WorldWideScience

Sample records for vicia unijuga lectin-binding

  1. Lectin binding patterns and immunohistochemical antigen detection ...

    African Journals Online (AJOL)

    Ibrahim Eldaghayes

    2018-02-09

    Feb 9, 2018 ... the effect of infection with Brucella abortus on the pattern of lectin binding in bovine fetal lungs (n=6) and bovine placentas (n=5). Fetal lungs and placenta from heifers experimentally inoculated with B. abortus, strain 2308 were examined by histological, lectin-histochemical, immunohistochemical and ...

  2. Cellular heterogeneity in the membrana granulosa of developing rat follicles: assessment by flow cytometry and lectin binding.

    Science.gov (United States)

    Kerketze, K; Blaschuk, O W; Farookhi, R

    1996-07-01

    The hormone-mediated maturation of ovarian follicles is apparently accompanied by position-specific differentiation of cells of the membrana granulosa. We have assessed the extent of this cellular heterogeneity by flow cytometry using a variety of fluorescein isothiocyanate-labeled lectins as probes. Follicular development was stimulated in immature rats by treatment with either diethylstilbestrol (DES) or equine CG (eCG). Lectin binding to monodispersed rat granulosa cells was then analyzed by flow cytometry. Our results demonstrate that there are two distinct populations of small (4-7 microM) and large (9-12 microM) granulosa cells in follicles from DES- and eCG-treated animals. Both populations appear to be mitotically active and show specific lectin-binding characteristics. Six lectins (canavalia ensiforms, triticum vulgaris, maclura pomifera, erythrina cristagalli, jacalin, and vicia villosa) bind equally to both small and large granulosa cells from the DES- and eCG-treated rats. In contrast, no binding to either cell population was detected with six other lectins (dolichos biflorus, griffonia simplicifolia-II, lycopersicon esculentum, datura stramonium, solanum tuberosum, and ulex europaeus). Furthermore, four galactose-binding lectins (bauhinia purpurea, glysine maximus, griffonia simplicifolia-I, and arachis hypogaea) were found to identify specific subsets of granulosa cells. Three of these lectins (bauhinia purpurea, glysine maximus, and griffonia simplicifolia-I) bind to only small granulosa cells from either DES- or eCG- treated immature rats. The fourth lectin (arachis hypogaea) identifies subpopulations of both small and large granulosa cells. Application of the four galactose-specific lectins to fixed sections of frozen ovaries demonstrated binding to the perioocyte and cumulus granulosa cells. We conclude that cellular heterogeneity exists within the follicular epithelium at various stages-specific lectin-binding sites.

  3. Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis

    OpenAIRE

    Tawakoli, Pune N.; Neu, Thomas R.; Busck, Mette M.; Kuhlicke, Ute; Schramm, Andreas; Attin, Thomas; Wiedemeier, Daniel B.; Schlafer, Sebastian

    2017-01-01

    ABSTRACT The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled lectins to visualize and quantify extracellular glycoconjugates in dental biofilms. Lectin binding was screened on pooled supragingival biofilm samples collected from 76 subjects using confocal...

  4. Presenting Precision Glycomacromolecules on Gold Nanoparticles for Increased Lectin Binding

    Directory of Open Access Journals (Sweden)

    Sophia Boden

    2017-12-01

    Full Text Available Glyco-functionalized gold nanoparticles have great potential as biosensors and as inhibitors due to their increased binding to carbohydrate-recognizing receptors such as the lectins. Here we apply previously developed solid phase polymer synthesis to obtain a series of precision glycomacromolecules that allows for straightforward variation of their chemical structure as well as functionalization of gold nanoparticles by ligand exchange. A novel building block is introduced allowing for the change of spacer building blocks within the macromolecular scaffold going from an ethylene glycol unit to an aliphatic spacer. Furthermore, the valency and overall length of the glycomacromolecule is varied. All glyco-functionalized gold nanoparticles show high degree of functionalization along with high stability in buffer solution. Therefore, a series of measurements applying UV-Vis spectroscopy, dynamic light scattering (DLS and surface plasmon resonance (SPR were performed studying the aggregation behavior of the glyco-functionalized gold nanoparticles in presence of model lectin Concanavalin A. While the multivalent presentation of glycomacromolecules on gold nanoparticles (AuNPs showed a strong increase in binding compared to the free ligands, we also observed an influence of the chemical structure of the ligand such as its valency or hydrophobicity on the resulting lectin interactions. The straightforward variation of the chemical structure of the precision glycomacromolecule thus gives access to tailor-made glyco-gold nanoparticles (glyco-AuNPs and fine-tuning of their lectin binding properties.

  5. Lectin-binding characteristics of a Lyme borreliosis spirochete Borrelia burgdorferi sensu stricto

    Czech Academy of Sciences Publication Activity Database

    Vancová, M.; Nebesářová, J.; Grubhoffer, Libor

    2005-01-01

    Roč. 50, č. 3 (2005), s. 229-238 ISSN 0015-5632 R&D Projects: GA ČR GA206/03/1323; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z60220518 Keywords : Borrelia burgdorferi * electron microscopy * lectin binding Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005

  6. Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis

    DEFF Research Database (Denmark)

    Tawakoli, Pune Nina; Neu, Thomas R; Busck, Mette Marie

    2017-01-01

    The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled...

  7. Flow cytometric analysis of lectin binding to in vitro-cultured Perkinsus marinus surface carbohydrates

    Science.gov (United States)

    Gauthier, J.D.; Jenkins, J.A.; La Peyre, Jerome F.

    2004-01-01

    Parasite surface glycoconjugates are frequently involved in cellular recognition and colonization of the host. This study reports on the identification of Perkinsus marinus surface carbohydrates by flow cytometric analyses of fluorescein isothiocyanate-conjugated lectin binding. Lectin-binding specificity was confirmed by sugar inhibition and Kolmogorov-Smirnov statistics. Clear, measurable fluorescence peaks were discriminated, and no parasite autofluorescence was observed. Parasites (GTLA-5 and Perkinsus-1 strains) harvested during log and stationary phases of growth in a protein-free medium reacted strongly with concanavalin A and wheat germ agglutinin, which bind to glucose-mannose and N-acetyl-D-glucosamine (GlcNAc) moieties, respectively. Both P. marinus strains bound with lower intensity to Maclura pomifera agglutinin, Bauhinia purpurea agglutinin, soybean agglutinin (N-acetyl-D-galactosamine-specific lectins), peanut agglutinin (PNA) (terminal galactose specific), and Griffonia simplicifolia II (GlcNAc specific). Only background fluorescence levels were detected with Ulex europaeus agglutinin I (L-fucose specific) and Limulus polyphemus agglutinin (sialic acid specific). The lectin-binding profiles were similar for the 2 strains except for a greater relative binding intensity of PNA for Perkinsus-1 and an overall greater lectin-binding capacity of Perkinsus-1 compared with GTLA-5. Growth stage comparisons revealed increased lectin-binding intensities during stationary phase compared with log phase of growth. This is the first report of the identification of surface glycoconjugates on a Perkinsus spp. by flow cytometry and the first to demonstrate that differential surface sugar expression is growth phase and strain dependent. ?? American Society of Parasitologists 2004.

  8. Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis

    DEFF Research Database (Denmark)

    Tawakoli, Pune Nina; Neu, Thomas R; Busck, Mette Marie

    2017-01-01

    The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled...... lectins to visualize and quantify extracellular glycoconjugates in dental biofilms. Lectin binding was screened on pooled supragingival biofilm samples collected from 76 subjects using confocal microscopy. FLBA was then performed with 10 selected lectins on biofilms grown in situ for 48 h in the absence...... in the dental biofilm matrix. The characterization and quantification of glycoconjugates in dental biofilms require a combination of several lectins. For 48-h-biofilms grown in absence of sucrose, AAL, Calsepa, HPA, LEA, and MNA-G are recommendable....

  9. Lectin-binding sites in the epithelium of normal human appendix vermiformis and in acute appendicitis.

    Science.gov (United States)

    Brinck, U; Bosbach, R; Korabiowska, M; Schauer, A; Gabius, H J

    1995-01-01

    By using histochemical methods, the binding pattern of various lectins in the epithelium of normal human appendix vermiformis was assessed. In addition to plant and invertebrate sugar receptors with nominal monosaccharide specificity for alpha-L-Fuc (UEA-I), alpha-D-Man and alpha-D-Gluc (Con A), alpha-D-GalNAc (DBA), D-GalNAc (SBA, HPA) beta-D-Gal (RCA-I) and D-Gal (VAA), a mammalian beta-galactoside-specific lectin (MW, 14 kDa) was included in the applied panel. The apical surface of enterocytes presented binding sites for RCA-I on all cells, binding sites of UEA-I, DBA, SBA, HPA and VAA heterogeneously and no binding sites of Con A and 14 kDa. Binding sites of DBA, SBA, HPA, VAA and RCA-I within enterocytes were located primarily focally in a supranuclear position, whereas Con A and 14 kDa bound to the cytoplasm both in apical and basal cell parts. In the follicle-associated epithelium more enterocytes expressed SBA- and VAA-binding sites than in the crypt epithelium. No differences between the lectin-binding pattern of M-cells and enterocytes were found in the follicle-associated epithelium. Intraepithelial macrophages were heterogeneously positive for the full panel of applied lectins. In contrast, intraepithelial lymphatic cells expressed binding sites only for RCA-I and less prominently for Con A, VAA and 14 kDa. Goblet cell mucus contained lectin-binding sites in a heterogeneous manner: binding sites for Con A were not detected in goblet cells for DBA, SBA, VAA and 14 kDa in less than 20%, for UEA-I in 20-40%, for HPA in 40-60% and for RCA-I in 60-100% of the goblet cells. Secreted mucus differed in its lectin-binding capacity from intracellular goblet cell mucus selectively by an increase of UEA-I, SBA- and RCA-I-binding sites and a lack of 14 kDa-binding sites. Comparative study of lectin binding to goblet cell mucin in another region of the large intestine, namely the rectosigmoid, demonstrated that DBA, SBA and 14 kDa bound mainly to the distal colon

  10. Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis.

    Science.gov (United States)

    Tawakoli, Pune N; Neu, Thomas R; Busck, Mette M; Kuhlicke, Ute; Schramm, Andreas; Attin, Thomas; Wiedemeier, Daniel B; Schlafer, Sebastian

    2017-01-01

    The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled lectins to visualize and quantify extracellular glycoconjugates in dental biofilms. Lectin binding was screened on pooled supragingival biofilm samples collected from 76 subjects using confocal microscopy. FLBA was then performed with 10 selected lectins on biofilms grown in situ for 48 h in the absence of sucrose. For five lectins that proved particularly suitable, stained biovolumes were quantified and correlated to the bacterial composition of the biofilms. Additionally, combinations of up to three differently labeled lectins were tested. Of the 10 lectins, five bound particularly well in 48-h-biofilms: Aleuria aurantia (AAL), Calystega sepiem (Calsepa), Lycopersicon esculentum (LEA), Morniga-G (MNA-G) and Helix pomatia (HPA). No significant correlation between the binding of specific lectins and bacterial composition was found. Fluorescently labeled lectins enable the visualization of glycoconjugates in the dental biofilm matrix. The characterization and quantification of glycoconjugates in dental biofilms require a combination of several lectins. For 48-h-biofilms grown in absence of sucrose, AAL, Calsepa, HPA, LEA, and MNA-G are recommendable.

  11. Solid phase measurements of antibody and lectin binding to xenogenic carbohydrate antigens

    DEFF Research Database (Denmark)

    Kirkeby, Svend; André, Sabine; Gabius, Hans-Joachim

    2004-01-01

    a naturally occurring subfraction from human serum, to Galalpha containing neoglycoproteins and mouse laminin that were immobilized on microtiter plates. RESULTS: Galalpha reactive antibodies with similar monosaccharide specificity have distinct structural preference for sugar ligands. Laminin...... and neoglycoproteins were treated with alpha-galactosidase and subsequently incubated with antibodies and lectins. The enzyme treatment was more deleterious on antibody binding than on lectin binding. CONCLUSION: Antibodies and lectins may bind to different galactose determinants on the glycoproteins. Two anti......-Galalpha1 antibodies that both have been raised against glycans on rabbit red blood cells may recognize Galalpha-antigens with varying specificities. Binding results obtained after digestion with alpha-galactosidase indicate that some xenoreactive Galalpha groups are not directly accessible for removal...

  12. A histochemical study of the microglial cells in the brain of Salamandra salamandra by lectin binding.

    Science.gov (United States)

    Franceschini, V; Ciani, F

    1992-01-01

    Seven biotinylated lectins were utilized as histochemical markers for the study of microglial cells in the brain of Salamandra salamandra. It has been demonstrated that SBA, BSA-I, BSA-I-B4 and RCA120 label the microglial cells and, on the basis of the binding selectivity of the single lectins for specific carbohydrates, it was found that alpha-galactosyl residues are present in high density on the microglial membrane of S. salamandra. The reaction was localized not only to the ramified microglial cells, but also to other round cells without extensions, interpreted as ameboid microglial cells. The results show that lectin binding is a reliable molecular probe for identifying microglial cells in urodels.

  13. Developmental changes in the distribution of cecal lectin-binding sites of Balb-c mice.

    Science.gov (United States)

    Doehrn, S; Breipohl, W; Lierse, W; Romaniuk, K; Young, W

    1992-01-01

    The existence of lectin-binding sites was investigated in the cecum of Balb-c mice at seven developmental stages ranging from 18 days post conception (p.c.) to 8 weeks after birth. Nine horseradish-peroxidase-conjugated lectins (concanavalin A, Triticum vulgaris, Dolichus biflorus, Helix pomatia, Arachis hypogaea, Glycine maximus, Lotus tetragonolobus, Ulex europaeus, Limulus polyphemus) were applied to 5- to 7-microns thin paraffin sections of Bouin-fixed tissue. After DAB staining the sections were evaluated by light microscopy. It was shown that each lectin exhibits a unique developmental pattern. The adult binding patterns were established at the age of 3-4 weeks with only minor changes occurring thereafter. Considerable differences in binding patterns occurred not only between lectins of different groups but also between lectins with the same nominal monosaccharide specificity.

  14. Vicia faba L.

    African Journals Online (AJOL)

    user

    2011-02-07

    Feb 7, 2011 ... Haciseferogullari H, Gezer I, Bahtiyarca Y, Menges HO (2003). Determination of some chemical and physical properties of sakis faba bean (Vicia faba L. var. major). J. Food .Eng. 60: 475-479. Hanelt P, Mettin D (1989). Biosystematics of the Genus vicia L. (Leguminosae). Annu. Rev. Ecol. Syst. 20: 199-223.

  15. Histochemical investigations on lectin binding in normal and irradiated mouse embryos

    Energy Technology Data Exchange (ETDEWEB)

    Nievergelt-Egido, M.C.; Michel, C. (Zurich Univ. (Switzerland). Inst. for Medical Radiobiology); Schmahl, W. (GSF-Inst. fuer Pathologie, Neuherberg (Germany))

    1993-04-01

    Lectin binding in normal and irradiated embryonic mouse tissues on day 10 of gestation was studied by peroxidase techniques. Specific binding of Dolichos biflorus lectin (DBA) was detected in the mesodermal blood vessels and in the otic vesicles. The amount of DBA as well as that of soybean agglutinin (SBA) and peanut agglutinin (PNA) increased after exposure to low doses of radiation (0.25, 0.50 and 0.75 Gy). The modifying influence of ionizing radiation was observed in the pituitary region, in the otic vesicles and in the blood vessel endothelium. The greatest effect appeared in the pituitary region at 0.75 Gy, while in the otic vesicles it appeared at 0.50 Gy. A dose-effect relationship was established for the DBA lectin affinity of the vascular endothelium. In comparison to DBA, SBA and PNA displayed more extensive staining after irradiation. The reactivity of these lectins appeared especially pronounced on the blood vessels within the central nervous system and in the luminal surface of the ependymal cells. It is of interest that maximal binding for PNA was observed at 0.25 Gy and for SBA at 0.50 Gy at the junctions between neuroepithelial cells. (orig.).

  16. Ulex Europeus Agglutinin (UEA-I) lectin binding in breast carcinoma and its relationship to prognostic factors.

    Science.gov (United States)

    Erhan, Y; Alkanat, M B; Akyildiz, M; Icoz, G; Yilmaz, R; Erhan, Y

    1996-09-01

    In this study, lectin binding was compared with pathological prognostic factors and clinical follow-up details. Formalin-fixed, paraffin-embedded tissues from 43 cases of breast carcinoma were studied for binding with Ulex Europeus Agglutinin (UEA-I) lectin. Staining results were compared with tumor size, histologic and nuclear grade, lymph node status (number, capsular and pericapsular invasion), blood and lymphatic vessel invasion, ER and PR status, clinical stage and the patients' short-term follow-up details. Analysis of staining with UEA-I showed a significant relationship with blood vessel invasion (P < 0.01) and lymphatic vessel invasion (P < 0.05). Furthermore, PR showed a significant inverse correlation with lectin binding (P < 0.05). Staining with UEA-I related significantly with axilliary lymph node metastases (P < 0.05). UEA-I was positive in four (66.6%) out of six cases with distant organ mestastasis. This study confirms that, in breast cancer, lectin binding to the cancer cells can be a reliable indicator for axilliary metastases, and the need for additional therapeutic interventions.

  17. Lectin binding to extracellularly melanized microfilariae of Brugia malayi from the hemocoel of Anopheles quadrimaculatus.

    Science.gov (United States)

    Nayar, J K; Mikarts, L L; Chikilian, M L; Knight, J W; Bradley, T J

    1995-11-01

    Binding patterns of fluorescein isothiocyanate (FITC)- and gold-conjugated lectins to extracellularly melanized sheathed and exsheathed microfilariae of subperiodic Brugia malayi, isolated from and in situ in the abdominal hemocoel of Anopheles quadrimaculatus 72-hr postinfection, were examined. Five FITC-conjugated lectins [Helix pomatia agglutinin (HPA), Arachis hypogaea (peanut agglutinin-PNA), Triticum vulgaris (wheat germ agglutinin-WGA), Lens culinaris (lentil-LCH), and Concanavalin A (Con A)] with specificities for different carbohydrate moieties were tested for binding to isolated melanized microfilariae and observed with transmitted light and fluorescence microscopy. All five FITC-lectins bound strongly to the acellular material accompanying the melanin deposits on the surface of isolated melanized microfilariae. Significant inhibition of FITC-lectin binding occurred when lectins were preincubated with their complementary carbohydrates before testing. H. pomatia agglutinin binding was totally inhibited by N-acetyl-D-glucosamine and N-acetyl-D-galactosamine. Other lectins were partially inhibited, such as PNA by galactose and lactose; WGA by N-acetylneuraminic acid; LCH by N-acetyl-D-glucosamine, mannose, glucose, and methyl alpha-D-mannopyranoside; and Con A by mannose and methyl alpha-D-mannopyranoside. Three gold-conjugated lectins (HPA, PNA, and Con A), examined by using transmission electron microscopy, bound to the outer surface of the acellular material associated with the melanin deposits on isolated melanized microfilarial sheaths and melanized microfilariae and to the remnants of lysed hemocytes found in the proximity of the melanized deposits. Con A in the presence of gold-labeled horseradish peroxidase, examined by using transmission electron microscopy, showed random binding within the melanized capsule formed around the microfilarial sheath in situ. These results indicate that the acellular material accompanying melanin deposits on melanized

  18. Lectin-binding patterns of small lymphocytes in bone marrow, thymus and spleen: Demonstration of lymphocyte subsets by quantitaive radioautography

    Energy Technology Data Exchange (ETDEWEB)

    Saveriano, N.; Drinnan, M.; Santer, V.; Osmond, D.G.

    1981-11-01

    Cells from mouse bone marrow, thymus and spleen were exposed to /sup 125/I-labeled concanavalin A (Con A), Lens culinaris lectin (LCL), soybean agglutinin (SBA), Hignoreomatia agglutinin (HPA), phytohemagglutinin-P (PHA-P), peanut agglutinin (PNA), or wheat germ agglutinin (WGA) in a range of concentrations and examined radioautographically. Small lymphocytes in the three organs differed in the minimal concentration of each lectin which gave detectable surface labeling, while at optimal lectin concentrations, their labeling intensity profiles differed markedly. Inhibition by sugars demonstrated the labeling specificity. Major populations of bone marrow small lymphocytes bound WGA strongly, while Con A, SBA, HPA, PHA-P and LCL were bound only weakly, and PNA binding was lacking. Most thymus cells bound Con A, SBA, HPA, PHA-P and PNA strongly. WGA and LCL weakly. Subsets of bone marrow and thymus small lymphocytes differed from the major populations in their lectin-binding intensities. Spleen small lymphocytes were heterogeneous in the binding of each lectin. However, a major population bound LCL exceptionally strongly, while few cells bound PNA. Using a panel of lectins under standardized conditions, these studies show distinctive lectin-binding patterns for small lymphocytes in the bone marrow, thymus and spleen, resepctively. Major and minor cell populations are distinguishable in each organ, providing an approach to discriminating lymphocyte lineages, subtypes and differentiation stages.

  19. Vicia faba L.

    African Journals Online (AJOL)

    Buzayehu

    Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of ..... of the isolates were utilized all amino acids sources.

  20. Lectin-binding assays for the isoforms of human erythropoietin: comparison of urinary and four recombinant erythropoietins.

    Science.gov (United States)

    Storring, P L; Tiplady, R J; Gaines Das, R E; Rafferty, B; Mistry, Y G

    1996-09-01

    Assays have been developed for the isoforms of erythropoietin (EPO) based on their binding to eight different lectins. These assays were used to compare the isoform compositions of two preparations of human urinary EPO (uEPO) and four preparations of recombinant DNA-derived human EPO (rEPO), which had been shown to differ in their biological and immunological properties and in their isoform composition as judged by isoelectric focusing and electrophoresis. Agarose-bound Ricinus communis agglutinin I (RCA), Erythrina cristagalli agglutinin (ECA), Maackia amurensis leukoagglutinin (MAL), Sambucus nigra agglutinin (SNA), Lycopersicon esculentum agglutinin (LEA), concanavalin A (Con A), Phaseolus vulgaris agglutinin-L4 (L-PHA) and Agaricus bisporus agglutinin (ABA) were used to bind EPO isoforms possessing: N-glycans containing non-sialylated outer Gal beta 1-4GlcNAc (RCA and ECA), NeuAc alpha 2-3Gal beta 1-4GlcNAc (MAL), NeuAc alpha 2-6Gal (SNA), or repeating Gal beta 1-4GlcNAc sequences (LEA); biantennary N-glycans (Con A); tetraantennary and 2,6-branched triantennary N-glycans (L-PHA); and O-glycans containing NeuAc alpha 2-6GalNAc (SNA) and Gal beta 1-3GalNAc (ABA). Free EPO was measured by mouse spleen cell bioassay or immunoassay. Estimates from most lectin-binding assays were reproducible between assays and batches of lectin-agarose, although batches of MAL- and ABA-agarose, and to a lesser extent LEA-agarose, differed in their EPO-binding. Lectin-binding assays showed differences between the isoform compositions of all EPOs, including the two Chinese hamster ovary cell-derived rEPOs, with RCA- and ECA-binding assays being the most discriminating. Lectin-binding estimates provided evidence that uEPO differs from these rEPOs in its lower content of isoforms with biantennary N-glycans and higher content of those with multiantennary N-glycans, and in its lower content of isoforms with N-glycans possessing repeating Gal beta 1-4GlcNAc sequences and of those with O

  1. Lectin binding profiles of SSEA-4 enriched, pluripotent human embryonic stem cell surfaces

    Directory of Open Access Journals (Sweden)

    Shin Soojung

    2005-07-01

    Full Text Available Abstract Background Pluripotent human embryonic stem cells (hESCs have the potential to form every cell type in the body. These cells must be appropriately characterized prior to differentiation studies or when defining characteristics of the pluripotent state. Some developmentally regulated cell surface antigens identified by monoclonal antibodies in a variety of species and stem cell types have proven to be side chains of membrane glycolipids and glycoproteins. Therefore, to examine hESC surfaces for other potential pluripotent markers, we used a panel of 14 lectins, which were chosen based on their specificity for a variety of carbohydrates and carbohydrate linkages, along with stage specific embryonic antigen-4 (SSEA-4, to determine binding quantitation by flow cytometry and binding localization in adherent colonies by immunocytochemistry. Results Enriching cells for SSEA-4 expression increased the percentage of SSEA-4 positive cells to 98–99%. Using enriched high SSEA-4-expressing hESCs, we then analyzed the binding percentages of selected lectins and found a large variation in binding percentages ranging from 4% to 99% binding. Lycopersicon (tomatoesculetum lectin (TL, Ricinus communis agglutinin (RCA, and Concanavalin A (Con A bound to SSEA-4 positive regions of hESCs and with similar binding percentages as SSEA-4. In contrast, we found Dolichos biflorus agglutinin (DBA and Lotus tetragonolobus lectin (LTL did not bind to hESCs while Phaseolus vulgaris leuco-agglutinin (PHA-L, Vicia villosa agglutinin (VVA, Ulex europaeus agglutinin (UEA, Phaseolus vulgaris erythro-agglutinin (PHA-E, and Maackia amurensis agglutinin (MAA bound partially to hESCs. These binding percentages correlated well with immunocytochemistry results. Conclusion Our results provide information about types of carbohydrates and carbohydrate linkages found on pluripotent hESC surfaces. We propose that TL, RCA and Con A may be used as markers that are associated with the

  2. Lectin binding as a probe of proliferative and differentiative phases in primary monolayer cultures of cutaneous keratinocytes

    Energy Technology Data Exchange (ETDEWEB)

    Ku, W.W.; Bernstein, I.A. (Univ. of Michigan, Ann Arbor (USA))

    1988-04-01

    The surface of cells in the cutaneous epidermis of the newborn rat exhibits a discrete change in lectin-binding specificity from Griffonia simplicifolia I-B4 (GS I-B4), specific for {alpha}-D-galactosyl residues, to Ulex europeus agglutinin I (UEA), specific for {alpha}-L-fucose, as the cell leaves the basal layer and differentiates. Primary monolayer cultures of rat keratinocytes maintained in low Ca{sup 2+} medium exhibited a characteristic unimodal pattern in the ratio of bound UEA to bound GS I-B4 (UEA/B4 ratio) over a 7-day culture period as determined by a quantitative fluorometric assay. Estimation of DNA synthesis showed (a) a higher ({sup 3}H)thymidine incorporation when the UEA/B4 ratio was low and (b) a steady but lower incorporation between Days 3 and 4, coincident with the higher UEA/B4 ratio. Autoradiographic results further showed that cells stained intensely with UEA failed to incorporate ({sup 3}H)thymidine into their nuclei. Overall, the results suggest that (a) the increase in the UEA/B4 ratio between Days 2 and 4 reflects the progression of a proportion of the cells in the monolayer to an early spinous cell stage, the ultimate fate of which is desquamation into the medium and (b) the decrease in the UEA/B4 ratio between Days 5 and 7 reflects a consequent proliferative response to this loss of cells.

  3. Impact of bacterial vaginosis, as assessed by nugent criteria and hormonal status on glycosidases and lectin binding in cervicovaginal lavage samples.

    Directory of Open Access Journals (Sweden)

    Bernard J Moncla

    Full Text Available The objective of this study was to evaluate the impact of hormonal status and bacterial vaginosis (BV on the glycosidases present and glycosylation changes as assessed by lectin binding to cervicovaginal lavage constituents. Frozen cervicovaginal lavage samples from a completed study examining the impact of reproductive hormones on the physicochemical properties of vaginal fluid were utilized for the present study. In the parent study, 165 women were characterized as having BV, intermediate or normal microflora using the Nugent criteria. The presence of glycosidases in the samples was determined using quantitative 4-methyl-umbelliferone based assays, and glycosylation was assessed using enzyme linked lectin assays (ELLA. Women with BV had elevated sialidase, α-galactosidase, β-galactosidase and α-glucosidase activities compared to intermediate or normal women (P<0.001, 0.003, 0.006 and 0.042 respectively. The amount of sialic acid (Sambucus nigra, P = 0.003 and high mannose (griffithsin, P<0.001 were reduced, as evaluated by lectin binding, in women with BV. When the data were stratified according to hormonal status, α-glucosidase and griffithsin binding were decreased among postmenopausal women (P<0.02 when compared to premenopausal groups. These data suggest that both hormonal status and BV impact the glycosidases and lectin binding sites present in vaginal fluid. The sialidases present at increased levels in women with BV likely reduce the number of sialic acid binding sites. Other enzymes likely reduce griffithsin binding. The alterations in the glycosidase content, high mannose and sialic acid binding sites in the cervicovaginal fluid associated with bacterial vaginosis may impact susceptibility to viruses, such as HIV, that utilize glycans as a portal of entry.

  4. Distribution of Glycan Motifs at the Surface of Midgut Cells in the Cotton Leafworm (Spodoptera littoralis Demonstrated by Lectin Binding

    Directory of Open Access Journals (Sweden)

    Tomasz Walski

    2017-12-01

    Full Text Available Glycans are involved in many biological phenomena, including signal transduction, cell adhesion, immune response or differentiation. Although a few papers have reported on the role of glycans in the development and proper functioning of the insect midgut, no data are available regarding the localization of the glycan structures on the surface of the cells in the gut of insects. In this paper, we analyzed the spatial distribution of glycans present on the surface of the midgut cells in larvae of the cotton leafworm Spodoptera littoralis, an important agricultural pest insect worldwide. For this purpose, we established primary midgut cell cultures, probed these individual cells that are freely suspended in liquid medium with a selection of seven fluorescently labeled lectins covering a range of different carbohydrate binding specificities [mannose oligomers (GNA and HHA, GalNAc/Gal (RSA and SSA, GlcNAc (WGA and Nictaba and Neu5Ac(α-2,6Gal/GalNAc (SNA-I], and visualized the interaction of these lectins with the different zones of the midgut cells using confocal microscopy. Our analysis focused on the typical differentiated columnar cells with a microvillar brush border at their apical side, which are dominantly present in the Lepidopteran midgut and function in food digestion and absorption, and as well as on the undifferentiated stem cells that are important for midgut development and repair. Confocal microscopy analyses showed that the GalNAc/Gal-binding lectins SSA and RSA and the terminal GlcNAc-recognizing WGA bound preferentially to the apical microvillar zone of the differentiated columnar cells as compared to the basolateral pole. The reverse result was observed for the mannose-binding lectins GNA and HHA, as well as Nictaba that binds preferentially to GlcNAc oligomers. Furthermore, differences in lectin binding to the basal and lateral zones of the cell membranes of the columnar cells were apparent. In the midgut stem cells, GNA and

  5. Lectin binding by trypanosoma equiperdum.

    Science.gov (United States)

    Jackson, P R

    1977-02-01

    Agglutination studies with 6 plant lectins indicated that the unaltered surface coat of Trypanosoma equiperdum isolated from rat blood lacks the carbohydrate molecules preferentially bound by these proteins. However, trypsin, pronase, chymopapain, or papain treatments exposed the binding sites for Concanavalin A and the phytohemagglutinins M and P and trypsinized cells were attached to Concanavalin A immobilized on agarose beads. Lipolytic, amylytic, and other proteolytic enzymes or other agents did not reduce or induce lectin agglutination and wheat germ, Anti A, and Anti H lectins did not clump the trypanosomes under any of the conditions employed. Carbohydrate residues resembling D-mannose or n-acetyl-D-galactosamine are therefore within the surface coat of T. equiperdum or on the cell membrane underneath it. The results are contrasted with the lectin induced agglutination of other parasite species and mammalian cells.

  6. ( Vicia peregrina ) seed as protein source for mirror carp ( Cyprinus ...

    African Journals Online (AJOL)

    An 80-day feeding trial was conducted in a recirculation system aquarium operating at 26 ± 0.3 °C, to evaluate the nutritive value of Vicia peregrina seed as a possible protein source in the diet of mirror carp (Cyprinus carpio) fingerlings. Vicia peregrina seed was included in the diets at different levels, viz. 100, 200, 300 g ...

  7. In vitro plant regeneration from Turkish Narbon Vetch (Vicia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-02-18

    Feb 18, 2009 ... containing peat moss and acclimatized in the greenhouse. Acclimatization was done by covering pots with polyethylene bags to maintain initial humidity for 1 .... Vicia L. In Davis PH (Ed.), Flora of Turkey and the East Aegean Islands. Edinburgh, Edinburgh University Press. 3: 274-325. Diallo MS, Ndiaye A, ...

  8. In vitro plant regeneration from Narbon Vetch ( Vicia narbonensis L ...

    African Journals Online (AJOL)

    Narbon vetch (Vicia narbonensis L.) is an agriculturally important forage plant that widely grows in an area extending from Central Europe to various parts of Asia. The study reports axillary shoot regeneration from cotyledonary node explants obtained from, in vitro raised seeds of 4 - 5 and 14 - 15 days old seedlings on MS ...

  9. Chemical composition and in vitro gas production of vetch ( Vicia ...

    African Journals Online (AJOL)

    Chemical composition and in vitro gas production of vetch (Vicia sativa) and some browse and grass species from northern Ethiopia were investigated. Vetch (fresh cut) was sampled in September and vetch hay samples were taken in October both during the early dry period. Samples of the browse and grass species were ...

  10. In vitro plant regeneration from Turkish Narbon Vetch ( Vicia ...

    African Journals Online (AJOL)

    Narbon vetch (Vicia narbonensis L.) is an important forage species among vetches of central Europe, Mediterranean, Near East, Ethiopia, central Asia and India. The study reports in vitro micropropagation of narbon vetch using cotyledon node, shoot tip and zygotic embryo explants on MS medium containing 0.25, 0.50, ...

  11. Lectin binding patterns and immunohistochemical antigen detection ...

    African Journals Online (AJOL)

    Ibrahim Eldaghayes

    2018-02-09

    Feb 9, 2018 ... María Andrea Fiorentino1,*, Fernando Alberto Paolicchi1, Carlos Manuel Campero1 and Claudio G. Barbeito2. 1INTA, Centro Regional Buenos Aires Sur, Estación Experimental Agropecuaria Balcarce, 7620 Balcarce,. Argentina. 2Cátedra de Histología y Embriología e Instituto de Patología, Facultad de ...

  12. Improvement of faba bean ( Vicia faba L .) yield and quality through ...

    African Journals Online (AJOL)

    Improvement of faba bean ( Vicia faba L .) yield and quality through biotechnological approach: A review. ... yield and quality. This review work examines the role of various techniques with reference to faba bean improvement. Key words: Vicia faba, faba bean, grain quality, resistance breeding, nitrogen fixation, zero tannin.

  13. Vicia vulcanorum (Fabaceae a new species from the island of Lanzarote (Canary Islands

    Directory of Open Access Journals (Sweden)

    Morales-Mateos, J. B.

    2012-12-01

    Full Text Available Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, a new species of subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. is described and illustrated from the island of Lanzarote, Canary Islands, north-west of Africa. It is related to and compared with Vicia cirrhosa C. Sm. ex Webb & Berthel. and Vicia filicaulis Webb & Berthel., two endemic species from the western and central group of the Canary Islands, and Vicia ferreirensis Goyder, an endemic species from Porto Santo Island, Madeira Archipelago.Se describe e ilustra Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, una nueva especie y endemismo de la isla de Lanzarote, Islas Canarias, perteneciente al subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. Se encuentra relacionada y es comparada con Vicia cirrhosa C. Sm. ex Webb & Berthel. y Vicia filicaulis Webb & Berthel., especies endémicas de las islas centrales y occidentales del archipiélago canario, y con Vicia ferreirensis Goyder, especie endémica de la isla de Porto Santo, en el archipiélago de Madeira.

  14. Observaciones cariológicas en Vicia amphicarpa sensu lato

    Directory of Open Access Journals (Sweden)

    Tardío Pato, F. Javier

    1998-12-01

    Full Text Available Cytological studies were carried out on twenty four amphicarpic wild populations of Vicia sativa group from different sites (19 from Spain, 4 from Syria and 1 from Turkey. Morphologically, 19 accessions can be attributed to taxon Dorthes and 5 to V. angustifolia subsp. pseudoangustifolia (Rouy Tardío, comb. nov. In our studies, these two taxa show different chromosome numbers, V. amphicarpa Dorthes, has 14 chromosomes, while V. angustifolia subsp. pseudoangustifolia has only 12. Furthermore, the form of the chromosomes in the karyotypes of both taxa is quite different. The chromosome number and the morphology of the karyotype found in the first taxon agree with most of previous reports on V. amphicarpa, with a very characteristic short metacentric and six acrocentric chromosomes, one of them satellited. However, the second taxon has a very different karyotype with three large chromosomes, one of them submetacentric and another satellited, plus another three chromosomes which are significantly smaller. Therefore, we can conclude that within the genus Vicia, at least two amphicarpic taxa exist, clearly differentiated, both in morphological and karyotypical characteristics.Se estudian cariológicamente 24 poblaciones anficárpicas silvestres pertenecientes al grupo Vicia sativa, de distinta procedencia (19 españolas, cuatro de Siria y una de Turquía. Se encuentran diferencias en los números cromosomáticos y en los cariótipos. Diecinueve poblaciones presentan 14 cromosomas y cariotipo como el observado por otros autores, constituido por un pequeño cromosoma metacéntrico y seis acrocéntricos, uno de ellos con satélite. Éstas corresponden a V. amphicarpa Dorthes. Las otras cinco, con 2n = 12 y cariotipo con tres cromosomas grandes, uno de ellos submetacéntrico, otro con satélite, y otros tres mucho más pequeños, corresponden a V. angustifolia subsp. pseudoangustifolia (Rouy Tardío. Esta anterior se propone como combinación nueva. Por

  15. [Studies on the chemical constitutens of Vicia amoena Fisch].

    Science.gov (United States)

    Wei, F; Yan, W M

    1997-10-01

    One new flavonoide was isolated from Vicia amoena Fisch. On the basis of spectral (UV, MS, NMR) and chemical reactions, it was elucidated to be kaempferol-3-O-beta-D-mannoside, named amoenin(A3). Moreover, five known compounds have been isolated and identified as quercetin, kaempferol, quercetin-3-O-alpha-L-rhamoside, quercetin-3-O-beta-D-glucoside, kaempferol-3, 7-O-alpha-L-dirhamoside. The total flavonoides showed significant effects on inducing hyperlipidemia and increasing micro-blood vessel elasticity.

  16. Rhizobium laguerreae sp. nov. nodulates Vicia faba on several continents.

    Science.gov (United States)

    Saïdi, Sabrine; Ramírez-Bahena, Martha-Helena; Santillana, Nery; Zúñiga, Doris; Álvarez-Martínez, Estela; Peix, Alvaro; Mhamdi, Ridha; Velázquez, Encarna

    2014-01-01

    Several fast-growing strains nodulating Vicia faba in Peru, Spain and Tunisia formed a cluster related to Rhizobium leguminosarum. The 16S rRNA gene sequences were identical to that of R. leguminosarum USDA 2370(T), whereas rpoB, recA and atpD gene sequences were phylogenetically distant, with sequence similarities of less than 96 %, 97 % and 94 %, respectively. DNA-DNA hybridization analysis showed a mean relatedness value of 43 % between strain FB206(T) and R. leguminosarum USDA 2370(T). Phenotypic characteristics of the novel strains also differed from those of the closest related species of the genus Rhizobium. Therefore, based on genotypic and phenotypic data obtained in this study, we propose to classify this group of strains nodulating Vicia faba as a novel species of the genus Rhizobium named Rhizobium laguerreae sp. nov. The type strain is FB206(T) ( = LMG 27434(T) = CECT 8280(T)).

  17. Mathematical modeling of biological growth for some Vicia faba varieties

    Science.gov (United States)

    Ionel, Samfira; Andreea, Ghica; Marius, Boldea; Monica, Butnariu; Marius, Sendroni; Andrei, M.-Kiss

    2013-10-01

    Vicia faba is one of the legume species of importance for human and animal nutrition. Over the past decade, the areas cultivated with this species have significantly increased. Given that the levels of the yield and quality obtained from this species depend largely on the specific soil and climate conditions, the present paper focuses on the study of the morpho-productive features under the conditions in Banat Plain, in the west of Romania. A collection of varieties and genetic lines was studied, with focus on the interdependence between plant height, characteristics of the foliage and in the end the foliar surface of the leaf and of the entire plant. The observations led to the conclusion that variety Melodie has the best response of biological growth on the plain.

