steps on a vicinal (001) simple cubic surface. This system is interesting because [110] steps have different elementary excitation energetics and favor step diffusion more than close-packed [100] steps. In this talk we show how this leads to relaxation dynamics showing greater fluctuations on a shorter time scale for [110] steps as well as 2-bond breaking processes being rate determining in contrast to 3-bond breaking processes for [100] steps. The existence of a steady state is shown via the convergence of terrace width distributions at times much longer than the relaxation time. In this time regime excellent fits to the modified generalized Wigner distribution (as well as to the Berry-Robnik model when steps can overlap) were obtained. Also, step-position correlation function data show diffusion-limited increase for small distances along the step as well as greater average step displacement for zigzag steps compared to straight steps for somewhat longer distances along the step. Work supported by NSF-MRSEC Grant DMR 05-20471 as well as a DOE-CMCSN Grant.

  10. Noisy coupled logistic maps in the vicinity of chaos threshold.

    Science.gov (United States)

    Tirnakli, Ugur; Tsallis, Constantino

    2016-04-01

    We focus on a linear chain of N first-neighbor-coupled logistic maps in the vicinity of their edge of chaos in the presence of a common noise. This model, characterised by the coupling strength ϵ and the noise width σmax, was recently introduced by Pluchino et al. [Phys. Rev. E 87, 022910 (2013)]. They detected, for the time averaged returns with characteristic return time τ, possible connections with q-Gaussians, the distributions which optimise, under appropriate constraints, the nonadditive entropy, Sq, basis of nonextensive statistics mechanics. Here, we take a closer look on this model, and numerically obtain probability distributions which exhibit a slight asymmetry for some parameter values, in variance with simple q-Gaussians. Nevertheless, along many decades, the fitting with q-Gaussians turns out to be numerically very satisfactory for wide regions of the parameter values, and we illustrate how the index q evolves with (N,τ,ϵ,σmax). It is nevertheless instructive on how careful one must be in such numerical analysis. The overall work shows that physical and/or biological systems that are correctly mimicked by this model are thermostatistically related to nonextensive statistical mechanics when time-averaged relevant quantities are studied.

  11. Recordando y descubriendo a Gala, la última descendiente de Rosalía de Castro

    OpenAIRE

    García Vega, Lucía

    2015-01-01

    Recientemente, se ha cumplido medio siglo del fallecimiento de Gala Martínez de Castro (1871-1964), último miembro de la familia ilustre fundada por la escritora Rosalía de Castro (1837-1885) y el historiador Manuel Martínez Murguía (1833-1923). A tr

  12. Contribution to the knowledge of jumping spiders (Araneae: Salticidae from vicinity of Jagodina, Central Serbia

    Directory of Open Access Journals (Sweden)

    Stanković, B.

    2012-09-01

    Full Text Available During last 10 years, based on personal collectings, 21 species from 14 genera of Salticidae (Araneae are recorded from vicinity of Jagodina: Ballus chalybeius, Carrhotus xanthogramma, Evarcha arcuata, Evarcha falcata, Heliophanus auratus, Heliophanus cupreus, Heliophanus flavipes, Heliophanus kochii, Icius hamatus, Icius subinermis, Leptorchestes berolinensis, Macaroeris nidicolens, Marpissa muscosa, Marpissa nivoyi, Mendoza canestrinii, Pellenes tripunctatus, Phintella castriesiana, Phlegra fasciata, Pseudeuophrys erratica, Pseudeuophrys lanigera, Salticus scenicus. All those species are provided with habitat notes and global distribution. New records for the spider fauna of Serbia are Heliophanus kochii (Simon 1868, Icius subinermis (Simon, 1937, Marpissa nivoyi (Lucas, 1846 and Mendoza canestrinii (Ninni, 1868.

  13. Determination of the Geothermal Potential by Geophysical Investigations in the Karbinci-Tarinci Area, in the Vicinity of Shtip

    International Nuclear Information System (INIS)

    Petrov, Goshe; Panovska, Sanja; Delipetrov, Marjan; Dimov, Gjorgji; Jovanovski, Vlatko

    2005-01-01

    Geophysical methods used in the determination of geothermal potential by geophysical investigations in the Karbinci-Tarinci area included as follows: detailed reflective seismic scanning, geomagnetic profiling, geo electric probe and electromagnetic VLF prospecting. The site investigated consists of rocks of Precambrian, Mesozoic (Jurassic), Tertiary (Paleogene Neogene) and Quaternary age. From earlier investigations carried out in the wider vicinity and from investigations carried out by the present authors, one can expect occurrence geothermal water in the area. (Author)

  14. A floristic survey of Yucca Mountain and vicinity, Nye County, Nevada

    International Nuclear Information System (INIS)

    Niles, W.E.; Leary, P.J.; Holland, J.S.; Landau, F.H.

    1994-12-01

    A survey of the vascular flora of Yucca Mountain and vicinity, Nye County, Nevada, was conducted from March to June 1994. An annotated checklist of recorded taxa was compiled. Voucher plant specimens were collected and accessioned into the Herbarium at the University of Nevada, Las Vegas. Collection data accompanying these specimens were entered into that herbarium's electronic data base. Combined results from this survey and the works of other investigators reveal the presence of a total of 325 specific and intraspecific taxa within the area, these allocated to 162 genera and 53 families. Owing to drought conditions prevalent throughout the area, the annual floristic component was largely absent during the period of study, and it is likely much under-represented in the tabulation of results. No taxon currently listed as threatened or endangered under the Endangered Species Act was encountered during this study. Several candidate species for listing under this Act were present, and distributional data for these were recorded. No change in the status of these candidate species is recommended as the result of this survey

  15. A floristic survey of Yucca Mountain and vicinity, Nye County, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Niles, W.E.; Leary, P.J.; Holland, J.S.; Landau, F.H.

    1994-12-01

    A survey of the vascular flora of Yucca Mountain and vicinity, Nye County, Nevada, was conducted from March to June 1994. An annotated checklist of recorded taxa was compiled. Voucher plant specimens were collected and accessioned into the Herbarium at the University of Nevada, Las Vegas. Collection data accompanying these specimens were entered into that herbarium`s electronic data base. Combined results from this survey and the works of other investigators reveal the presence of a total of 325 specific and intraspecific taxa within the area, these allocated to 162 genera and 53 families. Owing to drought conditions prevalent throughout the area, the annual floristic component was largely absent during the period of study, and it is likely much under-represented in the tabulation of results. No taxon currently listed as threatened or endangered under the Endangered Species Act was encountered during this study. Several candidate species for listing under this Act were present, and distributional data for these were recorded. No change in the status of these candidate species is recommended as the result of this survey.

  16. Post-accident environmental radiomonitoring in the vicinity of the Chernobyl NPP

    International Nuclear Information System (INIS)

    Hashari, M.; Assadi, M.; Reese, S.

    1997-01-01

    After the Chernobyl accident, the vicinity around the fourth reactor unit, destroyed after explosion, has become the largest outdoor laboratory, where the mankind's knowledge concerning the, radionuclides behaviour in the environment can be essentially tested and improved. An international group of scientists from the Ukraine, USA and the IAEA fellows from Brasil, Kenya, Syria and Iran as participants of Summer School on environmental monitoring, took participation in field exercises to investigate radioecological situation inside 30-km Exclusion Zone at three different sites: two fields and one forest with inherent levels of contamination. The present radioecological situation inside the 30-km Exclusion Zone is mainly determined by the 137 Cs + 134 Cs, 90 Sr and transuranic elements as well. The international group divided into teams and performed gamma and beta surveys, in-situ gamma-spectrometry and vegetation and soil sampling in contaminated field and forest locations. The aim of this work was to investigate the peculiarities of measurement at different sites and to develop recommendations on group-made environmental monitoring

  17. Tritium concentrations in environmental water and food samples collected around the vicinity of the PNPP-1

    International Nuclear Information System (INIS)

    Garcia, T.Y.; Enriquez, S.O.; Duran, E.B.

    1986-01-01

    The natural radioactivity levels of tritium in environmental samples collected around the vicinity and more distant environment of the first Philippine Nuclear Power Plant (PNPP-1) in Bataan were assessed. The samples analyzed consisted of water samples such as seawater, freshwater, drinking water, groundwater and rainwater; and food samples such as cereals, vegetables, fruits; meat, milk fish and crustaceans. Tritium concentrations in water samples were determined by distillation and liquid scintillation counting techniques. The food samples were analyzed for tissue-free water tritium by the freezing-drying method followed by liquid scintillation counting techniques. (Auth.) 13 refs

  18. Chiral separation of synthetic vicinal diol compounds by capillary zone electrophoresis with borate buffer and beta-cyclodextrin as buffer additive.

    Science.gov (United States)

    Zhao, Yan; Yang, Xingbin; Jiang, Ru; Sun, Xiaoli; Liu, Wenmin; Zhang, Shengyong

    2006-05-01

    The investigation on capillary electrophoretic enantioseparation of six synthetic compounds containing vicinal diol groups has been undertaken to acquire the optimum conditions using native beta-cyclodextrin (beta-CD) as chiral selector and borate as a background electrolyte. The separation was carried out in an uncoated capillary (58.5 cm x 75 microm i.d., effective length 48.5 cm) and the effects of several important factors were investigated in detail. The results showed that beta-CD as a chiral selector exhibited good enantioselectivity and that the enantioseparation was greatly influenced by the structure of the diols, the borate concentration and the buffer pH. The optimum performance was obtained for the chiral vicinal diols under the conditions of 200 mM borate buffer of pH 9.8 containing 1.7% beta-CD at an applied voltage of 15 kV and a capillary temperature of 20 degrees C. Under the conditions, four diols were baseline separated with fast analysis time and the good theoretical plate numbers (above 10 x 10(4)) and favorable migration-time reproducibilities (RSDs below 3.0%) were obtained. The separation results were satisfactory.

  19. Sediment porewater toxicity assessment studies in the vicinity of offshore oil and gas production platforms in the Gulf of Mexico

    Science.gov (United States)

    Carr, R.S.; Chapman, D.C.; Presley, B.J.; Biedenbach, J.M.; Robertson, L.; Boothe, P.; Kilada, R.; Wade, T.; Montagna, P.

    1996-01-01

    As part of a multidisciplinary program to assess the potential long-term impacts of offshore oil and gas exploration and production activities in the Gulf of Mexico, sediment chemical analyses and porewater toxicity tests were conducted in the vicinity of five offshore platforms. Based on data from sea urchin fertilization and embryological development assays, toxicity was observed near four of the five platforms sampled; the majority of the toxic samples were collected within 150 m of a platform. There was excellent agreement among the results of porewater tests with three different species (sea urchin embryological development, polychaete reproduction, and copepod nauplii survival). The sediment concentrations of several metals were well in excess of sediment quality assessment guidelines at a number of stations, and good agreement was observed between predicted and observed toxicity. Porewater metal concentrations compared with EC50, LOEC, and NOEC values generated for water-only exposures indicated that the porewater concentrations for several metals were high enough to account for the observed toxicity. Results of these studies utilizing highly sensitive toxicity tests suggest that the contaminant-induced impacts from offshore platforms are limited to a localized area in the immediate vicinity of the platforms. 

  20. P1-11: Visual Function and Neurotoxic Symptoms Related to Exposure to Organic Solvents

    Directory of Open Access Journals (Sweden)

    Ingrid Jimenez Barbosa

    2012-10-01

    Full Text Available Aim: Exposure to Perchloroethylene (PERC, a solvent used in dry-cleaning, is associated with neurotoxicity and changes in colour vision (CV and contrast sensitivity (CS. However, PERCs' impact on other aspects of visual function (VF such as chromatic contrast sensitivity (CCS, glass pattern detection (GPP, visual search (VS, and global motion sensitivity (GMS remains unclear. This study compared VF and neurotoxicity in two populations at risk, dry-cleaners (cases from Colombia and Australia. Control groups of people with community levels of exposure to PERC were also assessed. Methods: A case-control study of VF in people who are working in the dry-cleaning industry for at least 1 year (n = 40 Colombia; n= 34 Australia with controls (n = 35 each site. VF measures assessed were CSF, CCS, the FM Hue 100 test, VS, GPP, and GMS. Neurotoxic symptoms were assessed using the Q16 modified version questionnaire. Results: Cases had poorer CCS, hue discrimination, GPP, GMS, and higher Q16 scores than controls (p < .05. There was no effect of country. CS function was poorer than controls (p < .05 for spatial frequencies≥0.50 cpd for Australian cases but for ≥1.0 cpd for Colombian cases. There were no significant differences between cases and controls for serial and parallel VS. Conclusion: Our CSF and CV findings indicate that the CS deficit extends to lower spatial frequencies. Furthermore we report a reduction in the detection of form, motion, and CCS. These deficits were associated with neurotoxic symptoms. Because VS was unaffected, it suggests that PERC affects lower order visual functions more severely than higher level cognition.

  1. Different behavioral effect dose–response profiles in mice exposed to two-carbon chlorinated hydrocarbons: Influence of structural and physical properties

    International Nuclear Information System (INIS)

    Umezu, Toyoshi; Shibata, Yasuyuki

    2014-01-01

    The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles

  2. Different behavioral effect dose–response profiles in mice exposed to two-carbon chlorinated hydrocarbons: Influence of structural and physical properties

    Energy Technology Data Exchange (ETDEWEB)

    Umezu, Toyoshi, E-mail: umechan2@nies.go.jp; Shibata, Yasuyuki, E-mail: yshibata@nies.go.jp

    2014-09-01

    The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles.

  3. Marketing System of Fresh Friut and Vegetable: The Role of Modern and Wholesale Market in Jakarta and the Vicinity

    Directory of Open Access Journals (Sweden)

    Togar A. Napitupulu

    2010-05-01

    Full Text Available Marketing system of fresh fruits and vegetable in the context of the rapidly growing dynamic markets in Jakarta and the vicinity was studied. Unstructured interviews and observations of key persons, and panels were conducted, primarily in three main wholesale markets in Jakarta and the vicinity and some supermarkets. It was found that the availability of management services and associated facilities are not yet fully compatible with modern markets. Their role, therefore, in catering to the supermarkets is limited, in particular for vegetables due to requirements on quality and delivery schedules. In general, supermarkets procure their supply directly from production centers through special/dedicated suppliers, which currently amounts to about 1% to 5% of total production from production centers. If policy and conducive economic incentive are available, wholesale markets are not only domain of public investment anymore, but also private investments alike. The newly established wholesale markets show that they now have a higher rate of utilization than in the years before. It is therefore for the local government and the central government to furthers devise conducive policy and regulatory measures, and for the private to take this opportunity in terms of investment in developing the economy of the region. 

  4. Studying the InAs quantum points on the vicinal surface of a GaAs crystal by the atomic force microscopy

    CERN Document Server

    Evtikhiev, V P; Kotelnikov, E Y; Matveentsev, A V; Titkov, A N; Shkolnik, A S

    2002-01-01

    The methodology for processing the images, obtained through the atomic force microscopy, is proposed. It is shown by the concrete example, how the parameters of the InAs clusters on the vicinal surface of the GaAs crystal are determined. This makes it possible to calculate the energy levels of the electrons and holes in the quantum point with application of the previously developed cluster spherical model

  5. Compare. An analysis of jurisprudence of the Dutch Real Estate Appraisal in relation with the vicinity of wind turbines

    International Nuclear Information System (INIS)

    Berenschot, J.H.M.