  18. Words denoting faba bean (Vicia faba in European languages

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2011-01-01

    Full Text Available Faba bean (Vicia faba L took part in the 'agricultural revolution' of post-glacial Europe along with other grain legumes and cereals. In order to assess the diversity and the origin of the words denoting faba bean in the languages of Europe, a lexicological study was carried out with emphasis upon etymological dictionaries. The words in almost all modern Indo-European languages in Europe owe their origin to the Proto-Indo-European root *bhabh bhabhā, also denoting faba bean. The Proto-Altaic root *bŭkrV, denoting pea nut and cone, through the Proto-Turkic *burčak, denoting both pea and bean is responsible for the words in several modern Altaic languages of Europe while the others are borrowings from Arabic. The origin of the words in modern Caucasian languages is the Proto-Caucasian root *howł[ā], meaning both bean and lentil. The words in Uralic languages are either borrowings, mostly from Slavic, or derived from their own words denoting pea.

  19. Role of bioinoculants in development of salt-tolerance of Vicia faba ...

    African Journals Online (AJOL)

    Through biological inoculation technology, the bacterial-mycorrhizal-legume tripartite symbiosis in saline conditions was documented and the effects of dual inoculation with Azospirillum brasilense (NFB) and Arbuscular mycorrhizal (Am) fungus Glomus clarum on the host plants (Vicia faba) in pot cultures were investigated ...

  20. Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals

    NARCIS (Netherlands)

    Jansman, A.J.M.

    1993-01-01

    Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid

  1. On the presence of Vicia vicioides in Alicante

    Directory of Open Access Journals (Sweden)

    Pérez-Haase, A.

    2008-12-01

    Full Text Available Please read the Spanish version of this Abstract.

    En el presente trabajo se actualiza el conocimiento corológico de la leguminosa Vicia vicioides (Desf. Cout. en la provincia de Alicante, aportando información sobre cinco nuevas poblaciones, que se añaden a la única localidad conocida previamente.

  2. Construction of a comparative genetic map in faba bean (Vicia faba L.); conservation of genome structure with Lens culinaris

    National Research Council Canada - National Science Library

    Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P

    2008-01-01

    ... identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba...

  3. Synergistic interaction of Rhizobium leguminosarum bv. viciae and arbuscular mycorrhizal fungi as a plant growth promoting biofertilizers for faba bean (Vicia faba L.) in alkaline soil.

    Science.gov (United States)

    Abd-Alla, Mohamed Hemida; El-Enany, Abdel-Wahab Elsadek; Nafady, Nivien Allam; Khalaf, David Mamdouh; Morsy, Fatthy Mohamed

    2014-01-20

    Egyptian soils are generally characterized by slightly alkaline to alkaline pH values (7.5-8.7) which are mainly due to its dry environment. In arid and semi-arid regions, salts are less concentrated and sodium dominates in carbonate and bicarbonate forms, which enhance the formation of alkaline soils. Alkaline soils have fertility problems due to poor physical properties which adversely affect the growth and the yield of crops. Therefore, this study was devoted to investigating the synergistic interaction of Rhizobium and arbuscular mycorrhizal fungi for improving growth of faba bean grown in alkaline soil. A total of 20 rhizobial isolates and 4 species of arbuscular mycorrhizal fungi (AMF) were isolated. The rhizobial isolates were investigated for their ability to grow under alkaline stress. Out of 20 isolates 3 isolates were selected as tolerant isolates. These 3 rhizobial isolates were identified on the bases of the sequences of the gene encoding 16S rRNA and designated as Rhizobium sp. Egypt 16 (HM622137), Rhizobium sp. Egypt 27 (HM622138) and Rhizobium leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The best alkaline tolerant was R. leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The effect of R. leguminosarum bv. viciae STDF-Egypt 19 and mixture of AMF (Acaulospora laevis, Glomus geosporum, Glomus mosseae and Scutellospora armeniaca) both individually and in combination on nodulation, nitrogen fixation and growth of Vicia faba under alkalinity stress were assessed. A significant increase over control in number and mass of nodules, nitrogenase activity, leghaemoglobin content of nodule, mycorrhizal colonization, dry mass of root and shoot was recorded in dual inoculated plants than plants with individual inoculation. The enhancement of nitrogen fixation of faba bean could be attributed to AMF facilitating the mobilization of certain elements such as P, Fe, K and other minerals that involve in synthesis of nitrogenase and leghaemoglobin. Thus it is

  4. Induction of sister-chromatid exchanges in Vicia faba by arsenic-contaminated drinking water.

    Science.gov (United States)

    Gómez-Arroyo, S; Hernández-García, A; Villalobos-Pietrini, R

    1988-07-01

    Arsenic-contaminated drinking water from various towns of Comarca Lagunera, Coahuila, Mexico, was tested for its ability to induce sister-chromatid exchanges (SCE) in Vicia faba. 3-h treatments were applied and the differential staining technique of Tempelaar et al. (1982) was used. Atomic absorption spectrophotometry showed that the arsenic concentration in drinking water was 0.11-0.695 ppm, well over the maximum limit of 0.05 ppm (EPA, 1984). In all cases the SCE frequencies were significantly different from the controls. Some concentrations (0.2, 0.3, 0.5 and 1.0 ppm) of sodium arsenate (V) and potassium arsenite (III) were also applied to Vicia faba and all produced significant SCE frequencies, except 0.2 ppm of sodium arsenate.

  5. Isolation and biological activity of a new plant growth regulator of Vicia faba L

    Energy Technology Data Exchange (ETDEWEB)

    Sembdner, G.; Dathe, W.; Bergner, C.; Roensch, H. (Akademie der Wissenschaften der DDR, Halle/Saale. Inst. fuer Biochemie der Pflanzen)

    1983-01-01

    Jasmonic acid was identified as a plant growth inhibitor of the pericarp of Vicia faba by means of gas-liquid chromatography, high resolution mass spectrometry as well as /sup 1/H and /sup 13/C NMR. The highest level of jasmonic acid was reached during intensive pericarp growth. Jasmonic acid is a plant growth inhibitor possessing a relative activity in the wheat seedling bioassay of 1-2.5 % compared to ABA (=100%). Contrary to ABA, jasmonic acid does not cause retardation of leaf emergence. In the dwarf rice gibberellin bioassay relative low concentrations of jasmonic acid inhibit both autonomous and GA/sub 3/-stimulated growth. Jasmonic acid does not influence seed germination of Amaranthus caudatus. The possible physiological role of jasmonic acid in the Vicia pericarp and the distribution in plants of this new plant growth regulator type are discussed.

  6. Leaf traits associated with drought adaptation in faba bean (Vicia faba L.)

    OpenAIRE

    Khazaei, Hamid

    2014-01-01

    The potential for use of faba bean (Vicia faba L.) is increasing worldwide due to its positive environmental impact and nutritional interest, but there are many challenges for faba bean breeding and cultivation. These include its mixed breeding system, its unknown origin and wild progenitor, its large genome being the biggest diploid genome among field crops, and its relative sensitivity to biotic and abiotic stresses (e.g., drought). Little is known about the ecological adaptation of faba be...

  7. Combination of different methods for direct control of Vicia hirsuta in winter wheat

    OpenAIRE

    Lukashyk, P.; Köpke, U.

    2005-01-01

    Combinations of three different direct methods for controlling Vicia hirsuta (kainite application, flame weeding and harrowing) were investigated in field experiments. They were based on different strategies at early growth stages of V. hirsuta and standardised harrowing at late growth stages. The highest efficacy of kainite application and flame weeding was achieved at the one leaf stage of V. hirsuta. Winter wheat regeneration from damage caused by both kainite and thermal control was satis...

  8. Meiotic changes in Vicia faba L. subsequent to treatments of hydrazine hydrate and maleic hydrazide

    Directory of Open Access Journals (Sweden)

    Shaheen Husain

    2013-01-01

    Full Text Available Assessing the impact of mutagens for creating variations in crops like faba bean (Vicia faba L. is an important criterion in the contemporary world where food insecurity and malnutrition is alarming at the doors of various nations. Impact of two chemical mutagens viz. hydrazine hydrate (HZ and maleic hydrazide (MH on the two varieties (NDF-1 and HB-405 of Vicia faba were analysed in terms of meiotic behavior and pollen sterility. Since there are not enough data about the effect of these mutagens on the chromosomal behaviors of Vicia faba, this study presents the role of hydrazine hydrate and maleic hydrazide as well as various types of chromosomal aberrations in crop improvement. The lower concentration of mutagens showed less pollen sterility compared to the higher concentrations. Manipulation of plant structural component to induce desirable alternations provides valuable material for the breeders and could be used favorably for increasing mutation rate and obtaining a desirable spectrum of mutation in faba beans based on preliminary studies of cell division.

  9. Rhizobium anhuiense sp. nov., isolated from effective nodules of Vicia faba and Pisum sativum.

    Science.gov (United States)

    Zhang, Yu Jing; Zheng, Wen Tao; Everall, Isobel; Young, J Peter W; Zhang, Xiao Xia; Tian, Chang Fu; Sui, Xin Hua; Wang, En Tao; Chen, Wen Xin

    2015-09-01

    Four rhizobia-like strains, isolated from root nodules of Pisum sativum and Vicia faba grown in Anhui and Jiangxi Provinces of China, were grouped into the genus Rhizobium but were distinct from all recognized species of the genus Rhizobium by phylogenetic analysis of 16S rRNA and housekeeping genes. The combined sequences of the housekeeping genes atpD, recA and glnII for strain CCBAU 23252(T) showed 86.9 to 95% similarity to those of known species of the genus Rhizobium. All four strains had nodC and nifH genes and could form effective nodules with Pisum sativum and Vicia faba, and ineffective nodules with Phaseolus vulgaris, but did not nodulate Glycine max, Arachis hypogaea, Medicago sativa, Trifolium repens or Lablab purpureus in cross-nodulation tests. Fatty acid composition, DNA-DNA relatedness and a series of phenotypic tests also separated these strains from members of closely related species. Based on all the evidence, we propose a novel species, Rhizobium anhuiense sp. nov., and designate CCBAU 23252(T) ( = CGMCC 1.12621(T) = LMG 27729(T)) as the type strain. This strain was isolated from a root nodule of Vicia faba and has a DNA G+C content of 61.1 mol% (Tm).

  10. Stem anatomy of annual legume intercropping components: white lupin (Lupinus albus L., narbonne (Vicia narbonensis L. and common (Vicia sativa L. vetches

    Directory of Open Access Journals (Sweden)

    Lana Zoric

    2015-06-01

    Full Text Available The effect of intercropping on stem anatomy of both supporting (Lupinus albus and supported (Vicia narbonnensis and V. sativa annual forage legumes was investigated using stereological method. Intercropped plants showed minimal differences in volume densities (Vv of stem tissues and forage chemical composition compared to sole crops. The proportions of lignin and NDF (Neutral Detergent Fiber positively correlated with xylem Vv. The proportions of ADF (Acid Detergent Fiber, cellulose and ash in intercropped plants were increased or decreased mostly by less than 10% compared to those in pure stands. The Anatomical Equivalent Ratio (AER defined as the ratio based on anatomical quality-determining parameters, can assist in the evaluation of the benefits of specific intercropping systems. Intercropping of the legume species studied in this work, especially L. albus with V. sativa, showed encouraging results from anatomical perspective since it would not cause a decline of forage quality.

  11. Evaluation of Agricultural Use of Vicia sativa L. in Mercury Contaminated Soils; Evaluacion del Uso Agricola de Vicia sativa L. en Suelos Contaminados con Mercurio

    Energy Technology Data Exchange (ETDEWEB)

    Andres, A.; Millan, R.; Esteban, E.

    2010-03-08

    This study is framed in the project Recuperation de suelos contaminados por mercurio: recomendaciones de uso de suelos y plantas en la comarca minera de Almaden (REUSA), funded by Spanish Ministry of Education and Science. Moreover, this article is the result of the work carried out by Andres Andres for his Bachelors dissertation. Soils from the Almaden mining district are contaminated with high mercury concentrations, due to the extraction activities of that metal through the years. After the end of mining exploitation, which was the main source of wealth in the region, alternative uses of soils are needed in order to promote the socio-economic development of the studied area. The project here intends to evaluate the viability of the common vetch (Vicia sativa L.) crop in a substrate under similar conditions to the ones observed in the Almaden soils, by studying the mercury absorption capacity of the above mentioned species. (Author) 20 refs.

  12. Identification of protein secretion systems and novel secreted proteins in Rhizobium leguminosarum bv. viciae

    Directory of Open Access Journals (Sweden)

    Krehenbrink Martin

    2008-01-01

    Full Text Available Abstract Background Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Results Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP, a twin-arginine translocase (TAT secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP were generated, but only mutations affecting the PrsDE (Type I and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. Conclusion None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V is required for establishing the symbiosis with legumes. The PrsDE (Type I system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to

  13. Identification of protein secretion systems and novel secreted proteins in Rhizobium leguminosarum bv. viciae.

    Science.gov (United States)

    Krehenbrink, Martin; Downie, J Allan

    2008-01-29

    Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP), a twin-arginine translocase (TAT) secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP) were generated, but only mutations affecting the PrsDE (Type I) and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V) is required for establishing the symbiosis with legumes. The PrsDE (Type I) system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to the genes encoding the secretion system itself.

  14. Influence of salicylic acid on seed germination of Vicia faba L. under salt stress

    OpenAIRE

    Fatima Anaya; Rachid Fghire; Said Wahbi; Kenza Loutfi

    2018-01-01

    Seed germination is the critical stage for species survival. Salinity affects germination and seedling growth and yield of several crop species, such as broad bean. That is why this study was carried to evaluate the effects of NaCl on seed germination and influence of salicylic acid on seed in order to improving salt tolerant on broad bean. Vicia faba L. is an important pulse crop in the Mediterranean region. In many cases broad bean is grown on saline soils where growth and yield are limited...

  15. Genetic diversity and population structure of faba bean (Vicia faba) from Turkey

    OpenAIRE

    Göl, Şurhan; DOĞANLAR, Sami; FRARY, Anne

    2016-01-01

    Faba bean (Vicia faba L.) is an important food and feed legume because of the nutritional value of its seed protein and starch content, good biomass, and high efficiency nitrogen fixation.This study analyzed the molecular genetic diversity and population structure of 101 Turkish faba bean accessions using simple sequence repeat (SSR) markers.A total of 32 SSR markers yielded 281 loci of which 277 (98.6%) were polymorphic.Mean dissimilarity between genotypes was 0.355, a relatively high value ...

  16. Photosynthesis by Guard Cell Chloroplasts of Vicia faba L. : Effects of Factors Associated with Stomatal Movement

    OpenAIRE

    Weihua, WU; Sarah M., ASSMANN; The Biological Laboratories, Harvard University:(Current)Biology Department, Pennsylvania State University

    1993-01-01

    The properties of photosynthetic O_2 evolution by mesophyll cell chloroplasts (MCC) and guard cell chloroplasts (GCC) isolated from protoplasts of Vicia faba L. have been studied and effects on O_2 evolution of factors known to regulate stomatal movements have been compared. The O_2 evolution of GCC was CO_2-dependent. The saturating light intensity for O_2 evolution was between 150 and 200 μmol m^ s^ for MCC and was between 400 and 1,000μmol m^ s^ for GCC. Light quality (red vs. blue) had no...

  17. DmeRF system is required for nickel and cobalt resistance in Rhizobium leguminosarum bv. viciae.

    OpenAIRE

    Rubio Sanz, Laura; Prieto Carbajo, Rosa Isabel; Palacios Alberti, Jose Manuel; Brito Lopez, Maria Belen

    2013-01-01

    A member of the Cation Diffusion Facilitator (CDF) family with high sequence similarity to DmeF (Divalent metal efflux) from Cupridavirus metallidurans was identified in Rhizobium leguminosarum bv. viciae UPM1137. The R. leguminosarum dmeF mutant strain was highly sensitive to Co2+ and moderately sensitive to Ni2+, but its tolerance to other metals such as Zn2+, Cu2+ or Mn2+ was unaffected. An open reading frame located upstream of R. leguminosarum dmeF, designated dmeR, encodes a protein hom...

  18. SYMBIOTIC EFFECTIVENESS OF RHIZOBIUM LEGUMINOSARUM BV. VICIAE WITH PEA PLANTS AS INFLUENCED BY AZOTOBACTER CHROOCOCCUM

    OpenAIRE

    Stefan Martyniuk; Monika Kozieł; Anna Gałązka

    2015-01-01

    The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv) in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv) i...

  19. Survey the Effect of Oil Pollution on Morphological Characteristics in Faba Vulgaris and Vicia Ervilia

    Directory of Open Access Journals (Sweden)

    B. Lorestani

    2012-11-01

    Full Text Available Pollution results when a change in the environment harmfully affects the quality of human life including effect on animals, microorganisms and plants. Among the broad range of organic pollutants contaminating soil-water environment, polycyclic aromatic hydrocarbons are of great environment concern. Oil contaminated soil will affect germination, plant height, leaf area and biomass production. The aim of this research was to elucidate effects of oil pollution on morphological characteristics in Fabaceae family. For this purpose species of Faba vulgaris and Vicia ervilia were planted in different concentrations of oil in soil. For morphological studies, studied species were removed from polluted and non polluted soils separately and some morphological characters were studied in these species, then these characters were compared in plants, collected from polluted and non polluted soil. Finally, the level of significance of these differences was elucidated by using of SPSS. Obtained results showed that oil pollution can cause some abnormalities in structure of vegetative parts in plants grown on polluted soils. Decreasing of plant length and stem diameter and changing the leaf shape was among the most important effects of oil on morphological characteristics in Faba vulgaris and Vicia ervilia.

  20. [Effect of soil compaction on Vicia faba of growth in the Loess Plateau].

    Science.gov (United States)

    Nan, Zhibiao; Zhao, Hongyang; Nie, Bin

    2002-08-01

    The effect of soil compaction on the growth of Vicia faba was studied by pot experiment, field plot experiment, and farmers' field production during two consecutive years. The results showed that increasing soil bulk density at 0-7 cm depth significantly decreased the root and shoot dry weight per plant, increased plant mortality caused by Fusarium species, and decreased seed yields. Field experiments indicated that compared to the plants grown on the plots with soil bulk density of 1.55 and 1.64 g.cm-3, the root and shoot dry weight of plants grown on the plots with soil bulk density of 1.84 g.cm-3 decreased by 30.8% and 27.9%, respectively, while the plant mortality rate increased by 21.0-48.7%, and seed yields decreased by 19.8%. The trials conducted on eight farmers' land illustrated that there existed significant negative correlations between soil bulk density in Spring and root and shoot dry weight of Vicia faba seedlings, and between soil bulk density in Autumn and seed yields. The causes of high soil compaction were discussed, and suggestions for improving soil quality were presented.

  1. Changes Germination, Growth and Anatomy Vicia ervilia in Response to Light Crude Oil Stress

    Directory of Open Access Journals (Sweden)

    Bahareh Lorestani

    2014-05-01

    Full Text Available Thepetroleum concentrations are contaminant important sources in the environment. Hydrocarbon’s contaminants depend on their type and concentration can cause variable toxicity in soils, on the other hand, different kinds of plants also response concentration of contaminant differently, because of the diversity of physiological and morphological characteristics. In this study the effect of different concentrations of light crude oil was investigated on stem length, germination and anatomical of Vicia ervilia. A factorial experiment was used with a randomized complete block design (RCBD with three replications. The results showed that the germination and stem lengths decreased significantly (p≤ 0.05 with increasing concentrations of petroleum. Anatomical studies the changes of parenchyma, vascular bundles, epidermal and increase crack showed.

  2. Vicia faba Hypersensitivity and ASA Intolerance in a Farmer: A Case Report

    Directory of Open Access Journals (Sweden)

    Elisabetta Damiani

    2011-01-01

    Full Text Available The IgE-mediated allergic reactions to food are caused, generally, by ingestion. However, they can be rarely induced by exposure to airborne food particles through the handling or the cooking. Vicia faba is a vegetable which belongs to Legumes or Fabaceae family, Fabales order. Allergic reactions after ingestion of legumes and cases of asthma after exposure to the cooking vapors have been reported in the literature. A paper assessed the volatile substances (insect repellents released by V. faba. The authors demonstrated that this plant produces several chemical substances, such as small quantities of methyl salicylate. We describe a case of occupational allergy, induced by handling during picking up of fresh broad beans, in a farmer with history of adverse reaction after eating the cooked and raw vegetable.

  3. Vicia Faba

    African Journals Online (AJOL)

    evaluate symbiotic characteristics between the crop and the rhizobia in major faba bean producing areas in Tigray ... Nodulation status of the field crops was poor except Ofla, D/Temben and Alaje districts. Though the ..... acknowledge Solomon Hishe and Biadglegn Desmisse for GIS data processing. 6. REFERENCE.

  4. vicia faba

    African Journals Online (AJOL)

    ABSTRACT: The failure of faba bean production in some regions of Semien. Shewa necessitated a research for a ... ppm) and potassium, a high concentration of calcium and magnesium, and a lower population density of .... Magnesium sulphate, 0.5g; Sodium chloride, 0.2g; Yeast extract, 0.1g;. Mannitol, 10g; Agar, 15.

  5. Vicia Faba

    African Journals Online (AJOL)

    the color of nodules (pink which is effective, white which is ineffective in nitrogen fixation). The variation in nodule number and color in turn induce variation in growth and yield of the host due to variation in fixed N (Lupwayi and Mkandawire, 1996; Amijee and Giller, 1998). Faba bean in association with rhizobia can fix up to ...

  6. Impact of dual inoculation with Rhizobium and PGPR on growth and antioxidant status of Vicia faba L. under copper stress.

    Science.gov (United States)

    Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli

    2015-04-01

    Plant-growth-promoting bacteria (PGPR) may help reduce the toxicity of heavy metals in plants in polluted environments. In this work, the effects of dual inoculation with Rhizobium and PGPR strains on the growth of Vicia faba grown under copper stress were assessed during hydroponic culture. Growth parameters, copper (Cu) accumulation and antioxidant enzyme activities were studied. Copper concentrations above 1mM damaged plant growth, but co-inoculation reduced its harmful effect. Co-inoculation of plants treated with 1mM Cu and 2mM Cu increased the dry weights as compared with Cu-treated and uninoculated plants. However, it decreased copper uptake up to 80% in the roots of 1-mM-Cu-treated plants as compared to non-inoculated control. Copper tolerance in Vicia faba is linked to the activity of antioxidant systems that are modulated by metal concentrations: both superoxide dismutase (SOD) and catalase (CAT) were higher in the presence of Cu; a lower Cu dose of 0.5mM stimulated ascorbate peroxidase (APX) and/or peroxidase (POX) activities in shoots and roots; however in nodules CAT appeared to be the main peroxidase in H2O2 scavenging. The 1mM Cu treatment enhanced SOD, CAT and APX activities in roots and only SOD and POX were activated in shoots. All enzyme activities were inhibited by inoculation of 2mM Cu. The effect of inoculation with copper-accumulating PGPRs and the status of the antioxidant enzyme system were linked to changes in the copper tolerance status of Vicia faba. Our results suggested that Vicia faba inoculation with Rhizobium and PGPR Enterobacter clocae and Pseudomonas sp. could help to alleviate copper stress under hydroponic conditions. This result should be tested under field conditions for soil fertilization and phytostabilisation purposes. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  7. Effect of fulvic acids on lead-induced oxidative stress to metal sensitive Vicia faba L. plant

    OpenAIRE

    Shahid, Muhammad; Dumat, Camille; Silvestre, Jérôme; Pinelli, Eric

    2012-01-01

    International audience; Lead (Pb) is a ubiquitous environmental pollutant capable to induce various morphological, physiological, and biochemical functions in plants. Only few publications focus on the influence of Pb speciation both on its phytoavailability and phytotoxicity. Therefore, Pb toxicity (in terms of lipid peroxidation, hydrogen peroxide induction, and photosynthetic pigments contents) was studied in Vicia faba plants in relation with Pb uptake and speciation. V. faba seedlings we...

  8. Soil genotoxicity assessment--results of an interlaboratory study on the Vicia micronucleus assay in the context of ISO standardization.

    Science.gov (United States)

    Cotelle, Sylvie; Dhyèvre, Adrien; Muller, Serge; Chenon, Pascale; Manier, Nicolas; Pandard, Pascal; Echairi, Abdelwahad; Silvestre, Jérôme; Guiresse, Maritxu; Pinelli, Eric; Giorgetti, Lucia; Barbafieri, Meri; Silva, Valéria C; Engel, Fernanda; Radetski, Claudemir M

    2015-01-01

    The Vicia micronucleus assay was standardized in an international protocol, ISO 29200, "Assessment of genotoxic effects on higher plants-Vicia faba micronucleus test," for soil or soil materials (e.g., compost, sludge, sediment, waste, and fertilizing materials). The aim of this interlaboratory study on the Vicia micronucleus assay was to investigate the robustness of this in vivo assay in terms of its applicability in different countries where each participant were asked to use their own seeds and reference soil, in agreement with the ISO 29200 standard. The ISO 29200 standard protocol was adopted for this study, and seven laboratories from three countries (France, Italy, and Brazil) participated in the study. Negative and positive controls were correctly evaluated by 100 % of the participants. In the solid-phase test, the micronucleus frequency (number of micronuclei/1,000 cells) varied from 0.0 to 1.8 for the negative control (i.e., Hoagland's solution) and from 5.8 to 85.7 for the positive control (i.e., maleic hydrazide), while these values varied from 0.0 to 1.7 for the negative control and from 14.3 to 97.7 for the positive control in the case of liquid-phase test. The variability in the data obtained does not adversely affect the robustness of the protocol assessed, on the condition that the methodology described in the standard ISO 29200 is strictly respected. Thus, the Vicia micronucleus test (ISO 29200) is appropriate for complementing prokaryotic or in vitro tests cited in legislation related to risk assessment of genotoxicity potential.

  9. Environmental impact of sunscreen nanomaterials: Ecotoxicity and genotoxicity of altered TiO{sub 2} nanocomposites on Vicia faba

    Energy Technology Data Exchange (ETDEWEB)

    Foltete, Anne-Sophie, E-mail: as.foltete@yahoo.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Masfaraud, Jean-Francois, E-mail: masfa@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Bigorgne, Emilie, E-mail: emilie.bigorgne@umail.univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Nahmani, Johanne, E-mail: Johanne.nahmani@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Chaurand, Perrine, E-mail: chaurand@cerege.fr [Centre Europeen de Recherches et d' Enseignement des Geosciences de l' Environnement (CEREGE), UMR 6635 CNRS/Aix-Marseille Universite, Europole de l' Arbois, 13545 Aix-en-Provence (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France)

    2011-10-15

    Mineral sunscreen nanocomposites, based on a nano-TiO{sub 2} core, coated with aluminium hydroxide and dimethicone films, were submitted to an artificial ageing process. The resulting Altered TiO{sub 2} Nanocomposites (ATN) were then tested in the liquid phase on the plant model Vicia faba, which was exposed 48 h to three nominal concentrations: 5, 25 and 50 mg ATN/L. Plant growth, photosystem II maximum quantum yield, genotoxicity (micronucleus test) and phytochelatins levels showed no change compared to controls. Oxidative stress biomarkers remained unchanged in shoots while in roots, glutathione reductase activity decreased at 50 mg ATN/L and ascorbate peroxidase activity decreased for 5 and 25 mg ATN/L. Nevertheless, despite the weak response of biological endpoints, ICP-MS measurements revealed high Ti and Al concentrations in roots, and X-ray fluorescence micro-spectroscopy revealed titanium internalization in superficial root tissues. Eventual long-term effects on plants may occur. - Highlights: > TiO{sub 2}-containing sunscreen nanocomposites were artificially aged. > Vicia faba was exposed 48 h to the alteration byproducts in liquid phase. > Few endpoints were modified significantly from control. > A clogging on the roots and titanium penetration in tissues were suspected. > Eventual long-term effects of the particles may occur. - Artificially aged TiO{sub 2}-containing sunscreen nanocomposites caused few damages to Vicia faba in 48 h exposure, but particles clogged on roots and Ti entered the root tissues.

  10. Taxonomic relationships in some Vicia species from Egypt, based on seed morphology and SDS-PAGE of seed proteins - doi: 10.4025/actascibiolsci.v35i4.19345

    Directory of Open Access Journals (Sweden)

    Kadry Nabeh Abdel Khalik

    2013-07-01

    Full Text Available The seed morphology and seed proteins of 11 Vicia taxa from Egypt were studied. Macro- and micro-morphological characters, including seed shape, color, size, hilum shape and seed sculpture were described and analyzed. The secondary sculpture of the cell wall varies from papillose in nearly all Vicia species to lophate in V. hirsuta. Further, the seed proteins of studied taxa were investigated by SDS-PAGE and 39 different bands were scored. The similarity analysis based on the SDS-PAGE profile and seed morphology was found to be a useful characteristic for the discrimination of Vicia species both on the subgeneric and the sectional levels. The present study did not acknowledge V. tetrasperma and V. hirsuta as subgenus Ervum. As a result, division of Vicia into two subgenera i.e. Vicia and Cracca, is supported.

  11. The Effect of Humic Acid on Nutrient Composition in Broad Bean (Vicia faba L. Roots

    Directory of Open Access Journals (Sweden)

    Sener AKINCI

    2009-12-01

    Full Text Available Humic acids promote the conversion of mineral nutrients into forms available to plants. It also stimulates seed germination and viability, and its main effect usually being more prominent in the roots. The objective of this study was to determine of the influence of humic acid on broad bean (Vicia faba L. cultivar �Eresen 87� on root growth and development as well as nutrient uptake, during investigation in a pot experiment. Treatment with leonardite, as humic acid source positively affected both germination and harvesting, enhancing root length and biomass. Humic acid (HA caused significant increase of fresh (RFW and dry (RDW weights by 30.1% and 56.6% of broad bean roots, respectively. Flame photometer and atomic absorption spectrophotometry analyses revealed that K content was major nutrient among the tested elements. Humic acid increased the contents of Na and K significantly. The content of Ca and Fe was not significantly increased whereas Cu, Mn and Zn content decreased under HA treatment.

  12. Near-infrared spectroscopy (NIRS evaluation and regional analysis of Chinese faba bean (Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Jiaojiao Wang

    2014-02-01

    Full Text Available To analyze the nutritional composition of faba bean (Vicia faba L. seed, estimation models were developed for protein, starch, oil, and total polyphenol using near infrared spectroscopy (NIRS. Two hundred and forty-four samples from twelve producing regions were measured in both milled powder and intact seed forms. Partial least squares (PLS regression was applied for model development. The model based on ground seed powder was generally superior to that based on the intact seed. The optimal seed powder-based models for protein, starch, and total polyphenol had coefficients of correlation (r2 of 0.97, 0.93 and 0.89, respectively. The relationship between nutrient contents and twelve producing areas was determined by two-step cluster analysis. Three distinct groupings were obtained with region-constituent features, i.e., Group 1 of high oil, Group 2 of high protein, and Group 3 of high starch as well as total polyphenol. The clustering accuracy was 79.5%. Moreover, the nutrition contents were affected by seeding date, longitude, latitude, and altitude of plant location. Cluster analysis revealed that the differences in the seed were strongly influenced by geographical factors.

  13. Molecular Diversity Assessment Using Sequence Related Amplified Polymorphism (SRAP Markers in Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Salem S. Alghamdi

    2012-12-01

    Full Text Available Sequence-related amplified polymorphism (SRAP markers were used to assess the genetic diversity and relationship among 58 faba bean (Vicia faba L. genotypes. Fourteen SRAP primer combinations amplified a total of 1036 differently sized well-resolved peaks (fragments, of which all were polymorphic with a 0.96 PIC value and discriminated all of the 58 faba bean genotypes. An average pairwise similarity of 21% was revealed among the genotypes ranging from 2% to 65%. At a similarity of 28%, UPGMA clustered the genotypes into three main groups comprising 78% of the genotypes. The local landraces and most of the Egyptian genotypes in addition to the Sudan genotypes were grouped in the first main cluster. The advanced breeding lines were scattered in the second and third main clusters with breeding lines from the ICARDA and genotypes introduced from Egypt. At a similarity of 47%, all the genotypes formed separated clusters with the exceptions of Hassawi 1 and Hassawi 2. Group analysis of the genotypes according to their geographic origin and type showed that the landraces were grouped according to their origin, while others were grouped according to their seed type. To our knowledge, this is the first application of SRAP markers for the assessment of genetic diversity in faba bean. Such information will be useful to determine optimal breeding strategies to allow continued progress in faba bean breeding.

  14. DNA Damage in Vicia faba by Exposure to Agricultural Soils from Tlaxcala, Mexico.

    Science.gov (United States)

    Juárez-Santacruz, L; García-Nieto, E; García-Gallegos, E; Romo-Gómez, C; Ortiz-Ortiz, E; Costilla-Salazar, R; Luna-Zendejas, H S

    2015-12-01

    The aim of this research was to quantify some POPs, such as p,p' DDT, p,p' DDE, and PCBs in agricultural soils of Tlaxcala, Mexico and evaluate their capacity for eliciting DNA damage, using Vicia faba as bioindicator. The values of ΣDDTs and ΣPCBs ranged from 8-24 to 118-26,983 µg/kg, respectively. The samples T1 (HQ = 9.3) and T2 (HQ = 53.9) showed concentrations of ΣPCBs higher than Canadian guidelines (SQGE = 500 µg/kg). The genotoxicity testing produced percentages of DNA fragmentation higher than negative control and statistically significant (p < 0.05), both in agricultural soils and organic extracts. The soils T2, T3, N4, and N5 showed a DICA from 2.6 to 3.1 times, statistically higher (p < 0.05) than negative control. In general, the agricultural soils have greater genotoxic capacity than the organic extracts, suggesting a potential risk to biota that depends upon this ecosystem.

  15. Metabolic responses in root nodules of Phaseolus vulgaris and Vicia sativa exposed to the imazamox herbicide.

    Science.gov (United States)

    García-Garijo, A; Tejera, N A; Lluch, C; Palma, F

    2014-05-01

    Alterations on growth, amino acids metabolism and some antioxidant enzyme activities as result of imazamox treatment were examined in determinate and indeterminate nodules, formed by Phaseolus vulgaris and Vicia sativa, respectively. Young seedlings of both legumes were inoculated with their respective microsymbionts and grown under controlled conditions. At vegetative growth, plants were treated with imazamox (250μM) in the nutrient solution and harvested 7days after. Imazamox was mainly accumulated in V. sativa where concentrations were more than six fold higher than those detected in P. vulgaris. Nodule dry weight and total nitrogen content were reduced by the herbicide treatment: the highest decrease of nodule biomass (50%) and nitrogen content (40%) were registered in V. sativa and P. vulgaris, respectively. The concentration of branched-chain amino acids (BCAA) did not change in neither determinate nor indeterminate nodules even though the acetohydroxyacid synthase activity decreased in root and nodules of both symbioses with the herbicide application. Based on this last result and taking into account that total free amino acids increased in roots but not in nodules of common vetch, a possible BCAA translocation from root to nodule could occur. Our results suggest that the maintenance of BCAA balance in nodule become a priority for the plant in such conditions. The involvement of activities glutathione-S-transferase, guaiacol peroxidase and superoxide dismutase in the response of the symbioses to imazamox are also discussed. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. N-(jasmonoyl)tyrosine-derived compounds from flowers of broad beans (Vicia faba).

    Science.gov (United States)

    Kramell, Robert; Schmidt, Jürgen; Herrmann, Gabriele; Schliemann, Willibald

    2005-09-01

    Two new amide-linked conjugates of jasmonic acid, N-[(3R,7R)-(-)-jasmonoyl]-(S)-dopa (3) and N-[(3R,7R)-(-)-jasmonoyl]-dopamine (5), were isolated in addition to the known compound N-[(3R,7R)-(-)-jasmonoyl]-(S)-tyrosine (2) from the methanolic extract of flowers of broad bean (Vicia faba). Their structures were proposed on the basis of spectroscopic data (LC-MS/MS) and chromatographic properties on reversed and chiral phases and confirmed by partial syntheses. Furthermore, tyrosine conjugates of two cucurbic acid isomers (7, 8) were detected and characterized by LC-MS. Crude enzyme preparations from flowers of V. faba hydroxylated both (+/-)-2 and N-[(3R,7R/3S,7S)-(-)-jasmonoyl]tyramine [(+/-)-4] to (+/-)-3 and (+/-)-5, respectively, suggesting a possible biosynthetic relationship. In addition, a commercial tyrosinase (mushroom) and a tyrosinase-containing extract from hairy roots of red beet exhibited the same catalytic properties, but with different substrate specificities. The conjugates (+/-)-2, (+/-)-3, (+/-)-4, and (+/-)-5 exhibited in a bioassay low activity to elicit alkaloid formation in comparison to free (+/-)-jasmonic acid [(+/-)-1].

  17. SYMBIOTIC EFFECTIVENESS OF RHIZOBIUM LEGUMINOSARUM BV. VICIAE WITH PEA PLANTS AS INFLUENCED BY AZOTOBACTER CHROOCOCCUM

    Directory of Open Access Journals (Sweden)

    Stefan Martyniuk

    2015-09-01

    Full Text Available The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv in the solid-carrier inoculant. In a pot experiment the highest number of nodules was detected on roots of pea plants inoculated with the dual-culture inoculant containing Rlv and A. chroococcum, slightly lower numbers on pea roots inoculated with the mono-culture inoculum of Rlv and almost no nodules were found on the roots of pea un-inoculated (control treatment with the bacteria. In the micro-plot experiment conducted in the years 2011–2012 pre-sowing inoculation of pea seeds with the mono-culture inoculant of Rlv or with the mixed inoculant of Rlv and A. chroococcum slightly increased nodule numbers/plant, pod numbers/plant and seed numbers/pod, as compared to the un-inoculated control, but these differences were not reflected in pea seed yields/m2, which were similar in all treatments.

  18. Genetic Diversity Assessment of Portuguese Cultivated Vicia faba L. through IRAP Markers

    Directory of Open Access Journals (Sweden)

    Diana Tomás

    2016-03-01

    Full Text Available Faba bean have been grown in Portugal for a long time and locally adapted populations are still maintained on farm. The genetic diversity of four Portuguese faba bean populations that are still cultivated in some regions of the country was evaluated using the Inter Retrotransposons Amplified Polymorphism (IRAP technique. It was shown that molecular markers based on retrotransposons previously identified in other species can be efficiently used in the genetic variability assessment of Vicia faba. The IRAP experiment targeting Athila yielded the most informative banding patterns. Cluster analysis using the neighbor-joining algorithm generated a dendrogram that clearly shows the distribution pattern of V. faba samples. The four equina accessions are separated from each other and form two distinct clades while the two major faba bean accessions are not unequivocally separated by the IRAP. Fluorescent In Situ Hybridization (FISH analysis of sequences amplified by IRAP Athila revealed a wide distribution throughout V. faba chromosomes, confirming the whole-genome coverage of this molecular marker. Morphological characteristics were also assessed through cluster analysis of seed characters using the unweighted pair group method arithmetic average (UPGMA and principal component analysis (PCA, showing a clear discrimination between faba bean major and equina groups. It was also found that the seed character most relevant to distinguish accessions was 100 seed weight. Seed morphological traits and IRAP evaluation give similar results supporting the potential of IRAP analysis for genetic diversity studies.

  19. Molecular tools for utilization of mitochondrial diversity in faba bean (Vicia faba

    Directory of Open Access Journals (Sweden)

    Aleksić Jelena M.

    2014-01-01

    Full Text Available We performed in silico PCR analyses utilizing complete mitochondrial (mtDNA genome sequences of faba bean (Vicia faba and two related species, Vigna angularis and Vigna radiata, currently available in GenBank, to infer whether 15 published universal primer pairs for amplification of all 14 cis-spliced introns in genes of NADH subunits (nad genes are suitable for V. faba and related species. Then, we tested via PCR reactions whether seven out of 15 primer pairs would generate PCR products suitable for further manipulation in 16 genotypes of V. faba representing all botanical varieties of this species (major, minor, equina and subsp. paucijuga of various levels of improvement (traditional and improved cultivars originating from Europe, Africa, Asia and south America. We provide new PCR primers for amplification of nad1 intron 2/3 in V. faba, and demonstrate intraspecific variability in primary nucleotide sequences at this locus. Based on outcomes of both in silico predictions and PCR amplification, we report a set of PCR primers for amplification of five introns in nad genes that are promising molecular tools for future phylogeographic and other studies in this species for which unambiguous data on wild ancestors, centre of origin and domestication are lacking. [Projekat Ministarstva nauke Republike Srbije, br. 173005

  20. Contenidos de taninos y caracterización molecular de variedades de haba (Vicia faba L.) cultivadas por agricultores.

    OpenAIRE

    Jordan Aguilar, Bladimir

    2011-01-01

    En México el haba (Vicia faba L.) es importante para la alimentación de los habitantes del medio rural y urbano, contiene un alto contenido nutritivo, es un alimento balanceado, asimismo en la actualidad los productores demandan variedades con mayor calidad de semilla. El rango en cuanto al contenido de taninos en las semillas de haba cultivadas por los agricultores fue determinado, se estimaron las relaciones entre las variedades de haba mediante la utilización de marcadores moleculares tipo...

  1. Ca2+-mediated remote control of reversible sieve tube occlusion in Vicia faba

    DEFF Research Database (Denmark)

    Furch, Alexandra C.U.; Hafke, Jens B.; Schulz, Alexander

    2007-01-01

    (EPWs), and is reversible in intact plants. The time-course of the wound response was studied in sieve elements of main veins of intact Vicia faba plants using confocal and multiphoton microscopy. Only 15-45 s after burning a leaf tip, forisomes (giant protein bodies specific for legume sieve tubes...... reversible; callose degraded over the subsequent 1-2 h. The heat induction of both modes of occlusion coincided with the passage of an EPW visualized by electrophysiology or the potential-sensitive dye RH-414. In contrast to burning, cutting of the leaf tip induced neither an EPW nor callose deposition...

  2. Systemic granulomatous disease in cattle in Rio Grande do Sul, Brazil, associated with grazing vetch (Vicia spp)

    OpenAIRE

    Barros, Claudio S.L.; Rafael A. Fighera; Daniela B. Rozza; Raquel R. Rech; Simone V. Sallis; Langohr, Ingeborg M.

    2001-01-01

    Dois surtos de uma doença associada ao pastoreio de duas espécies de ervilhaca (predominantemente Vicia villosa e, em menor grau, V. sativa) foram observados em agosto-setembro de 2001, em vacas Holandesas adultas de duas propriedades rurais do Rio Grande do Sul. Foram afetadas, em uma das propriedades, quatro de 42 vacas (9,5%) e, na outra, uma de oito vacas (12,5%). Os sinais clínicos incluíam, embora não em todos os casos, febre, prurido, espessamento e enrugamento da pele com placas multi...

  3. Determination of 4-Chloroindole-3-Acetic Acid Methyl Ester in Lathyrus Vicia and Pisum by Gas Chromatography - Mass Spectrometry

    DEFF Research Database (Denmark)

    Engvild, Kjeld Christensen; Egsgaard, Helge; Larsen, Elfinn

    1980-01-01

    4-Chloroindole-3-acetic acid methyl ester was identified unequivocally in Lathyrus latifolius L., Vicia faba L. and Pisum sativum L. by thin layer chromatography, gas chromatography and mass spectrometry. The gas chromatographic system was able to separate underivatized chloroindole-3-acetic acid...... methyl ester isomers. The quantitative determination of 4-chloroindole-3-acetic acid methyl ester in immature seeds of these three species was performed by gas chromatography – mass spectrometry using deuterium labelled 4-chloro-indole-3-acetic acid methyl ester as an internal standard. P. sativum...

  4. Genetic diversity of Palestine landraces of faba bean (Vicia faba) based on RAPD markers.

    Science.gov (United States)

    Basheer-Salimia, R; Shtaya, M; Awad, M; Abdallah, J; Hamdan, Y

    2013-09-03

    Until now, neither phenotypic nor molecular approaches have been used to characterize the landraces of Palestine faba beans (Vicia faba). We used PCR-based RAPD markers to determine the genetic diversity and relatedness among 26 Palestinian faba bean landraces (traditional farmers' varieties) from 8 localities in the West Bank, Palestine. In tests with 37 primers, 14 generated no polymorphic bands, 12 exhibited weak and unclear products, and 11 primers produced good amplification products with high intensity and pattern stability. Ninety-four DNA fragments (loci) were detected, with an average of 8.54 loci per primer and size ranging from 160 to 1370 bp. A minimum of 4 and a maximum of 14 DNA fragments were obtained using (OPA-05 and OPA-09) and (BC-261) primers, respectively. The maximum percentage of polymorphic markers was 71.4 (BC-298) and the minimum was 50.0 (OPA-05, -09, -16). The 11 primers exhibited relatively high collective resolving power (Rp) values of 26.316, and varied from 0.154 for the OPA-09 primer to 5.236 for the BC-261, with an overall mean of 2.392. The primers BC-261, -322, and -298 were found to be the most useful RAPD primers to assess the genetic diversity of Palestinian faba beans, as they revealed relatively high Rp rates (5.236, 3.618, and 3.150, respectively). Based on the Jaccard coefficient, the genetic distance ranged from 0.358 to 0.069, with a mean of 0.213. We conclude that the RAPD technique is useful for determining genetic diversity and for developing suitable fingerprints for faba bean landraces grown in Palestine.

  5. Oxidative stress and DNA damage in broad bean (Vicia faba L.) seedlings induced by thallium.

    Science.gov (United States)

    Radić, Sandra; Cvjetko, Petra; Glavas, Katarina; Roje, Vibor; Pevalek-Kozlina, Branka; Pavlica, Mirjana

    2009-01-01

    Thallium (Tl) is a metal of great toxicological concern because it is highly toxic to all living organisms through mechanisms that are yet poorly understood. Since Tl is accumulated by important crops, the present study aimed to analyze the biological effects induced by bioaccumulation of Tl in broad bean (Vicia faba L.) as well as the plant's antioxidative defense mechanisms usually activated by heavy metals. Thallium toxicity was related to production of reactive oxygen species in leaves and roots of broad bean seedlings following short-term (72 h) exposure to thallium (I) acetate (0, 0.5, 1, 5, and 10 mg/L) by evaluating DNA damage and oxidative stress parameters as well as antioxidative response. The possible antagonistic effect of potassium (K) was tested by combined treatment with 5 mg/L of Tl (Tl+) and 10 mg/L of potassium (K+) acetate. Accumulation of Tl+ in roots was 50 to 250 times higher than in broad bean shoots and was accompanied by increase in dry weight and proline. Despite responsive antioxidative defense (increased activities of superoxide dismutase, ascorbate peroxidase, and pyrogallol peroxidase), Tl+ caused oxidative damage to lipids and proteins as evaluated by malondialdehyde and carbonyl group levels, and induced DNA strand breaks. Combined treatment caused no oxidative alternations to lipids and proteins though it induced DNA damage. The difference in Tl-induced genotoxicity following both acellular and cellular exposure implies indirect DNA damage. Results obtained indicate that oxidative stress is involved in the mechanism of Tl toxicity and that the tolerance of broad bean to Tl is achieved, at least in part, through the increased activity of antioxidant enzymes.

  6. Lead-induced DNA damage in Vicia faba root cells: potential involvement of oxidative stress.

    Science.gov (United States)

    Pourrut, Bertrand; Jean, Séverine; Silvestre, Jérôme; Pinelli, Eric

    2011-12-24

    Genotoxic effects of lead (0-20μM) were investigated in whole-plant roots of Vicia faba L., grown hydroponically under controlled conditions. Lead-induced DNA damage in V. faba roots was evaluated by use of the comet assay, which allowed the detection of DNA strand-breakage and with the V. faba micronucleus test, which revealed chromosome aberrations. The results clearly indicate that lead induced DNA fragmentation in a dose-dependant manner with a maximum effect at 10μM. In addition, at this concentration, DNA damage time-dependently increased until 12h. Then, a decrease in DNA damages was recorded. The significant induction of micronucleus formation also reinforced the genotoxic character of this metal. Direct interaction of lead with DNA was also evaluated with the a-cellular comet assay. The data showed that DNA breakages were not associated with a direct effect of lead on DNA. In order to investigate the relationship between lead genotoxicity and oxidative stress, V. faba were exposed to lead in the presence or absence of the antioxidant Vitamin E, or the NADPH-oxidase inhibitor dephenylene iodonium (DPI). The total inhibition of the genotoxic effects of lead (DNA breakage and micronucleus formation) by these compounds reveals the major role of reactive oxygen species (ROS) in the genotoxicity of lead. These results highlight, for the first time in vivo and in whole-plant roots, the relationship between ROS, DNA strand-breaks and chromosome aberrations induced by lead. Copyright © 2011 Elsevier B.V. All rights reserved.

  7. Phytostabilization of moderate copper contaminated soils using co-inoculation of Vicia faba with plant growth promoting bacteria.

    Science.gov (United States)

    Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli

    2015-03-01

    There is a need to conduct research on the selection of microbial isolates from rhizosphere of plants growing on heavy metal contaminated soils for specific restoration programs. This article suggest a consortium of bacteria combining Rhizobium sp. CCNWSX0481, Rhizobium leguminosarum bv. viciae, Enterobacter cloacae and Pseudomonas sp. 2(2010) that was examined for the ability to promote Vicia faba.L. growth when cultivated on the vineyard of soil moderately contaminated with copper. Data showed that inoculation was significant in nodulation; it increases the number and the weight of nodules of 50%. Co-inoculation was also found to positively influence growth and seed yield, through increasing fresh shoot and fresh root weights by 33 and 26%, respectively, and through rising numbers of seed per pod and pods per plant. In contrast, co-inoculation produced a significant reduction of accumulated copper in roots attending 35%, however, the treatment revealed no significant effects on the copper contents in pods and seeds. The tested inoculum could be an option to promote V. faba growth and to enhance soil fertilization in moderate copper contaminated soils. Further studies on the influence of co-inoculation practices on copper migration in soil-plant systems are recommended to acquire more information for evaluation of this legume safety. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Competitive nodulation blocking of cv. Afghanistan pea is related to high levels of nodulation factors made by some strains of Rhizobium leguminosarum bv. viciae

    NARCIS (Netherlands)

    Hogg, B.; Davies, A.E.; Wilson, K.E.; Bisseling, T.; Downie, J.A.

    2002-01-01

    Cultivar Afghanistan peas are resistant to nodulation by many strains of Rhizobium leguminosarum bv. viciae but are nodulated by strain TOM, which carries the host specificity gene nodX. Some strains that lack nodX can inhibit nodulation of cv. Afghanistan by strain TOM. We present evidence that

  9. Growth of broiler chicks fed diets containing tannin-free and tannin-containing near-isogenic lines of Faba bean (Vicia Faba L.).

    NARCIS (Netherlands)

    Helsper, J.P.F.G.; Loon, van Y.P.J.; Kwakkel, R.P.; Norel, van A.; Poel, van der A.F.B.

    1996-01-01

    Seeds from six pairs of near-isogenic lines of Vicia faba L., each pair consisting of a tannin-free (TF) and a tannin-containing (TC) partner line, were used to study the effect of breeding for the absence of condensed tannins on the seed content of dry matter (DM), crude protein (CP), and starch

  10. Dietary effects of faba-bean (Vicia faba L.) tannins on the morphology and function of the small-intestinal mucosa of weaned pigs

    NARCIS (Netherlands)

    Leeuwen, P. van; Jansman, A.J.M.; Wiebenga, J.; Koninkx, J.F.J.G.; Mouwen, J.M.V.M.

    1995-01-01

    The objective of the present study was to evaluate effects of condensed tannins in faba beans (Vicia faba L.) on morphological and functional variables of the small-intestinal mucosa of piglets. In an experiment with young piglets (8-17 kg body weight), fed on either a control diet or a diet

  11. Nutritional response of growing rats to faba beans (Vicia faba L., minor) and faba bean fractions.

    Science.gov (United States)

    Rubio, L A; Grant, G; Bardocz, S; Dewey, P; Pusztai, A

    1991-11-01

    The effects of raw faba bean (Vicia faba L., minor) meal (VFM) and its fractions on the growth and nitrogen utilization of rats have been determined in two experiments. Two commercial varieties of VFM were tested, local VFM (409-439 g/kg diet) and Troy VFM (439 g/kg diet). The bean fractions tested were V. faba lectin-depleted protein (VFDP), V. faba lectin (VFL) and V. faba cotyledon residue (VFCR). All diets were supplemented with amino acids to target requirements. Body-weight, body N and lipid contents of rats fed on VFM were reduced significantly in comparison with control rats fed on lactalbumin. This was due, in part, to the lower digestibility of the protein, lipid and dry matter (DM) of VFM diets. As a result, net protein utilization (NPU) and biological value (BV) of faba bean proteins were less than expected. Urine and urea-N outputs of the VFM-fed rats were also elevated in both experiments. Increasing the energy content of local VFM diets led to significantly higher dry body-weight, body N and lipid contents, with the result that the NPU and BV values of the protein also increased. However, the NPU values for VFM-fed rats were still significantly lower than those for the controls in both experiments. In contrast, true N, lipid and DM digestibilities in rats given local VFM were not significantly affected by the difference in the energy content of the diets. The replacement of two-thirds of the lactalbumin in the diet with VFDP (65 g/kg) reduced dry body-weight, N and lipid contents, NPU and BV compared with the control rats, even though N, lipid and DM digestibilities were not significantly different. The nutritional performance of rats fed on lactalbumin-based diets containing 7 g VFL/kg was similar to that of the controls. Similarly, the inclusion of the cotyledon residue (237 g VFCR/kg diet) had no appreciable effect on any of the variables studied. As VFL and VFCR had no antinutritional effects in these rats, it appears that the low nutritional

  12. Influence of ionizing irradiation on the antioxidant enzymes of Vicia faba L.

    Directory of Open Access Journals (Sweden)

    El-Beltagi, Hossam E. S.

    2010-09-01

    Full Text Available The seeds of Vicia faba L. Giza 834 were exposed to γ-irradiation at dose levels of 2.5, 5.0, 10.0 and 20.0 kGy and after that exposed to He–Ne (632.8 nm or diode (650.0 nm laser irradiation for 5 min. The activities of POD, APOX, CAT, SOD and GST enzymes were significantly stimulated and this stimulation reached its maximum at a dose level of 5.0 kGy for enzymes POD, APOX, CAT and SOD, but for GST enzyme at a dose level 10.0 kGy. For He- Ne laser, with or without different doses (2.5, 5.0, 10.0 and 20.0 kGy of γ-irradiation, enzyme induction was significantly stimulated and positively correlated with the dose levels of γ-irradiation in combination with the He-Ne treatment. There was a significant increase in the concentration of MDA and this increase was more pronounced at dose level 20.0 kGy (38.2 μmol/g d.w compared to the control (3.9 μmol/g d.w. Laser treatment by He–Ne laser or diode laser only caused a slight increase (P 2O2 content significantly increased in all treatments and this increase reached its maximum at dose level 20.0 kGy (36.3 μmol/g d.w compared to the control (2.3 μmol/g d.w.. On the other hand, He-Ne or diode laser treatments combined with γ-irradiation significantly decreased in comparison with γ-irradiation treatments alone. In the case of glutathione content, there were significant increases by γ-irradiation at dose levels 2.5, 5.0, 10.0 and 20.0 kGy. Furthermore, with a combination of γ-irradiation and He-Ne or diode laser, a marked increase in glutathione content was found and was more pronounced than that of gamma irradiation alone.Semillas de Vicia faba L. Giza 834 fueron expuestas a γ-irradiación a dosis de 2.5, 5.0, 10.0 y 20.0 kGy y después expuesta a una radiación laser de He–Ne (632.8 nm o de diodo (650.0 nm durante 5 minutos. Las actividades de las enzimas POD, APOX, CAT, SOD y GST fueron favorecidas significativamente, y éstas alcanzaron un máximo a una dosis de 5.0 kGy para las enzimas

  13. Granulomatous myelitis associated with hemorrhagic syndrome due to consumption of Vicia villosa by cattle Mielite granulomatosa associada à síndrome hemorrágica devido ao consumo de Vicia villosa em um bovino

    Directory of Open Access Journals (Sweden)

    Luciana Sonne

    2010-08-01

    Full Text Available An unusual case of spontaneous Vicia villosa poisoning affected a 6-year-old Holstein cow. Although the most striking findings included a generalized hemorrhagic condition associated with granulomatous myelitis, histological lesions typically seen with the vetch-associated systemic granulomatous syndrome were also present. Prominent gross findings were bloody nasal and oral discharges, disseminated hemorrhages, and bloody feces. Generalized hemorrhages associated with infiltration of numerous organs by lymphocytes, plasma cells, macrophages, multinucleated giants cells, and eosinophils were the main microscopic findings. Anti-CD68 immunostaining confirmed the presence of moderate histiocytic infiltrate and multinucleated giant cells in the bone marrow. These changes in the bone marrow probably caused the generalized hemorrhagic changes described here.Um bovino Holandês de seis anos naturalmente intoxicado pela Vicia villosa apresentou lesões não comumente encontradas nessa intoxicação. Embora a lesão mais evidente fosse hemorragia generalizada associada à mielite granulomatosa, as lesões granulomatosas típicas da intoxicação pela ervilhaca também estavam presentes histologicamente. Os principais achados macroscópicos foram hemorragias nasal e oral, hemorragias generalizadas e fezes com sangue. Lesões hemorrágicas generalizadas associadas com infiltrado inflamatório de linfócitos, plasmócitos, macrófagos, células gigantes multinucleadas e eosinófilos foram os principais achados microscópicos encontrados. O teste imuno-histoquímico anti-CD68 confirmou a presença de infiltrado moderado de macrófagos e de células gigantes multinucleadas na medula óssea. As alterações na medula óssea provavelmente constituem a causa da hemorragia generalizada descrita nesse caso.

  14. Sister chromatid exchanges in Vicia faba induced by arsenic-contaminated drinking water from Zimapan, Hidalgo, Mexico.

    Science.gov (United States)

    Gómez-Arroyo, S; Armienta, M A; Cortés-Eslava, J; Villalobos-Pietrini, R

    1997-11-27

    Sister chromatid exchanges (SCE) in Vicia faba root tips were used to examine well water containing high levels of arsenic. The increased amount of arsenic was contained in well water from different towns of Zimapan, Hidalgo, Mexico. Treatments of 3 h were applied followed by the differential staining technique of Tempelaar et al. (Mutation Res. 103 (1982) 321-326). Concentrations of arsenic from 0.267 up to 1.070 mg/l were determined by colorimetry in the polluted samples used for this study. These values were above the permissible limit of 0.05 mg/l in drinking water. In all cases, except one in which the As concentration was 0.021, the arsenic-contaminated water produced significant increases of SCE compared with the control (p Comarca Lagunera and the results observed in Zimapan.

  15. The digestibility in piglets of faba bean (Vicia faba L.) as affected by breeding towards the absence of condensed tannins.

    Science.gov (United States)

    Van der Poel, A F; Dellaert, L M; Van Norel, A; Helsper, J P

    1992-11-01

    Seed samples from two near-isogenic faba bean (Vicia faba L.) lines were examined for the levels of so-called anti-nutritional factors (ANF). From the ANF known to be present in faba beans, trypsin inhibitor activity, functional lectins, condensed tannins and pyrimidine glycosides were analysed. It was concluded that the lines differed only in the content of condensed tannins being 0.05). A multienzyme technique was used to predict the in vitro protein digestibility (IVPD) of the two lines. The IVPD of the LT line was 0.965 and about 0.05 higher than the HT line, confirming the difference in digestibility as measured in vivo. The present study shows the positive effects on digestibility of removal of condensed tannins in faba beans which was achieved by plant breeding.

  16. Ecogeographic variability and genetic diversity associated with seed albumins, globulins and prolamins patterns in Vicia taxa from Algeria.

    Science.gov (United States)

    Bechkri, Sakina; Medoukali, Imane; Khelifi, Douadi

    2017-12-01

    Genetic variability was studied in 78 populations of locally collected Vicia L. taxa for seed albumins, globulins and prolamins patterns by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) along with an ecogeographic characterization of sites investigated. 131, 119 and 98 bands were respectively used for albumin, globulin and prolamin cluster analysis. Dendrograms based on the Jaccard index and the UPGMA method were generated and the degree of genetic diversity between and within taxa was evaluated. Five clusters were generated from albumins, six from globulins and four from prolamins patterns. The results reflect the great diversity of storage proteins and a high correlation was obtained between the three studied fractions. Several accessions present specific bands which could be used as a discriminatory marker both on intra and interspecific levels. No clear relationships were seen between the groups according to their geographical origin. Data obtained from ecogeographic investigation can be used for future collecting missions.

  17. CAPs markers to assist selection for low vicine and convicine contents in faba bean (Vicia faba L.).

    Science.gov (United States)

    Gutierrez, N; Avila, C M; Duc, G; Marget, P; Suso, M J; Moreno, M T; Torres, A M

    2006-12-01

    The antinutritional factors (ANFs) present in Vicia spp. seeds are a major constraint to the wider utilization of these crops as grain legumes. In the case of faba bean (Vicia faba L.), a breeding priority is the absence vicine and convicine (v-c); responsible for favism in humans and for the reduced animal performance or low egg production in laying hens. The discovery of a spontaneous mutant allele named vc-, which induces a 10-20 fold reduction of v-c contents, may facilitate the process. However, the high cost and difficulty of the chemical detection of v-c seriously restricts the advances in breeding-selection. To identify random amplified polymorphic DNA (RAPD) markers linked to this gene, we have analysed an F(2 )population derived from a cross between a line with high v-c content (Vf6) and the vc- genotype (line 1268). Quantification of v-c was done by spectrophotometry on the parents and the F(2 )population (n = 136). By using bulked segregant analysis (BSA), two RAPD markers linked in coupling and repulsion phase to the allele vc- were identified and further converted into sequence characterized amplified regions (SCARs). Amplification of SCARS was more consistent, although the initial polymorphism between pools was lost. To recover the polymorphisms several approaches were explored. Restriction digestion with HhaI (for SCAR SCH01(620)) and RsaI (for SCAR SCAB12(850)) revealed clear differences between the parental lines. The simultaneous use of the two cleavage amplified polymorphism (CAP) markers will allow the correct fingerprinting of faba bean plants and can be efficiently used in breeding selection to track the introgression of the vc- allele to develop cultivars with low v-c content and improved nutritional value.

  18. Impact of bee pollinators on seed set and yield of Vicia villosa spp. dasycarpa (Leguminosae grown under semiarid conditions

    Directory of Open Access Journals (Sweden)

    Shahera Zaitoun

    2010-01-01

    Full Text Available A field experiment was conducted during 2005/2006 at Jordan University of Science and Technology campus (32°30” N, 35°59” E, Irbid, Jordan, to study the role of bee visitors on seed set and production of Vicia villosa spp. dasycarpa grown under semiarid conditions. Two treatments were imposed on Vicia villosa plants before flowering: 1 Plants were covered in cages (control or 2 Plants were left uncovered to permit bee visiting. The results of this experiment showed that V. villosa flowers were very attractive to worker honeybees as well as to few numbers of wild bees. The most frequent visitor species were A. mellifera and Anthophora albigena of family Apidae. V. villosa flowers attracted most of the bee visitors in the early hours of the day. The duration of their visit on the flowers also peaked early in the day and decreased toward the end of the day. The percentage of pod set of the un-covered plants averaged 14% out of the total florets on the plants, which was significantly higher than the covered plants (2%. These results indicated that the percentage of flower abscission was high and averaged more than 86%. Plant covering significantly reduced seed yield by reducing seed and pod number per plant and seed number per pod, but had no effect on individual seed weight. In conclusion, preventing bees from visiting during flowering of V. villosa spp. dasycarpa decreased seed set, seed yield and yield components. Further studies are needed to understand the high flower abscission and failure of seed set in this species.

  19. VsENOD5, VsENOD12 and VsENOD40 expression during Rhizobium-induced nodule formation on Vicia sativa roots

    DEFF Research Database (Denmark)

    Vijn, I; Yang, W C; Pallisgård, N

    1995-01-01

    We isolated ENOD5, ENOD12 and ENOD40 homologues from Vicia sativa and studied their expression pattern during Rhizobium-induced nodule formation. Comparison of the VsENOD40 nucleotide sequence with the pea, soybean and alfalfa ENOD40 sequences showed that the sequences contain two conserved regions...... the expression pattern of VsENOD5, VsENOD12 and VsENOD40 during Rhizobium-induced nodule formation. Although the expression of these genes is largely similar to that of the pea counterparts, differences where found for the expression of VsENOD12 and VsENOD40 in Vicia. VsENOD12 is expressed in the whole...

  20. High-quality permanent draft genome sequence of Rhizobium leguminosarum bv. viciae strain GB30; an effective microsymbiont of Pisum sativum growing in Poland.

    Science.gov (United States)

    Mazur, Andrzej; De Meyer, Sofie E; Tian, Rui; Wielbo, Jerzy; Zebracki, Kamil; Seshadri, Rekha; Reddy, Tbk; Markowitz, Victor; Ivanova, Natalia N; Pati, Amrita; Woyke, Tanja; Kyrpides, Nikos C; Reeve, Wayne

    2015-01-01

    Rhizobium leguminosarum bv. viciae GB30 is an aerobic, motile, Gram-negative, non-spore-forming rod that can exist as a soil saprophyte or as a legume microsymbiont of Pisum sativum. GB30 was isolated in Poland from a nodule recovered from the roots of Pisum sativum growing at Janow. GB30 is also an effective microsymbiont of the annual forage legumes vetch and pea. Here we describe the features of R. leguminosarum bv. viciae strain GB30, together with sequence and annotation. The 7,468,464 bp high-quality permanent draft genome is arranged in 78 scaffolds of 78 contigs containing 7,227 protein-coding genes and 75 RNA-only encoding genes, and is part of the GEBA-RNB project proposal.

  1. Quantification of cyanamide in young seedlings of Vicia species, Lens culinaris, and Robinia pseudo-acacia by gas chromatography-mass spectrometry.

    Science.gov (United States)

    Kamo, Tsunashi; Takemura, Tomoko; Wasano, Naoya; Fujii, Yoshiharu; Hiradate, Syuntaro

    2012-01-01

    We quantified the cyanamide content of young leaves of nine Vicia species, Lens culinaris, and Robinia pseudo-acacia using a modified analytical procedure that made it possible to measure the cyanamide content of a single leaf. Recent molecular phylogenetic analysis suggests that cyanamide is present in V. benghalensis, which is placed in a monophyletic group with cyanamide-biosynthesizing plants, V. villosa and V. cracca; this suggestion was verified.

  2. Effect on Some Characteristics of M2 Generation of Three Hungarian Vetch (Vicia pannonica Crantz.) The Application of Different Doses of Gamma Irradiation

    OpenAIRE

    BAĞCI, Muhittin; Mutlu, Hüseyin

    2014-01-01

    This study covers M2 generation of the mutation breeding Project with practice of gamma irradiation on Hungarian vetch (Vicia pannonica Crantz.). The study was counducted, with the purpose of determine and contrast control dose have effects on some properties of vegetational. In the study, M1 plant seeds of three Hungarian vetch cultivars (Tarmbeyazı-98, Anadolupembesi-2002 and Oğuz-2002) were planted. It was examined that morphological, biological and agricultural characteristics obtained M2...

  3. Relations between the crude protein content and the amino acid profile of organically produced field beans (Vicia faba L.) and field peas (Pisum sativum L.)

    OpenAIRE

    Witten, Stephanie; Aulrich, Karen

    2015-01-01

    In Organic Farming, grain legumes are important protein feedstuffs. There are hints indicating that the amino acid (AA) profile is affected by factors associated with varying crude protein (CP) contents of crops. The knowledge on this relationship between CP and AA profile needs to be extended to optimize feeding strategies for monogastrics as well as the selection of cultivars and varieties in fodder crop cultivation. Therefore, samples of 67 field beans (Vicia faba L.) and 86 field peas (Pi...

  4. Mannose-Binding Lectin Binds to Amyloid Protein and Modulates Inflammation

    Directory of Open Access Journals (Sweden)

    Mykol Larvie

    2012-01-01

    Full Text Available Mannose-binding lectin (MBL, a soluble factor of the innate immune system, is a pattern recognition molecule with a number of known ligands, including viruses, bacteria, and molecules from abnormal self tissues. In addition to its role in immunity, MBL also functions in the maintenance of tissue homeostasis. We present evidence here that MBL binds to amyloid β peptides. MBL binding to other known carbohydrate ligands is calcium-dependent and has been attributed to the carbohydrate-recognition domain, a common feature of other C-type lectins. In contrast, we find that the features of MBL binding to Aβ are more similar to the reported binding characteristics of the cysteine-rich domain of the unrelated mannose receptor and therefore may involve the MBL cysteine-rich domain. Differences in MBL ligand binding may contribute to modulation of inflammatory response and may correlate with the function of MBL in processes such as coagulation and tissue homeostasis.

  5. [The significance of Ulex europaeus agglutinin I lectin binding fibers in various muscular diseases].

    Science.gov (United States)

    Yatabe, K; Hiraguri, M; Sueishi, M; Takeuchi, M; Nonaka, I; Kawai, M

    1998-05-01

    In the present study, we have reported that Ulex europaeus agglutinin I (UEA I) lectin labeled muscle fibers in distal myopathy with rimmed vacuole formation (DMRV). UEA I binding to muscle fibers was also observed in a small number of biopsies with inflammatory myopathy, but not in other diseases, including neurogenic muscular atrophies and muscular dystrophies. In order to elucidate the relationship between this UEA I binding, rimmed vacuole formation and active autophagocytosis, we examined the UEA I binding fibers in other myopathies which frequently showed rimmed vacuoles, including adult onset acid maltase deficiency, oculo-pharyngo-distal type myopathy and oculopharyngeal muscular dystrophy. No UEA I lectin labeling fiber was observed in the diseases examined. We then studied UEA I binding behavior on 70 biopsies of inflammatory myopathy to characterize the clinical features of UEA I binding positive patients. UEA I binding fibers were observed in 3 of 28 patients (11%) with other collagen diseases, 11 of 36 (31%) without these disorders, and 2 of 6 (33%) with inclusion body myositis. There were no common clinical histories, complications or laboratory findings among the UEA I binding positive patients. In conclusion, a common process may exist between the muscle fiber degeneration in DMRV and subgroups of inflammatory myopathy patients, but the basic mechanism remains to be elucidated.

  6. Organogel-assisted topochemical synthesis of multivalent glyco-polymer for high-affinity lectin binding.

    Science.gov (United States)

    Krishnan, Baiju P; Raghu, Sreedevi; Mukherjee, Somnath; Sureshan, Kana M

    2016-12-01

    An organogelator, 2,4-undeca-diynyl-4',6'-O-benzylidene-β-d-galactopyranoside, which aligns its diacetylene upon gelation, has been synthesized. UV irradiation of its gel resulted in topochemical polymerization of the gelator forming polydiacetylene (PDA). We have used this gel-state reaction for the synthesis of surface-immobilized multi-valent glycoclusters, which showed 1000-fold enhanced binding, compared to monomers, with various galactose-binding lectins.

  7. The typing of Staphylococcus epidermidis by a lectin-binding assay

    DEFF Research Database (Denmark)

    Jarløv, J O; Hansen, J E; Rosdahl, V T

    1992-01-01

    A new typing method for Staphylococcus epidermidis was developed. Four biotinylated lectins--wheat germ agglutinin (WGA), soy bean agglutinin (SBA), lentil agglutinin (LCA) and Concanavalin A (ConA)--were added to immobilised whole cells of coagulase-negative staphylococci (CNS) in microtitration...

  8. Lectins binding during alloxan-induced diabetes in rat soleus muscle

    African Journals Online (AJOL)

    Membrane structural changes of soleus muscle of alloxan-diabetic rats were detected with a panel of six biotinylated lectins. Samples of muscles were obtained from normal and diabetic rats. The biotinylated lectins in staining were detected by avidin-peroxidase complex. Lectin stainning of soleus muscle cryostat sections ...

  9. C-type lectin binds to β-integrin to promote hemocytic phagocytosis in an invertebrate.

    Science.gov (United States)

    Wang, Xian-Wei; Zhao, Xiao-Fan; Wang, Jin-Xing

    2014-01-24

    Phagocytosis is a conserved cellular response among metazoans. Opsonins are some molecules that label targets to increase their susceptibility to phagocytosis. Opsonins are usually captured by receptors on the surface of phagocytes. Our previous study found the C-type lectin FcLec4 from Chinese white shrimp Fenneropenaeus chinensis might function as an opsonin to facilitate bacterial clearance. In the present study we purified the native FcLec4 protein and confirmed its opsonic activity in the near relation, kuruma shrimp Marsupenaeus japonicus. The possible receptor of FcLec4 was identified as β-integrin by panning a T7 phage display library of shrimp hemocytes and then confirmed by co-immunoprecipitation assay. We further proved that the interaction between FcLec4 and β-integrin did not rely on the carbohydrate recognition domain but on the N terminus of FcLec4. In addition, inhibition of FcLec4 expression using RNAi delayed bacterial clearance, and β-integrin knockdown suppressed the opsonic activity of FcLec4. This study is the first to show the direct interaction between an opsonin and its receptor in crustaceans. Our study provides new insights into invertebrate phagocytosis and the functions of C-type lectins.

  10. Griffonia simplicifolia lectins bind specifically to endothelial cells and some epithelial cells in mouse tissues.

    Science.gov (United States)

    Laitinen, L

    1987-04-01

    The binding of Griffonia simplicifolia agglutinin-I (GSA-I) and the isolectins GSA-I-AB3 and GSA-I-B4, having affinity for some alpha-D-galactosyl and N-acetyl galactosaminyl residues was studied in different mouse tissues. In brain, cardiac muscle and skeletal muscle, the GSA-I-lectin conjugates showed prominent binding only to blood vessel endothelia. Similarly, in the liver and kidney cortex the GSA-I-conjugates selectively reacted with endothelial cells of the sinusoids and with intertubular and glomerular capillaries, respectively. However, a strong reactivity with the GSA-I-conjugates was additionally seen in the acinar cells of the pancreas, in the stratified squamous epithelia of skin and tongue, and in transitional epithelium. SDS-PAGE electrophoresis combined with the lectin-blotting technique indicated that a similar set of glycoproteins are responsible for the GSA-I binding, even in different tissues. Another lectin with specificity for alpha-D-galactose, the Maclura pomifera agglutinin, displayed a distinctly different distribution of binding sites, mainly in the basement membranes, of all mouse tissues studied. The results suggest that some alpha-D-galactosyl residues, recognized by the binding of GSA-I lectins, are preferentially expressed in endothelial cells of mouse tissues, and also provide further evidence that endothelial cells can present a highly specific surface glycosylation pattern.

  11. Lectins binding during alloxan-induced diabetes in rat soleus muscle

    African Journals Online (AJOL)

    SERVER

    2008-04-17

    Apr 17, 2008 ... Key words: Diabetes, alloxan, Wistar rat, soleus muscle, lectin staining. ... betes mellitus on skeletal muscle of rats were examined by several authors ..... diagnosis and classification of diabetes mellitus and its complication.

  12. Nutritional improvement of corn pasta-like product with broad bean (Vicia faba) and quinoa (Chenopodium quinoa).

    Science.gov (United States)

    Giménez, M A; Drago, S R; Bassett, M N; Lobo, M O; Sammán, N C

    2016-05-15

    In this study, the nutritional quality of pasta-like product (spaghetti-type), made with corn (Zea mays) flour enriched with 30% broad bean (Vicia faba) flour and 20% of quinoa (Chenopodium quinoa) flour, was determined. Proximate chemical composition and iron, zinc and dietary fiber were determined. A biological assay was performed to assess the protein value using net protein utilization (NPU), true digestibility (TD) and protein digestibility-corrected amino acid score (PDCAAS). Iron and zinc availability were estimated by measuring dialyzable mineral fraction (%Da) resulting from in vitro gastrointestinal digestion. Nutritionally improved, gluten-free spaghetti (NIS) showed significantly increased NPU and decreased TD compared with a non-enriched control sample. One NIS-portion supplied 10-20% of recommended fiber daily intake. Addition of quinoa flour had a positive effect on the FeDa% as did broad bean flour on ZnDa%. EDTA increased Fe- and ZnDa% in all NIS-products, but it also impaired sensorial quality. Copyright © 2016. Published by Elsevier Ltd.

  13. Lead-induced genotoxicity to Vicia faba L. roots in relation with metal cell uptake and initial speciation.

    Science.gov (United States)

    Shahid, M; Pinelli, E; Pourrut, B; Silvestre, J; Dumat, C

    2011-01-01

    Formation of organometallic complexes in soil solution strongly influence metals phytoavailability. However, only few studies deal with the influence of metal speciation both on plant uptake and genotoxicity. In the present study, Vicia faba seedlings were exposed for 6h in controlled hydroponic conditions to 5 μM of lead nitrate alone and chelated to varying degrees by different organic ligands. Ethylenediaminetetraacetic acid and citric acid were, respectively, chosen as models of humic substances and low weight organic acids present in natural soil solutions. Visual Minteq software was used to estimate free lead cations concentration and ultimately to design the experimental layout. For all experimental conditions, both micronucleus test and measure of lead uptake by plants were finally performed. Chelation of Pb by EDTA, a strong chelator, dose-dependently increased the uptake in V. faba roots while its genotoxicity was significantly reduced, suggesting a protective role of EDTA. A weak correlation was observed between total lead concentration absorbed by roots and genotoxicity (r(2)=0.65). In contrast, a strong relationship (r(2)=0.93) exists between Pb(2+) concentration in exposure media and genotoxicity in the experiment performed with EDTA. Citric acid induced labile organometallic complexes did not demonstrate any significant changes in lead genotoxicity or uptake. These results demonstrate that metal speciation knowledge could improve the interpretation of V. faba genotoxicity test performed to test soil quality. Copyright © 2010 Elsevier Inc. All rights reserved.

  14. Genotoxicity of Silver Nanoparticles in Vicia faba: A Pilot Study on the Environmental Monitoring of Nanoparticles

    Directory of Open Access Journals (Sweden)

    Paul B. Tchounwou

    2012-05-01

    Full Text Available The use of silver nanoparticles (AgNPs in commercial products has increased significantly in recent years. Although there have been some attempts to determine the toxic effects of AgNPs in mammalian and human cell-lines, there is little information on plants which play a vital role in ecosystems. The study reports the use of Vicia faba root-tip meristem to investigate the genotoxicity of AgNPs under modified GENE-TOX test conditions. The root tip cells of V. faba were treated with four different concentrations of engineered AgNPs dispersion to study toxicological endpoints such as mitotic index (MI, chromosomal aberrations (CA and micronucleus induction (MN. For each concentration, five sets of microscopy observations were carried out. The results demonstrated that AgNPs exposure significantly increased (p < 0.05 the number of chromosomal aberrations, micronuclei, and decreased the MI in exposed groups compared to control. From this study we infer that AgNPs might have penetrated the plant system and may have impaired mitosis causing CA and MN. The results of this study demonstrate that AgNPs are genotoxic to plant cells. Since plant assays have been integrated as a genotoxicity component in risk assessment for detection of environmental mutagens, they should be given full consideration when evaluating the overall toxicological impact of the nanoparticles in the environment.

  15. Estimation of the effect of radionuclide contamination on Vicia sativa L. induction of chlorophyll fluorescence parameters using "Floratest" optical biosensor

    Science.gov (United States)

    Ruban, Yu.; Illienko, V.; Nesterova, N.; Pareniuk, O.; Shavanova, K.

    2017-12-01

    The presented research was aimed to determine the parameters of chlorophyll fluorescence (IChH) curve induction for Vicia sativa L. that were grown on radionuclide contaminated soils by using "Floratest" fluorometer. Plants were inoculated with 5 species of bacteria that might potentially block radionuclide uptake (Agrobacterium radiobacter IMBB-7246, Azotobacter chroococcum UKMB-6082, A. chroococcum UKMB-6003, Bacillus megaterium UKMB-5724, Rhizobium leguminosarum bv. viceae) and grown in sod-podzolic, chernozem and peat-bog soils, contaminated with 137Cs (4000±340 Bq/kg). As a result of research, it was determined that the most stressful factors for vetch plants are combination of soil radionuclide and presence of Bacillus megaterium UKM B-5724, as the number of inactive chlorophyll increased. In addition, the vetch plants significantly increased fixed level of fluorescence (Fst) under the influence of radioactive contamination in presence of Bacillus megaterium UKM B-5724, indicating inhibition of photosynthetic reactions. Other bacteria showed radioprotective properties in almost all types of soil.

  16. Relationship between geographical origin, seed size and genetic diversity in faba bean (Vicia faba L.) as revealed by SSR markers.

    Science.gov (United States)

    Göl, Şurhan; Doğanlar, Sami; Frary, Anne

    2017-05-11

    Faba bean (Vicia faba L.) is an important legume species because of its high protein and starch content. Broad bean can be grown in different climatic conditions and is an ideal rotation crop because of the nitrogen fixing bacteria in its roots. In this work, 255 faba bean germplasm accessions were characterized using 32 SSR primers which yielded 302 polymorphic fragments. According to the results, faba bean individuals were divided into two main groups based on the neighbor-joining algorithm (r = 0.91) with some clustering based on geographical origin as well as seed size. Population structure was also determined and agreed with the dendrogram analysis in splitting the accessions into two subpopulations. Analysis of molecular variance (AMOVA) revealed high levels of within population genetic variation. Genetic similarity and geographical proximity were related with separation of European accessions from African and Asian ones. Interestingly, there was no significant difference between landrace (38%) and cultivar (40%) diversity indicating that genetic variability has not yet been lost due to breeding. A total of 44 genetically well-characterized faba bean individuals were selected for a core collection to be further examined for yield and nutritional traits.