    2005-11-01

    The central question in this report concerns the impact of recent judgements with regard to the devaluation of houses as a result of wind turbines in the vicinity of those houses. More specific: does the installation of wind turbines near houses effect the so-called Real Estate Appraisal tax for those houses. From four cases it appears that three aspects are important: noise pollution, cast shadow hindrance and visual hindrance, caused by wind turbines [nl

  6. The vicinal difluoro motif: The synthesis and conformation of erythro- and threo- diastereoisomers of 1,2-difluorodiphenylethanes, 2,3-difluorosuccinic acids and their derivatives

    Directory of Open Access Journals (Sweden)

    Schüler Martin

    2006-10-01

    Full Text Available Abstract Background It is well established that vicinal fluorines (RCHF-CHFR prefer to adopt a gauche rather than an anti conformation when placed along aliphatic chains. This has been particularly recognised for 1,2-difluoroethane and extends to 2,3-difluorobutane and longer alkyl chains. It follows in these latter cases that if erythro and threo vicinal difluorinated stereoisomers are compared, they will adopt different overall conformations if the fluorines prefer to be gauche in each case. This concept is explored in this paper with erythro- and threo- diastereoisomers of 2,3-difluorosuccinates. Results A synthetic route to 2,3-difluorosuccinates has been developed through erythro- and threo- 1,2-difluoro-1,2-diphenylethane which involved the oxidation of the aryl rings to generate the corresponding 2,3-difluorosuccinic acids. Ester and amide derivatives of the erythro- and threo- 2,3-difluorosuccinic acids were then prepared. The solid and solution state conformation of these compounds was assessed by X-ray crystallography and NMR. Ab initio calculations were also carried out to model the conformation of erythro- and threo- 1,2-difluoro-1,2-diphenylethane as these differed from the 2,3-difluorosuccinates. Conclusion In general the overall chain conformations of the 2,3-difluorosuccinates diastereoisomers were found to be influenced by the fluorine gauche effect. The study highlights the prospects of utilising the vicinal difluorine motif (RCHF-CHFR as a tool for influencing the conformation of performance organic molecules and particularly tuning conformation by selecting specific diastereoisomers (erythro or threo.

  7. Effect of extrusion parameters on some properties of dietary fiber ...

    African Journals Online (AJOL)

    use

    2011-11-21

    Nov 21, 2011 ... Méndez-García, S.1, Martínez-Flores, H.E.2* and Morales-Sánchez, E.3. 1Student of ... product (Sánchez-Alonso et al., 2007), coconut fiber ..... Rodríguez R, Jiménez A, Fernández-Bolaños J, Guillén R, Heredia A. (2006).

  8. Monitoring of radionuclides in the vicinities of Finnish nuclear power plants in 1991-1992

    Energy Technology Data Exchange (ETDEWEB)

    Ikaeheimonen, T.K.; Klemola, S.; Ilus, E.; Sjoeblom, K.-L.

    1995-06-01

    Surveillance of radioactive substances around Finnish nuclear power plants continued in 1991-1992 according to regular monitoring programmes, in which about 1000 samples were analysed annually from terrestrial and aquatic environments of the two power plants. Trace amounts of activation products originating from the airborne releases of the local power plants were detected in several air, deposition and soil samples. Discharged nuclides were more abundant in the aquatic environment, especially in samples of indicator organisms, sinking matter and sediments. However, the concentrations were so low that they did not markedly increase the radiation burden in the environment. The dominant artificial radionuclides in the vicinity of the power plants remained the cesium isotopes, {sup 137}Cs and {sup 134}Cs, originating from the Chernobyl accident. (orig.) (21 figs., 40 tabs.).

  9. Microearthquake studies in the vicinity of the Cane Creek Potash Mine, Paradox Basin, Utah

    International Nuclear Information System (INIS)

    Wong, I.G.; Humphrey, J.R.; Silva, W.J.

    1987-08-01

    For a 12-week period in 1984, a 5- to 9-station high-resolution network of analog and digital microearthquake recorders operated monitoring seismicity. The solution mine, previously a room-and-pillar mine located at an average depth of 1 km in the late-Paleozoic Paradox Formation, was undergoing a major brine extraction and refilling. The objective was to determine whether the seismicity previously observed in the vicinity of the mine by the Paradox Basin microearthquake network was associated with the mining activities. Several thousand events of two types were recorded: (1) events identical in appearance to tectonic microearthquakes that occurred throughout the region, and (2) unusual harmonic surface-wave-like events thought to be caused by the collapsing of a column of salt in the main shaft. 31 refs., 36 figs., 3 tabs

  10. Organofluorine chemistry: synthesis and conformation of vicinal fluoromethylene motifs.

    Science.gov (United States)

    O'Hagan, David

    2012-04-20

    The C-F bond is the most polar bond in organic chemistry, and thus the bond has a relatively large dipole moment with a significant -ve charge density on the fluorine atom and correspondingly a +ve charge density on carbon. The electrostatic nature of the bond renders it the strongest one in organic chemistry. However, the fluorine atom itself is nonpolarizable, and thus, despite the charge localization on fluorine, it is a poor hydrogen-bonding acceptor. These properties of the C-F bond make it attractive in the design of nonviscous but polar organic compounds, with a polarity limited to influencing the intramolecular nature of the molecule and less so intermolecular interactions with the immediate environment. In this Perspective, the synthesis of aliphatic chains carrying multivicinal fluoromethylene motifs is described. It emerges that the dipoles of adjacent C-F bonds orientate relative to each other, and thus, individual diastereoisomers display different backbone carbon chain conformations. These conformational preferences recognize the influence of the well-known gauche effect associated with 1,2-difluoroethane but extend to considering 1,3-fluorine-fluorine dipolar repulsions. The synthesis of carbon chains carrying two, three, four, five, and six vicinal fluoromethylene motifs is described, with an emphasis on our own research contributions. These motifs obey almost predictable conformational behavior, and they emerge as candidates for inclusion in the design of performance organic molecules. © 2012 American Chemical Society

  11. Lagrangian Observations of Nonlinear Internal Waves and Turbulence Mixing in Luzon Strait and South China Sea and Internal Wave in the Vicinity of the Kuroshio Path

    National Research Council Canada - National Science Library

    Lien, Ren-Chieh; D'Asaro, Eric A

    2008-01-01

    ... mixing in the northern South China Sea. Results are reported. The second was to analyze observations of data taken in the vicinity of the Kuroshio path from Luzon Strait to the southern East China Sea...

  12. A la costa de Luis A. Martínez: ¿la defensa de un proyecto liberal para Ecuador?

    Directory of Open Access Journals (Sweden)

    1998-01-01

    Full Text Available A LA COSTA DE LUIS A. MARTINEZ : LA DEFENSE D’UN PROJET LIBERAL POUR L’ÉQUATEUR ? A la Costa est souvent analysé comme une peinture de moeurs, témoignage de la réalité sociale et politique de l´Équateur de la fin du XIX et du début du XX. En effet, ce roman prétend décrire le conflit traditionnel qui oppose socialement, économiquement et politiquement les Andes et la Côte. Mais il se présente aussi et surtout comme la défense d´un projet libéral pour l´Équateur et développe une démonstration idéologique systématique. En outre, il propose une lecture du sens de la vie et une réflexion sur le devenir de l´homme dont la portée dépasse largement l´argumentation idéologique. Ce sont sans aucun doute ces nuances, introduites tout au long de la narration, qui permettent à l´oeuvre d´échapper à son statut exemplaire, simple témoignage d´une époque, pour proposer une vision personnelle et créative. Muchos han visto en A la Costa una novela de tendencia costumbrista, testimonio de la realidad social y política del Ecuador a finales del siglo XIX y comienzos del XX. En efecto, la novela pretende describir el conflicto tradicional social, económico, político entre Sierra y Costa. Pero es también, y ante todo, la defensa de un proyecto liberal para Ecuador, desarrollando una sistemática demostración ideológica. Además, propone una lectura del sentido de la vida y una reflexión sobre el porvenir del hombre cuyo alcance va más allá de la defensa de un proyecto ideológico. Sin duda son estos matices, introducidos a lo largo de la narración, los que permiten que la obra escape del estatuto de novela ejemplar y testimonial para proponer una visión autónoma y creativa. THE NOVEL A LA COSTA OF LUIS A. MARTÍNEZ: THE DEFENSE OF A LIBERAL PROJECT FOR ECUADOR? The novel A la Costa has often been analyzed as a portrait of national costumes, a testimony to the social and political realities of Ecuador at the end of

  13. Analysis of Volatile Organic and Sulfur Compounds in Air Near a Pulp Paper Mill in North-Central Idaho

    Science.gov (United States)

    Johnston, N. A. C.; Bundy, B. A.; Andrew, J. P.; Grimm, B. K.; Ketcherside, D.; Rivero-Zevallos, J. A.; Uhlorn, R. P.

    2017-12-01

    Lewiston, Idaho is a small city in the Snake River Valley bordering North-Central Idaho and Southeastern Washington, with a population of over 40,000 including the surrounding areas. One of the main industries and employers in the region is a kraft paper mill in North Lewiston, which results in odorous levels of sulfur air pollutants there. The Idaho Department of Environmental Quality has an air monitoring station in Lewiston but measures only air particulate matter (PM). Surprisingly, not much long-term data exists on this area for specific air constituents such as volatile organics, hazardous air pollutants, and sulfur compounds. One year-long study conducted in 2006-2007 by the Nez Perce Tribe found high formaldehyde levels in the area, and warranted further study in July of 2016-2017. Our ongoing study began in the fall of 2016 and investigates the seasonal air composition in the Lewiston area. Specifically, active air sampling via sorbent tubes and analysis by thermal desorption gas chromatography-mass spectrometry (TD-GC-MS). was utilized to measure over 50 volatile organic compounds, hazardous air pollutants, and sulfurous compounds in ambient air (adapted from EPA Method TO-17). Seasonal, diurnal, and spatial variations in air composition were explored with weekly to monthly grab sampling. Dimethyl sulfide (DMS) and dimethyl disulfide (DMDS) were the primary sulfur compounds detected, and these varied considerably depending on time of day, season, location and meteorology. DMS was more prevalent in the summer months, while DMDS was more prevalent in the spring. Elevated concentrations of benzene and chloroform were found in the region during 2017, with average values of short term grab samples over three times the acceptable ambient concentrations in Idaho. These levels did not persist during longer term sampling of 12-hours, however further monitoring is needed to assess a potential health concern.

  14. Columbia River system operation review. Final environmental impact statement

    International Nuclear Information System (INIS)

    1995-11-01

    The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930's, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D'Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation

  15. Columbia River System Operation Review : Final Environmental Impact Statement, Appendix D: Exhibits.

    Energy Technology Data Exchange (ETDEWEB)

    Columbia River System Operation Review (U.S.)

    1995-11-01

    The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930`s, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D`Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation.

  16. Infrared spectroscopy of one-dimensional metallic nanostructures on silicon vicinal surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Hoang, Chung Vu

    2010-06-23

    Vicinal silicon(111) surfaces are used as templates for the growth of lead nanowires as well as gold and indium atom chains. The morphology of the Au atom chains was studied by use of Scanning Tunneling Microscopy (STM) and Reflection High Energy Electron Diffraction (RHEED). The In chains were investigated by infrared spectroscopy with the electrical field component of the IR light polarized either parallel or perpendicular to the wires. It is shown that at room temperature, In atom-chains display a plasmonic absorption feature along the chain but not in the perpendicular direction. Furthermore, upon cooling down to liquid nitrogen temperature, a metal to insulator transition is observed. A structural distortion is also confirmed by RHEED. As for the result of Pb nanowires, by means of infrared spectroscopy, it is now possible to control the average length of parallel nanowire arrays by monitoring four experimental parameters that influence on the nucleation density; namely: Pb coverage, evaporation rate, substrate temperature and the surface itself. The system shows an enhancement of the absorption at the antenna frequency in the low temperature regime. This scenario is assigned to the reduction of electron-phonon scattering due to low temperature. (orig.)

  17. Infrared spectroscopy of one-dimensional metallic nanostructures on silicon vicinal surfaces

    International Nuclear Information System (INIS)

    Hoang, Chung Vu

    2010-01-01

    Vicinal silicon(111) surfaces are used as templates for the growth of lead nanowires as well as gold and indium atom chains. The morphology of the Au atom chains was studied by use of Scanning Tunneling Microscopy (STM) and Reflection High Energy Electron Diffraction (RHEED). The In chains were investigated by infrared spectroscopy with the electrical field component of the IR light polarized either parallel or perpendicular to the wires. It is shown that at room temperature, In atom-chains display a plasmonic absorption feature along the chain but not in the perpendicular direction. Furthermore, upon cooling down to liquid nitrogen temperature, a metal to insulator transition is observed. A structural distortion is also confirmed by RHEED. As for the result of Pb nanowires, by means of infrared spectroscopy, it is now possible to control the average length of parallel nanowire arrays by monitoring four experimental parameters that influence on the nucleation density; namely: Pb coverage, evaporation rate, substrate temperature and the surface itself. The system shows an enhancement of the absorption at the antenna frequency in the low temperature regime. This scenario is assigned to the reduction of electron-phonon scattering due to low temperature. (orig.)

  18. Digital Geologic Map of the Nevada Test Site and Vicinity, Nye, Lincoln, and Clark Counties, Nevada, and Inyo County, California

    Science.gov (United States)

    Slate, Janet L.; Berry, Margaret E.; Rowley, Peter D.; Fridrich, Christopher J.; Morgan, Karen S.; Workman, Jeremiah B.; Young, Owen D.; Dixon, Gary L.; Williams, Van S.; McKee, Edwin H.; Ponce, David A.; Hildenbrand, Thomas G.; Swadley, W.C.; Lundstrom, Scott C.; Ekren, E. Bartlett; Warren, Richard G.; Cole, James C.; Fleck, Robert J.; Lanphere, Marvin A.; Sawyer, David A.; Minor, Scott A.; Grunwald, Daniel J.; Laczniak, Randell J.; Menges, Christopher M.; Yount, James C.; Jayko, Angela S.

    1999-01-01

    This digital geologic map of the Nevada Test Site (NTS) and vicinity, as well as its accompanying digital geophysical maps, are compiled at 1:100,000 scale. The map compilation presents new polygon (geologic map unit contacts), line (fault, fold axis, metamorphic isograd, dike, and caldera wall) and point (structural attitude) vector data for the NTS and vicinity, Nye, Lincoln, and Clark Counties, Nevada, and Inyo County, California. The map area covers two 30 x 60-minute quadrangles-the Pahute Mesa quadrangle to the north and the Beatty quadrangle to the south-plus a strip of 7.5-minute quadrangles on the east side-72 quadrangles in all. In addition to the NTS, the map area includes the rest of the southwest Nevada volcanic field, part of the Walker Lane, most of the Amargosa Desert, part of the Funeral and Grapevine Mountains, some of Death Valley, and the northern Spring Mountains. This geologic map improves on previous geologic mapping of the same area (Wahl and others, 1997) by providing new and updated Quaternary and bedrock geology, new geophysical interpretations of faults beneath the basins, and improved GIS coverages. Concurrent publications to this one include a new isostatic gravity map (Ponce and others, 1999) and a new aeromagnetic map (Ponce, 1999).