  17. Efecto de la acetilación sobre las propiedades funcionales y nutricionales de almidones de haba (VICIA FABA

    Directory of Open Access Journals (Sweden)

    Constanza López

    2011-03-01

    Full Text Available Se analizaron algunas propiedades funcionales del almidón de haba (Vicia faba, con dos niveles de proteína -12,89% y 4,41%-, obtenido por fraccionamiento por vía húmeda de las semillas secas. Se comparan el secado en rodillos y la liofilización como métodos para deshidratar la muestra, así como las propiedades funcionales del almidón antes y después de acetilarlo con anhídrido acético. También se investigaron ciertas propiedades de interés nutricional con el fin de observar la influencia de la modificación química en la biodisponibilidad del almidón de haba. Se realizó la determinación de almidón total, almidón resistente por retrogradación (AR3, almidón disponible y la velocidad de hidrólisis enzimática en el almidón nativo y en el modificado.

  18. Physiological impacts of soil pollution and arsenic uptake in three plant species: Agrostis capillaris, Solanum nigrum and Vicia faba.

    Science.gov (United States)

    Austruy, A; Wanat, N; Moussard, C; Vernay, P; Joussein, E; Ledoigt, G; Hitmi, A

    2013-04-01

    In order to revegetate an industrial soil polluted by trace metals and metalloids (As, Pb, Cu, Cd, Sb), the impact of pollution on three plant species, Solanum nigrum and Agrostis capillaris, both native species in an industrial site, and Vicia faba, a plant model species, is studied. Following the study of soil pollution from the industrial wasteland of Auzon, it appears that the As is the principal pollutant. Particular attention is given to this metalloid, both in its content and its speciation in the soil that the level of its accumulation in plants. In V. faba and A. capillaris, the trace metals and metalloids inhibit the biomass production and involve a lipid peroxidation in the leaves. Furthermore, these pollutants cause a photosynthesis perturbation by stomatal limitations and a dysfunction of photosystem II. Whatever the plant, the As content is less than 0.1 percent of dry matter, the majority of As absorbed is stored in the roots which play the role of trap organ. In parallel, the culture of S. nigrum decreases significantly the exchangeable and weakly adsorbed fraction of As in rhizospheric soil. This study has highlighted the ability of tolerance to trace metals of S. nigrum and to a lesser extent A. capillaris. Our data indicate that V. faba is not tolerant to soil pollution and is not a metallophyte species. Copyright © 2012 Elsevier Inc. All rights reserved.

  19. Detection of common vetch (Vicia sativa L.) in Lentil (Lens culinaris L.) using unique chemical fingerprint markers.

    Science.gov (United States)

    Thavarajah, Pushparajah; Thavarajah, Dil; Premakumara, G A S; Vandenberg, Albert

    2012-12-15

    Detection of adulteration of split red lentil (Lens culinaris L.) seeds with low level addition of split common vetch (Vicia sativa L.) is hampered by a lack of reliable detection methods. An analytical method was developed using high performance liquid chromatography with diode array detection (HPLC-DAD) based on two unique chemical markers found in common vetch: ß-cyanoalanine (BCA) and γ-glutamyl-ß-cyanoalanine (GCA). These two markers were present in samples of common vetch seed grown in Canada and Serbia. Authentic lentil samples grown in Canada, Australia, USA, Turkey, Syria, and Morocco had no detectable levels of these chemical markers. Commercial lentil samples for export from lentil processing plants in Saskatchewan, Canada, also had no detectable levels of GCA and BCA. The presence of vetch in intentionally adulterated lentil samples could be determined via chemical markers with a detection limit of 5% (w/w). The proposed method is a simple sample extraction and rapid HPLC analysis that could be widely used to detect intentional adulteration of lentils with common vetch. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Variation in seed mineral elements profile and yield in field bean (Vicia faba L. var. minor genotypes

    Directory of Open Access Journals (Sweden)

    Sara Lombardo

    2016-12-01

    Full Text Available Field bean (Vicia faba L. var. minor is one of the major leguminous crops cultivated in the world and mainly destined for animal feed. Although its seed is generally recognised as a good protein source, little is known about its mineral elements profile, which is an important aspect for a balanced animal diet. Therefore, the aim of the present work was to assess the seed mineral elements composition, along with some key production parameters, in eight field bean genotypes grown in a Mediterranean environment, without intensive management, over two years (2009/10 and 2010/11. Independently of the year, the seed of Chiaro di Torre Lama was the richest in phosphorus (P, magnesium, calcium and iron contents, while that of Sint 6 and Motta Chiaro 69 were the most effective accumulators of potassium and zinc, respectively. While all the genotypes yielded better in the second year (with more rainfall, the seasonal effect on seed mineral elements composition depended on the genotype. Indeed, the P content was 46% lower in Chiaro di Torre Lama, Motta Chiaro 69 and Sint 6 in the second year, while there was only a negligible seasonal effect for Sint 8 with respect to Fe content. Overall, this crop is reasonably productive under a low management regime and its seed can supply significant amounts of certain minerals (particularly P in feed formulations. Both aspects are important in a perspective of optimising field bean production in the Mediterranean area and, hence, improving farmers’ income.

  1. A note on the earliest distribution, cultivation and genetic changes in bitter vetch (Vicia ervilia in ancient Europe

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2015-01-01

    Full Text Available Bitter vetch (Vicia ervilia (L. Willd. was a part of the everyday diet of the Eurasian Neanderthal population and the modern human Palaeolithic hunter-gatherers at the end of the last Ice Age. The major criteria to determine the domestication in bitter vetch and other ancient grain legumes are non-dehiscent pods, larger seed size and smooth seed testa. Bitter vetch seeds were found among the earliest findings of cultivated crops at the site of Tell El-Kerkh, Syria, from 10th millennium BP. Along with cereals, pea and lentil, bitter vetch has become definitely associated with the start of the 'agricultural revolution' in the Old World. Bitter vetch entered Europe in its south-east regions and progressed into its interior via Danube. Its distribution was rapid, since the available evidence reveals its presence in remote places at similar periods. Recently the first success has been obtained in the extraction of ancient DNA from charred bitter vetch seeds. The linguistic evidence supports the fact that most of Eurasian peoples have their own words denoting bitter vetch, meaning that its cultivation preceded the diversification of their own proto-languages. [Projekat Ministarstva nauke Republike Srbije, br. TR-31024 i br. 173005

  2. Immunolocalization of dually phosphorylated MAPKs in dividing root meristem cells of Vicia faba, Pisum sativum, Lupinus luteus and Lycopersicon esculentum.

    Science.gov (United States)

    Winnicki, Konrad; Żabka, Aneta; Bernasińska, Joanna; Matczak, Karolina; Maszewski, Janusz

    2015-06-01

    In plants, phosphorylated MAPKs display constitutive nuclear localization; however, not all studied plant species show co-localization of activated MAPKs to mitotic microtubules. The mitogen-activated protein kinase (MAPK) signaling pathway is involved not only in the cellular response to biotic and abiotic stress but also in the regulation of cell cycle and plant development. The role of MAPKs in the formation of a mitotic spindle has been widely studied and the MAPK signaling pathway was found to be indispensable for the unperturbed course of cell division. Here we show cellular localization of activated MAPKs (dually phosphorylated at their TXY motifs) in both interphase and mitotic root meristem cells of Lupinus luteus, Pisum sativum, Vicia faba (Fabaceae) and Lycopersicon esculentum (Solanaceae). Nuclear localization of activated MAPKs has been found in all species. Co-localization of these kinases to mitotic microtubules was most evident in L. esculentum, while only about 50% of mitotic cells in the root meristems of P. sativum and V. faba displayed activated MAPKs localized to microtubules during mitosis. Unexpectedly, no evident immunofluorescence signals at spindle microtubules and phragmoplast were noted in L. luteus. Considering immunocytochemical analyses and studies on the impact of FR180204 (an inhibitor of animal ERK1/2) on mitotic cells, we hypothesize that MAPKs may not play prominent role in the regulation of microtubule dynamics in all plant species.

  3. Faba bean (Vicia faba minor and pea seeds (Pisum sativum as protein sources in lactating ewes’ diets.

    Directory of Open Access Journals (Sweden)

    D. Gatta

    2010-04-01

    Full Text Available 18 Massese lactating ewes, divided into 3 homogeneous groups for parity and milk yield, were used to evaluate the replacement effects of soybean meal by Faba bean (Vicia faba minor and Pea (Pisum sativum seeds. During a 70 days trial (beginning after weaning: 30±1.5 days after lambing animals were fed three isonitrogenous and isocaloric diets. Each diet was characterised by the presence of only one protein feed. The diets consisted of alfalfa hay (1.1 kg/head/d and a decreasing amount of mixed feed (from 1.1 to 0.7 kg/head/d to fit animals’ requirements. Milk yield, milk chemical composition, animals live weight and BCS, health state and hematochemical parameters were regularly monitored. No diets palatability problems were detected. No significant differences resulted for live weight, BCS, milk yield and milk chemical composition, except for milk protein: higher for faba bean (6.54% and soybean (6.39% respect pea (5.66% diets, P<0.05. No differences resulted for blood parameters too and no clinical signs of illness were observed. Therefore faba bean and pea seeds seem to be able to replace the soybean well.

  4. Antifungal activity of acetone extracts from Punica granatum L., Quercus suber L. and Vicia faba L.

    Science.gov (United States)

    Akroum, S

    2017-03-01

    Human and animal mycoses become more frequent and more resistant to traditional treatments. In this work, we tested the in vitro antifungal activity of acetonic extracts of Punica granatum L., Quercus suber L. and Vicia faba L. against seven pathogen fungi and the in vivo antifungal activity against Candida albicans and Trichophyton mentagrophytes. The phytochemical screening was also carried out and showed that the extracts contained mainly proanthocyanidins. Other polyphenols were also present but in low quantity. The acetone extract of V. faba L. gave a good in vitro inhibition of yeasts and was the most active for treating candidiasis in mice. It decreased the percentage of mortality with only 20μg. But the in vivo antifungal activity of this extract on T. mentagrophytes was low. It only showed a small diminution of crusting and erythema after the administration of 100μg. On the contrary, the acetone extracts of P. granatum L. had a poor activity against yeasts and a better one against moulds. It gave the best in vivo antifungal activity against T. mentagrophytes by healing animals with 40μg. The extract of P. granatum L. gave also an interesting in vivo antifungal activity against T. mentagrophytes with an active dose of 80μg. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  5. Flowering and characteristics of useful traits of some faba bean (Vicia faba L. var. major Harz cultivars and breeding lines

    Directory of Open Access Journals (Sweden)

    Helena Łabuda

    2012-12-01

    Full Text Available This study, conducted during the period 2008–2009, related to the growth, flowering, pod set, and yield of faba bean (Vicia faba L. var. major cultivars and breeding lines. Biometric measurements, made on 20 randomly selected plants, included the following traits: plant height, number of branches per plant, number of inflorescences per plant and number of flowers per inflorescence, number of pods per plant: large pods (marketable, small pods (undeveloped, and pods with disease symptoms. Moreover, the following characters were determined: pod and seed weight per plant in faba bean plants harvested once at processing maturity of fresh green seeds, pod length, width and weight as well as single seed weight. The evaluated cultivars and breeding lines of faba bean were characterized by large variations in the most important commercial traits. The abundance and duration of flowering as well as the number and weight of pods per plant were clearly modified by weather factors during the growth of plants. The new breeding lines R-366/1 and R-384 as well as the cultivars 'Bachus' and 'Jankiel Biały' were characterized by quite stable pod and seed yield per plant. Single harvesting of faba bean pods for green seeds at green maturity stage produced positive results in the case of all cultivars and breeding lines investigated; marketable pods per plant accounted for 75–80% of the total number of pods.

  6. Inhibition of raffinose family oligosaccharides and galactosyl pinitols breakdown delays germination of winter vetch (Vicia villosa Roth. seeds

    Directory of Open Access Journals (Sweden)

    Lesław B. Lahuta

    2011-01-01

    Full Text Available Beside RFOs, which are commonly present in legume seeds, seeds of some species contain galactosyl pinitols (GPs. These carbohydrates, like RFOs, have been hypothesized to constitute an important energy and carbon skeletal source during germination. To test this hypothesis we have applied a specific α-galactosidase inhibitor (1-deoxygalactonojirimycin, DGJ to germinating winter vetch (Vicia villosa Roth. seeds, containing more galactosyl pinitols than RFOs. The breakdown of RFOs but not that of GPs was completely blocked in both embryonic axes and cotyledons tissues, during the first 18 h of imbibition in DGJ. The inhibitor only decreased the rate of GPs degradation. The inhibitory effect of DGJ on GPs degradation was partially alleviated by addition of sucrose or galactose to DGJ solutions. After three days of germination in water, RFOs and GPs disappeared in axial tissues of seeds imbibed in water, galactose or sucrose. Eighteen-hour imbibition of seeds in DGJ drastically reduced germination, by ca 50%, during the first three days. The inhibitory effect of DGJ decreased during the next seven days of germination. The presence of galactose or sucrose in imbibition solution initially stimulated seed germination, but later this effect was not statistically significant. Our study provides clear evidence that galactosyl pinitols play an important role in early winter vetch seeds germination. Additionally, we suggest that galactosyl pinitols can replace RFOs as reserve material necessary for early germination.

  7. Between plant and diurnal variation in quantities and ratios of volatile compounds emitted by Vicia faba plants.

    Science.gov (United States)

    Webster, Ben; Gezan, Salvador; Bruce, Toby; Hardie, Jim; Pickett, John

    2010-01-01

    Ratios of volatile phytochemicals potentially offer a means for insects to recognise their host-plant species. However, for this to occur ratios of volatiles would need to be sufficiently consistent between plants and over time to constitute a host-characteristic cue. In this context we collected headspace samples from Vicia faba plants to determine how consistent ratios of key volatile phytochemicals used in host location by one of its insect pests, the black bean aphid, Aphis fabae, were. These were (E)-2-hexenal, (Z)-3-hexen-1-ol, 1-hexanol, benzaldehyde, 6-methyl-5-hepten-2-one, octanal, (Z)-3-hexen-1-yl acetate, (R)-linalool, methyl salicylate, decanal, undecanal, (E)-caryophyllene, (E)-beta-farnesene, (S)-germacrene D, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene, which had previously been found to be electrophysiologically and behaviourally active to A. fabae. Although the quantities of volatiles produced by V. faba showed large between plant and diurnal variation, correlations between quantities of compounds indicated that the ratios of certain pairs of volatiles were very consistent. This suggests that there is a host-characteristic cue available to A. fabae in the form of ratios of volatiles. 2009 Elsevier Ltd. All rights reserved.

  8. Contaminant bioavailability in soil and phytotoxicity/genotoxicity tests in Vicia faba L.: a case study of boron contamination.

    Science.gov (United States)

    Barbafieri, Meri; Giorgetti, Lucia

    2016-12-01

    In this work, the model plant for genotoxicity studies Vicia faba L. was used to investigate the relation between Boron (B) content and bioavailability in soil and plant genotoxic/phytotoxic response. A total of nine soil samples were investigated: two soil samples were collected from a B-polluted industrial area in Cecina (Tuscany, Italy), the other samples were obtained by spiking control soil (from a not polluted area of the basin) with seven increased doses of B, from about 20 to 100 mg B kg(-1). As expected, B availability, evaluated by chemical extraction, was higher (twofold) in spiked soils when compared with collected polluted soils with the same B total content. To analyze the phytotoxic effects of B, seed germination, root elongation, biomass production, and B accumulation in plant tissues were considered in V. faba plants grown in the various soils. Moreover, the cytotoxic/genotoxic effects of B were investigated in root meristems by mitotic index (MI) and micronuclei frequency (MCN) analysis. The results highlighted that V. faba was a B-sensitive plant and the appearance of phytotoxic effects, which altered plant growth parameters, were linearly correlated to the bioavailable B concentration in soils. Concerning the occurrence of cytotoxic/genotoxic effects induced by B, no linear correlation was observed even if MCN frequency was logarithmic correlated with the concentration of B bioavailable in soils.

  9. Characterisation of SalRAB a salicylic acid inducible positively regulated efflux system of Rhizobium leguminosarum bv viciae 3841.

    Directory of Open Access Journals (Sweden)

    Adrian J Tett

    Full Text Available Salicylic acid is an important signalling molecule in plant-microbe defence and symbiosis. We analysed the transcriptional responses of the nitrogen fixing plant symbiont, Rhizobium leguminosarum bv viciae 3841 to salicylic acid. Two MFS-type multicomponent efflux systems were induced in response to salicylic acid, rmrAB and the hitherto undescribed system salRAB. Based on sequence similarity salA and salB encode a membrane fusion and inner membrane protein respectively. salAB are positively regulated by the LysR regulator SalR. Disruption of salA significantly increased the sensitivity of the mutant to salicylic acid, while disruption of rmrA did not. A salA/rmrA double mutation did not have increased sensitivity relative to the salA mutant. Pea plants nodulated by salA or rmrA strains did not have altered nodule number or nitrogen fixation rates, consistent with weak expression of salA in the rhizosphere and in nodule bacteria. However, BLAST analysis revealed seventeen putative efflux systems in Rlv3841 and several of these were highly differentially expressed during rhizosphere colonisation, host infection and bacteroid differentiation. This suggests they have an integral role in symbiosis with host plants.

  10. Cd-induced oxidative stress and lignification in the roots of two Vicia sativa L. varieties with different Cd tolerances.

    Science.gov (United States)

    Rui, Haiyun; Chen, Chen; Zhang, Xingxing; Shen, Zhenguo; Zhang, Fenqin

    2016-01-15

    We examined the effects of Cd on growth, lipid peroxidation, reactive oxygen species (ROS) accumulation, antioxidant enzymatic activity, and lignin content in the roots of two varieties of Vicia sativa. Treatment with Cd decreased plant growth and increased ROS and lipid peroxidation levels to a greater extent in the Cd-sensitive variety ZM than in the Cd-tolerant variety L3. Most hydrogen peroxide (H2O2) and superoxide anion (O2(•-)) were accumulated in the cell walls and extracellular spaces in response to Cd treatments. Chemical assays and experiments using inhibitors showed that larger increases in H2O2 and O2(•-) production in ZM than in L3 were probably attributed to elevated Cd-induced nicotinamide adenine dinucleotide-peroxidase (NADH-POD) activity. Cd treatment increased the accumulation of lignin and the guaiacol peroxidase (GPOD) activities in the apoplast more significantly in ZM root than in L3. Howerver, root laccase activity was higher in L3 than in ZM. Thus Cd toxicity induced significant lignification in the roots of V. sativa, and increases in H2O2 accumulation and apoplastic GPOD activity were likely responsible for this effect. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. The Kok effect in Vicia faba cannot be explained solely by changes in chloroplastic CO2 concentration.

    Science.gov (United States)

    Buckley, Thomas N; Vice, Heather; Adams, Mark A

    2017-08-31

    The Kok effect - an abrupt decline in quantum yield (QY) of net CO2 assimilation at low photosynthetic photon flux density (PPFD) - is widely used to estimate respiration in the light (R), which assumes the effect is caused by light suppression of R. A recent report suggested much of the Kok effect can be explained by declining chloroplastic CO2 concentration (cc ) at low PPFD. Several predictions arise from the hypothesis that the Kok effect is caused by declining cc , and we tested these predictions in Vicia faba. We measured CO2 exchange at low PPFD, in 2% and 21% oxygen, in developing and mature leaves, which differed greatly in R in darkness. Our results contradicted each of the predictions based on the cc effect: QY exceeded the theoretical maximum value for photosynthetic CO2 uptake; QY was larger in 21% than 2% oxygen; and the change in QY at the Kok effect breakpoint was unaffected by oxygen. Our results strongly suggest the Kok effect arises largely from a progressive decline in R with PPFD that includes both oxygen-sensitive and -insensitive components. We suggest an improved Kok method that accounts for high cc at low PPFD. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  12. Biomass growth, micronucleus induction, and antioxidant stress enzyme responses in Vicia faba exposed to cadmium in solution.

    Science.gov (United States)

    Rosa, Edson V Cordova; Valgas, Cleidson; Souza-Sierra, Maria M; Corrêa, Albertina X R; Radetski, Claudemir Marcos

    2003-03-01

    Biomass growth, micronucleus induction, and antioxidative stress enzymes (superoxide dismutase, peroxidase, glutathione reductase, and catalase) were investigated simultaneously in the Vicia faba plant exposed to cadmium in solution. The biomass lowest-observed-effect concentration (LOEC) value was 2,000 microM Cd2+. In the shoots, enzymic activities increased without concentration-response relationships. In the roots, after an initial increase, activities of all enzymes showed negative concentration-response relationships. A significant increase in micronucleus induction was observed at 20 microM Cd2+. Regarding sensitivity, our results showed that biomass endpoint was less sensitive than micronucleus induction, which was less sensitive than antioxidative enzyme activities. The increase of antioxidant stress enzyme activities in response to cadmium exposure may be taken as evidence for an enhanced detoxification capacity of V. faba plants toward reactive oxygen species (and derivatives) that might be generated in the stressed plants. Concomitant micronucleus induction may be also interpreted as a consequence of oxidative stress, upholding the view that cadmium-induced DNA damage is, to some extent, via generation of reactive (intermediate) oxygen species.

  13. Lesões de pele em bovinos com doença granulomatosa sistêmica associada ao pastoreio de ervilhaca (Vicia spp. Skin lesions in cattle with systemic granulomatous disease associated to pasturing vetch (Vicia spp.

    Directory of Open Access Journals (Sweden)

    Rafael Almeida Fighera

    2005-04-01

    Full Text Available Descrevem-se as lesões cutâneas macroscópicas em 10 e histológicas em 8 vacas afetadas por doença granulomatosa sistêmica associada ao pastoreio de ervilhaca (Vicia spp.. Em todos os casos, as lesões cutâneas eram caracterizadas por múltiplas áreas coalescentes de alopecia, liquenificação e descamação. Os locais mais atingidos pela lesão de pele foram: cabeça e pescoço (10/10, tronco (4/10, períneo (3/10 e mama (2/10. Em todos os 8 casos avaliados histologicamente, as lesões se caracterizavam por dermatite perivascular superficial granulomatosa de intensidade variável. Outros achados histológicos incluíram dermatite perivascular profunda (1/8, perifoliculite (2/8, foliculite mural (3/8, hiperqueratose ortoqueratótica compacta (6/8, erosões (1/8, úlceras (2/8, microabscessos de Munro (8/8, crostas serocelulares (1/8, espongiose (4/8, degeneração hidrópica (5/8, acantólise (1/8, corpúsculos de Civatte (2/8, exocitose linfoplasmocitária (6/8, edema superficial (6/8, incontinência pigmentar (2/8, basofilia (6/8 e mineralização distrófica do colágeno (2/8, tumefação do núcleo das células endoteliais (8/8 e ectasia de glândulas sudoríparas (8/8.Gross and histopathological lesions in the skin of respectively 10 and 8 cows affected with systemic granulomatous disease associated with pasturing vetch (Vicia spp. are described. In all cases, the cutaneous lesions were characterized by multiple coalescent areas of alopecia, lichenification and desquamation. More frequently affected sites were the skin covering the head and neck (10/10, trunk (4/10, escutcheon (3/10 and mammary gland (2/10. In all 8 histologically examined cases the lesions were characterized by superficial perivascular granulomatous dermatitis of varying intensity. Other histological findings included deep perivascular dermatitis (1/8, perifoliculitis (2/8, mural foliculitis (3/8, compact orthokeratotic hyperkeratosis (6/8, erosions (1/8, ulcers (2

  14. [Effect of post-treatment with dry extract from vicia truncatula on NADPH-GSH dependent system of rat liver during chronic alcohol intoxication].

    Science.gov (United States)

    Dorkina, E G

    2010-04-01

    Experiments on white female rats showed that chronic ethanol consumption leads to activation of the NADPH - GSH dependent system of the liver, which provides protection against ethanol-induced oxidative stress. Post-treatment administration of dry extract from Vicia truncatula Fish ex Bieb. (300 mg/kg body weight) on the background of 40% ethanol increased this adaptive reaction without depletion in the system, in contrast to what was observed in rats treated with carsil. These results suggest a significant hepatoprotective effect of the dry extract during the chronic alcohol-induced injury of the liver.

  15. Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina Thysanoptera (Insecta-Vicia faba (Fabaceae association in Prepuna and Puna in Jujuy, Argentina

    Directory of Open Access Journals (Sweden)

    María Inés Zamar

    2012-03-01

    Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F

  16. Characterization and functional analysis of seven flagellin genes in Rhizobium leguminosarum bv. viciae. Characterization of R. leguminosarum flagellins

    Directory of Open Access Journals (Sweden)

    Tambalo Dinah D

    2010-08-01

    Full Text Available Abstract Background Rhizobium leguminosarum bv. viciae establishes symbiotic nitrogen fixing partnerships with plant species belonging to the Tribe Vicieae, which includes the genera Vicia, Lathyrus, Pisum and Lens. Motility and chemotaxis are important in the ecology of R. leguminosarum to provide a competitive advantage during the early steps of nodulation, but the mechanisms of motility and flagellar assembly remain poorly studied. This paper addresses the role of the seven flagellin genes in producing a functional flagellum. Results R. leguminosarum strains 3841 and VF39SM have seven flagellin genes (flaA, flaB, flaC, flaD, flaE, flaH, and flaG, which are transcribed separately. The predicted flagellins of 3841 are highly similar or identical to the corresponding flagellins in VF39SM. flaA, flaB, flaC, and flaD are in tandem array and are located in the main flagellar gene cluster. flaH and flaG are located outside of the flagellar/motility region while flaE is plasmid-borne. Five flagellin subunits (FlaA, FlaB, FlaC, FlaE, and FlaG are highly similar to each other, whereas FlaD and FlaH are more distantly related. All flagellins exhibit conserved amino acid residues at the N- and C-terminal ends and are variable in the central regions. Strain 3841 has 1-3 plain subpolar flagella while strain VF39SM exhibits 4-7 plain peritrichous flagella. Three flagellins (FlaA/B/C and five flagellins (FlaA/B/C/E/G were detected by mass spectrometry in the flagellar filaments of strains 3841 and VF39SM, respectively. Mutation of flaA resulted in non-motile VF39SM and extremely reduced motility in 3841. Individual mutations of flaB and flaC resulted in shorter flagellar filaments and consequently reduced swimming and swarming motility for both strains. Mutant VF39SM strains carrying individual mutations in flaD, flaE, flaH, and flaG were not significantly affected in motility and filament morphology. The flagellar filament and the motility of 3841 strains

  17. NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling in Vicia faba guard cells.

    Science.gov (United States)

    Yi, Min; Bai, Heli; Xue, Meizhao; Yi, Huilan

    2017-04-01

    NO and H2O2 have been implicated as important signals in biotic and abiotic stress responses of plants to the environment. Previously, we have shown that SO2 exposure increased the levels of NO and H2O2 in plant cells. We hypothesize that, as signaling molecules, NO and H2O2 mediate SO2-caused toxicity. In this paper, we show that SO2 hydrates caused guard cell death in a concentration-dependent manner in the concentration range of 0.25 to 6 mmol L-1, which was associated with elevation of intracellular NO, H2O2, and Ca2+ levels in Vicia faba guard cells. NO donor SNP enhanced SO2 toxicity, while NO scavenger c-PTIO and NO synthesis inhibitors L-NAME and tungstate significantly prevented SO2 toxicity. ROS scavenger ascorbic acid (AsA) and catalase (CAT), Ca2+ chelating agent EGTA, and Ca2+ channel inhibitor LaCl3 also markedly blocked SO2 toxicity. In addition, both c-PTIO and AsA could completely block SO2-induced elevation of intracellular Ca2+ level. Moreover, c-PTIO efficiently blocked SO2-induced H2O2 elevation, and AsA significantly blocked SO2-induced NO elevation. These results indicate that extra NO and H2O2 are produced and accumulated in SO2-treated guard cells, which further activate Ca2+ signaling to mediate SO2 toxicity. Our findings suggest that both NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling.

  18. Quorum-sensing-regulated transcriptional initiation of plasmid transfer and replication genes in Rhizobium leguminosarum biovar viciae.

    Science.gov (United States)

    McAnulla, Craig; Edwards, Anne; Sanchez-Contreras, Maria; Sawers, R Gary; Downie, J Allan

    2007-07-01

    Transfer of the Rhizobium leguminosarum biovar viciae symbiosis plasmid pRL1JI is regulated by a cascade of gene induction involving three LuxR-type quorum-sensing regulators, TraR, BisR and CinR. TraR induces the plasmid transfer traI-trb operon in a population-density-dependent manner in response to N-acylhomoserine lactones (AHLs) made by TraI. Expression of the traR gene is primarily induced by BisR in response to AHLs made by CinI, and expression of cinI is induced by CinR and repressed by BisR. Analysis of transcription initiation of cinI, traR and traI identified potential regulatory domains recognized by the CinR, BisR and TraR regulators. Deletion and mutation of the cinI promoter identified potential recognition motifs for activation by CinR and repression by BisR. Analysis of the DNA sequence upstream of traI and expression of transcriptional gene fusions revealed a predicted TraR-binding (tra-box) domain. Two transcript initiation sites were identified upstream of the plasmid replication gene repA, which is divergently transcribed from traI; one of these repA transcripts requires the quorum-sensing cascade mediated via BisR and TraR, showing that the pRL1JI plasmid replication genes are co-regulated with the plasmid transfer genes.

  19. Single-bilayer graphene oxide sheet tolerance and glutathione redox system significance assessment in faba bean ( Vicia faba L.)

    Science.gov (United States)

    Anjum, Naser A.; Singh, Neetu; Singh, Manoj K.; Shah, Zahoor A.; Duarte, Armando C.; Pereira, Eduarda; Ahmad, Iqbal

    2013-07-01

    Adsorbents based on single-bilayer graphene oxide sheet (hereafter termed "graphene oxide") are widely used in contaminated environments cleanup which may easily open the avenues for their entry to different environmental compartments, exposure to organisms and their subsequent transfer to human/animal food chain. Considering a common food crop—faba bean ( Vicia faba L.) germinating seedlings as a model plant system, this study assesses the V. faba-tolerance to different concentrations (0, 100, 200, 400, 800, and 1600 mg L-1) of graphene oxide (0.5-5 μm) and evaluates glutathione (γ-glutamyl-cysteinyl-glycine) redox system significance in this context. The results showed significantly increased V. faba sensitivity under three graphene oxide concentrations (in order of impact: 1,600 > 200 > 100 mg graphene oxide L-1), which was accompanied by decreased glutathione redox (reduced glutathione-to-oxidized glutathione) ratio, reduced glutathione pool, as well as significant and equally elevated activities of glutathione-regenerating (glutathione reductase) and glutathione-metabolizing (glutathione peroxidase; glutathione sulfo-transferase) enzymes. Contrarily, the two graphene oxide concentrations (in order of impact: 800 > 400 graphene oxide mg L-1) yielded promising results; where, significant improvements in V. faba health status (measured as increased graphene oxide tolerance) were clearly perceptible with increased ratio of the reduced glutathione-to-oxidized glutathione, reduced glutathione pool and glutathione reductase activity but decreased activities of glutathione-metabolizing enzymes. It is inferred that V. faba seedlings-sensitivity and/or tolerance to graphene oxide concentrations depends on both the cellular redox state (reduced glutathione-to-oxidized glutathione ratio) and the reduced glutathione pool which in turn are controlled by a finely tuned modulation of the coordination between glutathione-regenerating and glutathione-metabolizing enzymes.

  20. Increasing phosphorus supply is not the mechanism by which arbuscular mycorrhiza increase attractiveness of bean (Vicia faba) to aphids.

    Science.gov (United States)

    Babikova, Zdenka; Gilbert, Lucy; Randall, Kate C; Bruce, Toby J A; Pickett, John A; Johnson, David

    2014-10-01

    Arbuscular mycorrhizal (AM) fungi, important plant mutualists, provide plants with nutrients such as phosphorus (P) in return for carbon. AM fungi also enhance the attractiveness of plants to aphids via effects on emissions of plant volatiles used in aphid host location. We tested whether increased P uptake by plants is the mechanism through which AM fungi alter the volatile profile of plants and aphid behavioural responses by manipulating the availability of P and AM fungi to broad beans (Vicia faba L.) in a multi-factorial design. If AM fungi affect plant volatiles only via increased P acquisition, we predicted that the emission of volatiles and the attractiveness of mycorrhizal beans to aphids would be similar to those of non-mycorrhizal beans supplied with additional P. AM fungi and P addition increased leaf P concentrations by 40 and 24%, respectively. The production of naphthalene was less in mycorrhizal plants, regardless of P addition. By contrast, production of (S)-linalool, (E)-caryophyllene and (R)-germacrene D was less in plants colonized by AM fungi but only in the absence of P additions. The attractiveness of plants to pea aphids (Acyrthosiphon pisum Harris) was positively affected by AM fungi and correlated with the extent of root colonization; however, attractiveness was neither affected by P treatment nor correlated with leaf P concentration. These findings suggest that increased P uptake is not the main mechanism by which mycorrhiza increase the attractiveness of plants to aphids. Instead, the mechanism is likely to operate via AM fungi-induced plant systemic signalling. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  1. Hypoxia treatment on germinating faba bean (Vicia faba L. seeds enhances GABA-related protection against salt stress

    Directory of Open Access Journals (Sweden)

    Runqiang Yang

    2015-06-01

    Full Text Available The γ-aminobutyric acid (GABA is a non-protein amino acid with some functional properties for human health. Its content is usually lower in plant seeds. Hypoxia or salt (NaCl stress is an effective way for accumulating GABA during seed germination. However, NaCl stress on GABA accumulation under hypoxia is currently infrequent. The effect of NaCl on GABA accumulation in germinating faba bean (Vicia faba L. under hypoxia was therefore investigated in this study. Faba bean seeds were steeped in citric acid buffer (pH 3.5 containing NaCl with a final O2 concentration of 5.5 mg L-1 and germinated for 5 d. Results showed that 60 mmol L-1 NaCl was the optimum concentration for GABA accumulation in germinating faba beans under hypoxia. Germination for 5 d under hypoxia-NaCl stress was less beneficial for GABA accumulation than only hypoxia (control. Polyamine degradation pathway played a more important role for accumulating GABA in germinating faba bean as an adaptive response to NaCl stress. Removing NaCl significantly increased GABA content, while it decreased glutamate decarboxylase (GAD activity. Simultaneously, polyamine was accumulated, which might be related to the enhancement of physiological activity after recovery. When treated with aminoguanidine (AG for 3 d, GABA content decreased by 29.82%. These results indicated that the tolerance ability of GABA shunt to NaCl stress was weaker than that of polyamine degradation pathway. The NaCl treatment for 3 d under hypoxia could raise the contribution ratio of polyamine degradation pathway for GABA accumulation. The contribution ratio of polyamine degradation pathway for GABA formation was 29.82% when treated for at least 3 d

  2. Comparative transcriptional profiling provides insights into the evolution and development of the zygomorphic flower of Vicia sativa (Papilionoideae.

    Directory of Open Access Journals (Sweden)

    Zhipeng Liu

    Full Text Available BACKGROUND: Vicia sativa (the common vetch possesses a predominant zygomorphic flower and belongs to the subfamily Papilionoideae, which is related to Arabidopsis thaliana in the eurosid II clade of the core eudicots. Each vetch flower consists of 21 concentrically arranged organs: the outermost five sepals, then five petals and ten stamens, and a single carpel in the center. METHODOLOGY/PRINCIPAL FINDINGS: We explored the floral transcriptome to examine a genome-scale genetic model of the zygomorphic flower of vetch. mRNA was obtained from an equal mixture of six floral organs, leaves and roots. De novo assembly of the vetch transcriptome using Illumina paired-end technology produced 71,553 unigenes with an average length of 511 bp. We then compared the expression changes in the 71,553 unigenes in the eight independent organs through RNA-Seq Quantification analysis. We predominantly analyzed gene expression patterns specific to each floral organ and combinations of floral organs that corresponded to the traditional ABC model domains. Comparative analyses were performed in the floral transcriptomes of vetch and Arabidopsis, and genomes of vetch and Medicago truncatula. CONCLUSIONS/SIGNIFICANCE: Our comparative analysis of vetch and Arabidopsis showed that the vetch flowers conform to a strict ABC model. We analyzed the evolution and expression of the TCP gene family in vetch at a whole-genome level, and several unigenes specific to three different vetch petals, which might offer some clues toward elucidating the molecular mechanisms underlying floral zygomorphy. Our results provide the first insights into the genome-scale molecular regulatory network that controls the evolution and development of the zygomorphic flower in Papilionoideae.

  3. Chlorella induces stomatal closure via NADPH oxidase-dependent ROS production and its effects on instantaneous water use efficiency in Vicia faba.

    Science.gov (United States)

    Li, Yan; Xu, Shan-Shan; Gao, Jing; Pan, Sha; Wang, Gen-Xuan

    2014-01-01

    Reactive oxygen species (ROS) have been established to participate in stomatal closure induced by live microbes and microbe-associated molecular patterns (MAMPs). Chlorella as a beneficial microorganism can be expected to trigger stomatal closure via ROS production. Here, we reported that Chlorella induced stomatal closure in a dose-and time-dependent manner in epidermal peels of Vicia faba. Using pharmacological methods in this work, we found that the Chlorella-induced stomatal closure was almost completely abolished by a hydrogen peroxide (H2O2) scavenger, catalase (CAT), significantly suppressed by an NADPH oxidase inhibitor, diphenylene iodonium chloride (DPI), and slightly affected by a peroxidase inhibitor, salicylhydroxamic acid (SHAM), suggesting that ROS production involved in Chlorella-induced stomatal closure is mainly mediated by DPI-sensitive NADPH oxidase. Additionally, Exogenous application of optimal concentrations of Chlorella suspension improved instantaneous water use efficiency (WUEi) in Vicia faba via a reduction in leaf transpiration rate (E) without a parallel reduction in net photosynthetic rate (Pn) assessed by gas-exchange measurements. The chlorophyll fluorescence and content analysis further demonstrated that short-term use of Chlorella did not influence plant photosynthetic reactions center. These results preliminarily reveal that Chlorella can trigger stomatal closure via NADPH oxidase-dependent ROS production in epidermal strips and improve WUEi in leave levels.

  4. Bacillus simplex—A Little Known PGPB with Anti-Fungal Activity—Alters Pea Legume Root Architecture and Nodule Morphology When Coinoculated with Rhizobium leguminosarum bv. viciae

    Directory of Open Access Journals (Sweden)

    Ann M. Hirsch

    2013-09-01

    Full Text Available Two strains, 30N-5 and 30VD-1, identified as Bacillus simplex and B. subtilis, were isolated from the rhizospheres of two different plants, a Podocarpus and a palm, respectively, growing in the University of California, Los Angeles (UCLA Mildred E. Mathias Botanical Garden. B. subtilis is a well-known plant-growth promoting bacterial species, but B. simplex is not. B. simplex 30N-5 was initially isolated on a nitrogen-free medium, but no evidence for nitrogen fixation was found. Nevertheless, pea plants inoculated with B. simplex showed a change in root architecture due to the emergence of more lateral roots. When Pisum sativum carrying a DR5::GUSA construct, an indicator for auxin response, was inoculated with either B. simplex 30N-5 or its symbiont Rhizobium leguminosarum bv. viciae 128C53, GUS expression in the roots was increased over the uninoculated controls. Moreover, when pea roots were coinoculated with either B. simplex 30N-5 or B. subtilis 30VD-1 and R. leguminosarum bv. viciae 128C53, the nodules were larger, clustered, and developed more highly branched vascular bundles. Besides producing siderophores and solubilizing phosphate, the two Bacillus spp., especially strain 30VD-1, exhibited anti-fungal activity towards Fusarium. Our data show that combining nodulating, nitrogen-fixing rhizobia with growth-promoting bacteria enhances plant development and strongly supports a coinoculation strategy to improve nitrogen fixation, increase biomass, and establish greater resistance to fungal disease.

  5. Analysis of rhizobial endosymbionts of Vicia, Lathyrus and Trifolium species used to maintain mountain firewalls in Sierra Nevada National Park (South Spain).

    Science.gov (United States)

    Villadas, Pablo J; Lasa, Ana V; Martínez-Hidalgo, Pilar; Flores-Félix, José David; Martínez-Molina, Eustoquio; Toro, Nicolás; Velázquez, Encarna; Fernández-López, Manuel

    2017-03-01

    Forest fires lead to the annual disappearance of many natural formations that require the creation of firewall areas. They can be maintained by enriching their pastures with attractive plants for grazing livestock, mainly legumes, which have a high protein content and low dependence on N fertilizers due to their ability to establish nitrogen-fixing symbiosis with rhizobia. In this study, the rhizobia isolated from the nodules of six legumes from the genera Vicia, Lathyrus and Trifolium were analysed in a firewall zone established in Lanjarón (Granada) close to the Sierra Nevada National Park (Spain). The results showed a high genetic diversity of the isolated strains that had 3, 16, 14 and 13 different types of rrs, recA, atpD and glnII genes, respectively. All strains were phylogenetically close to the species from the Rhizobium leguminosarum group, although they were not identified as any of them. The isolated strains belonged to the symbiovars viciae and trifolii but high phylogenetic diversity was found within both symbiovars, since there were 16 and 14 nodC gene types, respectively. Some of these strains clustered with strains isolated in other countries and continents, but others formed atpD, recA, glnII and nodC clusters and lineages only found to date in this study. Copyright © 2016 Elsevier GmbH. All rights reserved.

  6. Genotoxicity assessment of particulate matter emitted from heavy-duty diesel-powered vehicles using the in vivo Vicia faba L. micronucleus test.

    Science.gov (United States)

    Corrêa, Albertina X R; Cotelle, Sylvie; Millet, Maurice; Somensi, Cleder A; Wagner, Theodoro M; Radetski, Claudemir M

    2016-05-01

    Diesel exhaust particulate matter (PM) can have an impact on the environment due to its chemical constitution. A large number of substances such as organic compounds, sulfates, nitrogen derivatives and metals are adsorbed to the particles and desorption of these contaminants could promote genotoxic effects. The objective of this study was to assess the in vivo genotoxicity profile of diesel exhaust PM from heavy-duty engines. Extracts were obtained through leaching with pure water and chemical extraction using three organic solvents (dichloromethane, hexane, and acetone). The in vivo Vicia faba micronucleus test (ISO 29200 protocol) was used to assess the environmental impact of the samples collected from diesel exhaust PM. The solid diesel PM (soot) dissolved in water, and the different extracts, showed positive results for micronucleus formation. After the addition of EDTA, the aqueous extracts did not show a genotoxic effect. The absence of metals in the organic solvent extract indicated that organic compounds also had a genotoxic effect, which was not observed for a similar sample cleaned in a C18 column. Thus, considering the ecological importance of higher plants in relation to ecosystems (in contrast to Salmonella spp., which are commonly used in mutagenicity studies), the Vicia micronucleus test was demonstrated to be appropriate for complementing prokaryotic or in vitro tests on diesel exhaust particulate matter included in risk assessments. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina

    Directory of Open Access Journals (Sweden)

    María Inés Zamar

    2012-03-01

    Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F

  8. Microvirga ossetica sp. nov., a species of rhizobia isolated from root nodules of the legume species Vicia alpestris Steven.

    Science.gov (United States)

    Safronova, Vera I; Kuznetsova, Irina G; Sazanova, Anna L; Belimov, Andrey A; Andronov, Evgeny E; Chirak, Elizaveta R; Osledkin, Yuri S; Onishchuk, Olga P; Kurchak, Oksana N; Shaposhnikov, Alexander I; Willems, Anne; Tikhonovich, Igor A

    2017-01-01

    Gram-stain-negative strains V5/3MT, V5/5K, V5/5M and V5/13 were isolated from root nodules of Vicia alpestris plants growing in the North Ossetia region (Caucasus). Sequencing of the partial 16S rRNA gene (rrs) and four housekeeping genes (dnaK, gyrB, recA and rpoB) showed that the isolates from V. alpestris were most closely related to the species Microvirga zambiensis (order Rhizobiales, family Methylobacteriaceae) which was described for the single isolate from root nodule of Listia angolensis growing in Zambia. Sequence similarities between the Microvirga-related isolates and M. zambiensis WSM3693T ranged from 98.5 to 98.7 % for rrs and from 79.7 to 95.8 % for housekeeping genes. Cellular fatty acids of the isolates V5/3MT, V5/5K, V5/5M and V5/13 included important amounts of C18 : 1ω7c (54.0-67.2 %), C16 : 0 (6.0-7.8 %), C19 : 0 cyclo ω8c (3.1-10.2 %), summed feature 2 (comprising one or more of iso-C16 : 1 I, C14 : 0 3-OH and unknown ECL 10.938, 5.8-22.5 %) and summed feature 3 (comprising C16 : 1ω7c and/or iso-C15 : 02-OH, 2.9-4.0 %). DNA-DNA hybridization between the isolate V5/3MT and M. zambiensis WSM3693T revealed DNA-DNA relatedness of 35.3 %. Analysis of morphological and physiological features of the novel isolates demonstrated their unique phenotypic profile in comparison with reference strains from closely related species of the genus Microvirga. On the basis of genotypic and phenotypic analysis, a novel species named Microvirga ossetica sp. nov. is proposed. The type strain is V5/3MT (=LMG 29787T=RCAM 02728T). Three additional strains of the species are V5/5K, V5/5M and V5/13.

  9. Effect of Calcium and Potassium on Antioxidant System of Vicia faba L. Under Cadmium Stress

    Directory of Open Access Journals (Sweden)

    Hayssam M. Ali

    2012-05-01

    Full Text Available Cadmium (Cd in soil poses a major threat to plant growth and productivity. In the present experiment, we studied the effect of calcium (Ca2+ and/or potassium (K+ on the antioxidant system, accumulation of proline (Pro, malondialdehyde (MDA, and content of photosynthetic pigments, cadmium (Cd and nutrients, i.e., Ca2+ and K+ in leaf of Vicia faba L. (cv. TARA under Cd stress. Plants grown in the presence of Cd exhibited reduced growth traits [root length (RL plant−1, shoot length (SL plant−1, root fresh weight (RFW plant−1, shoot fresh weight (SFW plant−1, root dry weight (RDW plant−1 and shoot dry weight (SDW plant−1] and concentration of Ca2+, K+, Chlorophyll (Chl a and Chl b content, except content of MDA, Cd and (Pro. The antioxidant enzymes [peroxidase (POD and superoxide dismutase (SOD] slightly increased as compared to control under Cd stress. However, a significant improvement was observed in all growth traits and content of Ca2+, K+, Chl a, Chl b ,Pro and activity of antioxidant enzymes catalase (CAT, POD and SOD in plants subjected to Ca2+ and/or K+. The maximum alleviating effect was recorded in the plants grown in medium containing Ca2+ and K+ together. This study indicates that the application of Ca2+ and/or K+ had a significant and synergistic effect on plant growth. Also, application of Ca2+ and/or K+ was highly effective against the toxicity of Cd by improving activity of antioxidant enzymes and solute that led to the enhanced plant growth of faba bean plants.

  10. Immobilization and Survival of Root Nodule Bacterium Rhizobium leguminosarum Biovar viciae / Gumiņbaktērijas Rhizobium leguminosarum biovar viciae imobilizācija un dzīvotspēja

    Directory of Open Access Journals (Sweden)

    Žvagiņa Signe

    2015-11-01

    Full Text Available Rhizobium leguminosarum biovar viciae ir augsnes baktērija, kas spēj veidot gumiņus uz zirņu, pupu, lēcu un vīķu saknēm un saistīt atmosfēras slāpekli simbiozē ar augiem. Gumiņbaktērijas izmanto lauksaimniecībā kā bioloģiskus mēslošanas līdzekļus augu augšanas veicināšanai. Komerciālos gumiņbaktēriju preparātus var iegādāties sausā, šķidrā vai liofilizētā formā. Parasti izmanto sausos sagatavotos mēslošanas līdzekļus uz kūdras bāzes. Šī pētījuma mērķis bija imobilizēt R. leguminosarum un noteikt tās dzīvotspēju šķidrumā un dažādos nesējmateriālos, lai izstrādātu uzlabotus gumiņbaktēriju preparātus. Imobilizēšanai izmantoja piecus sterilizētus materiālus: kūdru, māla pulveri, divu veidu ovālus šūnainās keramikas agregātus un cilindriskas keramikas granulas, kas izgatavotas no Planču depozīta Devona perioda māla. Imobilizāciju veica 2,5 stundu laikā 20 °C temperatūrā. Vēlāk kūdru, pulveri un granulas noberza un sasmalcināja ūdenī ar sterilu piestiņu, lai atdalītu pielipušās baktērijas. Baktēriju kolonijas veidojošo vienību skaitu noteica, izsējot iegūto suspensiju atšķaidījumus Petri traukos ar agarizētu barotni. Dzīvotspēju noteica arī ar LIVE/DEAD epifluorescences metodi. Iegūtie rezultāti parādīja, ka nesējmateriāls ietekmē imobilizācijas sekmes un ka uzglabāšanas temperatūra ietekmē R. leguminosarum dzīvotspēju. Vislabākos rezultātus ieguva, uzglabājot baktērijas suspensijā vai imobilizējot uz kūdras. Rekomendējam uzglabāt R. leguminosarum produktus −18 °C vai 4 °C temperatūrā.

  11. Similar Intracellular Location and Stimulus Reactivity, but Differential Mobility of Tailless (Vicia faba) and Tailed Forisomes (Phaseolus vulgaris) in Intact Sieve Tubes

    Science.gov (United States)

    van Bel, Aart J. E.

    2015-01-01

    Sieve elements of legumes contain forisomes—fusiform protein bodies that are responsible for sieve-tube occlusion in response to damage or wound signals. Earlier work described the existence of tailless and tailed forisomes. This study intended to quantify and compare location and position of tailless (in Vicia faba) and tailed (in Phaseolus vulgaris) forisomes inside sieve elements and to assess their reactivity and potential mobility in response to a remote stimulus. Location (distribution within sieve elements) and position (forisome tip contacts) of more than altogether 2000 forisomes were screened in 500 intact plants by laser scanning confocal microscopy in the transmission mode. Furthermore, we studied the dispersion of forisomes at different locations in different positions and their positional behaviour in response to distant heat shocks. Forisome distribution turned out to be species-specific, whereas forisome positions at various locations were largely similar in bushbean (Phaseolus) and broadbean (Vicia). In general, the tailless forisomes had higher dispersion rates in response to heat shocks than the tailed forisomes and forisomes at the downstream (basal) end dispersed more frequently than those at the upstream end (apical). In contrast to the tailless forisomes that only oscillate in response to heat shocks, downstream-located tailed forisomes can cover considerable distances within sieve elements. This displacement was prevented by gentle rubbing of the leaf (priming) before the heat shock. Movement of these forisomes was also prohibited by Latrunculin A, an inhibitor of actin polymerization. The apparently active mobility of tailed forisomes gives credence to the idea that at least the latter forisomes are not free-floating, but connected to other sieve-element structures. PMID:26624625

  12. Similar Intracellular Location and Stimulus Reactivity, but Differential Mobility of Tailless (Vicia faba) and Tailed Forisomes (Phaseolus vulgaris) in Intact Sieve Tubes.

    Science.gov (United States)

    Furch, Alexandra C U; Buxa, Stefanie V; van Bel, Aart J E

    2015-01-01

    Sieve elements of legumes contain forisomes-fusiform protein bodies that are responsible for sieve-tube occlusion in response to damage or wound signals. Earlier work described the existence of tailless and tailed forisomes. This study intended to quantify and compare location and position of tailless (in Vicia faba) and tailed (in Phaseolus vulgaris) forisomes inside sieve elements and to assess their reactivity and potential mobility in response to a remote stimulus. Location (distribution within sieve elements) and position (forisome tip contacts) of more than altogether 2000 forisomes were screened in 500 intact plants by laser scanning confocal microscopy in the transmission mode. Furthermore, we studied the dispersion of forisomes at different locations in different positions and their positional behaviour in response to distant heat shocks. Forisome distribution turned out to be species-specific, whereas forisome positions at various locations were largely similar in bushbean (Phaseolus) and broadbean (Vicia). In general, the tailless forisomes had higher dispersion rates in response to heat shocks than the tailed forisomes and forisomes at the downstream (basal) end dispersed more frequently than those at the upstream end (apical). In contrast to the tailless forisomes that only oscillate in response to heat shocks, downstream-located tailed forisomes can cover considerable distances within sieve elements. This displacement was prevented by gentle rubbing of the leaf (priming) before the heat shock. Movement of these forisomes was also prohibited by Latrunculin A, an inhibitor of actin polymerization. The apparently active mobility of tailed forisomes gives credence to the idea that at least the latter forisomes are not free-floating, but connected to other sieve-element structures.

  13. Construction of a comparative genetic map in faba bean (Vicia faba L.); conservation of genome structure with Lens culinaris.

    Science.gov (United States)

    Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P

    2008-08-09

    The development of genetic markers is complex and costly in species with little pre-existing genomic information. Faba bean possesses one of the largest and least studied genomes among cultivated crop plants and no gene-based genetic maps exist. Gene-based orthologous markers allow chromosomal regions and levels of synteny to be characterised between species, reveal phylogenetic relationships and chromosomal evolution, and enable targeted identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba), using an F6 population developed from a cross between the lines Vf6 (equina type) and Vf27 (paucijuga type). Of 796 intron-targeted amplified polymorphic (ITAP) markers screened, 151 markers could be used to construct a comparative genetic map. Linkage analysis revealed seven major and five small linkage groups (LGs), one pair and 12 unlinked markers. Each LG was comprised of three to 30 markers and varied in length from 23.6 cM to 324.8 cM. The map spanned a total length of 1685.8 cM. A simple and direct macrosyntenic relationship between faba bean and Medicago truncatula was evident, while faba bean and lentil shared a common rearrangement relative to M. truncatula. One hundred and four of the 127 mapped markers in the 12 LGs, which were previously assigned to M. truncatula genetic and physical maps, were found in regions syntenic between the faba bean and M. truncatula genomes. However chromosomal rearrangements were observed that could explain the difference in chromosome numbers between these three legume species. These rearrangements suggested high conservation of M. truncatula chromosomes 1, 5 and 8; moderate conservation of chromosomes 2, 3, 4 and 7 and no conservation with M. truncatula chromosome 6. Multiple PCR amplicons and comparative mapping were suggestive of small-scale duplication events in faba bean

  14. Construction of a comparative genetic map in faba bean (Vicia faba L.; conservation of genome structure with Lens culinaris

    Directory of Open Access Journals (Sweden)

    Avila Carmen M

    2008-08-01

    Full Text Available Abstract Background The development of genetic markers is complex and costly in species with little pre-existing genomic information. Faba bean possesses one of the largest and least studied genomes among cultivated crop plants and no gene-based genetic maps exist. Gene-based orthologous markers allow chromosomal regions and levels of synteny to be characterised between species, reveal phylogenetic relationships and chromosomal evolution, and enable targeted identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba, using an F6 population developed from a cross between the lines Vf6 (equina type and Vf27 (paucijuga type. Results Of 796 intron-targeted amplified polymorphic (ITAP markers screened, 151 markers could be used to construct a comparative genetic map. Linkage analysis revealed seven major and five small linkage groups (LGs, one pair and 12 unlinked markers. Each LG was comprised of three to 30 markers and varied in length from 23.6 cM to 324.8 cM. The map spanned a total length of 1685.8 cM. A simple and direct macrosyntenic relationship between faba bean and Medicago truncatula was evident, while faba bean and lentil shared a common rearrangement relative to M. truncatula. One hundred and four of the 127 mapped markers in the 12 LGs, which were previously assigned to M. truncatula genetic and physical maps, were found in regions syntenic between the faba bean and M. truncatula genomes. However chromosomal rearrangements were observed that could explain the difference in chromosome numbers between these three legume species. These rearrangements suggested high conservation of M. truncatula chromosomes 1, 5 and 8; moderate conservation of chromosomes 2, 3, 4 and 7 and no conservation with M. truncatula chromosome 6. Multiple PCR amplicons and comparative mapping were suggestive of

  15. (Vicia sativa L.) - triticale

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... This study was carried to determine the best seed mixture of vetch and triticale for East Mediterranean rainfed conditions of Turkey. The experiments were conducted in two locations, Adana and Kozan, during the years of 2003 - 2005. The field trials were arranged in a randomised block design with three.

  16. Drosophila melanogaster, Vicia faba and Arabidopsis thaliana short-term bioassays in genotoxicity evaluation of air and soil samples from sites surrounding two industrial factories in the Czech Republic.

    Science.gov (United States)

    Chroust, K; Kuglík, P; Relichová, J; Holoubek, I; Cáslavský, J; Veselská, R; Rysková, M; Benedík, J

    1997-01-01

    The Somatic Mutation and Recombination Test (SMART) in wing cells of Drosophila melanogaster, the Vicia faba cytogenetic tests-Sister Chromatid Exchange (SCE) and Micronucleus Test (MN), and the Müller test for gametic mutations in Arabidopsis thaliana were used for genotoxicity testing of environmental samples of pollutants from the surroundings of LACHEMA chemical factory (Brno, Czech Republic) and DEZA factory in Valasské Mezirící (Moravia, Czech Republic). Tested soil and air samples were taken from the near vicinity of both factories. The surroundings of both sites are heavy loaded by exhalation of chemicals from the factories. Chemical analyses of the 16 Polycyclic Aromatic Hydrocarbons (PAHs) according to the United States Environmental Protection Agency (US EPA) list of priority pollutants and heavy metals were performed in both soil and air samples. The Drosophila wing spot test was positive in 70.6% of the tested samples, the Vicia sister chromatid exchange test in 62.5%, and the Arabidopsis Müller test in 58.9%. The micronucleus Vicia faba test was quite insensitive in tested environmental samples. The concordance between SMART and SCE was 62.5%, between SMART and Müller test 76.5%, and between Müller test and SCE 100%. Total concordance of these three tests was 79.7%. Müller test for gametic mutation in Arabidopsis thaliana and cytogenetic SCE test in Vicia faba seem to be quite sensitive and convenient plant bioassays for assessing the mutagenic potential of environmental agents, when compared to the SMART test in Drosophila melanogaster.

  17. INFLUÊNCIA DO CULTIVO CONSORCIADO DE AVEIA PRETA (AVENA STRIGOSA SCHIEB. E ERVILHACA COMUM (VICIA SATIVA L. NA PRODUÇÃO DE FITOMASSA E NO APORTE DE NITROGÊNIO INFLUENCE OF INTERCROPPED COMMON VETCH (VICIA SATIVA L. AND NAKED OAT (AVENA STRIGOSA ON BIOMASS PRODUCTION AND NITROGEN ADDITION

    Directory of Open Access Journals (Sweden)

    R. Heinrichs

    1999-01-01

    Full Text Available Em um Podzólico Vermelho Amarelo e sob preparo convencional, foi avaliada a influência de proporções de sementes de ervilhaca (Vicia sativa L. e de aveia preta (Avena strigosa Schieb. cultivadas em consórcio, na produção de fitomassa e no aporte de nitrogênio no sistema. O experimento foi implantado em solo podzolico vermelho amarelo, de Santa Maria, RS. Os tratamentos foram casualizados em quatro blocos, constituindo-se de: 1- 100% Ervilhaca comum (E; 2- 90% E + 10% Aveia preta (A; 3- 75% E + 25% A; 4- 50% E + 50% A; 5- 25% E + 75% A; 6- 100% A; 7- pousio de inverno. A amostragem da fitomassa das coberturas verdes foi efetuada na ocasião do pleno florescimento em área de 0,8m2 por parcela. Os resultados evidenciaram que a aveia preta e a ervilhaca comum podem ser consorciadas, beneficiando assim, a produção de fitomassa e acúmulo de nitrogênio.The effect of intercropping common vetch (Vicia sativa L. with naked oat (Avena strigosa Schieb. at different seed proportions was evaluated. The trial was set up on a Red Yellow Podzolic soil of Santa Maria, RS, Brazil. The treatments were the following: 1- 100% E (common vetch; 2- 90% E + 10% A (naked oat; 3- 75% E + 25% A; 4- 50% E + 50% A; 5- 25% E + 75% A; 6- 100% A; 7- fall tillage organized in four randomized blocks. Biomass production was evaluated at the flowering stage in an area of 0.8 m2 per plot. Data show that both species can be intercropped which is beneficial to biomass production and nitrogen accumulation.

  18. Nitrogen transfer from Lupinus albus L., Trifolium incarnatum L. and Vicia sativa L. contribute differently to rapeseed (Brassica napus L.) nitrogen nutrition.

    Science.gov (United States)

    Génard, Thaïs; Etienne, Philippe; Laîné, Philippe; Yvin, Jean-Claude; Diquélou, Sylvain

    2016-09-01

    Nitrogen (N) transfer is well documented in legume-cereal intercropping but this is less often reported for legume-Brassica intercrops even though Brassica crops require higher levels of N fertilizers. The present study was carried out to quantify N transfer from legumes (Lupinus albus L., Trifolium incarnatum L. or Vicia sativa L.) to rapeseed (Brassica napus L.) using the split-root (15)N-labelling method. After three months we observed that legumes did not alter the growth of rapeseed. Vetch showed the lowest growth and demonstrated low (15)N shoot to root translocation and no significant N transfer to rapeseed. In contrast, significant (15)N enrichment was found in lupine and clover and (15)N was transferred to the associated rapeseed plants (around 6 and 4 mg N plant(-1), respectively), which contributed 2 to 3% of the rapeseed total N. Additionally, the data revealed that N2 fixation dominated the N nutrition in lupine despite the high N level provided in the donor compartment, suggesting a greater niche segregation between companion plants. Based on the results of this study we suggest that intercropping can be a relevant contributor to rapeseed N nutrition. Among the three legumes tested, clover and lupine seemed to be the best intercropping candidates.

  19. In vitro fermentation of lupin seeds (Lupinus albus) and broad beans (Vicia faba): dynamic modulation of the intestinal microbiota and metabolomic output.

    Science.gov (United States)

    Gullón, Patricia; Gullón, Beatriz; Tavaria, Freni; Vasconcelos, Marta; Gomes, Ana Maria

    2015-10-01

    Broad beans (Vicia faba) and lupin seeds (Lupinus albus) are legumes rich in a wide range of compounds, which may represent a useful dietary approach for modulating the human gut microbiome. In this work, after in vitro digestion, legume samples were used as carbon sources in anaerobic batch cultures to evaluate their impact on the intestinal microbiota composition and on their metabolic products. The fermentations were monitored by a decrease in pH, generation of short chain fatty acids (SCFA) and lactate and the changes in the dynamic bacterial populations by fluorescence in situ hybridization (FISH). The total SCFA at the end of fermentation was 81.52 mM for lupin seeds and 78.41 mM for broad beans accompanied by a decrease of the pH for both legumes. The microbial groups that increased significantly (P < 0.05) were Bifidobacterium spp., Lactobacillus-Enterococcus, Atopobium, Bacteroides-Pretovella, Clostridium coccoides-Eubacterium rectale, Faecalibacterium prausnitzii and Roseburia intestinalis. This impact on the intestinal microbiota suggests that lupin seeds and broad beans may be used in the development of novel functional foods, which can be included in dietary strategies for human health promotion.

  20. Nitrogen transfer from Lupinus albus L., Trifolium incarnatum L. and Vicia sativa L. contribute differently to rapeseed (Brassica napus L. nitrogen nutrition

    Directory of Open Access Journals (Sweden)

    Thaïs Génard

    2016-09-01

    Full Text Available Nitrogen (N transfer is well documented in legume-cereal intercropping but this is less often reported for legume-Brassica intercrops even though Brassica crops require higher levels of N fertilizers. The present study was carried out to quantify N transfer from legumes (Lupinus albus L., Trifolium incarnatum L. or Vicia sativa L. to rapeseed (Brassica napus L. using the split-root 15N-labelling method. After three months we observed that legumes did not alter the growth of rapeseed. Vetch showed the lowest growth and demonstrated low 15N shoot to root translocation and no significant N transfer to rapeseed. In contrast, significant 15N enrichment was found in lupine and clover and 15N was transferred to the associated rapeseed plants (around 6 and 4 mg N plant−1, respectively, which contributed 2 to 3% of the rapeseed total N. Additionally, the data revealed that N2 fixation dominated the N nutrition in lupine despite the high N level provided in the donor compartment, suggesting a greater niche segregation between companion plants. Based on the results of this study we suggest that intercropping can be a relevant contributor to rapeseed N nutrition. Among the three legumes tested, clover and lupine seemed to be the best intercropping candidates.

  1. Exploiting Illumina Sequencing for the Development of 95 Novel Polymorphic EST-SSR Markers in Common Vetch (Vicia sativa subsp. sativa

    Directory of Open Access Journals (Sweden)

    Zhipeng Liu

    2014-05-01

    Full Text Available The common vetch (Vicia sativa subsp. sativa, a self-pollinating and diploid species, is one of the most important annual legumes in the world due to its short growth period, high nutritional value, and multiple usages as hay, grain, silage, and green manure. The available simple sequence repeat (SSR markers for common vetch, however, are insufficient to meet the developing demand for genetic and molecular research on this important species. Here, we aimed to develop and characterise several polymorphic EST-SSR markers from the vetch Illumina transcriptome. A total number of 1,071 potential EST-SSR markers were identified from 1025 unigenes whose lengths were greater than 1,000 bp, and 450 primer pairs were then designed and synthesized. Finally, 95 polymorphic primer pairs were developed for the 10 common vetch accessions, which included 50 individuals. Among the 95 EST-SSR markers, the number of alleles ranged from three to 13, and the polymorphism information content values ranged from 0.09 to 0.98. The observed heterozygosity values ranged from 0.00 to 1.00, and the expected heterozygosity values ranged from 0.11 to 0.98. These 95 EST-SSR markers developed from the vetch Illumina transcriptome could greatly promote the development of genetic and molecular breeding studies pertaining to in this species.

  2. Impact of three different fungicides on fungal epi- and endophytic communities of common bean (Phaseolus vulgaris) and broad bean (Vicia faba).

    Science.gov (United States)

    Prior, René; Mittelbach, Moritz; Begerow, Dominik

    2017-06-03

    In this study, the impacts of three different fungicides to fungal phyllosphere communities on broad bean (Vicia faba, Fabaceae) and common bean (Phaseolus vulgaris, Fabaceae) were analyzed. The fungicides included copper, sulfur, and azoxystrobin. The plants were sowed, grown, and treated under conditions occurring in conventional and organic farming. A culture-based approach was used to identify changes in the phyllosphere fungal community after the treatment. Different effects on species richness and growth index of the epiphytic and endophytic communities for common bean and broad bean could be shown. Treatments with sulfur showed the weakest effect, followed by those based on copper and the systemic azoxystrobin, which showed the strongest effect especially on endophytic communities. The epiphytic fungal community took five weeks to recover after treatment with azoxystrobin. However, the effect of azoxystrobin on the endophytic community lasted more than five weeks. Finally, the data suggest that the surface structure of the host leaves have a huge impact on the mode of action that the fungicides exert.

  3. The effects of nano-TiO{sub 2} on seed germination, development and mitosis of root tip cells of Vicia narbonensis L. and Zea mays L

    Energy Technology Data Exchange (ETDEWEB)

    Ruffini Castiglione, Monica, E-mail: mruffini@biologia.unipi.it [University of Pisa, Department of Biology (Italy); Giorgetti, Lucia; Geri, Chiara [Institute of Agricultural Biology and Biotechnology (IBBA/CNR), UOS Pisa (Italy); Cremonini, Roberto [University of Pisa, Department of Biology (Italy)

    2011-06-15

    This study aimed to provide new information about phyto-toxicology of nano-TiO{sub 2} on plant systems. To contribute to the evaluation of the potential harmful effects of the nanoparticles on monocots and dicots we considered their effects on seed germination and root elongation applying a concentration range from 0.2 to 4.0 Per-Mille-Sign in the plants Zea mays L. and Vicia narbonensis L. Moreover, we achieved a genotoxicity study at cytological level in root meristems by means of traditional cytogenetic approach, to evidence possible alterations in mitotic activity, chromosomal aberrations, and micronuclei release. From these analyses it comes out that nano-TiO{sub 2} particles, after short-term exposure and under our experimental conditions, delayed germination progression for the first 24 h in both materials. Root elongation was affected only after treatment with the higher nano-TiO{sub 2} concentration. Further significant effects were detected showing mitotic index reduction and concentration-dependent increase in the aberration emergence that evidenced a nano-TiO{sub 2}-induced genotoxic effect for both species.

  4. CYP94A1, a plant cytochrome P450-catalyzing fatty acid omega-hydroxylase, is selectively induced by chemical stress in Vicia sativa seedlings.

    Science.gov (United States)

    Benveniste, Irène; Bronner, Roberte; Wang, Yong; Compagnon, Vincent; Michler, Pierre; Schreiber, Lukas; Salaün, Jean-Pierre; Durst, Francis; Pinot, Franck

    2005-08-01

    CYP94A1 is a cytochrome P450 (P450) catalyzing fatty acid (FA) omega-hydroxylation in Vicia sativa seedlings. To study the physiological role of this FA monooxygenase, we report here on its regulation at the transcriptional level (Northern blot). Transcripts of CYP94A1, as those of two other P450-dependent FA hydroxylases (CYP94A2 and CYP94A3) from V. sativa, are barely detectable during the early development of the seedlings. CYP94A1 transcripts, in contrast to those of the two other isoforms, are rapidly (less than 20 min) and strongly (more than 100 times) enhanced after treatment by clofibrate, an hypolipidemic drug in animals and an antiauxin (p-chlorophenoxyisobutyric acid) in plants, by auxins (2,4-dichlorophenoxyacetic acid and indole-3-acetic acid), by an inactive auxin analog (2,3-dichlorophenoxyacetic acid), and also by salicylic acid. All these compounds activate CYP94A1 transcription only at high concentrations (50-500 microM range). In parallel, these high levels of clofibrate and auxins modify seedling growth and development. Therefore, the expression of CYP94A1 under these conditions and the concomitant morphological and cytological modifications would suggest the implication of this P450 in a process of plant defense against chemical injury.

  5. Promutagen activation of triazine herbicides metribuzin and ametryn through Vicia faba metabolism inducing sister chromatid exchanges in human lymphocytes in vitro and in V. faba root tip meristems.

    Science.gov (United States)

    Flores-Maya, Saúl; Gómez-Arroyo, Sandra; Calderón-Segura, María Elena; Villalobos-Pietrini, Rafael; Waliszewski, Stefan M; de la Cruz, Leticia Gómez

    2005-03-01

    The aim of our study was the induction of sister chromatid exchanges (SCE) in human lymphocytes in vitro and in root tip meristems of Vicia faba to evaluate the genotoxic effects of metribuzin and ametryn. Direct treatments of these herbicides on human lymphocytes in vitro applied 24 h after the beginning of culture did not induce SCE; however, they showed a cytotoxic effect in the cultures expressed as cellular death. On the contrary, when extracts of V. faba roots, treated for 4 h with metribuzin and ametryn (in vivo activation), were added to the lymphocyte cultures, SCEs were significantly induced with an asymptotic response. Negative responses appeared with the in vitro assays, in which metribuzin and ametryn were added directly to the 48 h lymphocyte cultures for 4 h. Nevertheless, in treatments in which the S10 metabolic mix was added, the SCE frequencies were significantly different to the control, although a concentration-response relationship was only observed with metribuzin. The results showed that both herbicides needed the V. faba metabolism to produce SCE in human lymphocyte cultures. Metribuzin and ametryn applied to V. faba root tip meristems for 4 h increased SCE frequency significantly, and a concentration-response relationship was observed with both herbicides.

  6. Contributions of photosynthetic and non-photosynthetic cell types to leaf respiration in Vicia faba L. and their responses to growth temperature.

    Science.gov (United States)

    Long, Benedict M; Bahar, Nur H A; Atkin, Owen K

    2015-11-01

    In intact leaves, mitochondrial populations are highly heterogeneous among contrasting cell types; how such contrasting populations respond to sustained changes in the environment remains, however, unclear. Here, we examined respiratory rates, mitochondrial protein composition and response to growth temperature in photosynthetic (mesophyll) and non-photosynthetic (epidermal) cells from fully expanded leaves of warm-developed (WD) and cold-developed (CD) broad bean (Vicia faba L.). Rates of respiration were significantly higher in mesophyll cell protoplasts (MCPs) than epidermal cell protoplasts (ECPs), with both protoplast types exhibiting capacity for cytochrome and alternative oxidase activity. Compared with ECPs, MCPs contained greater relative quantities of porin, suggesting higher mitochondrial surface area in mesophyll cells. Nevertheless, the relative quantities of respiratory proteins (normalized to porin) were similar in MCPs and ECPs, suggesting that ECPs have lower numbers of mitochondria yet similar protein complement to MCP mitochondria (albeit with lower abundance serine hydroxymethyltransferase). Several mitochondrial proteins (both non-photorespiratory and photorespiratory) exhibited an increased abundance in response to cold in both protoplast types. Based on estimates of individual protoplast respiration rates, combined with leaf cell abundance data, epidermal cells make a small but significant (2%) contribution to overall leaf respiration which increases twofold in the cold. Taken together, our data highlight the heterogeneous nature of mitochondrial populations in leaves, both among contrasting cell types and in how those populations respond to growth temperature. © 2015 John Wiley & Sons Ltd.

  7. Early changes of the pH of the apoplast are different in leaves, stem and roots of Vicia faba L. under declining water availability.

    Science.gov (United States)

    Karuppanapandian, T; Geilfus, C-M; Mühling, K-H; Novák, O; Gloser, V

    2017-02-01

    Changes in pH of the apoplast have recently been discussed as an important factor in adjusting transpiration and water relations under conditions of drought via modulatory effect on abscisic acid (ABA) concentration. Using Vicia faba L., we investigated whether changes in the root, shoot and leaf apoplastic pH correlated with (1) a drought-induced reduction in transpiration and with (2) changes in ABA concentration. Transpiration, leaf water potential and ABA in leaves were measured and correlated with root and shoot xylem pH, determined by a pH microelectrode, and pH of leaf apoplast quantified by microscopy-based in vivo ratiometric analysis. Results revealed that a reduction in transpiration rate in the early phase of soil drying could not be linked with changes in the apoplastic pH via effects on the stomata-regulating hormone ABA. Moreover, drought-induced increase in pH of xylem or leaf apoplast was not the remote effect of an acropetal transport of alkaline sap from root, because root xylem acidified during progressive soil drying, whereas the shoot apoplast alkalized. We reason that other, yet unknown signalling mechanism was responsible for reduction of transpiration rate in the early phase of soil drying. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  8. Scavenger Receptor C-Type Lectin Binds to the Leukocyte Cell Surface Glycan Lewis By a Novel Mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Feinberg, H.; Taylor, M.E.; Weis, W.I.; /Stanford U., Med. School /Imperial Coll., London

    2007-07-10

    The scavenger receptor C-type lectin (SRCL) is unique in the family of class A scavenger receptors, because in addition to binding sites for oxidized lipoproteins it also contains a C-type carbohydrate-recognition domain (CRD) that interacts with specific glycans. Both human and mouse SRCL are highly specific for the Lewis(x) trisaccharide, which is commonly found on the surfaces of leukocytes and some tumor cells. Structural analysis of the CRD of mouse SRCL in complex with Lewis(x) and mutagenesis show the basis for this specificity. The interaction between mouse SRCL and Lewis(x) is analogous to the way that selectins and DC-SIGN bind to related fucosylated glycans, but the mechanism of the interaction is novel, because it is based on a primary galactose-binding site similar to the binding site in the asialoglycoprotein receptor. Crystals of the human receptor lacking bound calcium ions reveal an alternative conformation in which a glycan ligand would be released during receptor-mediated endocytosis.

  9. Transduction of Glycan-Lectin Binding using Near Infrared Fluorescent Single Walled Carbon Nanotubes for Glycan Profiling

    Science.gov (United States)

    Reuel, Nigel; Ahn, Jin-Ho; Kim, Jong-Ho; Zhang, Jingqing; Boghossian, Ardemis; Mahal, Lara; Strano, Michael

    2012-02-01

    In this work, we demonstrate a sensor array employing recombinant lectins as glycan recognition sites tethered via Histidine tags to Ni2+ complexes that act as fluorescent quenchers for semi-conducting single walled carbon nanotubes embedded in a chitosan to measure binding kinetics of model glycans. Two higher-affined glycan-lectin pairs are explored: fucose (Fuc) to PA-IIL and N-acetylglucosamine (GlcNAc) to GafD. The dissociation constants (KD) for these pairs as free glycans (106 and 19 μM respectively) and streptavidin-tethered (142 and 50 μM respectively) were found. The absolute detection limit for the current platform was found to be 2 μg of glycosylated protein or 100 ng of free glycan to 20 μg of lectin. Glycan detection is demonstrated at the single nanotube level (GlcNAc to GafD). Over a population of 1000 nanotubes, 289 of the SWNT sensors had signals strong enough to yield kinetic information (KD of 250 ± 10 μM). We are also able to identify the locations of ``strong-transducers'' on the basis of dissociation constant (4 sensors with KD 5% quench response). The ability to pinpoint strong-binding, single sensors is promising to build a nanoarray of glycan-lectin transducers as a method to profile glycans without protein labeling or glycan liberation pretreatment steps.

  10. Cell-surface changes in cadmium-resistant Euglena: Studies using lectin-binding techniques and flow cytometry

    Energy Technology Data Exchange (ETDEWEB)

    Bonaly, J.; Brochiero, E. [Faculte de Pharmacie, Chatenay-Malabry (France)

    1994-01-01

    Most in vitro studies on contaminants focus on the short-term effects of pollutants on cells, without regard to long-term effects and the ability of cells or microorganisms to develop a specific resistance to a pollutant. Cadmium is ubiquitous environmental contaminant. This heavy metal enters the aquatic environment mainly through vapor emissions and fallout during smelting operations. Diverse mechanisms of algal resistance to toxic metals are known. Among these, the most general mechanism is the development of metal-binding proteins. In cadmium-resistant unicellular Euglena gracilis Z algae cells, the metal did not appear to be sequestered on soluble metal-binding ligands. Previous experiments have shown that resistance development is related to a diminution of cadmium penetration into cells, implicating cell surface or membrane alteration. This research investigates the mechanisms of development of cadmium resistance in Euglena cells at the cell-surface level. Sugar chains of glycoproteins and glycolipids are a predominant feature of the surface of cells. Moreover, the cell-response to environmental changes is often orchestrated through surface macromolecules such as glycoproteins. In this study, we applied this lectin method to investigate surface carbohydrate expression during and after resistance development. Our interest was twofold: (1) to learn more about the carbohydrate composition of the cell-surface of Euglena; and (2) to determine whether transition from wild cells to Cd-resistant cells changes the expression of cell-surface carbohydrates. 13 refs., 2 figs., 1 tab.

  11. Studies on the relationship between lectin binding carbohydrates and different strains of Leishmania from the New World

    Directory of Open Access Journals (Sweden)

    J. Schottelius

    1982-03-01

    Full Text Available The culture forms of L. mexicana pifanoi (LRC L-90, L. mexicana mexicana (LRC L-94, M-379; L. braziliensis braziliensis (LRC L-77, L-1, M-2903, H-LSS and L. mexicana amazonensis (H-JMMO, M-JOF, H-21, H-PLL,M-1696 were tested with the following lectins: Canavalia ensiformis, Ricinus communis-120, Axinella polypoides, Phaseolus vulgaris, Evonymus europaeus, lotus tetragonolobus, Dolichos biflorus, Aaptos papillata II, Laburnum alpinum, Ulex europaeus, Arachis hypogaea and Soja hispida. All examined strains of Leishmania were agglutinated by C. ensiformis, R. communis-120 and A. popypoides. No agglutination reactions were observed with P. vulgaris, D.biflorus, A. papillata II, E. europaeus and L. tetragonolobus. Only L. m. pifanoi and the L. m. amazonensis strains H-JMMO and MJOF showed agglutination reactions with S. hispida, U. europaeus, L. alpinum and A. hypogaea, while L. m. mexicana (LRC L-94; M-379 strains, L. b. braziliensis H. LSS, LRC L-77; L-1; M-2903 and the L. m. amazonensis strains, H-PLL, H-21, M-1696 showed no agglutination reactions with these four lectins.

  12. Alterations in lectin binding to the epidermis following treatment with 8-methoxypsoralen plus long-wave ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Danno, K.; Takigawa, M.; Horio, T.