  19. Isotopic characterisation of lead in contaminated soils from the vicinity of a non-ferrous metal smelter near Plovdiv, Bulgaria

    Energy Technology Data Exchange (ETDEWEB)

    Bacon, Jeffrey R. [Macaulay Institute, Craigiebuckler, Aberdeen AB15 8QH (United Kingdom)]. E-mail: j.bacon@macaulay.ac.uk; Dinev, Nikolai S. [N Poushkarov Institute of Soil Science and Agroecology, Sofia (Bulgaria)

    2005-03-01

    Soil samples from the vicinity of a non-ferrous metal smelter near Plovdiv, Bulgaria contained very high concentrations of cadmium, lead and zinc (up to 140, 4900 and 5900 mg kg{sup -1}, respectively). A roadside soil in a relatively uncontaminated area also contained high concentrations of the same metals (24, 1550 and 1870 mg kg{sup -1}, respectively) indicating that the transport of ores could be a source of contamination. Even though the lead isotope ratios in all the samples fell within a very narrow range (for example, 1.186-1.195 for {sup 206}Pb/{sup 207}Pb), the samples could be differentiated into three distinct groups: ores ({sup 206}Pb/{sup 207}Pb and {sup 208}Pb/{sup 207}Pb ratios of 1.1874-1.1884 and 2.4755-2.4807, respectively), current deposition (1.1864 and 2.4704-2.4711, respectively) and local background (1.1927-1.1951 and 2.4772-2.4809, respectively). Although most of the current deposition has its origin in the ores used at the smelter, up to 12% could be from other sources such as petrol lead. - Although soils in the vicinity of a non-ferrous metal smelter near Plovdiv, Bulgaria, have become highly contaminated with the ores used, lead isotope analysis has revealed that up to 12% of current deposition could be from other sources such as petrol lead.

  20. Isotopic characterisation of lead in contaminated soils from the vicinity of a non-ferrous metal smelter near Plovdiv, Bulgaria

    International Nuclear Information System (INIS)

    Bacon, Jeffrey R.; Dinev, Nikolai S.

    2005-01-01

    Soil samples from the vicinity of a non-ferrous metal smelter near Plovdiv, Bulgaria contained very high concentrations of cadmium, lead and zinc (up to 140, 4900 and 5900 mg kg -1 , respectively). A roadside soil in a relatively uncontaminated area also contained high concentrations of the same metals (24, 1550 and 1870 mg kg -1 , respectively) indicating that the transport of ores could be a source of contamination. Even though the lead isotope ratios in all the samples fell within a very narrow range (for example, 1.186-1.195 for 206 Pb/ 207 Pb), the samples could be differentiated into three distinct groups: ores ( 206 Pb/ 207 Pb and 208 Pb/ 207 Pb ratios of 1.1874-1.1884 and 2.4755-2.4807, respectively), current deposition (1.1864 and 2.4704-2.4711, respectively) and local background (1.1927-1.1951 and 2.4772-2.4809, respectively). Although most of the current deposition has its origin in the ores used at the smelter, up to 12% could be from other sources such as petrol lead. - Although soils in the vicinity of a non-ferrous metal smelter near Plovdiv, Bulgaria, have become highly contaminated with the ores used, lead isotope analysis has revealed that up to 12% of current deposition could be from other sources such as petrol lead

  1. Daily insulin requirement of children and adolescents with type 1 diabetes: effect of age, gender, body mass index and mode of therapy.

    Science.gov (United States)

    Wiegand, Susanna; Raile, Klemens; Reinehr, Thomas; Hofer, Sabine; Näke, Andrea; Rabl, Wolfgang; Holl, Reinhard W

    2008-04-01

    The purpose of this study was to generate insulin dose (ID) percentiles for children and adolescents with type 1 diabetes mellitus (DM1) having the opportunity to assess this important parameter in relation to age and sex. Daily IDs per weight (ID/kg) were recorded in 22,177 patients with DM1 (3-25 years of age, DM1 duration of more than 2 years, 48% female) and ID percentiles (ID-Perc) were created statistically. The ID-Perc were compared between male and female, and between multiple insulin injection therapy (MIT) and continuous s.c. insulin infusion (CSII). A multivariate regression analysis was performed for ID in the third year of DM1 with ID/kg, body weight, age, gender, and insulin delivery regimen as variables. The 50th ID-Perc (P50) varied among 0.67 IU/kg (age 3 years), 0.93 IU/kg (13 years), and 0.70 IU/kg (23 years) increasing from early childhood to adolescence and decreasing toward adulthood. Highest P50 ID was found at 12 years in females (0.94 IU/kg) and at 14 years in males (0.92 IU/kg). Using ICT, the ID was significantly higher compared with CSII (P50: 0.94 IU/kg versus 0.79 IU/kg at 13 years). In multivariate regression analysis, ID was significantly (P>0.001) associated with age, gender, and insulin delivery regime. The ID-Perc were significantly different during various periods of childhood and were influenced by gender, body weight, and insulin injection regimes. Therefore, the presented data 1) provide evidence to interpret individual ID in children and adolescents with DM1 and 2) more specifically identify children with unusually high (insulin resistance and non-compliance) or low (MODY and persistent remission) insulin requirement.

  2. Analytical results for 544 water samples collected in the Attean Quartz Monzonite in the vicinity of Jackman, Maine

    Science.gov (United States)

    Ficklin, W.H.; Nowlan, G.A.; Preston, D.J.

    1983-01-01

    Water samples were collected in the vicinity of Jackman, Maine as a part of the study of the relationship of dissolved constituents in water to the sediments subjacent to the water. Each sample was analyzed for specific conductance, alkalinity, acidity, pH, fluoride, chloride, sulfate, phosphate, nitrate, sodium, potassium, calcium, magnesium, and silica. Trace elements determined were copper, zinc, molybdenum, lead, iron, manganese, arsenic, cobalt, nickel, and strontium. The longitude and latitude of each sample location and a sample site map are included in the report as well as a table of the analytical results.

  3. Monitoring of radionuclides in the vicinities of Finnish nuclear power plants in 1993 and 1994

    International Nuclear Information System (INIS)

    Klemola, S.; Ilus, E.; Ikaeheimonen, T.K.

    1998-08-01

    Monitoring of radioactive substances around Finnish nuclear power plants continued in 1993-1994 in accordance with the regular programmes. Some 1000 samples are analysed annually from the terrestrial and aquatic environments of the two power plant sites. Trace amounts of activation products originating from airborne releases from the local power plants were detected in several air, deposition and soil samples. Discharged nuclides were more abundant in the aquatic environment, especially in samples of indicator organisms, sinking matter and sediments. However, the concentrations were so low that they did not significantly increase the radiation burden in the environment. The dominant artificial radionuclides in the vicinity of the power plants remained the cesium isotopes, especially 137 Cs but also 134 Cs, originating from the Chernobyl accident. (orig.)

  4. Closure plan for the M-Area settling basin and vicinity at the Savannah River Plant

    International Nuclear Information System (INIS)

    Colven, W.P.; Pickett, J.B.; Muska, C.F.; Boone, L.F.

    1988-03-01

    The closure plan for the M-Area settling basin and vicinity was originally submitted to the South Carolina Department of Health and Environmental Control (SCDHEC) Bureau of Solid and Hazardous Waste Management in September 1984. The plan was revised in July and November 1985 in response to SCDHEC comments. After public comment in April through July 1986, the closure plan was conditionally approved by SCDHEC in March 1987. The conditions included (1) providing a temporary wastewater treatment facility to process the water remaining in the basin, (2) using a burn box to limit ash emissions from burning in the basin, (3) obtaining SCDHEC approval prior to operating the leach field, and (4) completing all closure activities within three years of the startup date

  5. Hydrodeoxygenation of vicinal OH groups over heterogeneous rhenium catalyst promoted by palladium and ceria support.

    Science.gov (United States)

    Ota, Nobuhiko; Tamura, Masazumi; Nakagawa, Yoshinao; Okumura, Kazu; Tomishige, Keiichi

    2015-02-02

    Heterogeneous ReOx-Pd/CeO2 catalyst showed excellent performance for simultaneous hydrodeoxygenation of vicinal OH groups. High yield (>99%), turnover frequency (300 h(-1)), and turnover number (10,000) are achieved in the reaction of 1,4-anhydroerythritol to tetrahydrofuran. This catalyst can be applied to sugar alcohols, and mono-alcohols and diols are obtained in high yields (≥85%) from substrates with even and odd numbers of OH groups, respectively. The high catalytic performance of ReOx-Pd/CeO2 can be assigned to rhenium species with +4 or +5 valence state, and the formation of this species is promoted by H2/Pd and the ceria support. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Three-dimensional problems of the hydrodynamic interaction between bodies in a viscous fluid in the vicinity of their contact

    Czech Academy of Sciences Publication Activity Database

    Petrov, A. G.; Kharlamov, Alexander A.

    2013-01-01

    Roč. 48, č. 5 (2013), s. 577-587 ISSN 0015-4628 R&D Projects: GA ČR(CZ) GA103/09/2066 Grant - others:Development of the Scientific Potential of the Higher Schoo(RU) 2.1.2/3604; Russian Foundation for Basic Research (RU) 11- 01-005355 Institutional support: RVO:67985874 Keywords : lubrication layer theory * viscous and inviscid fluids * thin layer * vicinity of a contact * three-dimensional problems Subject RIV: BK - Fluid Dynamics Impact factor: 0.320, year: 2013

  7. Assessment of volcanic and geothermal activity in the Pasco Basin and vicinity

    International Nuclear Information System (INIS)

    Davis, J.D.

    1980-01-01

    Event network analyses indicate the most likely volcanic hazard to the Pasco Basin is influx of ash fall tephra from source areas in the Cascade Range. Less likely, but still notable, is the possibility of water flooding the Pasco Basin as a result of volcanic damming of one or more major drainages in the region. The least probable hazards include (1) influx of ash flows from eruptions in the Cascade Range or the Basin and Range Province, (2) renewed flood basalt volcanism, and (3) breaching of a repository by a dike or fissure. It is highly unlikely that volcanism will pose a direct threat to the integrity of any nuclear waste repositories in the Pasco Basin. Low-temperature geothermal water (20 degrees--90 degrees C) is present at random locations within the Pasco Basin and vicinity. This water may represent a potential resource only for direct heating purposes. Available data indicate no geothermal reservoirs with temperatures high enough and depths shallow enough for economical production of electricity are present within the Pasco Basin. 70 refs., 16 figs., 7 tabs

  8. A research for environmental problems in the vicinity of mining area. Investigation into the impact of metallic mining on the environment and solutions

    Energy Technology Data Exchange (ETDEWEB)

    Min, Jeong Sik; Cheong, Young Wook; Lee, Hyun Joo; Song, Duk Young [Korea Inst. of Geology Mining and Materials, Taejon (Korea, Republic of)

    1995-12-01

    This study is focused on the impacts of metalliferous mines on the environment in the vicinity of the abandoned and active mines and establishment of abatements of mining environmental problems. Total number of metalliferous mines surveyed were 40 in which samples of waters, mine wastes and soil were taken. Water parameters such as the pH, Eh, TDS, conductivity, turbidity, dissolved oxygen and temperature were measured in the field. Elements such as As, Cd, Pb, Zn, Cu, Al, Mn, sulfate and cyanide were analyzed. Significant concentrations of heavy metals, mainly Cd, Zn, Cu, Fe, Mn and Al, were found in mine waters from adit and in leachates extracted from mine wastes. The mine waters flowing out from the Dalsung and Ilgwang mines were the typical acid mine drainage(AMD) contaminated by the heavy metals. Passive biological systems(Anoxic wetland) to treat AMD for metals were designed and monitored for effluents from the reactors with 4 types of composts, cow manure and limestones, Results showed that the mushroom compost with cow manure and limestone was the best substrates in metal removing efficiencies. Results from leaching of mine wastes showed that As, Cd and Cu were extracted from some of mine wastes. AMD from the mine waste dump of the Daduk mine was found. These mean that mine wastes can contaminate the soil, surface water and ground waters in vicinity of mines. Therefore cover systems or liner system for containments of mine wastes were suggested to preserve the environment. Cu and As concentrations in soils surveyed were below the heavy metal concentrations in soils of Korean standard preventing plant of the crops. However, most of the acid mine waters are drained untreated, and mine wastes with heavy metals are distributed near soil environment. Therefore efforts to reduce possibilities of soil contamination in the vicinity of mining areas is required. (author). 33 refs.

  9. Plant reactions as indicators of air pollution in the vicinity of a copper smelter

    Directory of Open Access Journals (Sweden)

    Jerzy Fabiszewski

    2014-01-01

    Full Text Available Several higher plant species and epiphytic lichen Hypogymnia physodes (L. Nyl. were examined in the vicinity of a copper smelter. The investigations included field experiments. Ecological surveys of some biotests and bioreactions using exposure of higher plants and transplanted lichens were critically appraised. Such basic processes of plants as photosynthesis and respiration, as well as the quantitative composition of chlorophyll pigments were used as biotests. The results indicate that the photosynthesis intensity is the most useful measure for the estimation of the effect of both heavy metal and SO2 pollutants. The degrees of chlorophyll degradation were in keeping with visual symptoms of injuries. For the ecological monitoring the measurement of respiration intensity, especially in lichens is not recommended. All applied biotests are presented in maps illustrating the degree of degradation of the area examined.

  10. Localized surface plasmon mediated energy transfer in the vicinity of core-shell nanoparticle

    Energy Technology Data Exchange (ETDEWEB)

    Shishodia, Manmohan Singh, E-mail: manmohan@gbu.ac.in; Juneja, Soniya [Department of Applied Physics, School of Vocational Studies and Applied Sciences, Gautam Buddha University, Greater Noida 201308 (India)

    2016-05-28

    Multipole spectral expansion based theory of energy transfer interactions between a donor and an acceptor molecule in the vicinity of a core-shell (nanoshell or core@shell) based plasmonic nanostructure is developed. In view of the diverse applications and rich plasmonic features such as tuning capability of surface plasmon (SP) frequencies, greater sensitivity to the change of dielectric environment, controllable redirection of electromagnetic radiation, closed form expressions for Energy Transfer Rate Enhancement Factor (ETREF) near core-shell particle are reported. The dependence of ETREF on different parameters is established through fitting equations, perceived to be of key importance for developing appropriate designs. The theoretical approach developed in the present work is capable of treating higher order multipoles, which, in turn, are also shown to play a crucial role in the present context. Moreover, closed form expressions derived in the present work can directly be used as formula, e.g., for designing SP based biosensors and estimating energy exchange between proteins and excitonic interactions in quantum dots.

  11. Los novatores como etapa histórica

    Directory of Open Access Journals (Sweden)

    Antonio MESTRE

    2009-11-01

    Full Text Available Los trabajos de Cenai sobre la historia de la filosofía española del siglo XVII y, en concreto, sobre la presencia de los filósofos modernos, encontraron una sorprendente constatación en el libro de O. V. Quiroz-Martínez. En 1949 aparecía La introducción de la filosofía moderna en España de la autora mexicana. Quiroz- Martínez estudiaba unos años muy complejos del pensamiento español: desde la aparición de la Philosofía libera de Isaac Cardoso (1673 hasta el Ocaso de las formas aristotélicas de Mateo Zapata (1745. Ahora bien, si el tema esencial era la filosofía, dada la implicación de la escolástica con la física aristotélica, la introducción de la filosofía moderna (Descartes o Gassendi provocaba las alusiones a cuestiones científicas. Así lo reconoce Quiroz-Martínez, cuando escribe: «Todas estas obras (de Tosca, Berní, Martín Martínez son favorables a la física moderna».

  12. Hydrographs Showing Groundwater Level Changes for Selected Wells in the Chambers-Clover Creek Watershed and Vicinity, Pierce County, Washington

    Science.gov (United States)

    Justin, G.B.; Julich, R.; Payne, K.L.