    1984-02-01

    The alterations in lectin fluorescence stainings to the epidermis were examined in guinea pig skin treated with topical application of a 1% 8-methoxypsoralen (8-MOP) solution plus long-wave ultraviolet (UVA) radiation (1.5-3.5 J/cm2) (PUVA). Serial biopsy specimens taken up to 21 days postirradiation were stained with 8 commercially available lectins labeled with either fluorescein isothiocyanate (FITC) or biotin (followed by avidin D-FITC): Bandeiraea simplicifolia agglutinin I (BSA), concanavalin A (Con-A), Dolichos biflorus agglutinin (DBA), peanut agglutinin (PNA), Ricinus communis agglutinin I (RCA), soybean agglutinin (SBA), Ulex europeus agglutinin I (UEA), and wheat germ agglutinin (WGA). In normal guinea pig skin UEA staining was absent. Following PUVA treatment, UEA and DBA stainings became apparent or stronger in intensity after days 7-14 (UEA) and days 4-7 (DBA), respectively, and returned to negative or weak by days 14-21. Stainings with Con-A, SBA, and WGA gave remarkable decreases in intensity after days 2-4 and recovered to the baseline by days 7-14. Intensity of BSA, PNA, and RCA stainings was decreased to a lesser degree than the other lectins. Such changes were not produced by application of 8-MOP, UVA radiation (less than 10 J/cm2), UVB radiation (900-2700 mJ/cm2), or tape stripping. These results suggest that PUVA treatment perturbs the composition or organization of epidermal cell surface glycoconjugates to induce alterations in lectin stainings.

  13. Differential Lectin Binding Patterns Identify Distinct Heart Regions in Giant Danio (Devario aequipinnatus) and Zebrafish (Danio rerio) Hearts

    Science.gov (United States)

    Manalo, Trina; May, Adam; Quinn, Joshua; Lafontant, Dominique S.; Shifatu, Olubusola; He, Wei; Gonzalez-Rosa, Juan M.; Burns, Geoffrey C.; Burns, Caroline E.; Burns, Alan R.; Lafontant, Pascal J.

    2016-01-01

    Lectins are carbohydrate-binding proteins commonly used as biochemical and histochemical tools to study glycoconjugate (glycoproteins, glycolipids) expression patterns in cells, tissues, including mammalian hearts. However, lectins have received little attention in zebrafish (Danio rerio) and giant danio (Devario aequipinnatus) heart studies. Here, we sought to determine the binding patterns of six commonly used lectins—wheat germ agglutinin (WGA), Ulex europaeus agglutinin, Bandeiraea simplicifolia lectin (BS lectin), concanavalin A (Con A), Ricinus communis agglutinin I (RCA I), and Lycopersicon esculentum agglutinin (tomato lectin)—in these hearts. Con A showed broad staining in the myocardium. WGA stained cardiac myocyte borders, with binding markedly stronger in the compact heart and bulbus. BS lectin, which stained giant danio coronaries, was used to measure vascular reconstruction during regeneration. However, BS lectin reacted poorly in zebrafish. RCA I stained the compact heart of both fish. Tomato lectin stained the giant danio, and while low reactivity was seen in the zebrafish ventricle, staining was observed in their transitional cardiac myocytes. In addition, we observed unique staining patterns in the developing zebrafish heart. Lectins’ ability to reveal differential glycoconjugate expression in giant danio and zebrafish hearts suggests they can serve as simple but important tools in studies of developing, adult, and regenerating fish hearts. PMID:27680670

  14. Labeling of Carbon Pools in Bradyrhizobium japonicum and Rhizobium leguminosarum bv viciae Bacteroids following Incubation of Intact Nodules with CO(2).

    Science.gov (United States)

    Salminen, S O; Streeter, J G

    1992-10-01

    The aim of the work reported here was to ascertain that the patterns of labeling seen in isolated bacteroids also occurred in bacteroids in intact nodules and to observe early metabolic events following exposure of intact nodules to (14)CO(2). Intact nodules of soybean (Glycine max L. Merr. cv Ripley) inoculated with Bradyrhizobium japonicum USDA 110 and pea (Pisum sativum L. cv Progress 9) inoculated with Rhizobium leguminosarum bv viciae isolate 128C53 were detached and immediately fed (14)CO(2) for 1 to 6 min. Bacteroids were purified from these nodules in 5 to 7 min after the feeding period. In the cytosol from both soybean and pea nodules, malate had the highest radioactivity, followed by citrate and aspartate. In peas, asparagine labeling equaled that of aspartate. In B. japonicum bacteroids, malate was the most rapidly labeled compound, and the rate of glutamate labeling was 67% of the rate of malate labeling. Aspartate and alanine were the next most rapidly labeled compounds. R. leguminosarum bacteroids had very low amounts of (14)C and, after a 1-min feeding, malate contained 90% of the radioactivity in the organic acid fraction. Only a trace of activity was found in aspartate, whereas the rate of glutamate and alanine labeling approached that of malate after 6 min of feeding. Under the conditions studied, malate was the major form of labeled carbon supplied to both types of bacteroids. These results with intact nodules confirm our earlier results with isolated bacteroids, which showed that a significant proportion of provided labeled substrate, such as malate, is diverted to glutamate. This supports the conclusion that microaerobic conditions in nodules influence carbon metabolism in bacteroids.

  15. Protein quality in cereals and pulses. 2. Influence of polyethyleneglycol on the nutritional availability of methionine in sorghum (Sorghum vulgar Pers.), field beans (Vicia faba L.) and barley.

    Science.gov (United States)

    Ford, J E; Hewitt, D

    1979-09-01

    1. Polyethyleneglycol (PEG 4000) was examined for its influence on relative nutritional value (RNV) and available methionine in sorghum (Sorghum vulgare Pers.), field beans (Vicia faba L.) and barley, as measured microbiologically with Streptococcus zymogenes. The results were assessed in relation to the content of tannins in the test samples. 2. In grain of hybrid sorghum the RNV averaged 87 (range 79--92) for six low-tannin varieties and 41 (30--53) for eleven high-tannin varieties. The corresponding available methionine values averaged 17.0 (15.7--18.9) and 8.9 (6.7--11.0) g/kg protein. Addition of PEG 4000 to the test samples increased the average RNV of the high-tannin varieties from 41 to 78, and the average available methionine content from 8.9 to 16.2 g/kg protein. 3. With seed of ten coloured flowered varieties of field beans, treatment with PEG gave a small but consistent increase in the available methionine content, which resulted from the inactivation of tannins in the testa. 4. In twenty-three samples of barley grain, treatment with PEG had no effect on the values obtained for available methionine. 5. Treatment of high-tannin sorghum grain with ammonia has been reported to inactivate the tannins and increase the nutritional value for rats and chicks. This finding was confirmed. The present study showed that ammonia and PEG 4000 were equally effective in enhancing the nutritional quality as measured in the microbiological tests.

  16. Evaluation of barley (Hordeum vulgare L. and faba bean (Vicia faba L. yield in different density and mixture intercropping via competition indices

    Directory of Open Access Journals (Sweden)

    F Eslami Khalili

    2016-05-01

    Full Text Available In order to study the intercropping of barley (Hordeum vulgare L. and faba bean (Vicia faba L. an experiment was conducted as factorial based on randomized complete block design with two factors and three replications at Sari Agricultural Science and Natural Resources University during 2009. The first factor was two seed ratios include D1: 75 and 150 kg.ha-1 of faba bean and barley, respectively (optimum seed ratio and D2: 100 and 200 kg.ha-1 of faba bean and barley, respectively (high seed ratio and the second factor consisted of different planting ratio, P1: sole cropping of faba bean, P2: 50% faba bean + 50 % barley, P3: 75% faba bean + 25% barley, P4: 25% faba bean + 75% barley, P5: sole cropping of barley. Land equivalent ratio (LER indicated that intercropping of 25% faba bean + 75% barley was better than 50% faba bean + 50% barley. According to significant interaction effects of density and intercropping ratio in terms of seed yield and some competitive indices for both crop species, the highest barley and faba bean yield (3306.66 and 4884.56 kg.ha-1, respectively were observed in sole cropping with high density. In this experiment, the 75 % faba bean + 25 % mixture with high density was recorded highest intercropping yield, barley aggressivity value and 27% yield increases of barley in mix-proportion compared to sole crops. Also, the most of faba bean aggressivity value and faba bean yield increases in mix-proportion compared to sole crop were obtained when 25% faba bean + 75% barley mixture with optimum density was used. Furthermore the 75% faba bean + 25% barley treatment plus optimum seed ratio had highest system productivity index.

  17. ABA induces H2O2 production in guard cells, but does not close the stomata on Vicia faba leaves developed at high air humidity

    Science.gov (United States)

    Arve, Louise E; Carvalho, Dália RA; Olsen, Jorunn E; Torre, Sissel

    2014-01-01

    Plants developed under constant high (> 85%) relative air humidity (RH) have larger stomata that are unable to close completely. One of the hypotheses for the less responsive stomata is that the plants have reduced sensitivity to abscisic acid (ABA). Both ABA and darkness are signals for stomatal closure and induce the production of the secondary messenger hydrogen peroxide (H2O2). In this study, the ability of Vicia faba plants developed in moderate or high RH to close the stomata in response to darkness, ABA and H2O2 was investigated. Moreover, the ability of the plants to produce H2O2 when treated with ABA or transferred to darkness was also assessed. Our results show that the ABA concentration in moderate RH is not increased during darkness even though the stomata are closing. This indicates that stomatal closure in V. faba during darkness is independent of ABA production. ABA induced both H2O2 production and stomatal closure in stomata formed at moderate RH. H2O2 production, as a result of treatment with ABA, was also observed in stomata formed at high RH, though the closing response was considerably smaller as compared with moderate RH. In either RH, leaf ABA concentration was not affected by darkness. Similarly to ABA treatment, darkness elicited both H2O2 production and stomatal closure following plant cultivation at moderate RH. Contrary to this, neither H2O2 production nor stomatal closure took place when stomata were formed at high RH. These results suggest that the reduced stomatal response in plants developed in continuous high RH is caused by one or more factors downstream of H2O2 in the signaling pathway toward stomatal closure. PMID:25763494

  18. Citotoxicidad y genotoxicidad de las aguas de los ríos Jequetepeque y Moche mediante el bioindicador ambiental Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Raúl Antonio Beltrán Orbegoso

    2017-01-01

    Full Text Available La evaluación de la toxicidad de las aguas de los ríos como método complementario al análisis físico, químico y biológico proporciona una información integral de la calidad del agua, por tanto, el objetivo del estudio fue determinar los niveles de citotoxicidad y genotoxicidad de las aguas de las cuencas alta, media y baja de los ríos Moche y Jequetepeque, usando el bioindicador ambiental Vicia faba L. “haba” (2n = 12. Se germinaron semillas de V. faba L.; luego las raicillas emergentes se expusieron, durante tres horas, a siete tratamientos: T1 (100 ml de agua destilada, T2 (1 ml agua de río Jequetepeque / 99 ml de agua destilada, T3 (5 ml agua de río Jequetepeque/ 95 ml de agua destilada, T4 (10 ml agua de río Jequetepeque/ 90 ml de agua destilada, T5 (1 ml agua de río Moche/ 99 ml de agua destilada, T6 (5 ml agua de río Moche/ 95 ml de agua destilada y T7 (10 ml agua de río Moche/ 90 ml de agua destilada. Los ápices de las raicillas fueron sometidos a la técnica de Tjio y Levan. El agua de la cuenca media del río Moche del T7, presenta una alta citotoxicidad (índice mitótico de 5,4 % y alteraciones de los índices de fases y un alto efecto genotóxico; las aguas del río Jequetepeque no evidencian efecto citotóxico ni genotóxico de importancia.

  19. Polycyclic aromatic hydrocarbon-contaminated soils: bioaugmentation of autochthonous bacteria and toxicological assessment of the bioremediation process by means of Vicia faba L.

    Science.gov (United States)

    Ruffini Castiglione, Monica; Giorgetti, Lucia; Becarelli, Simone; Siracusa, Giovanna; Lorenzi, Roberto; Di Gregorio, Simona

    2016-04-01

    Two bacterial strains, Achromobacter sp. (ACH01) and Sphingomonas sp. (SPH01), were isolated from a heavily polycyclic aromatic hydrocarbon (PAH)-contaminated soil (5431.3 ± 102.3 ppm) for their capacity to use a mixture of anthracene, pyrene, phenanthrene and fluorene as sole carbon sources for growth and for the capacity to produce biosurfactants. The two strains were exploited for bioaugmentation in a biopile pilot plant to increase the bioavailability and the degradation of the residual PAH contamination (99.5 ± 7.1 ppm) reached after 9 months of treatment. The denaturing gel gradient electrophoresis (DGGE) profile of the microbial ecology of the soil during the experimentation showed that the bioaugmentation approach was successful in terms of permanence of the two strains in the soil in treatment. The bioaugmentation of the two bacterial isolates positively correlated with the PAH depletion that reached 7.9 ± 2 ppm value in 2 months of treatment. The PAH depletion was assessed by the loss of the phyto-genotoxicity of soil elutriates on the model plant Vicia faba L., toxicological assessment adopted also to determine the minimum length of the decontamination process for obtaining both the depletion of the PAH contamination and the detoxification of the soil at the end of the process. The intermediate phases of the bioremediation process were the most significant in terms of toxicity, inducing genotoxic effects and selective DNA fragmentation in the stem cell niche of the root tip. The selective DNA fragmentation can be related to the selective induction of cell death of mutant stem cells that can compromise offsprings.

  20. Infestation of Broad Bean (Vicia faba) by the Green Stink Bug (Nezara viridula) Decreases Shoot Abscisic Acid Contents under Well-Watered and Drought Conditions.

    Science.gov (United States)

    Ederli, Luisa; Brunetti, Cecilia; Centritto, Mauro; Colazza, Stefano; Frati, Francesca; Loreto, Francesco; Marino, Giovanni; Salerno, Gianandrea; Pasqualini, Stefania

    2017-01-01

    The response of broad bean (Vicia faba) plants to water stress alone and in combination with green stink bug (Nezara viridula) infestation was investigated through measurement of: (1) leaf gas exchange; (2) plant hormone titres of abscisic acid (ABA) and its metabolites, and of salicylic acid (SA); and (3) hydrogen peroxide (H2O2) content. Furthermore, we evaluated the effects of experimentally water-stressed broad-bean plants on N. viridula performance in terms of adult host-plant preference, and nymph growth and survival. Water stress significantly reduced both photosynthesis (A) and stomatal conductance (gs ), while infestation by the green stink bug had no effects on photosynthesis but significantly altered partitioning of ABA between roots and shoots. Leaf ABA was decreased and root ABA increased as a result of herbivore attack, under both well-watered and water-deprived conditions. Water stress significantly impacted on SA content in leaves, but not on H2O2. However, infestation of N. viridula greatly increased both SA and H2O2 contents in leaves and roots, which suggests that endogenous SA and H2O2 have roles in plant responses to herbivore infestation. No significant differences were seen for green stink bug choice between well-watered and water-stressed plants. However, for green stink bug nymphs, plant water stress promoted significantly lower weight increases and significantly higher mortality, which indicates that highly water-stressed host plants are less suitable for N. viridula infestation. In conclusion two important findings emerged: (i) association of water stress with herbivore infestation largely changes plant response in terms of phytohormone contents; but (ii) water stress does not affect the preference of the infesting insects, although their performance was impaired.

  1. ABA induces H2O2 production in guard cells, but does not close the stomata on Vicia faba leaves developed at high air humidity.

    Science.gov (United States)

    Arve, Louise E; Carvalho, Dália R A; Olsen, Jorunn E; Torre, Sissel

    2014-01-01

    Plants developed under constant high (> 85%) relative air humidity (RH) have larger stomata that are unable to close completely. One of the hypotheses for the less responsive stomata is that the plants have reduced sensitivity to abscisic acid (ABA). Both ABA and darkness are signals for stomatal closure and induce the production of the secondary messenger hydrogen peroxide (H2O2). In this study, the ability of Vicia faba plants developed in moderate or high RH to close the stomata in response to darkness, ABA and H2O2 was investigated. Moreover, the ability of the plants to produce H2O2 when treated with ABA or transferred to darkness was also assessed. Our results show that the ABA concentration in moderate RH is not increased during darkness even though the stomata are closing. This indicates that stomatal closure in V. faba during darkness is independent of ABA production. ABA induced both H2O2 production and stomatal closure in stomata formed at moderate RH. H2O2 production, as a result of treatment with ABA, was also observed in stomata formed at high RH, though the closing response was considerably smaller as compared with moderate RH. In either RH, leaf ABA concentration was not affected by darkness. Similarly to ABA treatment, darkness elicited both H2O2 production and stomatal closure following plant cultivation at moderate RH. Contrary to this, neither H2O2 production nor stomatal closure took place when stomata were formed at high RH. These results suggest that the reduced stomatal response in plants developed in continuous high RH is caused by one or more factors downstream of H2O2 in the signaling pathway toward stomatal closure.

  2. [Dendritic arborization patterns of interneurons labeled with a lectin, Vicia villosa, in rat cerebral cortex: studies by intracellular injection of lucifer yellow using aldehyde-fixed slices].

    Science.gov (United States)

    Ojima, H

    1993-04-01

    In order to characterize the dendritic field of a number of interneurons in the cerebral cortex, the labeling of extracellular sugar chains which define a subset of interneurons was combined with the subsequent intracellular filling of dyes in aldehyde-fixed tissue. Neurons whose cell body had been outlined by a lectin, Vicia villosa (VVA), which recognizes terminal N-acetylgalactosamine, were intracellularly injected with a fluorescent tracer, Lucifer yellow (LY), in the rat parietal cortex under direct visualization. After immunohistochemical detection of LY, somal morphology and the dendritic fields of injected neurons were reconstructed from serial sections and characterized in each of the layers II/III, IV, V and VI. Multipolar, flask-shaped and bitufted somata were VVA-positive. Multipolar neurons with round soma and spherical dendritic field were found in layers II/III, IV and V, while those with vertically elongated dendritic fields were found in layer VI. Cell bodies were located roughly in the center of the spherical or cylindrical dendritic fields. Neurons with apparently multipolar but flask- or pear-shaped soma were found frequently in layer IV, and much less frequently in layer II/III and VI. The majority of the dendrites originated from the neck portion of flask and formed a roughly spherical dendritic field with the cell body located more or less eccentrically. Some neurons in layer IV had an oval, somewhat vertically elongated soma and displayed a typical bitufted dendritic arborization pattern with vertically elongated dendritic fields. The overall dendritic field sizes of the cells gradually increased at deeper layers of the cortex.(ABSTRACT TRUNCATED AT 250 WORDS)

  3. Bacterially produced Pt-GFP as ratiometric dual-excitation sensor for in planta mapping of leaf apoplastic pH in intact Avena sativa and Vicia faba.

    Science.gov (United States)

    Geilfus, Christoph-Martin; Mühling, Karl H; Kaiser, Hartmut; Plieth, Christoph

    2014-01-01

    Ratiometric analysis with H(+)-sensitive fluorescent sensors is a suitable approach for monitoring apoplastic pH dynamics. For the acidic range, the acidotropic dual-excitation dye Oregon Green 488 is an excellent pH sensor. Long lasting (hours) recordings of apoplastic pH in the near neutral range, however, are more problematic because suitable pH indicators that combine a good pH responsiveness at a near neutral pH with a high photostability are lacking. The fluorescent pH reporter protein from Ptilosarcus gurneyi (Pt-GFP) comprises both properties. But, as a genetically encoded indicator and expressed by the plant itself, it can be used almost exclusively in readily transformed plants. In this study we present a novel approach and use purified recombinant indicators for measuring ion concentrations in the apoplast of crop plants such as Vicia faba L. and Avena sativa L. Pt-GFP was purified using a bacterial expression system and subsequently loaded through stomata into the leaf apoplast of intact plants. Imaging verified the apoplastic localization of Pt-GFP and excluded its presence in the symplast. The pH-dependent emission signal stood out clearly from the background. PtGFP is highly photostable, allowing ratiometric measurements over hours. By using this approach, a chloride-induced alkalinizations of the apoplast was demonstrated for the first in oat. Pt-GFP appears to be an excellent sensor for the quantification of leaf apoplastic pH in the neutral range. The presented approach encourages to also use other genetically encoded biosensors for spatiotemporal mapping of apoplastic ion dynamics.

  4. IMPROVING THE TOLERANCE OF Vicia faba AGAINST ENVIRONMENTAL SALINITY RESULTED FROM THE IRRIGATION WITH SEA WATER BY USING KNO3 AND (NH42SO4 AS CHEMICAL OSMOREGULATORS Mejoramiento de la tolerancia de Vicia faba a salinidad ocasionada por irrigación con agua de mar usando KNO3 AND (NH42SO4 como osmoreguladores químicos

    Directory of Open Access Journals (Sweden)

    KAMEL MOHAMED

    2012-05-01

    Full Text Available The familiar solutes, Na+, K+, Ca2+, Mg2+, Cl-, PO4(3-, SO4(2-, soluble carbohydrates, amino acids and soluble proteins, which play a role in osmotic adjustment were estimated to investigate the role of potassium nitrate and ammonium sulphate as osmoregulators and their effects on the solutes composition. Vicia faba L. was cultivated and irrigated with 5, 10, 15 and 20 % (v:v sea water. The plants were divided to three groups. The first was irrigated with sea water only. The second was treated with 5 mM KNO3 while the third was treated with 5mM (NH42SO4. The plants were left to grow until flowering stage. The results indicated that the non treated group increased the soluble carbohydrates in the roots to avoid the influx of sodium. The treatment with KNO3 decreased the sodicity (SAR while (NH42SO4 treatment decreased the SK:Na value in the shoots at higher salinity. The availability of nitrogen as nitrate or ammonium ions enhances the accumulation of soluble carbohydrates in shoots. The plants of all groups were depended on Ca2+, as compatible solute more than Na+, and K+.Los solutos Na+, K+, Ca2+, Mg2+, Cl-, PO4(3-, SO4(2-, carbohidratos y proteínas solubles, así como amino ácidos son importantes en ajuste osmótico y fueron estimados para determinar el papel de nitrato de potasio y sulfato de amonio como osmoreguladores y su efecto en la composición de solutos. Vicia faba L. fue cultivada e irrigada con 5, 10, 15 y 20 % (v:v de agua de mar permitiendo crecimiento hasta el estado de floración. Las plantas fueron divididas en tres grupos. El primero fue irrigado con agua de mar solamente. El segundo fue tratado con 5 mM KNO3, mientras que el tercer grupo fue expuesto a 5mM (NH42SO4. Los resultados indican que las plantas del primer grupo (no tratado incrementan carbohidratos solubles en sus raíces para evitar influjo de sodio. El tratamiento con KNO3 disminuye riqueza de sodio (SAR mientras que la exposición a (NH42SO4 diminuye la de SK

  5. Recipient-induced transfer of the symbiotic plasmid pRL1JI in Rhizobium leguminosarum bv. viciae is regulated by a quorum-sensing relay.

    Science.gov (United States)

    Danino, Vittoria E; Wilkinson, Adam; Edwards, Anne; Downie, J Allan

    2003-10-01

    Analysis of the regulation of plasmid transfer genes on the symbiotic plasmid pRL1JI in Rhizobium leguminosarum bv. viciae has revealed a novel regulatory relay that is specifically poised to detect an N-acyl-homoserine lactone (AHL) made by different cells (potential recipients of pRL1JI). Adjacent to the traI-trbBCDEJKLFGHI plasmid transfer operon on pRL1JI are two regulatory genes, bisR and traR, which encode LuxR-type quorum-sensing regulators required for conjugation. Potential recipients of pRL1JI induce the traI-trb operon and plasmid transfer via a quorum-sensing relay involving BisR, TraR and the traI-trb operon in donor cells. BisR induces expression of traR in response to N-(3-hydroxy-7-cis-tetradecenoyl)-l-homoserine lactone (3-OH-C14:1-HSL), which is produced by CinI in potential recipient strains. In donor strains (carrying pRL1JI), BisR represses the expression of the chromosomal gene cinI; this repression results in a very low level of formation of 3-OH-C14:1-HSL and hence relatively low levels of expression of traR and the traI-trb operon in strains carrying pRL1JI. However, if 3-OH-C14:1-HSL from potential recipients is present, then traR and plasmid transfer are induced. The induction of traR occurs at very low concentrations of 3-OH-C14:1-HSL (around 1 nm). TraR then induces the traI-trb operon in a quorum-sensing dependent manner in re-sponse to the TraI-made AHLs, N-(3-oxo-octanoyl)-l-homoserine lactone and N-(octanoyl)-l-homoserine lactone. The resulting autoinduction results in high levels of expression of the traI-trb operon. Premature expression of the traI-trb operon is reduced by TraM, which probably titres out TraR preventing expression of traI when there are low levels of traR expression. Expression of traR in stationary phase cells is limited by feedback inhibition mediated by TraI-made AHLs.

  6. Raw Pea (Pisum sativum, raw Faba bean (Vicia faba var. minor and raw Lupin (Lupinus albus var. multitalia as alternative protein sources in broiler diets

    Directory of Open Access Journals (Sweden)

    Gianfranco Piva

    2010-01-01

    Full Text Available The ban of the meat and bone meal for entering animal diets and the concern of transgenic feeds poses a challenge toanimal nutritionists in Europe. The challenge is to find homegrown protein-rich feedstuffs, making sure no antinutritionalfactors are present which could interfere in the animals’ performance. The raw Pea (Pisum sativum (RP, raw Fababean (Vicia faba, variety minor (RFb and raw Lupin (Lupinus albus, variety multitalia (RL were evaluated as alternativeprotein sources into broiler diets. Six hundred thirty 1d-old Ross male chicks, Marek vaccinated, were randomlyassigned to seven dietary treatments (5 pens per treatment/18 birds per pen. Chicks were floor housed, ad libitum fedisocaloric and isonitrogenous diets and had free access to water. Artificial light was provided 10 h/d. The bulk of the basediet (control diet was corn (48.7%, 56.6% and 57%, solvent-extracted soybean meal (42.8%, 37.3% and 33.4%, cornoil (4.4%, 5.2% and 6.3%, plus synthetic amino acids, minerals, trace minerals and vitamins, respectively for the 1-10d-old, 11-28d-old and 29 to 42d-old growing periods. The RP, RFb and RL entered diets in substitution of the soybeanand corn according to the cost optimization (P100, Fb100 and L100, respectively for RP, RFb and RL and at half of theoptimized quantity (RP50, RFb50 and RL50, respectively for RP, RFb and RL. The amount used as fed basis for the higherlevel of inclusion were: P100: 350 g/kg for all diets; Fb100: 480 g/kg (1-10d-old and 500 g/kg (11-42d-old; L100:360 g/kg (1-10d-old and 300 g/kg (11-42d-old. The average daily gain (ADG were lower (P compared to the control group. Over the whole period of growth, the RFb group had similar ADG compared to the controlgroup and for both levels of inclusion, whereas reduced (P (P growth. Birds performance was improved (P and breast and leg quarter cuts. The RFb and RL could represent valuable protein feeds in broilers diet formulation.

  7. Evaluation of microbial biomass C and N content of the soils cultivated with vetch (Vicia sativa L. and alfalfa (Medicago sativa L.

    Directory of Open Access Journals (Sweden)

    İlyas Bolat

    2016-01-01

    Full Text Available Legume forage crops have the ability of retaining free nitrogen in the air through symbiotic Rhizobium bacteria found in their roots. Additionally, microbial biomass (MB–an essential living component of soil and a significant factor influencing plant nutrient dynamics–is considered to be accurate indicator of soil’s biological condition. Given the aforementioned aspects, soil MB C (Cmic and MB N (Nmic of different legume forage crops were investigated in this study. Soil samples were taken in order to identify certain physical and chemical characteristics of the soil using volume cylinders (0 – 6.5 cm depth from Vicia sativa L. (VSP and Medicago sativa L. planted (MSP areas. To determine the Cmic and Nmic contents, topsoil samples were also taken from 0 – 6.5 cm depth. Cmic and Nmic contents were identified using chloroform – fumigation – extraction method. There was no statistical significance for particle density, bulk density, electrical conductivity, CaCO3 %, and decomposition ratio (Corg/Ntotal of the VSP and MSP soil (P > 0.05. However, some other soil characteristics such as temperature, porosity, sand, silt and clay contents, pH, organic C and total N differed significantly (P < 0.05. Compared to VSP soil, the Cmic contents were determined to be 27 % higher (P < 0.05 in MSP soil. In VSP soil, the soil Nmic content ranged from 83.38 µg g-1 to 124.67 µg g-1, while it ranged from 91.62 µg g-1 to 187.07 µg g-1 in MSP soil. The Nmic content of the MSP soil was observed to be approximately 35 % higher than VSP soil, and a statistically significant difference (P < 0.05 was noticed between the two. Moreover, a significant positive correlation was found not only between the Cmic and organic C contents (r = 0.667; P < 0.05 but also between the Nmic and total N contents of MSP and VSP soil (r = 0.881; P < 0.01. The results of the study revealed that soil Cmic and Nmic values differ as the types of planted legume forage crops

  8. Integration of sunflower (Helianthus annuus residues with a pre-plant herbicide enhances weed suppression in broad bean (Vicia faba Integração de resíduos de girassol (Helianthus annuus com herbicida pré-emergente na supressão de plantas daninhas na cultura da fava (Vicia faba

    Directory of Open Access Journals (Sweden)

    I.S Alsaadawi

    2011-12-01

    Full Text Available Field trial was conducted with the aim of utilizing allelopathic crop residues to reduce the use of synthetic herbicides in broad bean (Vicia faba fields. Sunflower residue at 600 and 1,400 g m-2 and Treflan (trifluralin at 50, 75 and 100% of recommended dose were incorporated into the soil alone or in combination with each other. Untreated plots were maintained as a control. Herbicide application in plots amended with sunflower residue had the least total weed count and biomass, which was even better than herbicide used alone. Integration of recommended dose of Treflan with sunflower residue at 1,400 g m-² produced maximum (987.5 g m-2 aboveground biomass of broad bean, which was 74 and 36% higher than control and recommended herbicide dose applied alone, respectively. Combination of herbicide and sunflower residue appeared to better enhance pod number and yield per unit area than herbicide alone. Application of 50% dose of Treflan in plots amended with sunflower residue resulted in similar yield advantage as was noticed with 100% herbicide dose. Chromatographic analysis of residue-infested field soil indicated the presence of several phytotoxic compounds of phenolic nature. Periodic data revealed that maximum suppression in weed density and dry weight synchronized with peak values of phytotoxins observed 4 weeks after incorporation of sunflower residues. Integration of sunflower residues with lower herbicide rates can produce effective weed suppression without compromising yield as a feasible and environmentally sound approach in broad bean fields.O experimento foi realizado com o objetivo de utilizar resíduos agrícolas com potencial alelopático para reduzir o uso de herbicidas sintéticos em fava (Vicia faba. Resíduos de girassol (600 e 1,400 g m-2 e Treflan (50, 75 e 100% da dose recomendada foram incorporados ao solo isoladamente ou em combinação uns com os outros. Parcelas não tratadas foram mantidas como controle. A aplicação de

  9. Pea seeds (Pisum sativum, faba beans (Vicia fabavar. minor and lupin seeds (Lupinus albus var. multitalia as protein sources in broiler diets: effect of extrusion on growth performance

    Directory of Open Access Journals (Sweden)

    Gianfranco Piva

    2010-01-01

    Full Text Available The effect of extrusion of pea seeds (Pisum sativum (PS, faba bean (Vicia faba, variety minor (FB and lupin seeds (Lupinus albus, variety multitalia (LS on broiler performance were evaluated. Four hundred sixty two 1d-old Ross male chicks, Marek vaccinated, were randomly assigned to seven dietary treatments (3 pens per treatment/22 birds per pen. Chicks were floor housed, ad libitum fed isocaloric and isonitrogenous diets and had free access to water. Artificial light was provided 10 h/d. The bulk of the base diet (control diet was corn (48.8%, 53.7% and 57%, solvent-extracted soy- bean meal (42.8%, 37.3% and 33.4%, corn oil (4.4%, 5.2% and 6.3%, plus synthetic amino acids, minerals, trace minerals and vitamins, respectively for the 1-10d-old, 11-28d-old and 29 to 42d-old growing periods. The amounts of PS, FB and LS used on an as fed basis were: PS and extruded PS (EPS: 353 (1-10d-old, 356 (11-28d-old and 350 (29- 42d-old g/kg; FB and extruded FB (EFB: 479 (1-10d-old, 497 (11-28d-old and 500 (29-42d old g/kg; LS and extrud- ed LS (ELS: 360 (1-10d-old and 300 (11-42d-old g/kg. High levels of pea (350 g/kg and faba bean (500 g/kg did not show negative effects on body weight gain (BWG and bird feed intake compared to control. Lupin at the 300 g/kg level reduced (P< 0.05 the BWG during the finishing period (22 to 42 d, however the effect disappeared over the whole experimental period (1-42 d compared to the control group. The ELS group had a lower (P< 0.01 feed intake com- pared to the control group and to the LS group. The feed conversion rate (FCR was similar among groups for the whole experimental period; however during the grower period the FCR was higher (P< 0.05 for the PS, FB and EFB groups com- pared to the control group. Birds consuming the PS diet had a reduced (P< 0.05 eviscerated carcass yield compared to the control group. The breast meat percent yield was higher (P< 0.01 for birds consuming the FB and EFB diets compared to the control

  10. LC-MSdetermination of L-DOPA concentration in the leaf and flower tissues of six faba bean (Vicia fabaL. lines with common and rare flowercolors

    Directory of Open Access Journals (Sweden)

    Jinguo Hu

    2015-07-01

    Full Text Available Background: Parkinson’s disease (PD is the second most common neurodegenerative disorder characterized by the loss of muscle control, which causes trembling of the limbs and head as well as impaired balance. L-DOPA (L-3,4-dihydroxy phenylalanine is the major ingredient of several prescription drugs used to treat PD. Faba bean (Vicia faba L. is one of the few plant species that is known to produce L-DOPA and has the potential to be developed as a functional food crop for people suffering with PD. Objective: Aimed to provide needed information for people who want to use faba bean as a natural remedy or functional food to relieve PD symptoms, this study analyzed the variation of L-DOPA concentration in the leaf and flower tissues of six faba bean lines with common and rare flower colors. Methods: Leaf and flower samples were taken from field grown plants with different flower colors, namely, pink with purple lines and black dots, pure white, brown, and crimson. Samples were freeze-dried and L-DOPA was quantified by a LC-MS system consisting of an ACQUITY UPLC in line with a Synapt G2 HDMS quadrupole time-of-flight mass spectrometer. This experiment was carried out in two consecutive years (2012 and 2013 and the plants used in the second year were grown from the seeds harvested from the plants used in the first year. Results and Discussion: Our two-year study revealed a high level of variation in L-DOPA concentration for leaf and flower tissues among the six faba bean lines studied. The average L-DOPA concentration based on dry weight (DW in flowers ranged from 27.8 to 63.5 mg/g and 18.2 to 48.7 mg/g for leaf tissues. There was no significant correlation between L-DOPA concentrations in flowers and leaves. The L-DOPA concentration in flowers and in leaves of the same line varied but were not statistically significant between the two years. Ideally, the genotype with the highest average L-DOPA concentration in both flowers and leaves would be grown

  11. Anbautelegramm Saatwicke (Vicia sativa L.)

    OpenAIRE

    Böhm, Herwart; Weissmann, Elmar

    2013-01-01

    Für den Anbau von Saatwicken werden in einem kurzgefassten Anbautelegramm die Stärken und Schwächen sowie grundlegende Kennwerte zu Standortansprüchen, Aussaat, Unkrautregulierung, Nährstoffbedarf und Schaderregern beschrieben.

  12. (Vicia faba) IN SOUTHERN ETHIOPIA

    African Journals Online (AJOL)

    Win7Ent

    2013-06-03

    Jun 3, 2013 ... iron, zinc, calcium, riboflavin, vitamin A, and vitamin C [4]. Although Ethiopia has a fairly large livestock population, availability of meat and milk for local human consumption is limited, especially in rural areas where wealth index values are in the lower quintiles, according to the most recent Demographic ...

  13. (Vicia faba) IN SOUTHERN ETHIOPIA

    African Journals Online (AJOL)

    Win7Ent

    2013-06-03

    Jun 3, 2013 ... in 22.5, 4.7, and 8.3% of study children, respectively. Questionnaires ..... this study, however, requires preparation of the raw ingredients. .... Survey 2009/10 Report for the National Nutrition Program of Ethiopia. Ethiopian ...

  14. Analyse de la tolérance des populations locales de fève (Vicia faba L. à la sécheresse au stade juvénile

    Directory of Open Access Journals (Sweden)

    Nora AQTBOUZ

    2016-03-01

    Full Text Available Drought is the most important abiotic stress responsible of the production instability and lower levels of yields of faba bean (Vicia faba L.. The cropping of tolerant varieties can be an opportunity to stabilize production. The objective of the present study was to evaluate the genetic variability and to study the drought tolerance in the juvenile plant stage in a collection of local Moroccan faba bean populations from the province of Taounate. A number of 60 local populations were studied under controlled conditions in a greenhouse. Different morphological and physiological traits were studied before and under water stress and during the recovery phase. The difference between recovery and water stress phases estimates the capacity of local populations to recover from drought. The local populations contain a wide diversity for different studied traits. The gain in dry matter has a negative and highly significant correlation with dry matter yield under water stress (r = -0.64 **. The populations 16, 47, 1 and 9 have proven to be the most drought tolerant at juvenile stage.

  15. Plant growth, metabolism and adaptation in relation to stress conditions. XXVII. Can ascorbic acid modify the adverse effects of NaCl and mannitol on amino acids, nucleic acids and protein patterns in Vicia faba seedlings?

    Science.gov (United States)

    Younis, M E; Hasaneen, M N A; Kazamel, A M S

    2009-03-01

    The adverse effects of either NaCl or mannitol on amino acids, protein patterns and nucleic acids in Vicia faba seeds were investigated. The exogenous addition of 4 mM ascorbic acid to the stressing media in which the broad bean seeds were germinated in combination with either the ionic (NaCl) or osmotic (mannitol) stressor induced significant protective changes in the total amount and in the relative composition of amino acids in general and in proline, glycine, glutamic, aspartic, alanine and serine in particular. It also induced changes in nucleic acids (RNA and DNA) content. These changes occurred throughout the entire period of the experiments (12 days). Separate administration of NaCl or mannitol enhanced the occurrence of particular novel proteins that were not detected in control bean seeds (water medium). Protein banding patterns of broad bean seedlings treated with NaCl or mannitol in combination with 4 mM ascorbic acid showed different de novo protein bands, with different molecular weights, at different stages of seedlings growth, with lower levels or a nearly complete absence of the major stress proteins. The pattern of changes for amino acids and nucleic acids and the range of protein bands extracted from the variously treated broad bean seedlings indicate a positive role of ascorbic acid in the alleviation of the damage effects induced by NaCl and mannitol. The importance of this role in the stress tolerance of broad beans is discussed.

  16. Lectin binding studies on murine peritoneal cells: physicochemical characterization of the binding of lectins from Datura stramonium, Evonymus europaea, and Griffonia simplicifolia to murine peritoneal cells.

    Science.gov (United States)

    Petryniak, J; Huard, T K; Nordblom, G D; Goldstein, I J

    1986-01-01

    Purified 125I-labeled lectins from Datura stramonium, Evonymus europaea, and Griffonia simplicifolia (I-B4 isolectin) were used to analyze changes in the expression of carbohydrates on the surface of resident (PC) and thioglycollate-stimulated murine (C57B/6J) peritoneal exudate cells (PEC). The lectins from D. stramonium, E. europaea, and G. simplicifolia I-B4 bind specifically to PEC with relatively high affinity (Kd = 5.65 +/- 1.08 X 10(-7) M, 1.08 +/- 0.12 X 10(-8) M, and 1.33 +/- 0.15 X 10(-7) M, respectively). Assuming a single lectin molecule binds to each cell surface saccharide, the number of receptor sites per cell ranged for different cell samples from 22.3 to 50.0 X 10(6), from 3.8 to 4.8 X 10(6), and from 2.0 to 16.8 X 10(6) for D. stramonium, E. europaea, and G. simplicifolia I-B4 lectins, respectively. There were approximately 3- to 7-fold, 16- to 20-fold, and 2- to 20-fold increases in binding capacity for D. stramonium, E. europaea and G. simplicifolia I-B4, respectively, compared to the binding to resident, peritoneal cells. Scatchard plots of the binding of all three lectins to PEC were linear, suggesting that the receptor sites for these lectins are homogeneous and noninteracting. The binding capacity of these lectins to PEC was unchanged after trypsin digestion of cells. The expression of carbohydrates on the surface of PEC was also monitored by an agglutination assay. PEC were agglutinated by all three lectins whereas PC either were not agglutinated or were agglutinated only at high lectin concentrations. On the basis of our knowledge of the carbohydrate binding specificity of the D. stramonium and G. simplicifolia I-B4 lectins, we postulate that, parallel with thioglycolate stimulation, there is an increase in the number of N-acetyllactosamine residues and terminal alpha-D-galactosyl end groups. The blood group B, and H type 1 determinants--DGa1 alpha 1,3[LFuc alpha 1,2]DGa1 beta 1,3(or 4)DGlcNAc and LFuc alpha 1,2DGa1 beta 1,3DG1cNAc, respectively, as well as DGa1 alpha 1,3DGa1 beta 1,3(or 4)DGlcNAc--may be considered to be possible receptors for the E. europaea lectin. These glycoconjugates, present on the surface of peritoneal exudate cells, provide new chemical markers for studying the differentiation of resident peritoneal cells.