    2009-01-01

    Selected groundwater level hydrographs for the Chambers-Clover Creek watershed (CCCW) and vicinity, Washington, are presented in an interactive web-based map to illustrate changes in groundwater levels in and near the CCCW on a monthly and seasonal basis. Hydrographs are linked to points corresponding to the well location on an interactive map of the study area. Groundwater level data and well information from Federal, State, and local agencies were obtained from the U.S. Geological Survey National Water Information System (NWIS), Groundwater Site Inventory (GWSI) System.

  13. Socioeconomic conditions in cultural communities: The Nez Perce Tribe, the confederated Tribes of the Umatilla Indian Reservation and the confederated tribes and bands of the Yakima Indian Nation: Interim profile report

    International Nuclear Information System (INIS)

    Stokowski, P.A.; Friedli, E.A.

    1987-11-01

    A series of BWIP Socioeconomic Profile Reports are being prepared. This report is one of the first set of five separate BWIP Profile Reports, which cover: economic/demographic conditions; fiscal conditions; housing characteristics; public services and facilities; and socioeconomic conditions in cultural communities. The BWIP Socioeconomic Profile Reports are designed to provide information about the characteristics of the communities in which socioeconomic impacts from BWIP may occur. The Profile Reports present a compilation of historical information about socioeconomic conditions in the affected communities. These reports are designed to provide a transition between the BWIP EA, published in 1986, the Monitoring Reports, and other technical reports associated with the BWIP SMMP and CSP. The principal objectives of the Profile Reports are to update the DOE BWIP socioeconomic database by compiling available secondary and primary data and to make this information available to both the DOE program and other interested parties. The initial Profile Reports will help identify the need for additional data. The database developed for the profiles will assemble socioeconomic data in a uniform, readily accessible format. 16 refs., 1 fig., 17 tabs

  14. Monitoring of radionuclides in the vicinities of Finnish nuclear power plants in 1993 and 1994

    Energy Technology Data Exchange (ETDEWEB)

    Klemola, S.; Ilus, E.; Ikaeheimonen, T.K

    1998-08-01

    Monitoring of radioactive substances around Finnish nuclear power plants continued in 1993-1994 in accordance with the regular programmes. Some 1000 samples are analysed annually from the terrestrial and aquatic environments of the two power plant sites. Trace amounts of activation products originating from airborne releases from the local power plants were detected in several air, deposition and soil samples. Discharged nuclides were more abundant in the aquatic environment, especially in samples of indicator organisms, sinking matter and sediments. However, the concentrations were so low that they did not significantly increase the radiation burden in the environment. The dominant artificial radionuclides in the vicinity of the power plants remained the cesium isotopes, especially {sup 137}Cs but also {sup 134}Cs, originating from the Chernobyl accident. (orig.) 14 refs.

  15. Content of Natural Radionuclides in Sediments in the Vicinity of a Former Uranium Mine

    International Nuclear Information System (INIS)

    Strok, M.; Planinsek, P.; Smodis, B.

    2011-01-01

    Former Slovenian uranium mine Zirovski vrh lies in the subalpine environment with relative high rainfall and population density. As a legacy of uranium mining, Jazbec and Borst waste piles were constructed in the vicinity of a former uranium mine. On the Jazbec waste pile, about 2.5 millions of tons of spoil, and 0.05 millions of tons of red mud were deposited. Average activity concentrations in spoil are 750 Bq/kg for 238U, 226Ra and 230Th, and in red mud 495 Bq/kg for 238U, 190 Bq/kg for 226Ra and 65100 Bq/kg for 230Th. On the Borst waste pile, about 0.6 millions of tons of uranium mill tailings (UMT) were deposited. Average activity concentrations in UMT are 995 Bq/kg for 238U, 8630 Bq/kg for 226Ra and 3930 Bq/kg for 230Th. Seepage waters with elevated radionuclide concentrations from both waste piles flow in the nearby streams Brebovscica and Todrascica. Todrascica outfalls into the Brebovscica and Brebovscica into the Poljanska Sora River. Due to the different biogeochemical processes, natural radionuclides from both waste piles can be transferred to the sediments of the affected streams. These processes are mainly driven by the sorption onto the particles and particles settling or by the direct diffusion to sediments. Therefore the aim of this work was to find out at which extent these processes occur in the specific case by comparing activity concentrations in sediments before and after inflow of seepage waters from both waste piles. In sediment samples, 238U, 234U, 230Th, 226Ra, 210Pb and 210Po activity concentrations were determined, using radiochemical separations followed by either alpha spectrometry or proportional counting. Results of the content of natural radionuclides in sediments in the vicinity of a former uranium mine showed that activity concentrations of all analyzed radionuclides were higher in sediments after the inflow of seepage waters from waste piles in Brebovscica and Todrascica stream. This was not the case for Poljanska Sora River

  16. Mortality of persons resident in the vicinity of electricity transmission facilities

    Energy Technology Data Exchange (ETDEWEB)

    McDowall, M E

    1986-02-01

    Several studies have raised the possibility that exposure to electrical and/or magnetic fields may be injurious to health in particular by the promotion or initiation of cancer. To investigate whether the electricity transmission system presents a long term hazard to public health, the mortality of nearly 8,000 persons, identified as living in the vicinity of electrical transmission facilities at the time of the 1971 Population Census, has been followed to the end of 1983. All identified transmission installations within pre-defined areas were included in the study with the result that the greater part of the study group were believed to be resident near relatively low voltage sub-stations. Overall mortality was lower than expected and no evidence of major health hazards emerged. The only statistically significant excess mortality was for lung cancer (in women overall, and in persons living closest to the installations); this result is difficult to interpret in the absence of smoking data, and is not supported by other evidence but does not appear to be due to the social class distribution of the study group. The study did not support previously reported associations of exposure to electro-magnetic fields with acute myeloid leukaemia, other lymphatic cancers and suicide.

  17. EASTERN EUROPE, A REGION OF INSECURITY IN THE EUROPEAN UNION'S VICINITY

    Directory of Open Access Journals (Sweden)

    Bogdan – Lucian Cumpanasu

    2014-08-01

    Full Text Available During Cold War, the region of Eastern Europe was formed by European states that were behind the Iron Curtain.Once the communism has fallen and former Warsaw's Pact members have joined EU in 2004 and 2007 along with the Baltic republics, a New Eastern Europe comprising Ukraine, Republic of Moldova and the Caucasian Republics emerged at the border of EU. The north, west and south maritime frontiers of European Union are opposite with Eastern territorial one that are more difficult to control and defend against asymmetrical threats as: organized crime, drugs traffic, arms proliferation and illegal immigration. this paper aims to demonstrate that EU's policies initiated in the framework of Eastern Partnership (EaP that wanted to bring peace in the Eastern neighborhood did not succeed to fulfill the desired goals. One explanation is that EU did not take in consideration the Russian dream of redesigning its sphere of influence in Eastern Europe. Another one is that the cultural, political and social differences between EU and its EaP partners led to the failure of the project. Thus, European Union's actions toward Eastern vicinity led to a clash between two civilizations: East and West as well as to a geopolitical competition between Russian Federation and EU over their shared neighborhood.

  18. Enhancement of strong-field multiple ionization in the vicinity of the conical intersection in 1,3-cyclohexadiene ring opening

    International Nuclear Information System (INIS)

    Petrovic, Vladimir S.; Kim, Jaehee; Schorb, Sebastian; White, James; Cryan, James P.; Zipp, Lucas; Glownia, J. Michael; Broege, Douglas; Miyabe, Shungo; Tao, Hongli; Martinez, Todd; Bucksbaum, Philip H.

    2013-01-01

    Nonradiative energy dissipation in electronically excited polyatomic molecules proceeds through conical intersections, loci of degeneracy between electronic states. We observe a marked enhancement of laser-induced double ionization in the vicinity of a conical intersection during a non-radiative transition. We measured double ionization by detecting the kinetic energy of ions released by laser-induced strong-field fragmentation during the ring-opening transition between 1,3-cyclohexadiene and 1,3,5-hexatriene. The enhancement of the double ionization correlates with the conical intersection between the HOMO and LUMO orbitals

  19. Optical characterization of gold chains and steps on the vicinal Si(557) surface: Theory and experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hogan, Conor [Consiglio Nazionale delle Ricerche, Istituto di Struttura della Materia, via Fosso del Cavaliere 100, 00133 Rome (Italy); Department of Physics and European Theoretical Spectroscopy Facility (ETSF), University of Rome ' ' Tor Vergata' ' , Via della Ricerca Scientifica 1, 00133 Rome (Italy); McAlinden, Niall; McGilp, John F. [School of Physics, Trinity College Dublin, Dublin 2 (Ireland)

    2012-06-15

    We present a joint experimental-theoretical study of the reflectance anisotropy of clean and gold-covered Si(557), a vicinal surface of Si(111) upon which gold forms quasi-one-dimensional (1D) chains parallel to the steps. By means of first-principles calculations, we analyse the close relationship between the various surface structural motifs and the optical properties. Good agreement is found between experimental and computed spectra of single-step models of both clean and Au-adsorbed surfaces. Spectral fingerprints of monoatomic gold chains and silicon step edges are identified. The role of spin-orbit coupling (SOC) on the surface optical properties is examined, and found to have little effect. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. Dispersion of inorganic contaminants in surface water in the vicinity of Potchefstroom

    Science.gov (United States)

    Manyatshe, A.; Fosso-Kankeu, E.; van der Berg, D.; Lemmer, N.; Waanders, F.; Tutu, H.

    2017-08-01

    Potchefstroom and the neighbouring cities rely mostly on the Mooi River and Vaal River for their water needs. These rivers flow through the gold mining areas and farms, and are therefore likely to be contaminated with substantial amounts of inorganic pollutants. Water was collected along the rivers network, streams, canals and dams in Potchefstroom and the vicinity. The samples were characterized for geochemical parameters, metals and anions concentrations. The results showed high concentrations of potentially toxic elements such as As (4.53 mg/L - 5.74 mg/L), Cd (0.25 mg/L - 0.7 mg/L), Pb (1.14 mg/L - 5.13 mg/L) and U (0.04 mg/L - 0.11 mg/L) which were predominantly found around the mining areas. Elevated concentrations of anions such SO42- and CN- were detected around mining areas while NO3- was dominant near farms. The relatively high levels of anions and metals in the surface water made it unfit for domestic or agricultural use. The study showed that contaminants in mining and agricultural facilities were potentially mobilised, thus impacting the nearby water systems.

  1. Arguments and experience feed back for the distribution of iodine tablets in the vicinity of nuclear plants

    International Nuclear Information System (INIS)

    Le Guen, B.; Gonin, M.; Hemidy, P.Y.; Bailloeuil, C.; Van Boxsom, D.; Renier, S.; Garcier, Y.

    2001-01-01

    Arguments and experience feed back for the distribution of iodine tablets in the vicinity of nuclear power plants. In the event of a nuclear accident, radioactive isotopes of iodine including 131 I can be released into the atmosphere. In 1997, as a safety measure, the French government decided to begin the distribution of stable iodine tablets (KI) to those living in the vicinity of nuclear power plants, to avoid having to do so in an emergency. The tablets were previously stored by Electricite de France (EDF) which held them at the disposal of the government authorities. Since the tablets distributed in 1997 are approaching their use-by date, EDF has started a new distribution campaign within a ten-kilometer radius of its twenty sites with a total of 58 nuclear reactors. During the public information meetings, the discussion focused on the effectiveness of this protective measure and the nature and frequency of the possible side effects while measuring the duration of its action under the conditions in which it was administered. A bibliographic study of the kinetics of iodine in the human body has enabled the indications and the means of use to be determined. The degree of effectiveness with which incorporation of radioactive iodine into the thyroid is prevented and the onset of thyroid dysfunction depend on both external and individual factors: uptake of iodine from food, functional condition of the thyroid, age, etc. In cases of prolonged exposure to radioactive iodine over several days, consideration needs to be given to taking stable iodine a second time, to maintain maximum protection. This presentation covers the impact of the 1997 and 2000 information campaigns, the effect of making stable iodine available to the public, the extent to which the public feels involved, and the reactions of health professionals. (author)

  2. Geology in the Vicinity of the TYBO and BENHAM Underground Nuclear Tests, Pahute Mesa, Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    L. B. Prothro

    2001-12-01

    Recent radiochemical evidence from groundwater characterization and monitoring wells in the vicinity of the TYBO and BENHAM underground nuclear tests in Area 20 of the Nevada Test Site, suggests that migration of radionuclides within groundwater beneath this portion of Area 20 may be more rapid than previously thought. In order to gain a better understanding of the hydrogeologic conditions in the TYBO-BENHAM area for more accurate flow and transport modeling, a reevaluation of the subsurface geologic environment in the vicinity of the two underground tests was conducted. Eight existing drill holes provided subsurface control for the area. These holes included groundwater characterization and monitoring wells, exploratory holes, and large-diameter emplacement holes used for underground nuclear weapons tests. Detailed and consistent geologic descriptions of these holes were produced by updating existing geologic descriptions with data from petrographic, chemical, and mineralogic analyses, and current stratigraphic concepts of the region. The updated descriptions, along with surface geologic data, were used to develop a detailed geologic model of the TYBO-BENHAM area. This model is represented by diagrams that correlate stratigraphic, lithologic, and alteration intervals between holes, and by isopach and structure maps and geologic cross sections. Regional data outside the TYBO-BENHAM area were included in the isopach and structure maps to better evaluate the geology of the TYBO-BENHAM area in a regional context. The geologic model was then evaluated with regard to groundwater flow and radionuclide migration to assess the model's implications for flow and transport modeling. Implications include: (1) confirmation of the general hydrogeology of the area described in previous studies; (2) the presence of two previously unrecognized buried faults that could act as zones of enhanced permeability within aquifers; and (3) secondary alteration within tuff confining

  3. On the existence of pulsars in the vicinity of the massive black hole in the galactic center

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Fupeng; Lu, Youjun [National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Yu, Qingjuan, E-mail: zhangfupeng@pku.edu.cn, E-mail: luyj@nao.cas.cn, E-mail: yuqj@pku.edu.cn [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China)

    2014-04-01

    Pulsars, if existing and detectable in the immediate vicinity of the massive black hole (MBH) in the Galactic center (GC), may be used as a superb tool to probe both the environment and the metric of the central MBH. The recent discovery of a magnetized pulsar in the GC suggests that many more pulsars should exist near the MBH. In this paper, we estimate the number and the orbital distribution of pulsars in the vicinity of the MBH in the GC by assuming that the pulsar progenitors, similar to the GC S-stars, were captured to orbits tightly bound to the MBH through the tidal breakup of stellar binaries. We use the current observations on both the GC S-stars and the hypervelocity stars to calibrate the injection rate(s) of and the dynamical model(s) for the stellar binaries. By including the relaxation processes, supernova kicks, and gravitational wave radiation in our simulations, we estimate that ∼97-190 (9-14) pulsars may presently orbit the central MBH with semimajor axes ≤4000 AU (≤1000 AU), which is compatible with the current observational constraints on the number of the GC pulsars. The semimajor axis and the pericenter distance of the pulsar closest to the central MBH are probably in the range of ∼120-460 AU and ∼2-230 AU, respectively. Future telescopes, such as the Square Kilometer Array, may be able to detect a significant number of pulsars with semimajor axis smaller than a few thousand AU in the GC. Long-term monitoring of these pulsars would be helpful in constraining both the environment and the metric of the central MBH. Our preferred model also results in about ten hyperfast pulsars with velocity ≳ 1500 km s{sup –1} moving away from the Milky Way.

  4. Radon exhalation rates from soil and sand samples collected from the vicinity of Yamuna river

    International Nuclear Information System (INIS)

    Garg, A.K.; Sushil Kumar; Chauhan, Pooja; Chauhan, R.P.

    2011-01-01

    Soil, sand and stones are the most popular building materials for Indian dwellings. Radon is released into ambient air from these materials due to ubiquitous uranium and radium in them, thus increasing the airborne radon concentration. The radioactivity in sand and soils is related to radioactivity in the rocks from which they are formed. These materials contain varying amount of uranium. In the present investigation, the radon emanated from soil and sand samples from different locations in the vicinity of Yamuna river has been estimated. The samples have been collected from different locations near the Yamuna river. The samples collecting sites are from Yamunanagar in Haryana to Delhi. The radon concentration in different samples has been calculated, based upon the data, the mass and the surface exhalation rates of radon emanated from them have also been calculated

  5. Experimental investigation of power peak in vicinity of WWER-440 control rod at end of fuel cycle

    International Nuclear Information System (INIS)

    Mikus, J.

    2004-01-01

    This paper presents some results of the axial power (fission density) distribution measurements carried out on the light-water, zero-power reactor LR-0 in a WWER-440 type core in vicinity of the WWER-440 control rod model at zero boron concentration in moderator, modelling the conditions at the end of the WWER-440 fuel cycle. Further information concerns the control rod model description, specification of the LR-0 core, fuel assemblies and measurement conditions. The aim of performed experiment is enlargement of the available power peaking database to enable the validation of the calculation codes by means of the measured data that correspond to the end of WWER-440 fuel cycle. (author)

  6. Waves generated in the vicinity of an argon plasma gun in the ionosphere

    Science.gov (United States)

    Cahill, L. J., Jr.; Arnoldy, R. L.; Lysak, R. L.; Peria, W.; Lynch, K. A.

    1993-01-01

    Wave and particle observations were made in the close vicinity of an argon plasma gun carned to over 600 km altitude on a sounding rocket. The gun was carned on a subpayload, separated from the main payload early in the flight. Twelve-second argon ion ejections were energized alternately with a peak energy of 100 or 200 eV. They produced waves, with multiple harmonics, in the range of ion cyclotron waves, 10 to 1000 Hz at rocket altitudes. Many of these waves could not be identified as corresponding to the cyclotron frequencies of any of the ions, argon or ambient, known to be present. In addition, the wave frequencies were observed to rise and fall and to change abruptly during a 12-s gun operation. The wave amplitudes, near a few hundred Hertz, were of the order of O. 1 V/m. Some of the waves may be ion-ion hybrid waves. Changes in ion populations were observed at the main payload and at the subpayload during gun operations. A gun-related, field-aligned, electron population also appeared.

  7. Ground beetles (Carabidae on quarry terraces in the vicinity of Brno (Czech Republic

    Directory of Open Access Journals (Sweden)

    Lucie Novotná

    2012-01-01

    Full Text Available The occurrence of ground beetles (Carabidae, Coleoptera was monitored in the exhausted limestone quarry of massif Hády near Brno using formaldehyde pitfall traps with a monthly interval of collection. Research was conducted from April to October in 2009 and 2010. The obtained material was investigated on some synecological characteristics and species affiliation to bioindication groups. In total for both years, 462 specimens of 43 species were captured. Most species were found in habitats with vegetation cover in the immediate vicinity of cultivated agricultural land – 441 specimens of 39 species. In the quarry itself only a minimal amount of ground beetles was found – 21 specimens of 11 species. Decrease in the abundance of ground beetles towards the center of the quarry was demonstrated. Next, significant species of Brachinus crepitans, Brachinus explodens and Cicindela sylvicola (endangered species pursuant to Decree 395/1992 Coll. and species listed in the Red List were reported – near threatened Ophonus sabulicola and vulnerable Cylindera germanica (also endangered species pursuant to Decree 395/1992 Coll.

  8. Diffuse γ-ray emission in the vicinity of young star cluster Westerlund 2

    Science.gov (United States)

    Yang, Rui-zhi; de Oña Wilhelmi, Emma; Aharonian, Felix

    2018-04-01

    We report the results of our analysis of the publicly available data obtained by the Large Area Telescope (LAT) on board the Fermi satellite towards the direction of the young massive star cluster Westerlund 2. We found significant extended γ-ray emission in the vicinity of Westerlund 2 with a hard power-law energy spectrum extending from 1 to 250 GeV with a photon index of 2.0 ± 0.1. We argue that amongst several alternatives, the luminous stars in Westerlund 2 are likely sites of acceleration of particles responsible for the diffuse γ-ray emission of the surrounding interstellar medium. In particular, the young star cluster Westerlund 2 can provide sufficient non-thermal energy to account for the γ-ray emission. In this scenario, since the γ-ray production region is significantly larger than the area occupied by the star cluster, we conclude that the γ-ray production is caused by hadronic interactions of accelerated protons and nuclei with the ambient gas. In that case, the total energy budget in relativistic particles is estimated of the order of 1050 erg.

  9. Enhancing sediment distribution at the vicinity of power plant intakes using double rows of vanes and groins (Case study: New tebbin power plant

    Directory of Open Access Journals (Sweden)

    Sayed Mahgoub

    2013-12-01

    The study results showed that, in case of vanes absence, sediments with rates 1–2 m3/week were stuck within the sediment trap under the winter conditions. Also, the results indicated that the submerged vanes play an important role in preventing the sediment intrusion. Also, it was clear that using groins might lead to enhancing the sediment distribution at the intake vicinity.

  10. Energetic Electron Acceleration Observed by MMS in the Vicinity of an X-Line Crossing

    Science.gov (United States)

    Jaynes, A. N.; Turner, D. L.; Wilder, F. D.; Osmane, A.; Baker, D. N.; Blake, J. B.; Fennell, J. F.; Cohen, I. J.; Mauk, B. H.; Reeves, G. D.; hide

    2016-01-01

    During the first months of observations, the Magnetospheric Multiscale Fly's Eye Energetic Particle Spectrometer instrument has observed several instances of electron acceleration up to greater than 100 keV while in the vicinity of the dayside reconnection region. While particle acceleration associated with magnetic reconnection has been seen to occur up to these energies in the tail region, it had not yet been reported at the magnetopause. This study reports on observations of electron acceleration up to hundreds of keV that were recorded on 19 September 2015 around 1000 UT, in the midst of an X-line crossing. In the region surrounding the X-line, whistler-mode and broadband electrostatic waves were observed simultaneously with the appearance of highly energetic electrons which exhibited significant energization in the perpendicular direction. The mechanisms by which particles may be accelerated via reconnection-related processes are intrinsic to understanding particle dynamics among a wide range of spatial scales and plasma environments.

  11. Doses to Terrestrial Biota in the Vicinity of BNFL Sellafield, Cumbria, UK (invited paper)

    Energy Technology Data Exchange (ETDEWEB)

    Copplestone, D.; Johnson, M.S.; Jackson, D.; Jones, S.R

    2000-07-01

    Source terms and corresponding radionuclide activity concentrations in biota for {sup 134}Cs, {sup 137}Cs, {sup 238}Pu, {sup 239+240}Pu and {sup 241}Am have been assessed for three semi-natural ecosystems in the vicinity of BNFL Sellafield, Cumbria, UK. Estimates of absorbed doses (mGy.d{sup -1}) have been calculated. Doses to key indicator species, Oniscus asellus (detritivorous invertebrate), Carabus violaceous (predatory invertebrate) and Apodemus sylvaticus (granivorous wood mouse) are discussed with reference to the 1 mGy.d{sup -1} level, below which it is postulated that no observable effects on populations in a terrestrial ecosystem occur. Implications for the 'critical group' and 'reference model' approaches for a framework of radiological environmental protection are discussed. The need to assess the most highly exposed species is advanced. New research focused on the application of biomarker techniques as a mechanism for determining the interactions and effects of environmental contaminants on ecosystem structure and functioning is presented. (author)

  12. Uranium mill tailings remedial action program. Radiological survey of Shiprock vicinity property SH01, Shiprock, NM, August-November 1982

    International Nuclear Information System (INIS)

    Flynn, K.F.; Justus, A.L.; Sholeen, C.M.; Smith, W.H.; Wynveen, R.A.

    1984-04-01

    A comprehensive survey of the vicinity property designated as SH01 was conducted on an intermittent basis from August 23 to November 11, 1982. At the time of the survey, three structures were located on the property - two residential structures and a residential trailer. In addition to the three residences, the frame from a former truck scale was still on the property. The lands surrounding the structures and former truck scale were sparsely covered with vegetation. The assessment activities included determination of indoor and outdoor surface radiation levels through direct instrument surveys and analysis of air and soil samples. No evidence of radioactive contamination was found inside the structures, although elevated levels of radioactivity due to proximity to or shine from contaminated soils were indicated within all. The short-term radon daughter measurements did not exceed the limit of 0.02 Working Level for average annual concentration including background, as specified in the EPA Standard 40 CFR 192. The assessment indicated elevated levels of radioactivity in the outdoor environs, encompassing about 32,000 ft 2 (2900 m 2 ) of land surrounding, and north of, the former truck scale. Analysis of a surface soil sample collected from the environs indicated a radium concentration considerably in excess of the limit of 5 pCi/g above background specified in the EPA Standard. Subsurface soil sampling was not conducted, and thus the vertical extent of the radiological contamination is not known. Since the surface soil contamination level exceeded the limit specified in the EPA Standard, remedial action for this vicinity site should be considered

  13. The Distribution and Health Risk Assessment of Metals in Soils in the Vicinity of Industrial Sites in Dongguan, China

    Directory of Open Access Journals (Sweden)

    Chao Liu

    2016-08-01

    Full Text Available Exponential industrialization and rapid urbanization have resulted in contamination of soil by metals from anthropogenic sources in Dongguan, China. The aims of this research were to determine the concentration and distribution of various metals (arsenic (As, cadmium (Cd, chromium (Cr, copper (Cu, mercury (Hg, nickel (Ni, lead (Pb and zinc (Zn in soils and identify their potential health risks for local residents. A total of 106 soil samples were collected from the vicinity of industrial sites in Dongguan. Two types of samples were collected from each site: topsoil (0–20 cm, TS and shallow soil (20–50 cm, SS. Results showed that the soils were contaminated by metals and pollution was mainly focused on TS. The geoaccumulation index (Igeo and pollution indexes (PI implied that there was a slight increase in the concentrations of Cd, Cu, Hg, Ni, and Pb, but the metal pollution caused by industrial activities was less severe, and elements of As and Cr exhibited non-pollution level. The risk assessment results suggested that there was a potential health risk associated with As and Cr exposure for residents because the carcinogenic risks of As and Cr via corresponding exposure pathways exceeded the safety limit of 10−6 (the acceptable level of carcinogenic risk for humans. Furthermore, oral ingestion and inhalation of soil particles are the main exposure pathways for As and Cr to enter the human body. This study may provide basic information of metal pollution control and human health protection in the vicinity of industrial regions.

  14. PCDD/F contamination on surface soil in the vicinity of a hazardous waste incinerator: is it possible a different trend?

    Science.gov (United States)

    Korucu, Mahmut Kemal

    2017-01-01

    This study is the first to investigate the contamination of polychlorinated dibenzo-p-dioxins and polychlorinated dibenzofurans (PCDD/Fs) on surface soils in the vicinity of the first hazardous waste incinerator of Turkey. In the study, 24 soil samples were taken from a 1625-m-radius circle whose center is the stack of the incinerator. This process was repeated 1 year later. Since the acquired average PCDD/F concentrations of the two sampling campaigns (0.05 and 0.02 ng WHO-toxic equivalent (TEQ)/kg) were meaningfully low compared to the related literatures, a new sampling campaign was carried out to control this inconsistency, but this time in a foreign laboratory (0.56 ng WHO-TEQ/kg). In the same period, eight gas samples were taken from the stack under different operational conditions of the facility. According to the evaluations of the findings, the geographical-meteorological data of the study area and the specific operational conditions of the facility corroborate the concentrations of the first and the second soil samplings rather than the third one. The major underlying reason for the inconsistency of the soil concentrations may be the fact that the data analysis procedures used by the laboratories are different. The author suggests a hypothesis which argues that the soils in the vicinity of a hazardous waste incinerator may have significantly lower concentration levels than in related literatures.

  15. Pablo Rodríguez Jiménez. Cartas de Amor en tiempos de guerra. Rafael Uribe Uribe. Selección de textos y prólogo. Bogotá: Editorial Universidad del Rosario, Escuela de Ciencias Humanas, 2014. 256 páginas

    Directory of Open Access Journals (Sweden)

    Eulalia Hernández Ciro

    2015-07-01

    Full Text Available Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprensión de la historia de nuestro país, no solo porque muestran el lado sensible y cotidiano de la vida de un hombre que ocupa un lugar privilegiado en la historia de Colombia, sino porque dejan entrever los discursos, las representaciones y las prácticas de la clase dirigente del país. Acercarse a esta correspondencia posibilita conocer asuntos concernientes a los roles femeninos y masculinos, a la educación de los hijos, a las relaciones sociales y públicas, a la vida doméstica, es decir, tanto las ideas y los sentimientos, como la geografía y la cultura material de una época.

  16. Ecological studies of wood-boring bivalves in the vicinity of the Oyster Creek Nuclear Generating Station. Progress report Sep-Nov 81

    International Nuclear Information System (INIS)

    Hoagland, K.E.; Crocket, L.

    1982-06-01

    The species composition, distribution, and population dynamics of wood-boring bivalves are being studied in the vicinity of the Oyster Creek Nuclear Generating Station, Barnegat Bay, New Jersey. Untreated wood test panels are used to collect organisms at 12 stations. Physiological tolerances of 3 species are also under investigation in the laboratory. Competition among the species is being analyzed. In the fall of 1981, Teredo bartschi remained in Oyster Creek despite continuous prolonged outages of the Oyster Creek Nuclear Generating Station

  17. Radioactivity measurements in the vicinity of the mine waste heap at Crossen and radiation dose assessment

    International Nuclear Information System (INIS)

    Kulzer, R.

    1998-01-01

    The radiation dose to the population living in the vicinity of the mine waste heap is assessed. The measurements carried out were to verify the dose relevance of ambient radioactivity on site, in particular the ingestion and inhalation pathways and the external exposure pathways. The nuclide Pb-210 was used as an indicator because of its large dose factor for assessment of ingestion and its airborne dispersion as an Rn-222 daughter product. The waste heap material releases large quantities of this nuclide. Ingestion of radioactivity from the waste heap may be caused by wind-borne erosion and activity deposition on plants in the area. Therefore, the specific activities of Pb-210 and Ra-226 have been measured in soil and plant specimens sampled at various distances from the waste heap. (orig./CB) [de

  18. The impact of silicon solar cell architecture and cell interconnection on energy yield in hot & sunny climates

    KAUST Repository

    Haschke, Jan; Seif, Johannes P.; Riesen, Yannick; Tomasi, Andrea; Cattin, Jean; Tous, Loï c; Choulat, Patrick; Aleman, Monica; Cornagliotti, Emanuele; Uruena, Angel; Russell, Richard; Duerinckx, Filip; Champliaud, Jonathan; Levrat, Jacques; Abdallah, Amir A.; Aï ssa, Brahim; Tabet, Nouar; Wyrsch, Nicolas; Despeisse, Matthieu; Szlufcik, Jozef; De Wolf, Stefaan; Ballif, Christophe

    2017-01-01

    architectures, including so-called Aluminum back-surface-field (BSF), passivated emitter and rear cell (PERC), passivated emitter rear totally diffused (PERT), and silicon heterojunction (SHJ) solar cells. We compare measured temperature coefficients (TC

  19. Plasma parameters in the vicinity of the quartz window of a low pressure surface wave discharge produced in O2

    DEFF Research Database (Denmark)

    Nakao, S.; Stamate, Eugen; Sugai, H.