  17. Comparative study of procedures for histological detection of lectin binding by use of Griffonia simplicifolia agglutinin I and gastrointestinal mucosa of the rat.

    Science.gov (United States)

    Kuhlmann, W D; Peschke, P

    1984-01-01

    The histological localisation of alpha-D-galactopyranosyl residues in glycoconjugates of rat stomach and duodenal mucosae was studied by use of Griffonia simplicifolia agglutinin I, i.e. the isolectin mixture (A + B) and the isolectin B4 (B4). Cryostat sections which were either unfixed or acetone fixed and paraffin sections from both ethanol-acetic acid and formaldehyde fixed tissue blocks were compared. Cellular details were better preserved in paraffin than in cryostat sections. Reactivity of cells binding GS I was less sensitive after formaldehyde than after ethanol-acetic acid fixation inasmuch as higher concentrations of lectins were needed. This drawback could be overcome by trypsinisation of the sections. The binding pattern of GS I (A + B) corresponded with that of GS I (B4) in either cryostat or paraffin sections. GS I was detected in the cytoplasm of parietal cells and in Brunner's gland cells. In duodenal crypts and villi, lectin was bound to supranuclear regions in the cytoplasm of columnar and goblet cells. The staining efficiency of fluorescein (FITC), horseradish peroxidase (HRP) and colloidal gold particle (CGP) labels in both direct and indirect lectin stainings was compared. Under all experimental conditions, indirect methods required lower concentrations of lectins than direct ones; indirect procedures increased sensitivity about 5-10 fold. CGP labels were always of highest sensitivity when gold particles were further developed by a silver precipitation method. HRP was not as efficient in lectin localisation as CGP, but cytochemical staining was more convenient in routine work. Direct FITC labellings proved to be of lowest sensitivity.

  18. Phosphorylation of H2AX histones in response to double-strand breaks and induction of premature chromatin condensation in hydroxyurea-treated root meristem cells of Raphanus sativus, Vicia faba, and Allium porrum.

    Science.gov (United States)

    Rybaczek, Dorota; Maszewski, Janusz

    2007-01-01

    Histone H2A variant H2AX is rapidly phosphorylated on the induction of DNA double-strand breaks by ionizing radiation and hydroxyurea-mediated replication arrest, resulting in the formation of gamma-H2AX foci along megabase chromatin domains nearby the sites of incurred DNA damage. In an attempt to establish a relationship between species-specific nuclear architecture and H2AX phosphorylation in S/G(2) phase-arrested root meristem cells, immunocytochemical comparisons using an antibody raised against human gamma-H2AX were made among three plants differing with respect to DNA contents: Allium porrum, representing a reticulate type of DNA package, Vicia faba, having semireticulate cell nuclei, and Raphanus sativus, characterised by a chromocentric type of chromatin. Another approach was aimed at determining possible correlations between the extent of hydroxyurea-induced phosphorylation of H2AX histones and the quantities of root meristem cells induced by caffeine to enter aberrant mitotic division (premature chromosome condensation). It was concluded that the higher-order structure of chromatin may contribute to the accessibility of molecular factors engaged in the recognition and repair of genetic lesions. Consequently, in contrast to A. porrum and V. faba, a diffuse chromatin in chromocentric cell nuclei of R. sativus may become more vulnerable both to generate DNA double-strand breaks and to recruit molecular elements needed to arrange the cell cycle checkpoint functions, and thus, more resistant to factors which allow the cells to enter premature chromosome condensation spontaneously. On the other hand, however, caffeine-mediated overriding of the S-M checkpoint control system resulted in the typical appearance of premature chromosome condensation, irrespective of the genomic content of DNA.

  19. IMPROVING THE TOLERANCE OF Vicia fabaAGAINST ENVIRONMENTAL SALINITY RESULTED FROM THE IRRIGATION WITH SEA WATER BY USING K2 SO4 AND (NH42SO4 AS CHEMICAL OSMOREGULATORS.

    Directory of Open Access Journals (Sweden)

    Kamel Mohamed

    2012-08-01

    Full Text Available Vicia faba L. was cultivated with irrigation with 5, 10, 15 and 20% (v:v sea water. The plants were divided to three groups. The first was irrigated without treatments while the second was treated with 5 mM KNO3 and the third was treated with 5mM (NH42 SO4. The plants were left to grow until flowering stage. The famous solutes Na+, K+, Ca2+, Mg2+, Cl-, PO43-, SO42-, soluble carbohydrates, amino acids and soluble proteins were estimated to investigate the role of potassium nitrate and ammonium sulphates as osmoregulators. The results indicated that the non-treated group increased the soluble carbohydrates in the roots to avoid the influx of sodium. The treatment with KNO3 decreased the sodicity (SAR in the shoots. The availability of nitrogen as nitrate or ammonium ions enhances the accumulation of soluble carbohydrates in shoots. KNO3 treatment decreased SAR strongly while (NH42 SO4 treatment the SK:Na value in the shoots at higher salinity. The plants of all groups were depended on Ca2+ as compatible solute

  20. SUPPLEMENTARY VALUE OF VETCH (VICIA DASYCARPA) HAY ...

    African Journals Online (AJOL)

    Personal

    (Boran x Friesian) cows fed with a basal diet of urea-molasses-treated wheat straw. ... wheat straw. INTRODUCTION. Wheat straw is one of the major cereal crop residues produced in the world. As an example, around 2.5 million tons of wheat straw are produced annually .... temperature in sealed plastic bags until required.

  1. SUPPLEMENTARY VALUE OF VETCH (VICIA DASYCARPA) HAY ...

    African Journals Online (AJOL)

    Personal

    on feed intake and digestibility as well as milk production and composition in lactating F1 crossbred. (Boran x Friesian) cows ... cows of similar milk yield (8–10 kg d-1), body weight (BW) and stage of lactation (early lactation), but differing in parities were ... vetch in the daily ration of lactating cows can only be justified when ...

  2. Üç Macar Fiği (Vicia pannonica Crantz.) Çeşidinde Farklı Dozlarda Gama Işını Uygulamasının M2 generasyonunda Bazı Bitkisel Özellikleri Üzerine Etkileri

    OpenAIRE

    BAĞCI, Muhittin; Mutlu, Hüseyin

    2015-01-01

    Bu çalışma, “Macar fiği (Vicia pannonica Crantz.) Bitkisinde Gama Işını Uygulaması ile Mutasyon Islahı” projesinin M2 generasyonunu kapsamaktadır. Araştırma, üç Macar fiği çeşidinde, gama ışını dozlarının M2 generasyonunda, bazı bitkisel özellikler üzerine etkilerini belirlemek ve kontrol doz (0 Gy) uygulaması ile karşılaştırmak amacıyla yürütülmüştür. Araştırmada, üç Macar fiği çeşidinin (Tarmbeyazı-98, Anadolupembesi-2002 ve Oğuz-2002) M1 bitkilerinin tohumları ekilmiştir. Elde edilen M2 bi...

  3. The lectin domains of polypeptide GalNAc-transferases exhibit carbohydrate-binding specificity for GalNAc: lectin binding to GalNAc-glycopeptide substrates is required for high density GalNAc-O-glycosylation

    DEFF Research Database (Denmark)

    Wandall, Hans H; Irazoqui, Fernando; Tarp, Mads Agervig

    2007-01-01

    Initiation of mucin-type O-glycosylation is controlled by a large family of UDP GalNAc:polypeptide N-acetylgalactosaminyltransferases (GalNAc-transferases). Most GalNAc-transferases contain a ricin-like lectin domain in the C-terminal end, which may confer GalNAc-glycopeptide substrate specificity...... to the enzyme. We have previously shown that the lectin domain of GalNAc-T4 modulates its substrate specificity to enable unique GalNAc-glycopeptide specificities and that this effect is selectively inhibitable by GalNAc; however, direct evidence of carbohydrate binding of GalNAc-transferase lectins has...... not been previously presented. Here, we report the direct carbohydrate binding of two GalNAc-transferase lectin domains, GalNAc-T4 and GalNAc-T2, representing isoforms reported to have distinct glycopeptide activity (GalNAc-T4) and isoforms without apparent distinct GalNAc-glycopeptide specificity (Gal...

  4. Altered lectin-binding sites in normal colon and ulcerative colitis Alteração dos sítios de ligação da lectina no cólon normal e na colite ulcerativa

    Directory of Open Access Journals (Sweden)

    Mario R. Melo-Júnior

    2004-04-01

    Full Text Available The aim of this study was to evaluate the expression of carbohydrates via lectin histochemistry and computer image analysis in normal colon and ulcerative colitis. Sections of human intestinal tissues (4mm were incubated with lectins (Con A, WGA, LTA and PNA and evaluated through optical microscopy. Staining results were analysed using an image analysis programme. The results showed a positive intense staining pattern to the inflammatory cells, mainly neutrophils of sigmoid and rectum portion of colon as well as epithelial gland cells. WGA and LTA lectins showed distinct patterns between normal gland epithelium and ulcerative colitis. PNA and Con A failed to recognize carbohydrate moieties in studied cases. The results were also confirmed by the image analysis. The observations reported here suggest that WGA and LTA lectins are promising histologic markers to differentiate normal gland epithelium from inflammatory ulcerative colitis regarding the differences observed in the expression of N-acetylglucosamine and L-fucose.O presente trabalho objetivou, através de histoquímica com lectinas e análise digital de imagens, avaliar a expressão de carboidratos em amostras de colo normal e com colite ulcerativa. A partir de fragmentos de mucosa intestinal foram obtidos cortes histológicos (4mm que foram incubados com lectinas (Con A, WGA, LTA e PNA, e os resultados das marcações foram avaliados através de microscopia óptica e sistema de análise de imagens. Os resultados obtidos revelaram uma intensa marcação para as células inflamatórias, principalmente neutrófilos infiltrados no tecido de reto e sigmóide, bem como células das glândulas intestinais. As lectinas WGA e LTA exibiram padrões distintos de marcação entre o epitélio normal e os casos de colite ulcerativa. As lectinas PNA e Con A falharam em reconhecer os carboidratos celulares nos casos estudados em ambos os grupos. Os resultados obtidos foram confirmados pela análise de imagem. As observações obtidas sugerem que as lectinas WGA e LTA são marcadores promissores para diferenciar o epitélio normal do padrão inflamatório da colite ulcerativa, indicando uma expressão distinta de N-acetilglicosamina e L-fucose nos respectivos casos estudados.

  5. Preparo convencional e cultivo mínimo do solo na cultura de mandioca em condições de adubação verde com ervilhaca e aveia preta Differences between convencional and minimum tillage soil preparation for cassava cropping with Vicia sativa and Avena strigosa green manure

    Directory of Open Access Journals (Sweden)

    Antonio Gabriel Filho

    2000-12-01

    properties. The use of plants for green cover manure and the use of minimum tillage may contribute to reduction of soil erosion and to facilitate manual harvest. An experiment in eutrophic Oxisol, located in Marechal Cândido Rondon country state of Paraná, Brazil, was carried out to collect information on the physical soil properties, harvest effort strength and cassava productivity. Experimental design was composed by eight treatments with four repetitions on a 2x4 factorial. Were used two soil tillage (conventional and minimum and four soil cover types: common vetch (Vicia sativa, black oat (Avena strigosa, common vetch plus black oat and bare soil. The results showed that soil density and resistance to penetration in the 0-10cm layer were higher under conventional than under minimum tillage. There were no differences for cassava harvest effort and cassava productivity between soil tillage treatments as well as among types of soil cover. No significant interaction was detected also. It is hypotesized that the results obtained are due to the fact that soil used did not have compaction, the soil had a high degree of natural fertility and there was no water stress during the experiment. Consequenthy, minimum tillage may substitute conventional tillage and reduce costs for cassava cropping.

  6. Variability in yield of faba beans (Vicia faba L.)

    NARCIS (Netherlands)

    Grashoff, C.

    1992-01-01

    Yield variability is one of the major problems in growing faba beans. In this thesis, the effect of water supply pattern on yield variability of the crop is studied with experiments in the field and under controlled conditions, and with a simulation model. In a series of field experiments,

  7. In vitro plant regeneration from Narbon Vetch (Vicia narbonensis L ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... photoperiod. The pH of all cultures was adjusted to 5.6 - 5.8 before adding 0.65% agar (Duchefa) and autoclaving at 121oC, 118 kPa pressure for 20 min. To induce roots, the shoots regenerated on all .... geographic origins for very successful tissue culture in the future. Moreover, it is expected that the ...

  8. Replacement of Concentrate Mix With Vetch ( Vicia dasycarpa ) Hay ...

    African Journals Online (AJOL)

    The experiment was conducted with the objective to assess the effect of replacing vetch for concentrate mix on feed intake and digestibility as well as milk production and composition in lactating crossbred (Boran x Friesian) cows kept on a basal feed of urea- molasses treated wheat straw (UMTWS). Eight crossbred cows of ...

  9. An evaluation of fababean (Vicia faba) and lupin (Lupinus albus ...

    African Journals Online (AJOL)

    No significant differences in CP degra- dability between fababean and lupin seed were observed, while. DM degradability was significantly (P •••0.05) higher for lupin seed at the low outflow rate, but significantly (P •••0.05) lower for lupin seed at the high outflow rate. Several other researchers (Cronje, 1983; Freer & Dove, ...

  10. Association of Faba Bean Rust ( Uromyces viciae-fabae ) with ...

    African Journals Online (AJOL)

    ... stage and field management practices. The mean incidence of the disease varied from 44.6% in Bedeno to 98% in Tullo, while severity of the disease varied from 12.7% in Bedeno to 65% in Gorogutu and Kurfachale districts. Logistic regression analysis for the association of rust incidence and severity with environmental ...

  11. Effects of animal's rumen juice on seed germination of Vicia ...

    African Journals Online (AJOL)

    ... were significant interaction effects between rumen juice and seed size on seed germination of V. angustifolia. Our results suggest that grazing pressure of animal feed present have significant negatively effects on seed germination for V. angustifolia with different seed size in alpine area of the Qinghai-Tibetan Plateau.

  12. Characterization of Phosphate Solubilizing Faba Bean ( Vicia faba L ...

    African Journals Online (AJOL)

    Some species of rhizobial bacteria nodulating faba bean are characterized by phosphate solubilization. In order to study their in vitro and symbiotic characteristics, twelve rhizobial isolates nodulating faba bean were collected from acidic soil of Wollega, Ethiopia. Solubilization index of the isolates ranges from 1.25 to 2.10.

  13. An evaluation of fababean (Vicia faba) and lupin (Lupinus albus ...

    African Journals Online (AJOL)

    chemiese samestelling van fababoon- en lupiensaad en stoppel is bepaal. Skape op beide stoppellande het toegeneem in liggaams- massa (P ~ 0.01) oor die eerste 35 dae van beweiding, waama skape op beide weidings se gemiddelde liggaamsmassa afgeneem het. Die gemiddelde liggaamsmassa van die hamels het ...

  14. An evaluation of fababean ( Vicia faba ) and lupin ( Lupinus albus ...

    African Journals Online (AJOL)

    Die eksperiment is uitgevoer om fababoon- en soetlupien-oesreste as somerweiding vir jong Merinohamels te vergelyk. Die droë materiaal (DM)- en ruproteïen (RP)-degradeelbaarheid sowel as die chemiese samestelling van fababoon- en lupiensaad en stoppel is bepaal. Skape op beide stoppellande het toegeneem in ...

  15. Intercropping of wheat (Triticum aestivum) and bean (Vicia faba ...

    African Journals Online (AJOL)

    use

    2011-12-05

    Dec 5, 2011 ... Details of field and soil characteristics and meteoro- logical data of experimental site are given in Tables 1 and 2. Experimental design. The treatments were compared in a complete randomized block design with four replications. Five treatments were included in the experiment as showed in Table 3.

  16. Intercropping of wheat ( Triticum aestivum ) and bean ( Vicia faba ...

    African Journals Online (AJOL)

    The experiment was carried out as randomized complete block design with four replications. The results show that intercropping systems had a significant effect on environmental resources consumption, where intercropping systems had more light interception and water, and nutrient uptake compared to sole crops, ...

  17. NMR investigations of protein-carbohydrate interactions : Studies on the relevance of Trp/Tyr variations in lectin binding sites as deduced from titration microcalorimetry and NMR studies on hevein domains. Determination of the NMR structure of the complex between pseudohevein and N,N ',N ''-triacetylchitotriose

    NARCIS (Netherlands)

    Asensio, JL; Siebert, HC; von der Lieth, CW; Laynez, J; Bruix, M; Soedjanaamadja, UM; Beintema, JJ; Canada, FJ; Gabius, HJ; Jimenez-Barbero, J

    2000-01-01

    Model studies on lectins and their interactions with carbohydrate ligands in solution are essential to gain insights into the driving forces for complex formation and to optimize programs for computer simulations. The specific interaction of pseudohevein with N,N',N"-triacetylchitotriose has been

  18. Screening of faba bean (Vicia faba L.) accessions to acidity and aluminium stresses

    Science.gov (United States)

    Stoddard, Frederick L.

    2017-01-01

    Background Faba bean is an important starch-based protein crop produced worldwide. Soil acidity and aluminium toxicity are major abiotic stresses affecting its production, so in regions where soil acidity is a problem, there is a gap between the potential and actual productivity of the crop. Hence, we set out to evaluate acidity and aluminium tolerance in a range of faba bean germplasm using solution culture and pot experiments. Methods A set of 30 accessions was collected from regions where acidity and aluminium are or are not problems. The accessions were grown in solution culture and a subset of 10 was grown first in peat and later in perlite potting media. In solution culture, morphological parameters including taproot length, root regrowth and root tolerance index were measured, and in the pot experiments the key measurements were taproot length, plant biomass, chlorophyll concentration and stomatal conductance. Result Responses to acidity and aluminium were apparently independent. Accessions Dosha and NC 58 were tolerant to both stress. Kassa and GLA 1103 were tolerant to acidity showing less than 3% reduction in taproot length. Aurora and Messay were tolerant to aluminium. Babylon was sensitive to both, with up to 40% reduction in taproot length from acidity and no detectable recovery from Al3+ challenge. Discussion The apparent independence of the responses to acidity and aluminium is in agreement with the previous research findings, suggesting that crop accessions separately adapt to H+ and Al3+ toxicity as a result of the difference in the nature of soil parent materials where the accession originated. Differences in rankings between experiments were minor and attributable to heterogeneity of seed materials and the specific responses of accessions to the rooting media. Use of perlite as a potting medium offers an ideal combination of throughput, inertness of support medium, access to leaves for detection of their stress responses, and harvest of clean roots for evaluation of their growth. PMID:28194315

  19. Evaluation of faba beans (Vicia faDa cv. Fiord) and sweet lupins ...

    African Journals Online (AJOL)

    OLCKERS, R.C., 1991. Evaluering van gars as voedingsbron in varkdi€te in die Winterreenstreek. MSc.(Agric)-tesis. Universiteit van Stellenbosch,. Stellenbosch 7600, Suid-Afiika. ORTIZ, L.T., CENTENO, C. & TREVINO, J., 1993. Tannins in faba bean seeds: effects on the digestion of protein and antino acids in growing.

  20. Antioxidant Activities of Phenolic Compounds in Green and White Faba Bean (Vicia faba L.)

    OpenAIRE

    Yu-wei Luo; Wei-hua Xie; Xiao-xiao Jin; Qian (Janice) Wang; Zhen-ping Hao; Bei-bei Tao

    2014-01-01

    Polyphenols and tannins have implications for health and nutrition because of their antioxidant activities. Foods with high content of phenolics, such as fruits, vegetables, grains and legumes, show decreasing incidence of several diseases upon their consumption. However, there are limited reports on ant oxidative properties of tannins present in legumes. Faba bean seed has been known for high content of condensed tannin which is attributed as one of the ant nutritional factors in this highly...

  1. Screening of faba bean (Vicia faba L. accessions to acidity and aluminium stresses

    Directory of Open Access Journals (Sweden)

    Kiflemariam Y. Belachew

    2017-02-01

    Full Text Available Background Faba bean is an important starch-based protein crop produced worldwide. Soil acidity and aluminium toxicity are major abiotic stresses affecting its production, so in regions where soil acidity is a problem, there is a gap between the potential and actual productivity of the crop. Hence, we set out to evaluate acidity and aluminium tolerance in a range of faba bean germplasm using solution culture and pot experiments. Methods A set of 30 accessions was collected from regions where acidity and aluminium are or are not problems. The accessions were grown in solution culture and a subset of 10 was grown first in peat and later in perlite potting media. In solution culture, morphological parameters including taproot length, root regrowth and root tolerance index were measured, and in the pot experiments the key measurements were taproot length, plant biomass, chlorophyll concentration and stomatal conductance. Result Responses to acidity and aluminium were apparently independent. Accessions Dosha and NC 58 were tolerant to both stress. Kassa and GLA 1103 were tolerant to acidity showing less than 3% reduction in taproot length. Aurora and Messay were tolerant to aluminium. Babylon was sensitive to both, with up to 40% reduction in taproot length from acidity and no detectable recovery from Al3+ challenge. Discussion The apparent independence of the responses to acidity and aluminium is in agreement with the previous research findings, suggesting that crop accessions separately adapt to H+ and Al3+ toxicity as a result of the difference in the nature of soil parent materials where the accession originated. Differences in rankings between experiments were minor and attributable to heterogeneity of seed materials and the specific responses of accessions to the rooting media. Use of perlite as a potting medium offers an ideal combination of throughput, inertness of support medium, access to leaves for detection of their stress responses, and harvest of clean roots for evaluation of their growth.

  2. Evaluation of dehulled faba bean ( Vicia faba cv. Fiord) as a protein ...

    African Journals Online (AJOL)

    Fiord) as a protein source for laying hens. ... South African Journal of Animal Science ... Although food intake increased linearly with faba bean inclusion, reflecting a need by the hens to consume more in an attempt to obtain sufficient of some unidentified limiting nutrient, laying performance was the same on all feeds in the ...

  3. [Genetic singularity coefficients of common vetch Vicia sativa L. accessions determined with molecular markers].

    Science.gov (United States)

    Potokina, E K; Aleksandrova, T G

    2008-11-01

    Organization and practical application of ex situ collections require estimation of genetic differences between numerous accessions of local cultivars and field weed forms collected from the same ecological and geographical region and similar in their morphophysiological characteristics. A mathematical algorithm for estimating the degree of genetic singularity of a specimen in the system of local gene pool determined with the help of molecular markers is described. The utility of this algorithm is demonstrated by the example of classification of 677 common vetch accessions from the collection of the Vavilov Institute of Plant Industry from 11 ecological-geographic regions of Russia analyzed using AFLP. The proposed classification of accessions is the result of processing the AFLP data by weighting the marker traits based on their frequency in particular regions. This allowed each accession to be characterized according to the ratio of rare and frequent alleles as a genetic singularity coefficient. The proposed method is appropriate for any types of molecular markers. A practical result of its application is the classification of accessions using a five-point score scale, which can be added to descriptors of certificate databases and used for optimization of the work with collections.

  4. Sporoderm infrastructural and cytochemical modifications in cytoplasmic male sterile broad-bean (Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Jean-Claude Audran

    2014-01-01

    Full Text Available A comparative study of mature sporoderms of sterile and fertile pollen grains was performed using electron microscopic techniques. In sterile pollen grains, intine is lacking; ectexine sculpture is reduced and tectum is overlaid by membranous systems. Infratectal texture is compact and a sporopollenin granulous mass is obturing the aperture central region. Endexine reacts with proteins and acidic carbohydrates tests.

  5. ALLEVIATION OF SALINITY STRESS ON Vicia faba L. PLANTS VIA SEED PRIMING WITH MELATONIN

    Directory of Open Access Journals (Sweden)

    Mona Gergis DAWOOD

    2015-01-01

    Full Text Available La melatonina es una molécula ambientalmente amigable con una potente capacidad antioxidante y de trampa de radicales libres. Dos experimentos en materas fueron realizados en dos inviernos consecutivos (2011/2012 y 2012/2013 en instalaciones del Centro Nacional de Investigaciones, Dokki, Cairo, Egipto, para estudiar el potencial de la melatonina (100 mM and 500 mM para disminuir los efectos nocivos del agua de mar diluida a concentraciones relativamente bajas y altas (3,85 dS/m and 7,69 dS/m, respectivamente. Los resultados mostraron que la irrigación de plantas de haba con agua de mar diluida reduce los parámetros de crecimiento (altura de la planta, número de hojas/planta, peso fresco y seco de la planta, el contenido relativo de agua (RWC, los pigmentos fotosintéticos (clorofilas a, b y carotenoides, el ácido indo lacético, los carbohidratos totales, K+, Ca+2, al igual que las relaciones K+/Na+ y Ca2+/Na+. Esto fue acompañado por un incremento significativo en el contenido de fenoles, solutos compatibles (carbohidratos solubles totales, aminoácidos libres, prolina, Na+ y Cl- en comparación con las plantas control (plantas no tratadas. De otro lado, los tratamientos con melatonina mejoraron los parámetros de crecimiento, RWC, los pigmentos fotosintéticos, carbohidratos totales, contenido fenólico total, ácido indo acético, K+,Ca+2 al igual que las relaciones K+/Na+ y Ca+2/ Na+ , tanto en las plantas irrigadas con agua dulce de la llave como en las irrigadas con agua de mar diluida en comparación con los controles correspondientes. De otro lado, los tratamientos con melatonina redujeron los niveles de solutos compatibles, al igual que los contenidos de Na+ y Cl-, en comparación con los controles. El estrés por salinidad y/o los tratamientos con melatonina indujeron la producción de nuevas bandas de proteínas que no estuvieron presentes en las plantas control. El tratamiento de melatonina 500 mM tuvo un efecto más pronunciado que el tratamiento de 100 mM en disminuir los efectos adversos de los dos niveles de salinidad estudiados sobre el comportamiento de las plantas de haba.

  6. Effect of salt stress on plant growth and metabolism of bean plant Vicia faba (L.

    Directory of Open Access Journals (Sweden)

    Amira M.S. Abdul Qados

    2011-01-01

    An increase was observed in the protein content in the two measurement periods due to the impact of salinity stress. A directly proportional relationship was found between protein content and the increase in salt concentrations in the first measurement period, while it was inversely proportional in the second.

  7. Acumulación de arsénico en el cultivo de habas (Vicia Faba)

    OpenAIRE

    Francisco Prieto García; Judith Callejas Hernández; Alma D. Román Gutiérrez; Judith Prieto Méndez; Alberto J. Gordillo Martínez; María A. Méndez Marzo

    2007-01-01

    La presencia de arsénico en aguas y suelos de Zimapán, en el estado de Hidalgo, México, causa que los cultivos de haba presenten concentraciones apreciables de dicho elemento. Los suelos evaluados presentaron texturas, conductividad, contenidos de N y de arsénico diferentes, pero resultados similares en pH, potencial redox, y contenido de materia orgánica. La elevada bioacumulación de arsénico en estos suelos fue directamente proporcional al tiempo de exposición. Las concentraciones de arséni...

  8. Asociacion Thysanoptera -Vicia faba en la Prepuna y Puna de Jujuy, Argentina

    National Research Council Canada - National Science Library

    Zamar, Maria Ines; Neder de Roman, Lilia Estela

    2012-01-01

    .... Los objetivos de este estudio fueron: identificar el complejo de tisanopteros antofilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecologicos y determinar el rol que cumplen en esta asociacion...

  9. Faba beans (Vicia faba) in dairy cow diet: effect on milk production and quality

    OpenAIRE

    Rosanna Scipioni; Maurizio Moschini; Domenico Pietro Lo Fiego; Francesco Masoero; Michele Comellini; Luisa Antonella Volpelli

    2010-01-01

    The use of alternative plant proteins in place of the soybean meal protein in diets for farmed animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among the possible alternatives, the heat-processed (flaked) faba beans appears interesting for dairy cow diet. Two consecutive experiments were carried out to test flaked faba beans as a partial substitute for soybean meal in the diet of Reggiana breed dairy cows producing milk for Parmigiano-Regg...

  10. Structure and function of seed storage proteins in faba bean (Vicia faba L.).

    Science.gov (United States)

    Liu, Yujiao; Wu, Xuexia; Hou, Wanwei; Li, Ping; Sha, Weichao; Tian, Yingying

    2017-05-01

    The protein subunit is the most important basic unit of protein, and its study can unravel the structure and function of seed storage proteins in faba bean. In this study, we identified six specific protein subunits in Faba bean (cv. Qinghai 13) combining liquid chromatography (LC), liquid chromatography-electronic spray ionization mass (LC-ESI-MS/MS) and bio-information technology. The results suggested a diversity of seed storage proteins in faba bean, and a total of 16 proteins (four GroEL molecular chaperones and 12 plant-specific proteins) were identified from 97-, 96-, 64-, 47-, 42-, and 38-kD-specific protein subunits in faba bean based on the peptide sequence. We also analyzed the composition and abundance of the amino acids, the physicochemical characteristics, secondary structure, three-dimensional structure, transmembrane domain, and possible subcellular localization of these identified proteins in faba bean seed, and finally predicted function and structure. The three-dimensional structures were generated based on homologous modeling, and the protein function was analyzed based on the annotation from the non-redundant protein database (NR database, NCBI) and function analysis of optimal modeling. The objective of this study was to identify the seed storage proteins in faba bean and confirm the structure and function of these proteins. Our results can be useful for the study of protein nutrition and achieve breeding goals for optimal protein quality in faba bean.

  11. Evaluation of dehulled faba bean (Vicia faba cv. Fiord) as a protein ...

    African Journals Online (AJOL)

    p2492989

    Abstract. Dehulled faba beans were evaluated as an alternative to soybeans as a protein source for laying hens using 240 ... industry that is being forced to exclude animal protein sources in animal feeds. ... Wilson &. Teague (1974) reported that this latter rate of inclusion had no effect on laying performance or food intake,.

  12. Evaluation of vegetable-faba bean (Vicia faba L.) intercropping under Latvian agro-ecological conditions.

    Science.gov (United States)

    Lepse, Līga; Dane, Sandra; Zeipiņa, Solvita; Domínguez-Perles, Raul; Rosa, Eduardo As

    2017-10-01

    Monoculture is used mostly in conventional agriculture, where a single crop is cultivated on the same land for a period of at least 12 months. In an organic and integrated growing approach, more attention is paid to plant-environment interactions and, as a result, diverse growing systems applying intercropping, catch crops, and green manure are being implemented. Thus, field experiments for evaluation of vegetable/faba bean full intercropping efficiency, in terms of vegetable and faba bean yield and protein content, were set up during two consecutive growing seasons (2014 and 2015). Data obtained showed that the most efficient intercropping variants were cabbage/faba bean (cabbage yield 1.27-2.91 kg m-2 , immature faba bean pods 0.20-0.43 kg m-2 ) and carrot/faba bean (carrot yield 1.67-2.28 kg m-2 , immature faba bean pods 0.10-0.52 kg m-2 ), whilst onion and faba bean intercrop is not recommended for vegetable growing since it induces a very low onion yield (0.66-1.09 kg m-2 ), although the highest immature faba bean pod yield was found in the onion/faba bean intercropping scheme (up to 0.56 kg m-2 ). Vegetable/faba bean intercropping can be used in practical horticulture for carrot and cabbage growing in order to ensure sustainable farming and environmentally friendly horticultural production. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  13. The dynamics of faba bean (Vicia faba L. parasitism by Orobanche foetida

    Directory of Open Access Journals (Sweden)

    Zouhaier ABBES

    2010-09-01

    Full Text Available Normal 0 14 false false false MicrosoftInternetExplorer4 The dynamics of Orobanche foetida parasitizing faba bean are examined using Petri dish experiments. Rates of broomrape seed germination and seedling attachment to the host roots were quantified on three resistant genotypes (the Egyptian line Giza 429, the Spanish cultivar Baraca, and the Tunisian cultivar Najeh [XBJ90.03-16-1-1-1] and the susceptible cv. Bachaar. The percentage of O. foetida seed germination (11 to 38% was lower near the roots of resistant host plants than it was near the roots of ‘Bachaar’ (67%. O. foetida parasitism was followed using three parametric logistic functions. In this way some major parameters of the infection process were quantified: the maximal number (Nmax and the maximal rate (Rmax of broomrape attachments to the host roots, the median time required for attachment (T50, the maximal percentage of established tubercles reaching the final growth stage at 70 days after inoculation (DAI (%max, and the maximal rate of established tubercle growth (R’max. Broomrape attachment was lower and slower in resistant plants, as indicated by low Nmax and Rmax values combined with high T50 values. Furthermore the precocity of the resistant genotypes was correlated with low attachment. The parameters %max and R’max did not discriminate the susceptible cultivar Bachaar from Giza 429 or Baraca. On the other hand, the %max and the R’max were lower in the ‘Najeh’ plants. The findings indicated that both low attachment and limited growth of established tubercles contributed to resistance in the Najeh cultivar.

  14. Seed Filling Trend of Faba bean (Vicia faba L. as Affected by Planting Date and Density

    Directory of Open Access Journals (Sweden)

    Ali Rahemi Karizaki

    2016-03-01

    Full Text Available To investigate the effect of planting date and plant density on phenology, seed yield, its components, seed filling rate and grain filling period of faba bean, a factorial experiment based on randomized complete block design with four replications was conducted at Research Farm of Agricultural Sciences and Natural Resources of Gonbad University, Iran, during growing season of 2012-2013. The factors were three planting dates (4th of November, 4th of December 2013 and 3th of January 2014 and four planting densities (8, 12, 16 and 18 plant/m2. The results showed that planting dates significantly affected on phenology, yield and its components, seed filling rate and periods while the effect of plant density on seed filling period was not significant. Comparison of sigmoid equation coefficients showed that seed filling rates in three planting dates were different. The highest seed filling rate was obtained in 3th of January and the lowest at November 4, planting dates. The effect of planting date on seed filling duration was also significant, but it was not on plant density. Regression analysis showed that increasing 0.01g seed growth rate in seed unit, resulted in seed weight increase by 45.11, 32.43 and 26.66 g for November 4, December 4 and January 3 planting dates respectively. Delaying planting dates decreased seed filling period by 8.53 days and seed weight by 0.27 g. due to its effect on day length and temperature changes. Delayed planting dates were more effective on the rate and period of seed filling and phenology of faba bean. Delaying in planting date increased time to emergence, while decreased seed filling period and seed yield because of coincidence of this period with high temperatures.

  15. Large-Scale Transcriptome Analysis in Faba Bean (Vicia faba L. under Ascochyta fabae Infection.

    Directory of Open Access Journals (Sweden)

    Sara Ocaña

    Full Text Available Faba bean is an important food crop worldwide. However, progress in faba bean genomics lags far behind that of model systems due to limited availability of genetic and genomic information. Using the Illumina platform the faba bean transcriptome from leaves of two lines (29H and Vf136 subjected to Ascochyta fabae infection have been characterized. De novo transcriptome assembly provided a total of 39,185 different transcripts that were functionally annotated, and among these, 13,266 were assigned to gene ontology against Arabidopsis. Quality of the assembly was validated by RT-qPCR amplification of selected transcripts differentially expressed. Comparison of faba bean transcripts with those of better-characterized plant genomes such as Arabidopsis thaliana, Medicago truncatula and Cicer arietinum revealed a sequence similarity of 68.3%, 72.8% and 81.27%, respectively. Moreover, 39,060 single nucleotide polymorphism (SNP and 3,669 InDels were identified for genotyping applications. Mapping of the sequence reads generated onto the assembled transcripts showed that 393 and 457 transcripts were overexpressed in the resistant (29H and susceptible genotype (Vf136, respectively. Transcripts involved in plant-pathogen interactions such as leucine rich proteins (LRR or plant growth regulators involved in plant adaptation to abiotic and biotic stresses were found to be differently expressed in the resistant line. The results reported here represent the most comprehensive transcript database developed so far in faba bean, providing valuable information that could be used to gain insight into the pathways involved in the resistance mechanism against A. fabae and to identify potential resistance genes to be further used in marker assisted selection.

  16. Large-Scale Transcriptome Analysis in Faba Bean (Vicia faba L.) under Ascochyta fabae Infection

    Science.gov (United States)

    Ocaña, Sara; Seoane, Pedro; Bautista, Rocio; Palomino, Carmen; Claros, Gonzalo M.; Torres, Ana M.; Madrid, Eva

    2015-01-01

    Faba bean is an important food crop worldwide. However, progress in faba bean genomics lags far behind that of model systems due to limited availability of genetic and genomic information. Using the Illumina platform the faba bean transcriptome from leaves of two lines (29H and Vf136) subjected to Ascochyta fabae infection have been characterized. De novo transcriptome assembly provided a total of 39,185 different transcripts that were functionally annotated, and among these, 13,266 were assigned to gene ontology against Arabidopsis. Quality of the assembly was validated by RT-qPCR amplification of selected transcripts differentially expressed. Comparison of faba bean transcripts with those of better-characterized plant genomes such as Arabidopsis thaliana, Medicago truncatula and Cicer arietinum revealed a sequence similarity of 68.3%, 72.8% and 81.27%, respectively. Moreover, 39,060 single nucleotide polymorphism (SNP) and 3,669 InDels were identified for genotyping applications. Mapping of the sequence reads generated onto the assembled transcripts showed that 393 and 457 transcripts were overexpressed in the resistant (29H) and susceptible genotype (Vf136), respectively. Transcripts involved in plant-pathogen interactions such as leucine rich proteins (LRR) or plant growth regulators involved in plant adaptation to abiotic and biotic stresses were found to be differently expressed in the resistant line. The results reported here represent the most comprehensive transcript database developed so far in faba bean, providing valuable information that could be used to gain insight into the pathways involved in the resistance mechanism against A. fabae and to identify potential resistance genes to be further used in marker assisted selection. PMID:26267359

  17. Evaluation of faba beans ( Vicia faba cv. Fiord) and sweet lupins ...

    African Journals Online (AJOL)

    l l threed ietsw eree valuatedin a growth trial using l0 pigs( flveb oarsa ndf lve gilts)o vert heg rowthi nterval3 0-90 kg. The experimentadle signw asa 3 (diets)x 2 (sex)f 'actorialC. arcassc haracteristicwse red etermineda t thee ndo f theg rowtht rial.P igsi n the metabolisrna ndN balance trial consurned5 % less( P < 0.01)o ...

  18. Acumulación de arsénico en el cultivo de habas (Vicia Faba

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    2007-01-01

    Full Text Available La presencia de arsénico en aguas y suelos de Zimapán, en el estado de Hidalgo, México, causa que los cultivos de haba presenten concentraciones apreciables de dicho elemento. Los suelos evaluados presentaron texturas, conductividad, contenidos de N y de arsénico diferentes, pero resultados similares en pH, potencial redox, y contenido de materia orgánica. La elevada bioacumulación de arsénico en estos suelos fue directamente proporcional al tiempo de exposición. Las concentraciones de arsénico acumuladas más altas se obtuvieron en la raíz, el tallo, y las hojas, respectivamente. Concentraciones de 4 mg l-1, fueron letales para el cultivo; el fenómeno se apreció a partir de la etapa III de desarrollo, con la aparición de daños en las raíces y un fuerte efecto en la floración, que inhibió la formación de vainas.