    2007-01-01

    Plasma parameters in the vicinity of the dielectric window of a low density, microwave discharge produced in 0, at 915 N/FHz are investigated by a spherical probe and optical emission spectroscopy while the microwave field distribution is measured by a spectrum analyzer. The electron energy...... distribution function is found to be strongly dependent on the position with respect to the slot antenna, exhibiting a group of energetic electrons at locations where the electric field and the optical intensity exhibit maximum values. The density of energetic electrons decreases sharply just a few cm away...

  20. Risk for non Hodgkin’s lymphoma in the vicinity of French municipal solid waste incinerators

    Directory of Open Access Journals (Sweden)

    Sauleau Erik-André

    2008-10-01

    Full Text Available Abstract Background Dioxin emissions from municipal solid waste incinerators are one of the major sources of dioxins and therefore are an exposure source of public concern. There is growing epidemiologic evidence of an increased risk for non-Hodgkin's lymphoma (NHL in the vicinity of some municipal solid waste incinerators with high dioxin emission levels. The purpose of this study was to examine this association on a larger population scale. Methods The study area consisted of four French administrative departments, comprising a total of 2270 block groups. NHL cases that had been diagnosed during the period 1990–1999, and were aged 15 years and over, were considered. Each case was assigned a block group by residential address geocoding. Atmospheric Dispersion Model System software was used to estimate immissions in the surroundings of 13 incinerators which operated in the study area. Then, cumulative ground-level dioxin concentrations were calculated for each block group. Poisson multiple regression models, incorporating penalized regression splines to control for covariates and dealing with Poisson overdispersion, were used. Five confounding factors were considered: population density, urbanisation, socio-economic level, airborne traffic pollution, and industrial pollution. Results A total of 3974 NHL incident cases was observed (2147 among males, and 1827 among females during the 1990–1999 time period. A statistically significant relationship was found at the block group level between risk for NHL and dioxin exposure, with a relative risk (RR of 1.120 (95% confidence interval [CI] 1.002 – 1.251 for persons living in highly exposed census blocks compared to those living in slightly exposed block groups. Population density appeared positively linked both to risk for NHL and dioxin exposure. Subgroup multivariate analyses per gender yielded a significant RR for females only (RR = 1.178, 95% CI 1.013 – 1.369. Conclusion This study, in

  1. Comparison of biophysical factors influencing on emphysema quantification with low-dose CT

    Science.gov (United States)

    Heo, Chang Yong; Kim, Jong Hyo

    2014-03-01

    Emphysema Index(EI) measurements in MDCT is known to be influenced by various biophysical factors such as total lung volume, and body size. We investigated the association of the four biophysical factors with emphysema index in low-dose MDCT. In particular, we attempted to identify a potentially stronger biophysical factor than total lung volume. A total of 400 low-dose MDCT volumes taken at 120kVp, 40mAs, 1mm thickness, and B30f reconstruction kernel were used. The lungs, airways, and pulmonary vessels were automatically segmented, and two Emphysema Indices, relative area below -950HU(RA950) and 15th percentile(Perc15), were extracted from the segmented lungs. The biophysical factors such as total lung volume(TLV), mode of lung attenuation(ModLA), effective body diameter(EBD), and the water equivalent body diameter(WBD) were estimated from the segmented lung and body area. The association of biophysical factors with emphysema indices were evaluated by correlation coefficients. The mean emphysema indices were 8.3±5.5(%) in RA950, and -930±18(HU) in Perc15. The estimates of biophysical factors were 4.7±1.0(L) in TLV, -901±21(HU) in ModLA, 26.9±2.2(cm) in EBD, and 25.9±2.6(cm) in WBD. The correlation coefficients of biophysical factors with RA950 were 0.73 in TLV, 0.94 in ModLA, 0.31 in EBD, and 0.18 WBD, the ones with Perc15 were 0.74 in TLV, 0.98 in ModLA, 0.29 in EBD, and 0.15 WBD. Study results revealed that two biophysical factors, TLV and ModLA, mostly affects the emphysema indices. In particular, the ModLA exhibited strongest correlation of 0.98 with Perc15, which indicating the ModLA is the most significant confounding biophysical factor in emphysema indices measurement.

  2. Formation of sub-ion scale filamentary force-free structures in the vicinity of reconnection region

    International Nuclear Information System (INIS)

    Zelenyi, L M; Artemyev, A V; Petrukovich, A A; Frank, A G; Nakamura, R

    2016-01-01

    In this paper we review the results of spacecraft observations of current sheets (CSs) of sub-ion spatial scales in the Earth’s magnetotail as well as experiments with these structures in laboratory devices. We demonstrate that such sub-ion CSs having a thickness less than the ion gyroradius are usually formed in the vicinity of the magnetic reconnection region and are supported by strong electron currents flowing along magnetic field lines. The magnetic field configuration of sub-ion CSs is close to the force-free configuration, with a strong shear magnetic field component in the CS central region. Spacecraft observations suggest that parallel electron currents are generated by electron beams (pronounced enhancement of the phase space density for electrons with small pitch angles and energies  ∼1–3 keV). We discuss several models describing such force-free sub-ion CSs. (paper)

  3. Nuclear threats in the vicinity of the Nordic countries. A database, Nordic Nuclear Safety Research

    International Nuclear Information System (INIS)

    Margrethe, I.; Eikelmann, H.

    2003-01-01

    The acute phase of an accident and the possibility of high exposure of the populations are always the most important threats in the emergency preparedness work. Radioactive contamination from an accident can however also cause long time effects for land use and enhanced doses to special population groups and economic problems for agriculture, grazing animals, reindeer industry, hunting, freshwater fishing, tourism and recreation. For planning purposes it is always valuable to be aware of potential radiation hazard and other potential threats in the vicinity of the Nordic countries. Thus, mapping such threats in a Nordic context is an important factor in emergency preparedness in the Nordic countries. The project has dealt with threats from the north west of Russia and the Baltic states. The results from the different activities in the project is generated in a web based database called the 'the base of knowledge'. (orig.)

  4. Accumulation of Aluminium and Physiological Status of Tree Foliage in the Vicinity of a Large Aluminium Smelter

    Directory of Open Access Journals (Sweden)

    E. D. Wannaz

    2012-01-01

    Full Text Available A pollution gradient was observed in tree foliage sampled in the vicinity of a large aluminium production facility in Patagonia (Argentina. Leaves of Eucalyptus rostrata, and Populus hybridus and different needle ages of Pinus spec. were collected and concentrations of aluminium (Al and sulphur (S as well as physiological parameters (chlorophyll and lipid oxidation products were analyzed. Al and S concentrations indicate a steep pollution gradient in the study showing a relationship with the physiological parameters in particular membrane lipid oxidation products. The present study confirms that aluminium smelting results in high Al and sulphur deposition in the study area, and therefore further studies should be carried out taking into account potentially adverse effects of these compounds on human and ecosystem health.

  5. Relativistic theory for syntonization of clocks in the vicinity of the Earth

    Science.gov (United States)

    Wolf, Peter; Petit, G.

    1995-01-01

    A well known prediction of Einstein's general theory of relativity states that two ideal clocks that move with a relative velocity, and are submitted to different gravitational fields will, in general, be observed to run at different rates. Similarly the rate of a clock with respect to the coordinate time of some spacetime reference system is dependent on the velocity of the clock in that reference system and on the gravitational fields it is submitted to. For the syntonization of clocks and the realization of coordinate times (like TAI) this rate shift has to be taken into account at an accuracy level which should be below the frequency stability of the clocks in question, i.e. all terms that are larger than the instability of the clocks should be corrected for. We present a theory for the calculation of the relativistic rate shift for clocks in the vicinity of the Earth, including all terms larger than one part in 10(exp 18). This, together with previous work on clock synchronization (Petit & Wolf 1993, 1994), amounts to a complete relativistic theory for the realization of coordinate time scales at picosecond synchronization and 10(exp -18) syntonization accuracy, which should be sufficient to accommodate future developments in time transfer and clock technology.

  6. Large impacted upper ureteral calculi: A comparative study between retrograde ureterolithotripsy and percutaneous antegrade ureterolithotripsy in the modified lateral position

    Directory of Open Access Journals (Sweden)

    Kamal Moufid

    2013-01-01

    Conclusions: In our series, Perc-URS is a safe and efficient treatment option for proximal ureteral stone, especially when the stone size is superior to 15 mm with the presence of moderate or severe hydronephrosis.

  7. Portfolio as a tool to evaluate clinical competences of traumatology in medical students

    OpenAIRE

    Santonja-Medina, Fernando; Garc?a-Sanz, M Paz; Mart?nez-Mart?nez, Francisco; B?, David; Garc?a-Esta?, Joaqu?n

    2016-01-01

    Fernando Santonja-Medina,1,2 M Paz García-Sanz,3 Francisco Martínez-Martínez,1,2 David Bó,1,2,4 Joaquín García-Estañ,5 1Faculty of Medicine, Department of Traumatology, 2Faculty of Medicine, University Hospital Virgen de la Arrixaca, 3Faculty of Medicine, Department of Education, 4Faculty of Medicine, University Hospital Morales Meseguer, 5Faculty of Medicine, Department of Physiology, University of Murcia, Murcia, S...

  8. Contribution à étymologie de l' oronyme slovène Nanos

    Directory of Open Access Journals (Sweden)

    Anton Grad

    1982-12-01

    Full Text Available Pour ll' origine de l' oronyme slovène Nanos (a l' est de Trieste, obscure jusqu'ici, l' auteur propose, en se basant sur le nom italien de la montagne, à savoir Naso (= nez df M.onte Re, la base romane Nason (= gros nez, désignation populaire - supposée par l' auteur - de la montagne, d' où par metathèse s - n > n - s, en slovène Nanos.

  9. New approach to study mobility in the vicinity of dynamical arrest; exact application to a kinetically constrained model

    Science.gov (United States)

    DeGregorio, P.; Lawlor, A.; Dawson, K. A.

    2006-04-01

    We introduce a new method to describe systems in the vicinity of dynamical arrest. This involves a map that transforms mobile systems at one length scale to mobile systems at a longer length. This map is capable of capturing the singular behavior accrued across very large length scales, and provides a direct route to the dynamical correlation length and other related quantities. The ideas are immediately applicable in two spatial dimensions, and have been applied to a modified Kob-Andersen type model. For such systems the map may be derived in an exact form, and readily solved numerically. We obtain the asymptotic behavior across the whole physical domain of interest in dynamical arrest.

  10. Determination of bench-mark elevations at Bethel Island and vicinity, Contra Costa and San Joaquin counties, California, 1987

    Science.gov (United States)

    Blodgett, J.C.; Ikehara, M.E.; McCaffrey, William F.

    1988-01-01

    Elevations of 49 bench marks in the southwestern part of the Sacramento-San Joaquin River Delta were determined during October and November 1987. A total of 58 miles of level lines were run in the vicinity of Bethel Island and the community of Discovery Bay. The datum of these surveys is based on a National Geodetic Survey bench mark T934 situated on bedrock 10.5 mi east of Mount Diablo and near Marsh Creek Reservoir. The accuracy of these levels, based on National Geodetic Survey standards, was of first, second, and third order, depending on the various segments surveyed. Several bench marks were noted as possibly being stable, but most show evidence of instability. (USGS)

  11. Intrinsic Channeling of Vortices along the ab Plane in Vicinal YBa2Cu3O7-δ Films

    International Nuclear Information System (INIS)

    Berghuis, P.; Di Bartolomeo, E.; Wagner, G.A.; Evetts, J.E.

    1997-01-01

    We have measured the critical current density j c as a function of the orientation of a magnetic field in vicinal YBa 2 Cu 3 O 7-δ films. When both field and Lorentz force lie within the ab plane, we observe a minimum in j c . At high temperatures, as the c -axis coherence length approaches the ab -plane distance, the minimum in j c could not be observed, indicating that this effect is related to the breakdown of the rectilinear vortex state for fields at a small angle to the ab planes. Our results are the first demonstration of intrinsic channeling of vortex strings along the ab planes. copyright 1997 The American Physical Society

  12. A survey of endogenous retrovirus (ERV) sequences in the vicinity of multiple sclerosis (MS)-associated single nucleotide polymorphisms (SNPs).

    Science.gov (United States)

    Brütting, Christine; Emmer, Alexander; Kornhuber, Malte; Staege, Martin S

    2016-08-01

    Although multiple sclerosis (MS) is one of the most common central nervous system diseases in young adults, little is known about its etiology. Several human endogenous retroviruses (ERVs) are considered to play a role in MS. We are interested in which ERVs can be identified in the vicinity of MS associated genetic marker to find potential initiators of MS. We analysed the chromosomal regions surrounding 58 single nucleotide polymorphisms (SNPs) that are associated with MS identified in one of the last major genome wide association studies. We scanned these regions for putative endogenous retrovirus sequences with large open reading frames (ORFs). We observed that more retrovirus-related putative ORFs exist in the relatively close vicinity of SNP marker indices in multiple sclerosis compared to control SNPs. We found very high homologies to HERV-K, HCML-ARV, XMRV, Galidia ERV, HERV-H/env62 and XMRV-like mouse endogenous retrovirus mERV-XL. The associated genes (CYP27B1, CD6, CD58, MPV17L2, IL12RB1, CXCR5, PTGER4, TAGAP, TYK2, ICAM3, CD86, GALC, GPR65 as well as the HLA DRB1*1501) are mainly involved in the immune system, but also in vitamin D regulation. The most frequently detected ERV sequences are related to the multiple sclerosis-associated retrovirus, the human immunodeficiency virus 1, HERV-K, and the Simian foamy virus. Our data shows that there is a relation between MS associated SNPs and the number of retroviral elements compared to control. Our data identifies new ERV sequences that have not been associated with MS, so far.

  13. Phytotoxicology section investigation in the vicinity of Riddell Hanna No. 1 oil well, Lot 11, Conc 13, Chatham Twp., Kent County, 1990

    International Nuclear Information System (INIS)

    1992-02-01

    A survey was conducted around the Riddell Hanna No.1 oil well in the Windsor district of Ontario to determine the degree and extent of damage that may have been caused to a farm field in the vicinity of the well. The well has been operating for decades, and occasionally has been purged by pumping out brine. In the past (possibly up to ten years ago) the brine was not contained but was deposited directly onto the field adjacent the well. Large patches of bare soil were evident in the soybean field immediately south of the well. Effects of the contaminant on the soybeans were clearly evident in all adjacent areas up to 3 m from the bare patches. Soil and vegetation samples were collected from affected areas and a control site. Results of analyses of electrical conductivity and sodium and chloride concentrations in soils in the vicinity of the well are presented. In the affected area, conductivity reaches six times the level expected to cause severe damage to most plants. Both Na and Cl concentrations in the plants were higher in the affected area than in the control area. The total affected area was estimated at 7,600 m 2 , of which 4,000 m 2 does not support any plant life. 3 refs., 2 figs

  14. Uranium mill tailings remedial action program. Radiological survey of Shiprock vicinity property SH02 Shiprock, New Mexico, August-November 1984

    International Nuclear Information System (INIS)

    Flynn, K.F.; Justus, A.L.; Sholeen, C.M.; Smith, W.H.; Wynveen, R.A.

    1984-04-01

    A comprehensive survey of the vicinity property designated as SH02 was conducted on an intermittent basis from August 3 to November 11, 1982. At the time of the survey, seven structures were located on the property - two residential trailers, one institutional building, two institutional trailers, a storage building, and a pump house. The lands surrounding the structures were either sparsely covered with vegetation or gravelled. The assessment activities included determination of indoor and outdoor surface radiation levels through direct instrument surveys; measurement of ambient external penetrating radiation levels at 1-meter heights; and analysis of air and soil samples. No evidence of radioactive contamination was found inside the structures; background levels of radioactivity were indicated within all seven. The short-term radon daughter measurements did not exceed the limit of 0.02 Working Level for average annual concentration including background, as specified in the EPA Standard 40 CFR 192. The assessment indicated elevated levels of radioactivity at one general area in the outdoor environs, encompassing about 1400 ft 2 (130 m 2 ) of land along the property's northern boundary. Analysis of a surface soil sample collected from this area indicated a radium concentration considerably in excess of the limit of 5 pCi/g above background specified in the EPA Standard. Subsurface soil sampling was not conducted, and thus the vertical extent of the radiological contamination is not known. Since the surface soil contamination level exceeded the limit specified in the EPA Standard, remedial action for this vicinity site should be considered

  15. Uranium Mill Tailings Remedial Action Program. Radiological survey of Shiprock vicinity property SH16, Shiprock, New Mexico, October-November 1982

    International Nuclear Information System (INIS)

    Flynn, K.F.; Justus, A.L.; Sholeen, C.M.; Smith, W.H.; Wynveen, R.A.

    1984-05-01

    At the time of the survey, one residential structure was located on the property. The lands surrounding the structure were landscaped with lawn cover and other vegetation. The assessment activities included determination of indoor and outdoor surface radiation levels, for both fixed and removable contamination, through direct instrument and smear (indoor only) surveys; measurement of ambient external penetrating radiation levels at 1-meter heights; and analyses of air and soil samples. No evidence of radioactive contamination was found in the residential structure; background levels of radioactivity were indicated throughout. Radiation exposure rates were less than the 20 μR/h above background limit. Short-term radon daughter measurements did not exceed the 0.02 WL limit for average annual concentration including background. The assessment indicated elevated levels of radioactivity at several areas in the outside environs. Three localized areas, or discrete hot spots, were found within the backyard. A general area of elevated radioactivity was found at the back alleyway, encompassing about 1200 ft 2 . Radiochemical analyses of the soil sample collected from the backyard indicated a radium concentration of 14 +- 1 pCi/g, which is in excess of the limit of 5 pCi/g above background. Analyses of surface soil samples collected at the alleyway from nearly vicinity property sites also indicated radium concentrations in excess of the limit. Subsurface soil sampling was not conducted, and thus the vertical extent of the radiological contamination is not known. Remedial action for this vicinity site should be considered

  16. Survey of pickup ion signatures in the vicinity of Titan using CAPS/IMS

    Science.gov (United States)

    Regoli, L. H.; Coates, A. J.; Thomsen, M. F.; Jones, G. H.; Roussos, E.; Waite, J. H.; Krupp, N.; Cox, G.

    2016-09-01

    Pickup ion detection at Titan is challenging because ion cyclotron waves are rarely detected in the vicinity of the moon. In this work, signatures left by freshly produced pickup heavy ions (m/q ˜ 16 to m/q ˜ 28) as detected in the plasma data by the Cassini Plasma Spectrometer/Ion Mass Spectrometer (CAPS/IMS) instrument on board Cassini are analyzed. In order to discern whether these correspond to ions of exospheric origin, one of the flybys during which the reported signatures were observed is investigated in detail. For this purpose, ion composition data from time-of-flight measurements and test particle simulations to constrain the ions' origin are used. After being validated, the detection method is applied to all the flybys for which the CAPS/IMS instrument gathered valid data, constraining the region around the moon where the signatures are observed. The results reveal an escape region located in the anti-Saturn direction as expected from the nominal corotation electric field direction. These findings provide new constraints for the area of freshly produced pickup ion escape, giving an approximate escape rate of 3.3-2+3×1023 ions· s-1.

  17. Longtime radionuclide monitoring in the vicinity of Salaspils nuclear reactor; Dauerhaftes Monitoring der Radionuklide in Umgebung von Salaspils Kernreaktor

    Energy Technology Data Exchange (ETDEWEB)

    Riekstina, D.; Berzins, J.; Krasta, T. [Latvia Univ. (Latvia). Inst. of Solid State Physics; Skrypnik, O.; Alksnis, J. [Latvia Univ. (Latvia). Inst. of Chemical Physics

    2016-07-01

    The research nuclear reactor in Salaspils was decommissioned in 1998. Now reactor is partially dismantled and its territory is used as a temporary storage of radioactivity contaminated materials and water. Environment radioactivity monitoring for presence of artificial radionuclides in the vicinity of Salaspils nuclear reactor is carried out since 1990. Data include Cs-137 concentration in soils, tritium concentration in ground water, as well as H-3, Cs-137, Co-60 concentration and gross beta-activity of reactors sewage and rainwater drainage. The systematic monitoring allowed to detect in December 2014 a leakage from the special wastewater basin and so to prevent a pollution of ground water outside reactors territory.

  18. Primordial inhomogeneities in the expanding universe. I - Density and velocity distributions of galaxies in the vicinities of rich clusters

    Science.gov (United States)

    Silk, J.; Wilson, M. L.

    1979-01-01

    The density profiles and Hubble flow deviations in the vicinities of rich galaxy clusters are derived for a variety of models of initial density and velocity perturbations at the recombination epoch. The galaxy correlation function, measured with respect to the Abell clusters, is used to normalize the theoretical models. The angular scales of the required primordial inhomogeneities are calculated. It is found that the resulting density profiles around rich clusters are surprisingly insensitive to the shape of the initial perturbations and also to the cosmological density parameter, Omega. However, it is shown that the distribution of galaxy radial velocities can provide a possible means of deriving Omega.

  19. Toxicity evaluation of natural samples from the vicinity of rice fields using two trophic levels.

    Science.gov (United States)

    Marques, Catarina R; Pereira, Ruth; Gonçalves, Fernando

    2011-09-01

    An ecotoxicological screening of environmental samples collected in the vicinity of rice fields followed a combination of physical and chemical measurements and chronic bioassays with two freshwater trophic levels (microalgae: Pseudokirchneriella subcapitata and Chlorella vulgaris; daphnids: Daphnia longispina and Daphnia magna). As so, water and sediment/soil elutriate samples were obtained from three sites: (1) in a canal reach crossing a protected wetland upstream, (2) in a canal reach surrounded by rice fields and (3) in a rice paddy. The sampling was performed before and during the rice culture. During the rice cropping, the whole system quality decreased comparatively to the situation before that period (e.g. nutrient overload, the presence of pesticides in elutriates from sites L2 and L3). This was reinforced by a significant inhibition of both microalgae growth, especially under elutriates. Contrary, the life-history traits of daphnids were significantly stimulated with increasing concentrations of water and elutriates, for both sampling periods.

  20. 222Rn in private well water in the vicinity of uranium mines over ten years

    International Nuclear Information System (INIS)

    Yunoki, Eiji; Kataoka, Toshio; Michihiro, Kenshu; Sugiyama, Hirokazu; Shimizu, Mitsuo; Mori, Tadashige

    1994-01-01

    There are many small uranium mines of the sedimentary type in Kamisaibara, Okayama Prefecture, Japan. As inhabitants in Kamisaibara consume water from privately-dug wells, it is important to investigate distributions of 222 Rn in privately-dug well water in the vicinity of the mines. The determination of 222 Rn in well water was carried out from April 1980 to October 1990. Though small in area (16 km 2 ), each well water has its own characteristic activity concentrations of 222 Rn. The activity concentrations of 222 Rn are almost constant for each specific well over a long period (about 10 years). In general, the correlation coefficients for several sampling points are small. As Akawase and Tennoh are situated in the same rock type, the correlation coefficient is the highest value in this area. The estimated dose equivalent for the human stomach is approximately 0.4-54 μSv/year. The type of distribution of 222 Rn in privately-dug well water is log normal. (author)

  1. Archaeological survey of the McGee Ranch vicinity, Hanford Site, Washington

    Energy Technology Data Exchange (ETDEWEB)

    Gard, H.A.; Poet, R.M.

    1992-09-01

    In response to a request for a cultural resources review from Westinghouse Hanford Company for the Action Plan for Characterization of McGee Ranch Soil, Pacific Northwest Laboratory's Hanford Cultural Resources Laboratory (HCRL) conducted an archaeological survey of the McGee Ranch vicinity, located in the northwest portion of the Hanford Site. Staff members covered 8.4 km{sup 2} and recorded 42 cultural resources; 22 sites, and 20 isolated artifacts. Only 2 sites and 3 isolates were attributed to a prehistoric Native American occupation. The historic sites date from the turn of the century to the 1940s and are representative of the settlement patterns that occurred throughout the Columbia Basin. In addition to an archaeological pedestrian survey of the project area, we conducted literature and records searches and examined available aerial photographs. Records kept at HCRL were reviewed to determine if any archaeological survey had been conducted previously within the project area. Although no survey had been conducted, portions of the area adjacent to project boundaries were surveyed in 1988 and 1990. During those surveys, historic and prehistoric cultural resources were observed, increasing the possibility that similar land usage had taken place within the current project boundaries. Literature searches established a general historical sequence for this area. Aerial photographs alerted researchers to homesteads and linear features, such as roads and irrigation ditches, that might not be apparent from ground level.

  2. Archaeological survey of the McGee Ranch vicinity, Hanford Site, Washington

    Energy Technology Data Exchange (ETDEWEB)

    Gard, H.A.; Poet, R.M.

    1992-09-01

    In response to a request for a cultural resources review from Westinghouse Hanford Company for the Action Plan for Characterization of McGee Ranch Soil, Pacific Northwest Laboratory`s Hanford Cultural Resources Laboratory (HCRL) conducted an archaeological survey of the McGee Ranch vicinity, located in the northwest portion of the Hanford Site. Staff members covered 8.4 km{sup 2} and recorded 42 cultural resources; 22 sites, and 20 isolated artifacts. Only 2 sites and 3 isolates were attributed to a prehistoric Native American occupation. The historic sites date from the turn of the century to the 1940s and are representative of the settlement patterns that occurred throughout the Columbia Basin. In addition to an archaeological pedestrian survey of the project area, we conducted literature and records searches and examined available aerial photographs. Records kept at HCRL were reviewed to determine if any archaeological survey had been conducted previously within the project area. Although no survey had been conducted, portions of the area adjacent to project boundaries were surveyed in 1988 and 1990. During those surveys, historic and prehistoric cultural resources were observed, increasing the possibility that similar land usage had taken place within the current project boundaries. Literature searches established a general historical sequence for this area. Aerial photographs alerted researchers to homesteads and linear features, such as roads and irrigation ditches, that might not be apparent from ground level.

  3. "Killer" Microcapsules That Can Selectively Destroy Target Microparticles in Their Vicinity.

    Science.gov (United States)

    Arya, Chandamany; Oh, Hyuntaek; Raghavan, Srinivasa R

    2016-11-02

    We have developed microscale polymer capsules that are able to chemically degrade a certain type of polymeric microbead in their immediate vicinity. The inspiration here is from the body's immune system, where killer T cells selectively destroy cancerous cells or cells infected by pathogens while leaving healthy cells alone. The "killer" capsules are made from the cationic biopolymer chitosan by a combination of ionic cross-linking (using multivalent tripolyposphate anions) and subsequent covalent cross-linking (using glutaraldehyde). During capsule formation, the enzyme glucose oxidase (GOx) is encapsulated in these capsules. The target beads are made by ionic cross-linking of the biopolymer alginate using copper (Cu 2+ ) cations. The killer capsules harvest glucose from their surroundings, which is then enzymatically converted by GOx into gluconate ions. These ions are known for their ability to chelate Cu 2+ cations. Thus, when a killer capsule is next to a target alginate bead, the gluconate ions diffuse into the bead and extract the Cu 2+ cross-links, causing the disintegration of the target bead. Such destruction is visualized in real-time using optical microscopy. The destruction is specific, i.e., other microparticles that do not contain Cu 2+ are left undisturbed. Moreover, the destruction is localized, i.e., the targets destroyed in the short term are the ones right next to the killer beads. The time scale for destruction depends on the concentration of encapsulated enzyme in the capsules.

  4. Tritium levels in milk in the vicinity of chronic tritium releases.

    Science.gov (United States)

    Le Goff, P; Guétat, Ph; Vichot, L; Leconte, N; Badot, P M; Gaucheron, F; Fromm, M

    2016-01-01

    Tritium is the radioactive isotope of hydrogen. It can be integrated into most biological molecules. Even though its radiotoxicity is weak, the effects of tritium can be increased following concentration in critical compartments of living organisms. For a better understanding of tritium circulation in the environment and to highlight transfer constants between compartments, we studied the tritiation of different agricultural matrices chronically exposed to tritium. Milk is one of the most frequently monitored foodstuffs in the vicinity of points known for chronic release of radionuclides firstly because dairy products find their way into most homes but also because it integrates deposition over large areas at a local scale. It is a food which contains all the main nutrients, especially proteins, carbohydrates and lipids. We thus studied the tritium levels of milk in chronic exposure conditions by comparing the tritiation of the main hydrogenated components of milk, first, component by component, then, sample by sample. Significant correlations were found between the specific activities of drinking water and free water of milk as well as between the tritium levels of cattle feed dry matter and of the main organic components of milk. Our findings stress the importance of the metabolism on the distribution of tritium in the different compartments. Overall, dilution of hydrogen in the environmental compartments was found to play an important role dimming possible isotopic effects even in a food chain chronically exposed to tritium. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Quantification of vicine and convicine in faba bean seeds using hydrophilic interaction liquid chromatography.

    Science.gov (United States)

    Purves, Randy W; Khazaei, Hamid; Vandenberg, Albert

    2018-02-01

    Faba bean (Vicia faba L.) provides environmental and health benefits; however, the presence of the pyrimidine glycosides vicine and convicine (v-c) in its seeds limits consumption. Low v-c genotypes have been introduced, but the convicine levels in these genotypes have not been quantified. To improve detection, the polar nature of v-c was exploited by implementing hydrophilic interaction liquid chromatography (HILIC). A sample preparation method using a two-step extraction was developed for use with UV and/or tandem mass spectrometry (SRM) detection. The HILIC-UV method was suitable for over three orders of magnitude, covering the range of v-c concentrations in faba bean seeds across all genotypes tested. The linear range of HILIC-SRM was slightly less (∼3 orders of magnitude), but improved sensitivity and selectivity make it more suitable for quantifying low v-c samples. The analysis of 13 genotypes suggests that v-c concentrations in faba bean seeds may be independent quantitative traits. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Assessment of lead in blood samples of children residing in the vicinity of industries

    International Nuclear Information System (INIS)

    Shah, F.; Kazi, T.G.; Afridi, H.I.; Brahaman, K.D.; Arain, S.S.; Panhwar, A.H.

    2013-01-01

    The aim of present study was to determine the lead (Pb) distributions in blood and prevalence of elevated Pb exposure among children, age ranged (5-10 years), residing near industrialized region of Hyderabad city, Pakistan. For comparison, biological samples of children of same age group from non-industrial area were also analyzed. The Pb concentration in blood samples was determined by electrothermal atomic absorption spectrometry, prior to microwave assisted acid digestion. The results showed that significantly higher proportion of children living in the vicinity of industrial area, had blood Pb levels (BLL) in the range of 15.4-35.6 micro g/dL, and 8.51-16.7 micro g/dL for those of non-industrial area. The blood Pb level was higher in boys of both groups as compared to girls of same age group, but the difference was not significant (p=0.178). Negative correlation was observed between BLL and hemoglobin levels (p<0.001), while positive correlation was observed between BLL and age. (author)

  7. Identification of emission sources of particle-bound polycyclic aromatic hydrocarbons in the vicinity of the industrial zone of the city of Novi Sad

    Directory of Open Access Journals (Sweden)

    Jovčić Nataša S.

    2013-01-01

    Full Text Available Data on polycyclic aromatic hydrocarbons (PAHs in ambient air accessed at selected locations in the vicinity of the industrial zone of the city of Novi Sad, Serbia, have been presented and analyzed in order to determine seasonal and spatial variations and to identify emission sources of particle-bound PAHs. Previous studies have demonstrated that the major contributors of PAHs in urban areas are the emissions from vehicle exhaust, and emissions releases from industrial processes like aluminium production, creosote and wood preservation, waste incineration, cement manufacture, petrochemical and related industries, commercial heat/power production etc. The sampling campaigns have been conducted at three sampling sites, during the two 14-day periods. The first site was situated near industrial area, with a refinery, power plant and heavy-traffic road in the vicinity. The second site was located nearby the heavy traffic area, especially busy during the rush hour. The third site was residential district. Summer sampling period lasted from June 26th to July 10th 2008, while sampling of ambient air during the winter was undertaken from January 22nd to February 5th 2009. Eighty-four (84 air samples were collected using a high volume air sampler TCR Tecora H0649010/ECHO. 16 US EPA polycyclic aromatic hydrocarbons were determined in all samples using a gas chromatographer with a mass spectrometer as a detector (Shimatzu MDGC/GCMS-2010. The total average concentrations of PAHs ranged from 1.21 to 1.77 ng/m3 during the summer period and from 6.31 to 7.25 ng/m3 in the winter. Various techniques, including diagnostic ratio (DR and principal component analysis (PCA, have been used to define and evaluate potential emission sources of PAHs. Diagnostic ratio analysis indicated that vehicles, diesel or/and gasoline, industrial and combustion emissions were sources of PAHs in the vicinity of the industrial zone. Additionally, principal component analysis was used

  8. Production of neutron-rich nuclides in the vicinity of N = 126 shell closure in multinucleon transfer reactions

    Directory of Open Access Journals (Sweden)

    Karpov Alexander

    2017-01-01

    Full Text Available Multinucleon transfer in low-energy nucleus-nucleus collisions is widely discussed as a method of production of yet-unknown neutron-rich nuclei hardly accessible (or inaccessible by other methods. Modeling of complicated dynamics of nuclear reactions induced by heavy ions is done within a multidimensional dynamical model of nucleus-nucleus collisions based on the Langevin equations. The model gives a continuous description of the system evolution starting from the well-separated target and projectile in the entrance channel of the reaction up to the formation of final reaction products. In this paper, rather recent sets of experimental data for the 136Xe+198Pt,208Pb reactions are analyzed together with the production cross sections for neutron-rich nuclei in the vicinity of the N = 126 magic shell.

  9. Analysis of stress fields and elastic energies in the vicinity of nanograin boundaries using the disclination approach

    Science.gov (United States)

    Sukhanov, Ivan I.; Ditenberg, Ivan A.

    2017-12-01

    The paper provides a theoretical analysis of elastic stresses and elastic energy distribution in nanostructured metal materials in the vicinity of nanograin boundaries with a high partial disclination density. The analysis demonstrates the stress field distribution in disclination grain boundary configurations as a function of nanograin size, taking into account the superposition of these stresses in screening the disclination pile-ups. It is found that the principal stress tensor components reach maximum values only in disclination planes P ≈ E/25 and that the stress gradients peak at nodal points ∂P/∂x ≈ 0.08E nm-1. The shear stress components are localized within the physical grain size, and the specific elastic energy distribution for such configurations reveals characteristic local maxima which can be the cause for physical broadening of nanograin boundaries.

  10. Nitrogen-doped carbon nanotubes as a metal catalyst support

    CSIR Research Space (South Africa)

    Mabena, LF

    2011-05-01

    Full Text Available ., which are among the most commonly used heterogeneous catalyst supports (Mart??nez-Me?ndez et al. 2006). Catalyst activity depends on the particle size and appropriate dis- tance between each particle. These catalysts deposited on a support... supported Pt electrodes. Appl Catal B Environ 80:286?295 Maldonado S, Morin S, Stevenson KJ (2006) Structure, composition, and chemical reactivity of carbon nanotubes by selective nitrogen doping. Carbon 44:1429?1437 Mart??nez-Me?ndez S, Henr??quez Y...

  11. Crystalline and lattice matched Ba0.7Si0.3O layers on plane and vicinal Si(001) surfaces

    International Nuclear Information System (INIS)

    Zachariae, J.

    2006-01-01

    In this work the low temperature growth conditions of epitaxial and lattice-matched Ba 0.7 Sr 0.3 O layers on Si(100) were investigated using the combination of low energy electron diffraction (LEED), x-ray photoemission (XPS) and electron energy loss spectroscopy (EELS). With these methods crystallinity, stoichiometry and electronic structure of both occupied and unoccupied levels were studied as a function of layer thickness. Oxide layers were generated by evaporating the metals in oxygen ambient pressure with the sample at room temperature. Perfect crystallinity and lattice matching was only obtained starting with a preadsorbed monolayer (ML) of Sr or Ba at a concentration close to one monolayer. The XPS analysis shows that Ba 0.7 Sr 0.3 O as a high-K gate dielectric offers an adequate band gap, an appropriate band alignment and a atomically sharp interface to the Si(001) substrate. No silicide and silicate species, or SiO 2 formation at the interface after oxidation were found. To show that Ba 0.7 Sr 0.3 O is really appropriate to replace SiO 2 as a gate dielectric, first C-V and I-V curves of MOS-diodes with SrO, BaO and Ba 0.7 Sr 0.3 O as gateoxide were measured under ambient conditions. Besides other results, it turns out that the measured dielectric constant of Ba 0.7 Sr 0.3 O conforms with the expected value of ε ∼ 25 - 30. Exploring ways for self-organized structuring of insulating films, the possibility to produce replicas of step trains, given by a vicinal Si(001)-4 [110] surface, in layers of crystalline and perfectly lattice matched Ba 0.7 Sr 0.3 O were investigated. For this purpose high-resolution spot profile analyses in low-energy electron diffraction (SPA-LEED) both on flat Si(001) and on vicinal Si(001)-4 [110] were carried out. The G(S) analysis of these mixed oxide layers reveals a strong influence of local compositional fluctuations of Sr and Ba ions and their respective scattering phases, which appears as an unphysically large variation

  12. Critical behavior of a La0,7Sr0,3MnO3 crystal in the vicinity of its transition to ferromagnetic state

    International Nuclear Information System (INIS)

    Kalita, V.M.; Lozenko, A.F.; Ryabchenko, S.M.; Trotsenko, P.O.; Tovstolitkyin, O.Yi.; Pogoryilij, A.M.

    2009-01-01

    Magnetostatic properties of a La 0,7 Sr 0,3 MnO 3 single crystal have been studied in the vicinity of its critical temperature T c . A nonlinear temperature dependence of the inverse magnetic susceptibility which is characteristic of the Griffiths phase, has been found in the minimal measuring magnetic field at temperatures slightly above the temperature of ferromagnetic (FM) ordering. A conclusion was made that such a nonlinearity arises owing to the formation of magnetic polarons

  13. Identification of emission sources of particle-bound polycyclic aromatic hydrocarbons in the vicinity of the industrial zone of the city of Novi Sad

    OpenAIRE

    Jovčić Nataša S.; Radonić Jelena R.; Turk-Sekulić Maja M.; Vojinović-Miloradov Mirjana B.; Popov Srđan B.

    2013-01-01

    Data on polycyclic aromatic hydrocarbons (PAHs) in ambient air accessed at selected locations in the vicinity of the industrial zone of the city of Novi Sad, Serbia, have been presented and analyzed in order to determine seasonal and spatial variations and to identify emission sources of particle-bound PAHs. Previous studies have demonstrated that the major contributors of PAHs in urban areas are the emissions from vehicle exhaust, and emissions releases from industrial processes like a...

  14. Environmental impact and human health risks of polychlorinated dibenzo-p-dioxins and dibenzofurans in the vicinity of a new hazardous waste incinerator: a case study.

    OpenAIRE

    Ferré-Huguet, Núria; Nadal, Martí; Schuhmacher, Marta; Domingo, José L.

    2006-01-01

    KEYWORDS - CLASSIFICATION: adverse effects;analysis;Benzofurans;cancer epidemiology;Dioxins;Environmental Exposure;Environmental Health;Environmental Monitoring;Hazardous Waste;Humans;Incineration;metabolism;Refuse Disposal;Research;Risk Assessment;Spain;Toxicology. The purpose of this study was to assess the environmental impact of polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) in the vicinity of a new hazardous waste incinerator (HWI) 4 years after regular operation of the...

  15. Impact of radiofrequency radiation on DNA damage and antioxidants in peripheral blood lymphocytes of humans residing in the vicinity of mobile phone base stations.

    Science.gov (United States)

    Zothansiama; Zosangzuali, Mary; Lalramdinpuii, Miriam; Jagetia, Ganesh Chandra

    2017-01-01

    Radiofrequency radiations (RFRs) emitted by mobile phone base stations have raised concerns on its adverse impact on humans residing in the vicinity of mobile phone base stations. Therefore, the present study was envisaged to evaluate the effect of RFR on the DNA damage and antioxidant status in cultured human peripheral blood lymphocytes (HPBLs) of individuals residing in the vicinity of mobile phone base stations and comparing it with healthy controls. The study groups matched for various demographic data including age, gender, dietary pattern, smoking habit, alcohol consumption, duration of mobile phone use and average daily mobile phone use. The RF power density of the exposed individuals was significantly higher (p base stations, showed significantly (p base station/s. The analysis of various antioxidants in the plasma of exposed individuals revealed a significant attrition in glutathione (GSH) concentration (p < 0.01), activities of catalase (CAT) (p < 0.001) and superoxide dismutase (SOD) (p < 0.001) and rise in lipid peroxidation (LOO) when compared to controls. Multiple linear regression analyses revealed a significant association among reduced GSH concentration (p < 0.05), CAT (p < 0.001) and SOD (p < 0.001) activities and elevated MN frequency (p < 0.001) and LOO (p < 0.001) with increasing RF power density.

  16. QTL list: SpRg-7 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available entage concerning shoot regeneration 2 ME10-141 ... Chr07 19.51 6.84 ... 10.1186/1471-2229-11-140 22014149 ... QT73653 Solanum lycopersicum Solanaceae SpRg-7 In vitro plant regeneraion bud perc

  17. Hydrodynamics of the interaction between bodies in a viscous fluid in the vicinity of their contact at low and high Reynolds numbers

    Czech Academy of Sciences Publication Activity Database

    Petrov, A. G.; Kharlamov, Alexander

    2013-01-01

    Roč. 48, č. 2 (2013), s. 179-191 ISSN 0015-4628 R&D Projects: GA ČR GA103/09/2066 Grant - others:Russian Foundation for Basic Research (RU) 11-01-00535; Russian Foundation for Basic Research (RU) 11-01-00857; Target Analytical Program; Development of the Scientific Potential of the Higher School(RU) 2.1.2/3604 Institutional support: RVO:67985874 Keywords : lubrication layer theory * viscous and inviscid fluids * thin layer * contact vicinity Subject RIV: BK - Fluid Dynamics Impact factor: 0.320, year: 2013

  18. Statistical analysis of electromagnetic radiation measurements in the vicinity of GSM/UMTS base station antenna masts.

    Science.gov (United States)

    Koprivica, Mladen; Neskovic, Natasa; Neskovic, Aleksandar; Paunovic, George

    2014-01-01

    As a result of dense installations of public mobile base station, additional electromagnetic radiation occurs in the living environment. In order to determine the level of radio-frequency radiation generated by base stations, extensive electromagnetic field strength measurements were carried out for 664 base station locations. Base station locations were classified into three categories: indoor, masts and locations with installations on buildings. Having in mind the large percentage (47 %) of sites with antenna masts, a detailed analysis of this location category was performed, and the measurement results were presented. It was concluded that the total electric field strength in the vicinity of base station antenna masts in no case exceeded 10 V m(-1), which is quite below the International Commission on Non-Ionizing Radiation Protection reference levels. At horizontal distances >50 m from the mast bottom, the median and maximum values were <1 and 2 V m(-1), respectively.

  19. Statistical analysis of electromagnetic radiation measurements in the vicinity of GSM/UMTS base station antenna masts

    International Nuclear Information System (INIS)

    Koprivica, M.; Neskovic, N.; Neskovic, A.; Paunovic, G.

    2014-01-01

    As a result of dense installations of public mobile base station, additional electromagnetic radiation occurs in the living environment. In order to determine the level of radio-frequency radiation generated by base stations, extensive electromagnetic field strength measurements were carried out for 664 base station locations. Base station locations were classified into three categories: indoor, masts and locations with installations on buildings. Having in mind the large percentage (47 %) of sites with antenna masts, a detailed analysis of this location category was performed, and the measurement results were presented. It was concluded that the total electric field strength in the vicinity of base station antenna masts in no case exceeded 10 V m -1 , which is quite below the International Commission on Non-Ionizing Radiation Protection reference levels. At horizontal distances >50 m from the mast bottom, the median and maximum values were -1 , respectively. (authors)

  20. Monitoring of Radio-nuclides in the Vicinities of Finnish Nuclear Power Plants in 2002-2004

    International Nuclear Information System (INIS)

    Ilus, E.; Klemola, S.; Vartti, V.-P.; Mattila, J.; Ikaeheimonen, T.K.

    2000-03-01

    The monitoring of radioactive substances round Finnish nuclear power plants continued in 2002-2004 in accordance with the regular environmental monitoring programmes. Altogether, some 1000 samples are analysed annually from the terrestrial and aquatic environs of the two power plants. Trace amounts of activation products originating from airborne releases from the local power plants were detected in several air and deposition samples taken from the close vicinities of the power plants. At Loviisa, observations were made in two; at Olkiluoto in three aerosol samples during the reporting period. Except for the naturally occurring beryllium-7, the concentrations of all radionuclides in the air samples were very low; from few microbequerels to few tens of microbequerels per cubic metre. A similar pattern was tenable for the deposition samples as well. The activity concentrations of cobalt-60 of local origin were at their highest 0.3 bequerels per square metre in one sample taken from Loviisa and in one sample taken from Olkiluoto. No traces of local discharge nuclides were detected in foodstuffs, drinking water or garden products. In mushrooms and wild berries picked up in 2004 from the Loviisa area, only Chernobyl-derived caesium isotopes and natural potassium-40 were detected. Local discharge nuclides were more abundant in the aquatic environment, especially in samples of indicator organisms, sinking matter and sediments, which effectively accumulate radioactive substances. Besides tritium originating from local discharges, the most significant artificial radionuclide in the samples taken from the aquatic environs of the power plants was still caesium-137 originating from the Chernobyl accident (potassium-40 is a naturally occurring radionuclide). Elevated tritium concentrations were more frequent in the water samples from Loviisa. In indicator organisms and sinking matter, the observed concentrations of local discharge nuclides were generally somewhat higher and