  19. Faba beans (Vicia faba in dairy cow diet: effect on milk production and quality

    Directory of Open Access Journals (Sweden)

    Rosanna Scipioni

    2010-02-01

    Full Text Available The use of alternative plant proteins in place of the soybean meal protein in diets for farmed animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among the possible alternatives, the heat-processed (flaked faba beans appears interesting for dairy cow diet. Two consecutive experiments were carried out to test flaked faba beans as a partial substitute for soybean meal in the diet of Reggiana breed dairy cows producing milk for Parmigiano-Reggiano cheese-making. In both experiments a “Control” concentrate (12% soybean meal, no faba beans was compared with a “Faba” concentrate (7.5% soybean meal and 10% flaked faba beans. Forages fed to animals were hay (mixed grass and alfalfa plus mixed grass in experiment 1, hay only in experiment 2. Milk yield and quality and the characteristics of grab faecal samples as empirical indicators of digestibility, were similar between feeding groups. The milk urea content was slightly lower in the “Faba” group, particularly in experiment 2 (“Control” vs “Faba”: 34.6 vs 32.9 mg/dL in experiment 1, P<0.1; 27.4 vs 23.4 mg/dL in experiment 2, P<0.01; the plasma urea content in experiment 2 confirmed the trend observed in milk (3.9 vs 3.0 mmol/L, P<0.01. The inclusion of faba beans, within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation, could represent a feasible opportunity for a partial substitution of soybean meal.

  20. Evaluation of dehulled faba bean (Vicia faba cv. Fiord) as a protein ...

    African Journals Online (AJOL)

    p2492989

    predicted that traditional sources of protein for livestock will become increasingly scarce because of the need to feed a progressively larger human population that will compete with an expanding intensive livestock industry that is being forced to exclude animal protein sources in animal feeds. As a result, a considerable.

  1. Weed control under integrated nutrient management systems in faba bean (Vicia faba) production in Egypt

    National Research Council Canada - National Science Library

    I.M. El-Metwally; M.T. Abdelhamid

    2008-01-01

    Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential...

  2. Evaluation of faba bean (Vicia faba cv. Fiord) as a protein source for ...

    African Journals Online (AJOL)

    p2492989

    linearly, and food intake increased linearly, with increasing faba bean content, but when the feeds were ... higher proanthocyanidin (condensed tannin) content of the hulls of these varieties compared with the ..... qualitative treatments such as sex, vaccine, strain or growth promoter and are inappropriate for response.

  3. THE VARIATION OF NUCLEIC ACIDS CONTENT AFTER SIMAZIN TREATMENT ON VICIA SATIVA L.

    Directory of Open Access Journals (Sweden)

    Odeta Grama-Tiganasu

    2005-08-01

    Full Text Available Simazin has in certain conditions stimulatory effects on nucleic acids biosynthese. The biosyntese and mitotic division stimulation sugest the possibility to use simazin like growing and germination stimulator.

  4. Thidiazuron-induced plant regeneration from protoplasts of Vicia faba cv. Mythos.

    Science.gov (United States)

    Tegeder, M; Gebhardt, D; Schieder, O; Pickardt, T

    1995-12-01

    Protoplasts of 10 cultivars of V. faba were isolated from etiolated shoot-tips and tested for their regeneration capacity. After purification, protoplasts were embedded in sodium alginate and cultivated in the medium of Kao and Michayluk (1975) containing 0.5 mg·1(-1) of each 2,4-dichlorophenoxyacetic acid, naphthylacetic acid and 6-benzylaminopurine. Depending on cultivar, division frequencies of up to 40% were obtained. Six weeks after embedding, protoplast-derived calluses were transferred to Gelrite-solidified media with different combinations of growth regulators. A two step protocol (auxin high/low) was tested for its ability to induce somatic embryogenesis. The formation of globular structures was observed, but no embryo formation could be achieved. In contrast, cultivation of protocalluses on medium supplemented with thidiazuron resulted in shoot development in cultivar Mythos. To generate mature plants, the shoots were grafted onto young seedlings. In order to optimize the in vitro-conditions, different concentrations of thidiazuron alone or in combination with naphthylacetic acid were tested, showing that an increase of thidiazuron and the addition of naphthylacetic acid positively affects both the viability of protocalluses and the regeneration frequency.

  5. Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals

    NARCIS (Netherlands)

    Jansman, A.J.M.

    1993-01-01

    Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid hypertrophy of the parotid glands in rats and increase

  6. Effect of supplementary soil nitrogen on yield of Vicia villosa Roth ...

    African Journals Online (AJOL)

    Sixty plots of 2 x 2 sq. m size were then demarcated and further divided into 5 similar units comprising 4 blocks of 3 plots each. The plots in each block were independently allotted to 3 treatments in a randomized complete block (RCB) design. Treatments were T1 – control (without SSN), T2 and T3 are manure and inorganic ...

  7. Nutritional evaluation of dehulled faba bean (Vicia faba cv. Fiord) in ...

    African Journals Online (AJOL)

    p2492989

    formulated to meet or exceed NRC (1998) nutrient requirements of weaner pigs. Diluting full-fat soya with ..... Of interest was whether a significant trend in performance would be evident as a result of the .... supplement for swine. Can. J. Anim.

  8. Gema and Šarac: The first Serbian cultivars of spring feed faba bean (Vicia Faba

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2009-01-01

    Full Text Available In 2007 and 2008, the trials of the Department of Variety Protection and Registration of the Ministry of Agriculture, Forestry and Water Management of the Republic of Serbia were carried out on four locations, including two new Novi Sad spring feed faba bean lines, B-412 and B-413, and the control cultivar Uran. In average, the highest grain yield was in the cultivar Gema (2905 kg ha-1, although there were no significant differences between three tested cultivars. In comparison to the control, Gema and Šarac had significantly higher crude protein content in grain dry matter, with 341.4 g kg-1 and 341.1 g kg-1. .

  9. Resolving browning during the establishment of explant cultures in Vicia faba L. for genetic transformation

    Directory of Open Access Journals (Sweden)

    Helena Klenotičová

    2013-01-01

    Full Text Available Optimisation of in vitro regeneration systems of two explant types for low-tannine cultivars of faba bean based on culturing of shoot apices and cotyledonary nodes were provided by usage of various antioxidants - ascorbic acid, citric acid, glutathione and activated charcoal. In subsequent testing, the combined effects of antioxidants with transformation co-cultivation compounds acetosyringone and L-cysteine was studied. The application of antioxidants lead to decreased callogenesis, citric acids treatments (50 mg.l−1 dramatically decreased necrotic response of explants. However, citric acid, used together with ascorbic acid completely inhibited shoot growth in shoot apex cultures. Glutathion evoked hyperhydricity of explants. Activated charcoal induced rooting on media which are commonly used for shoot proliferation. Combination of acetosyringone with antioxidants influenced shoot proliferation, except of variant with ascorbic acid. Citric acid was the best and universal antioxidant in faba bean in vitro cultures and its use is recommended for faba bean genetic transformation experiments.

  10. Evaluation of vetch species and their accessions for agronomic ...

    African Journals Online (AJOL)

    Vicia narbonensis and Vicia sativa were erect, short plant height and early maturing for both forage and seed yields, while Vicia dasycarpa, Vicia villosa and Vicia stropurpurea have creeping growth habit, tall plant height and intermediate to late maturity for forage and seed yields. Taller species gave better forage dry matter ...

  11. Weed control under integrated nutrient management systems in faba bean (Vicia faba) production in Egypt Controle de plantas daninhas sob sistemas de manejo integrado em feijão de fava (Vicia faba) no Egito

    National Research Council Canada - National Science Library

    I.M. El-Metwally; M.T. Abdelhamid

    2008-01-01

    Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential...

  12. Weed control under integrated nutrient management systems in faba bean (Vicia faba production in Egypt Controle de plantas daninhas sob sistemas de manejo integrado em feijão de fava (Vicia faba no Egito

    Directory of Open Access Journals (Sweden)

    I.M. El-Metwally

    2008-01-01

    Full Text Available Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential. The experiment included five treatments, composed of organic and mineral fertilizers, alone and mixed at different rates, along with a control and six weed control treatments, including oxadiargyl, prometryn, hand hoeing treatments alone or mixed with the herbicides, and a nonweeded treatment (control.The herbicide treatments were not superior to the two hand-hoeing treatments. Using compost favored growth and yield of faba bean more than of weeds. Adding fertilizer also improved most yield parameters. Application of compost alone or combined with 50 or 100% of the recommended NPK rate improved faba bean growth in terms of net assimilation rate, specific leaf area, and leaf weight ratio as components of relative growth rate. This improvement in growth resulted in increase of seed yield, yield components and protein of faba bean. Faba bean yield performance improved under interactive fertilizer effects and weed control treatments as growth improved, as a result of nutrient release from fertilizers and weed control.Dois experimentos em condições de campo foram conduzidos em duas épocas sucessivas - 2005/2006 e 2006/2007 - para determinar se o manejo pode melhorar a competitividade do feijão-fava contra plantas daninhas e contribuir para um maior potencial de produção. Os experimentos incluíram cinco tratamentos, compostos de: fertilizantes orgânicos e minerais, isoladamente ou em mistura em diferentes doses, além do tratamento controle, e seis tratamentos de controle de plantas daninhas, incluindo tratamentos usando oxadiargyl, prometryn, manualmente ou misturados com os herbicidas e um tratamento sem plantas daninhas (controle. Os tratamentos com os herbicidas não foram superiores aos dois tratamentos manuais (hand hoeing.O uso de composto favoreceu o crescimento e rendimento da fava mais que os das plantas daninhas. A adição de fertilizantes também aumentou a maioria dos parâmetros de rendimento. A aplicação do composto isoladamente ou em combinação com 50 ou 100% da dose recomendada de NPK aumentou a taxa de assimilação líquida do feijão-fava, sua área foliar específica e a razão folha-peso, como componentes da taxa de crescimento relativo. O aumento do crescimento resultou em aumento do rendimento das sementes, dos componentes de rendimento e da proteína do feijão de fava. O desempenho do rendimento do feijão de fava aumentou sob efeitos interativos de tratamentos com fertilizante e de controle de plantas daninhas à medida que o crescimento aumentou, como resultado da liberação de nutrientes dos fertilizantes e controle dessas plantas.

  13. Symbiotic effectiveness and phylogeny of rhizobia isolated from faba bean (Vicia faba L.) in Sichuan hilly areas, China.

    Science.gov (United States)

    Xu, Kai Wei; Zou, Lan; Penttinen, Petri; Wang, Ke; Heng, Nan Nan; Zhang, Xiao Ping; Chen, Qiang; Zhao, Ke; Chen, Yuan Xue

    2015-10-01

    A total of 54 rhizobial strains were isolated from faba bean root nodules in 21 counties of Sichuan hilly areas in China, and their symbiotic effectiveness, genetic diversity and phylogeny were assessed. Only six strains increased the shoot dry mass of the host plant significantly (P ≤ 0.05). Based on the cluster analysis of combined 16S rDNA and intergenic spacer region (IGS) PCR-RFLP, the strains were divided into 31 genotypes in 11 groups, indicating a high degree of genetic diversity among the strains. The sequence analysis of three housekeeping genes (atpD, glnII and recA) and 16S rDNA indicated that the strains represented two R. leguminosarum, two Rhizobium spp., R. mesosinicum, Agrobacterium sp. and A. tumefaciens. The strains representing four Rhizobium species were divided into two distinct nodC and nifH genotypes. However, the phylogeny of housekeeping genes and symbiotic genes was not congruent, implying that the strains had been shaped by vertical evolution of the housekeeping genes and lateral evolution of the symbiotic genes. Copyright © 2015 Elsevier GmbH. All rights reserved.

  14. Implication du stress oxydatif dans la toxicité du plomb sur une plante modèle, Vicia faba

    OpenAIRE

    Pourrut, Bertrand

    2008-01-01

    Le plomb est un des métaux les plus utilisés par l'Homme mais c'est aussi l'un des plus toxiques. Dans les écosystèmes, la teneur en plomb d'origine anthropique n'a cessé d'augmenter depuis plusieurs siècles. Dans plusieurs régions en France, le plomb pose actuellement des problèmes importants en matière de contamination de l'environnement. Les plantes, du fait de leur immobilité, sont particulièrement exposées. De nombreuses études ont déjà évalué la toxicité de ce métal sur les végétaux, ma...

  15. Effects of gamma irradiation and/or cooking on nutritional quality of faba bean (Vicia faba L.) cultivars seeds.

    Science.gov (United States)

    Osman, Asha Mohamed Ali; Hassan, Amro B; Osman, Gammaa A M; Mohammed, Nagat; Rushdi, Mohamed A H; Diab, Eiman E; Babiker, Elfadil E

    2014-08-01

    The effect of gamma irradiation (0.5 and 1.0 kGy) and/or cooking on the proximate composition, mineral content, tannin content, phytic acid content and the in vitro protein digestibility (IVPD) of two Sudanese faba bean cultivars (BB7-S1 and SH-S2) was investigated in the present study. The results obtained revealed that gamma irradiation and/or cooking treatments have slight effect in chemical composition and mineral content, while they caused significant (P ≤ 0.05) reduction on tannin content for both cultivars. Cooking of faba bean seeds also insignificantly (P ≤ 0.05) reduced phytic acid content for both cultivars, while irradiation process and/or cooking had fluctuated effect. For both cultivars, irradiation of seeds and/or cooking increased the in vitro protein digestibility (IVPD), with maximum value of IVPD (79.97%) obtained for cultivar BB7-S1. The results indicate that the treatments used in this study might improve the nutritive quality of faba bean seed due to reduction in antinutritional factors with a concomitant increase in IVPD.

  16. Folate content in faba beans (Vicia faba L.)—effects of cultivar, maturity stage, industrial processing, and bioprocessing

    Science.gov (United States)

    Hefni, Mohammed E; Shalaby, Mohamed T; Witthöft, Cornelia M

    2015-01-01

    Faba beans are an important source of folate and commonly consumed in Egypt. This study examined the effects of Egyptian industrial food processing (e.g., canning and freezing), germination, cultivar, and maturity stages on folate content, with the aim to develop a candidate functional canned faba bean food with increased folate content. The folate content in four cultivars of green faba beans ranged from 110 to 130 μg 100 g−1 fresh weight (535–620 μg 100 g−1 dry matter [DM]), which was four- to sixfold higher than in dried seeds. Industrial canning of dried seeds resulted in significant folate losses of ∼20% (P = 0.004), while industrial freezing had no effect. Germination of faba beans increased the folate content by >40% (P faba beans resulted in a net folate content of 194 μg 100 g−1 DM, which is 52% more than in conventional canned beans. The consumption of green faba beans should be recommended, providing ∼120 μg dietary folate equivalents per 100 g/portion. PMID:25650294

  17. Effects of gamma irradiation and/or cooking on nutritional quality of faba bean (Vicia faba L.) cultivars seeds

    OpenAIRE

    Osman, Asha Mohamed Ali; Hassan, Amro B.; Osman, Gammaa A. M.; Mohammed, Nagat; Rushdi, Mohamed A. H.; Diab, Eiman E.; Babiker, Elfadil E.

    2012-01-01

    The effect of gamma irradiation (0.5 and 1.0 kGy) and/or cooking on the proximate composition, mineral content, tannin content, phytic acid content and the in vitro protein digestibility (IVPD) of two Sudanese faba bean cultivars (BB7-S1 and SH-S2) was investigated in the present study. The results obtained revealed that gamma irradiation and/or cooking treatments have slight effect in chemical composition and mineral content, while they caused significant (P ≤ 0.05) reduction on tannin conte...

  18. Utilización de harina de haba (vicia faba l.) en la elaboración de pan

    OpenAIRE

    Rocha Espinoza, Ma. Del Carmen; Vásquez Arreaga, María N.; Cornejo Zuñiga, Fabiola

    2011-01-01

    En nuestro país, se han venido desarrollando investigaciones que permiten reemplazar parcialmente la harina de trigo por harinas no tradicionales, con el fin de reducir costos. En el presente trabajo se pretende conocer la influencia del uso de harinas no tradicionales (harina de haba) en la retro degradación del pan. Se comenzó con una caracterización de los aspectos físicos y químicos más importantes de la materia prima; color, olor, estado de madurez, humedad, pH, acidez y actividad de ...

  19. Preparación y determinación de propiedades funcionales de Concentrados proteicos de haba (Vicia faba

    Directory of Open Access Journals (Sweden)

    Lina Modercay

    2010-07-01

    Full Text Available Con cl propósito de obtener concentrados proteicos de haba, que eventualmente puedan ser empleados en la elaboración de alimentos para consumo humano, se establecieron a nivel de laboratorio, las condiciones para la extracción de las proteínas a partir de harina de haba baja en tegumento. Los resultados muestran que se obtiene un concentrado con más de 60% de proteína bruta en base seca, al suspender la harina de haba en agua en unarclaci'on I:6apH 8 manteniendo el sistema con agitación constante durante 0.5 hora a 40 °C y posteriormente acidificando el sobrenadante con HCl IN hasta pH 5.5. El método más aconsejable para el proceso de secado, es cl de rodillos de acuerdo con las características químicas, físicas y funcionales del producto.

  20. Factors influencing distribution and local coexistence of diploids and tetraploids of Vicia cracca: inferences from a common garden experiment

    Czech Academy of Sciences Publication Activity Database

    Eliášová, A.; Münzbergová, Zuzana

    2017-01-01

    Roč. 130, č. 4 (2017), s. 677-687 ISSN 0918-9440 Institutional support: RVO:67985939 Keywords : drought stress * seed production * vegetative growth Subject RIV: EF - Botanics Impact factor: 1.899, year: 2016

  1. Pea (Pisum sativum and faba beans (Vicia faba in dairy cow diet: effect on milk production and quality

    Directory of Open Access Journals (Sweden)

    Maurizio Moschini

    2012-04-01

    Full Text Available The use of alternative plant proteins in place of the soybean meal protein in diets for producing animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among possible alternatives, the heat-processed legume grains seem interesting for dairy cow diets. Two consecutive experiments were carried out to evaluate flaked pea and faba beans as substitute for soybean meal in diets for Reggiana breed dairy cows producing milk for Parmigiano-Reggiano cheese-making. In both experiments a C concentrate (110 g/kg soybean meal, no pea and faba beans was compared to a PF concentrate (150 g/kg flaked pea, 100 g/kg flaked faba beans, no soybean meal. Forages fed to animals were hay (mixed grass and alfalfa in experiment 1 and hay plus mixed grass in experiment 2. Concentrate intake, milk yield and milk quality (rennet coagulation traits included were similar between feeding groups. Parameters on the grab faecal samples, as empirical indicators of digestibility, had a smaller (Pvs 3.1 and 2.3 vs 2.8%, respectively for PF and C in experiment 1 and 2. Some blood indicators of nitrogen metabolism (protein, albumin, urea were similar between the feeding groups. The inclusion of pea and faba beans, within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation, could represent a feasible opportunity for a total substitution of soybean meal.

  2. PREPARACIÓN DE PELÍCULAS PARA ALIMENTOS A PARTIR DE CONCENTRADOS PROTEICOS DE HABA (Vicia faba

    Directory of Open Access Journals (Sweden)

    Ana Patricia Rozo

    2008-02-01

    Full Text Available El trabajo se planeó con el objeto de evaluar la factibilidad de utilizar concentrados proteicos de haba en la preparación de películas para recubrir alimentos, utilizando como patrón de comparación películas preparadas con albúmina fresca de huevo.Los resultados muestran que utilizando concentrados proteicos de haba sin deshidratar, en suspensiones que contengan 5 g de proteína por 100 g de agua, y adicionando glicerol como agente plastificante,se pueden obtener películas cuyas características de permeabilidad alvapor de agua, solubilidad y contenido de agua dependen de las condiciones de secado del material.

  3. Occurrence of broad bean (Vicia faba L. diseases in Olsztyn-Elbąg and Bydgoszcz Provinces

    Directory of Open Access Journals (Sweden)

    Stanisław Sadowski

    2013-12-01

    Full Text Available During the years 1981-1985, there were conducted studies of the healthiness of broad bean,'Nadwiślański' variety, cultivated in different soil and climate conditions of the two regions: i.e. Bydgoszcz - comparatively warmer and drier, and Olsztyn-Elbląg - colder and moister. It was found that the main reason for a premature broad bean leaves dry in up in the Olsztyn-Elbląg Region was caused by the fungi Cercospora and Botrytis, and in the Bydgoszcz Region - the root rot which occurs here to a greater extent. Root gangrene was greater intensity in drier and lighter soils. Rotting broad bean roots were most frequently occupied by the fungi of the Fusarium family (ca. 70%. The prevailing species were Fusarium oxysporum, next F. solani and more rarely F. culmorum and F. avenaceum. Climate conditions and soil species affected considerably the species composition of the root fungi.

  4. Controle de plantas daninhas sob sistemas de manejo integrado em feijão de fava (Vicia faba) no Egito

    OpenAIRE

    El-Metwally, I.M.; Abdelhamid, M.T.

    2008-01-01

    Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential. The experiment included five treatments, composed of organic and mineral fertilizers, alone and mixed at different rates, along with a control and six weed control treatments, including oxadiargyl, prometryn, hand hoeing treatments alone or mixed with the herbicides, and a nonweed...

  5. Produção e qualidade proteica da fava (Vicia faba), ervilha (Pisum sativum) e triticale (x Triticosecale)

    OpenAIRE

    Laranjeira, Sara Silva

    2017-01-01

    Dissertação de Mestrado em Engenharia Agronómica As restrições económicas e ambientais de fertilizantes azotados minerais utilizados na produção de gramíneas conferem um papel de relevo ao cultivo de leguminosas com incorporação dos seus resíduos no solo como fonte de azoto para as culturas principais da rotação. A reduzida investigação em Portugal sobre a utilização de espécies leguminosas em condições mediterrânicas como fonte de azoto, conduziu-nos ao presente estudo realizado no campus...

  6. ESTUDIO DE LA CALIDAD PROTEICA Y DEL CONTENIDO DE ENERGÍA METABOLIZABLE DEL HABA (VICIA FABA*

    Directory of Open Access Journals (Sweden)

    Ana Silvia Bermudez

    2010-09-01

    Full Text Available In order to determínate the faba bean CEP, the possible role of bis hemaglutinine on this valué and to know the metabolizable energy in this legume we made two experiments in the poultry section of the experimental Center of Tibaitatá. In each experiment we used 45 chickens in random distribution in groups of five. In the first experiment we used diets whose proteic source was respectively isolated soybean protein (control diet, raw faba bean, and faba bean treated with steam in an autoclave. The results obtained show a low utilization of food when the ratio was prepared with faba beans, probably due to the aminoacids imbalance, also it produced hypertrophia of the páncreas due probably to the presence of antitriptyc agents which were not destroyed by the heat treatment. The nutritional valué of the faba bean protein increase 67o with the inactivation of the favine, although it is still lower (27% compared with the control diet. In the second experiment we obtain relatively high valúes for the faba beans metabolical useful energy compared with other legume valúes like ajonjolí, which shows us that this bean is a good energy supplier.

  7. Texture of cellulose microfibrils of root hair cell walls of Arabidopsis thaliana, Medicago truncatula, and Vicia sativa

    NARCIS (Netherlands)

    Akkerman, M.; Franssen-Verheijen, M.A.W.; Immerzeel, P.; Hollander, den L.; Schel, J.H.N.; Emons, A.M.C.

    2012-01-01

    Cellulose is the most abundant biopolymer on earth, and has qualities that make it suitable for biofuel. There are new tools for the visualisation of the cellulose synthase complexes in living cells, but those do not show their product, the cellulose microfibrils (CMFs). In this study we report the

  8. Lectin cytochemical localisation of glycoconjugates in the olfactory system of the lizards Lacerta viridis and Podarcis sicula.

    Science.gov (United States)

    Franceschini, V; Lazzari, M; Ciani, F

    2000-07-01

    To investigate the presence of defined carbohydrate moieties on the cell surface of the olfactory and vomeronasal receptor cells and the projections of the latter into the olfactory bulbs, a lectin binding study was performed on the olfactory system of the lizards: Lacerta viridis and Podarcis sicula. Both lizards showed a high lectin binding for N-acetyl-glucosamine in the sensory neurons. The lectin binding patterns in Lacerta indicated that the main olfactory system possessed a moderate density of N-acetyl-galactosamine residues and detectable levels of galactose ones. The vomeronasal system on the other hand contained a high density of N-acetyl-galactosamine moieties and a moderate density of glucosamine ones. In Podarcis the main olfactory system and vomeronasal organ contained respectively detectable and moderate levels of galactose residues. The expression of specific glycoconjugates may be associated with outgrowth, guidance and fasciculation of olfactory and vomeronasal axons.

  9. Glycopeptides from murine teratocarcinoma cells: structure of the determinants recognised by Griffonia simplicifolia agglutinin I and by sera from patients with ovarian germ cell tumors.

    Science.gov (United States)

    Kamada, Y; Muramatsu, H; Muramatsu, T; Kawata, M; Sekiya, S; Takamizawa, H

    1988-05-15

    High-molecular-weight glycopeptides synthesised by teratocarcinoma OTT6050 bear the binding site for Griffonia simplicifolia agglutinin I and are recognised by antibodies in the sera of patients with ovarian germ cell tumors. Digestion of the glycopeptides with endo-beta-D-galactosidase C abolished the lectin binding activity and the antigenic activity. Since the product of the enzymic digestion is alpha-D-Gal-(1----3)-D-Gal, it is concluded that the disaccharide structure is involved in the lectin binding site and the antigenic site.

  10. Effect of ensiling moist field bean (Vicia faba), pea (Pisum sativum) and lupine (Lupinus spp.) grains on the contents of alkaloids, oligosaccharides and tannins.

    Science.gov (United States)

    Gefrom, A; Ott, E M; Hoedtke, S; Zeyner, A

    2013-12-01

    Ensiling legume grain may be an inexpensive and ecologically interesting method to produce a high-protein feed of local origin. The typically patchy maturation recommends harvesting and ensiling the seeds in moist condition. Developing a method for preserving legume grains harvested before maturation by lactic acid fermentation would have several advantages. Under laboratory conditions, crushed legume seeds of beans, peas and lupines with high moisture content of 35 % were ensiled with different additives (molasses and lactic acid bacteria). To characterize the final silages, contents of proximate nutrients and antinutritional factors (alkaloids, oligosaccharides, tannins) were analysed. The addition of lactic acid bacteria ensured a fast and pronounced lactic acid production and decreased contents of undesired fermentation products like ethanol. An additional use of molasses for ensilage did not provide a remarkable additional benefit. Excluding sugar and starch, the contents of proximate nutrients were not remarkably altered after ensiling. As an overall effect, lactic acid fermentation reduced tannins and oligosaccharides. It can be supposed that the oligosaccharides after breakdown of the complex molecules acted as a source of fermentable carbohydrates. A relevant reduction of alkaloids did not occur. The lactic acid fermentation of legume grains can be recommended as an appropriate method for conservation. With respect to the economic advantages and compared with methods of chemical preservation, the lactic acid fermentation of legume grains under anaerobic conditions is an environmentally compliant procedure and therefore also an option for organic farming. © 2012 Blackwell Verlag GmbH.

  11. Determinación de las mejores condiciones para la extracción de la lectina de raíz de haba (vicia faba)

    OpenAIRE

    Navarro, Y.; Pérez, G

    2010-01-01

    Para la determinación de las mejores condiciones de extracción de la lectina de raíz de haba (LRH), se utilizaron iniciaimente raíces enteras y paredes celulares de raíces. De acuerdo con los resultados, se establecieron las condiciones experimentales para la preparación de paredes celulares por tres métodos. Se encontró que el Método I, en el cual se usó Sarkosyl 0.5%, KH2PO4 0.01 M pH 6.0 para la obtención de paredes celulares y luego se extrajo la lectina con buffer de citrato de sodio 0.1...

  12. Induction de la phytotoxicité du Plomb chez Vicia faba L. : rôles de l'absorption et de la spéciation

    OpenAIRE

    Shahid, Muhammad

    2010-01-01

    Peu d'études concernent actuellement l'influence de la spéciation du plomb (polluant métallique toxique, persistant et très présent dans les écosystèmes) sur sa phyto-toxicité. Pourtant, l'absorption des métaux, leur translocation et les mécanismes impliqués dans leur phyto-toxicité peuvent être fortement modifiés par ce paramètre. Dans ce contexte, l'objectif de la thèse était d'étudier l'influence de la spéciation chimique du plomb (formation de divers complexes organométalliques) sur sa ph...

  13. Nutritional value of raw and micronised field beans (Vicia faba L. var. minor) with and without enzyme supplementation containing tannase for growing chickens.

    Science.gov (United States)

    Abdulla, Jalil Mahmwd; Rose, Stephen Paul; Mackenzie, Alexander Mackay; Ivanova, Sonya Georgieva; Staykova, Genoveva Petrova; Pirgozliev, Vasil Radoslavov

    2016-10-01

    An experiment examined the effects of two field bean cultivar samples with different tannin contents, the effect of heat treatment (micronising) and the effect of dietary supplementation of a proprietary enzyme preparation containing tannase, pectinase, and xylanase activities on metabolisable energy (ME), total tract dry matter digestibility (DMD) and ether extract digestibility (EED), nitrogen retention (NR), tannin degradability, gastrointestinal tract (GIT) development, and endogenous mucin losses excretion in broiler chickens. The Control diet contained per kg 221 g crude protein and 12.83 MJ ME. Four additional diets contained 300 g/kg of each of the two untreated or micronised experimental field bean cultivar samples. Each diet was then split into two batches and one of them was supplemented with 3400 units tannase per kg diet resulting in 10 diets in total. Each diet was fed to seven pens with two randomly selected male broilers each. Birds fed the high tannin bean sample had a lower weight gain (p beans increased (p beans reduced the degradability of condensed tannins and increased endogenous mucin losses (p bean samples were not improved by heat treatment, but enzyme supplementation improved the feeding value of all diets regardless of the bean samples or heat treatment. Further research is warranted to study the effectiveness of tannase supplementation in poultry diet formulations by dose response trials with purified tannase preparations.

  14. Effect of air classification and fermentation by Lactobacillus plantarum VTT E-133328 on faba bean (Vicia faba L.) flour nutritional properties.

    Science.gov (United States)

    Coda, Rossana; Melama, Leena; Rizzello, Carlo Giuseppe; Curiel, José Antonio; Sibakov, Juhani; Holopainen, Ulla; Pulkkinen, Marjo; Sozer, Nesli

    2015-01-16

    The effects of air classification and lactic acid bacteria fermentation on the reduction of anti-nutritional factors (vicine and convicine, trypsin inhibitor activity, condensed tannins and phytic acid) and in vitro protein and starch digestibility of faba bean flour were studied. Free amino acid (FAA) profile analysis was also carried out. Air classification allowed the separation of the flour into protein and starch rich fractions, showing different chemical compositions and microstructures. Lactobacillus plantarum growth and acidification in faba bean flour and its fractions were assessed. The anti-nutritional compounds were separated mostly to the fine protein-rich fraction. Fermentation caused the decrease of vicine and convicine contents by more than 91% and significantly reduced trypsin inhibitor activity and condensed tannins (by more than 40% in the protein-rich fraction). No significant (P>0.05) variation was observed for total phenols and phytic acid content. Fermentation increased the amount of FAA, especially of the essential amino acids and γ-aminobutyric acid, enhanced the in vitro protein digestibility and significantly lowered the hydrolysis index. This work showed that the combination of air classification and fermentation improved nutritional functionality of faba bean flour which could be utilized in various food applications. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Feeding value of field beans (Vicia faba L. var. minor) with and without enzyme containing tannase, pectinase and xylanase activities for broilers.

    Science.gov (United States)

    Abdulla, Jalil Mahmwd; Rose, Stephen Paul; Mackenzie, Alexander Mackay; Pirgozliev, Vasil Radoslavov

    2017-04-01

    Effects of field beans with various tannin content and exogenous enzyme mixture containing tannase, pectinase and xylanase activities on N-corrected dietary apparent metabolisable energy (AMEn), coefficients of dry matter (DMR) and nitrogen retention (NR), fat digestibility, gastrointestinal tract (GIT) development, jejunal villus morphometry, ileal digesta viscosity and sialic acid were examined. Birds' growth performance and energy conversion ratio (ECR) were also measured. Birds were fed one of eight mash diets. The Control diet contained as major ingredients wheat (400 g/kg) and soybean meal (SBM) (127 g/kg and 221 g crude protein/kg and 12.83 MJ AMEn/kg. To reduce nutrient density, the Control diet also contained washed sand at 119 g/kg. Another three diets containing 300 g/kg of each of three experimental field bean cultivar samples in replacement for SBM and sand were also mixed. Each diet was fed to nine pens with two male Ross 308 broilers. Diets high in tannin had low AMEn, ECR, DMR and NR (p beans increased (p beans with different tannin contents may vary when fed to broilers. The supplementation of the enzyme mixture improved the feeding value of diets for broilers. The beneficial effect of the addition of the enzyme mixture seems to be mediated through reduced ileal digesta viscosity and improved nutrient availability.

  16. Early changes of the pH of the apoplast are different in leaves, stem and roots of Vicia faba L. under declining water availability

    Czech Academy of Sciences Publication Activity Database

    Karuppanapandian, T.; Geilfus, C.M.; Muehling, K.H.; Novák, Ondřej; Gloser, V.

    2017-01-01

    Roč. 255, FEB (2017), s. 51-58 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : xylem sap constituents * abscisic-acid * stomatal conductance * leaf apoplast * helianthus-annuus * plant-responses * intact plants * nacl stress * drying soil * guard-cells * Drought stress * Abscisic acid * Soil drying * Xylem sap * Osmolality * Water relations * Leaf water potential Subject RIV: EF - Botanics Impact factor: 3.437, year: 2016

  17. Evaluación de cinco genotipos de haba (Vicia faba L. con seis niveles de fósforo en Tecámac, México

    Directory of Open Access Journals (Sweden)

    Edgar Jesús Morales Rosales

    2002-01-01

    Full Text Available Por medio de una investigación de campo, basada en el diseño de bloques al azar con 30 tratamientos y tres repeticiones con un arreglo factorial, se evaluó: altura a la primera vaina (APV, altura final (AF, número de tallos (NT, número de granos por vaina (NGV, número de vainas por planta (NVP, peso de 100 semillas P(100S y rendimiento de grano (REND. El análisis de varianza reveló efectos significativos e interesantes para los cinco genotipos de haba.

  18. VARIABILITY OF LENGTH OF STEM OF DETERMINATE AND INDETERMINATE CULTIVARS OF COMMON VETCH (VICIA SATIVA L. SSP. SATIVA AND ITS IMPACT ON SELECTED CROPPING FEATURES

    Directory of Open Access Journals (Sweden)

    Jadwiga ANDRZEJEWSKA

    2006-12-01

    Full Text Available In the years 2001 and 2002, the study was conducted in six experiments in order to examine the conditioning of the length of stem variability and its impact on cropping features of determinate and indeterminate cultivars of common vetch. Rainfall in June and July as well as during the whole growing season was positively correlated with length of stem, but negatively correlated with seed yield, to a larger extent in the group of indeterminate cultivars than in the determinate one. Duration of blooming stage, length of stem, and seed yield showed the largest variability in both groups. Increase in length of stem of plants of indeterminate cultivars led to the delay in maturation, to less even maturation, and to the decrease in the thousand seed weight and seed yield. Increase in length of stem of plants of determinate cultivars delayed reaching the phase of technical maturation and decreased evenness of plant maturation. Determinate growth of common vetch did not lead to the reduction of lodging.

  19. [The feed value in growing pigs of a new cultivar of field beans (Vicia faba L.) supplemented with DL-methionine or DL-methionine-hydroxyanalog].

    Science.gov (United States)

    Abel, H j; Burghard, G

    2002-02-01

    A basal control mixture of barley, soy bean meal and soy bean oil was replaced by 25% of the new field bean-cultivar 'Divine' and the resulting two mixtures were supplemented with minerals, trace elements, vitamins and amino acids according to the ideal protein concept. The control diet was adjusted with DL-methionine (DL-Met), the field bean mixture either with DL-Met or DL-methionine-hydroxyanalogue (DL-MHA) assuming biological equivalence on a molar basis for both supplements. The three experimental diets were fed to growing pigs (35-40 kg bwt.). Spontaneous urine samples were analysed separately for determining parameters that characterize the acid-base status of the pigs. There were no significant differences between experimental groups in nutrient digestibilities. The level of bacterially fermentable substances was increased in the diets containing field beans. The field beans contained 14 mg ME/kg DM. There were no significant (p mixtures resulted from a higher electrolyte balance of the diet.

  20. CONTENIDO Y TRASLOCACIÓN DE PLOMO EN AVENA (Avena sativa, L. Y HABA (Vicia faba, L. DE UN SUELO CONTAMINADO

    Directory of Open Access Journals (Sweden)

    Elizabeth García-Gallegos

    2011-01-01

    Full Text Available Un experimento en invernadero se estableció para determinar la concentración de plomo (Pb en suelo, raíz y parte aérea de haba y avena; se calculó el factor de bioconcentración y traslocación en las dos especies. Se probaron 50, 100 y 150 mg·Pb·kg-1 de suelo, incluyendo un control. Las plantas se colectaron a los 60 días después de la siembra y se midieron altura de planta (AP, volumen radical (VR y biomasa seca total (BST, además del contenido de Pb en suelo, raíz y parte aérea. La cuantificación de Pb se realizó por espectrofotometría de absorción atómica. El suelo cultivado con haba presentó un 28.48 % de PbEDTA. Las variables AP, VR y BST no fueron afectadas de manera drástica por las concentraciones de Pb probadas. Las plantas de haba y avena absorbieron un total de 55 mg·kg-1 y 45.3 mg·kg-1, respectivamente, las cuales se consideran tóxicas para plantas cultivadas. Los resultados pueden servir de base para ampliar el conocimiento del contenido de Pb absorbido y traslocado en plantas de haba y avena, ya que la capacidad de tolerar y absorber Pb es específica de la especie, inclusive de la variedad de planta.

  1. Nutritional value of raw and micronised field beans (Vicia fabaL. var.minor) with and without enzyme supplementation containing tannase for growing chickens

    OpenAIRE

    Abdulla, J.M.; Rose, S. P.; Mackenzie, A M; Ivanova, S.G.; Staykova, G.P.; Pirgozliev, V.

    2016-01-01

    An experiment examined the effects of two field bean cultivar samples with different tannin contents, the effect of heat treatment (micronising) and the effect of dietary supplementation of a proprietary enzyme preparation containing tannase, pectinase, and xylanase activities on metabolisable energy (ME), total tract dry matter digestibility (DMD) and ether extract digestibility (EED), nitrogen retention (NR), tannin degradability, gastrointestinal tract (GIT) development, and endogenous muc...

  2. Determinación de las mejores condiciones para la extracción de la lectina de raíz de haba (vicia faba

    Directory of Open Access Journals (Sweden)

    Y. De navarro

    2010-07-01

    Full Text Available Para la determinación de las mejores condiciones de extracción de la lectina de raíz de haba (LRH, se utilizaron iniciaimente raíces enteras y paredes celulares de raíces. De acuerdo con los resultados, se establecieron las condiciones experimentales para la preparación de paredes celulares por tres métodos. Se encontró que el Método I, en el cual se usó Sarkosyl 0.5%, KH2PO4 0.01 M pH 6.0 para la obtención de paredes celulares y luego se extrajo la lectina con buffer de citrato de sodio 0.1 M pH 4.2, es el más adecuado. El fraccionamiento se realizó por filtración por gel usando Sephadex G-25.

  3. Economical Evaluation of Faba bean (Vicia faba and Maize (Zea mays L. Intercropping Based on Total Relative Value Index and Weeds Growth Reduction

    Directory of Open Access Journals (Sweden)

    J. Hamzei

    2016-05-01

    Full Text Available The chemical control of weeds raises serious concerns about food safety and environmental quality, which have necessitated the need for non chemical weed management techniques such as intercropping. Intercropping can suppress weeds and reduce the use of herbicides in production systems. Therefore, the objective of this work was to evaluate the effects of intercropping of faba bean and maize, as well as hand-weeding on maize grain yield and total grain yield. The experiment was carried out during growing season of 2010 as a randomized complete block design with three replications at the Agricultural Research Station, Faculty of Agriculture, Bu-Ali Sina University, Hamedan, Iran. Sole cropping of maize with weed control (MWF, sole cropping of maize without weed control (MWI, intercropping of 15% faba bean+maize (M+15%F, 30% faba bean+maize (M+30%F, 45% faba bean+maize (M+45%F  and sole cropping of faba bean were the experimental treatments. Weed biomass and density were affected by treatments. With increasing faba bean density in the intercropping treatments, weed biomass and density decreased significantly from 85 plants and 310 g m-2 for MWI treatment to 22 plants and 63 g m-2 for M+45%F treatment, respectively. The greatest number of seed row per ear, seed number per ear and grain and biological yields (8033 and 17933 kg ha-1, respectively were achieved at MWF treatment and the smallest values for these attributes were revealed at MWI treatment. There was no significant difference between MWF and M+45%F treatments for total grain yield (i.e. grain yield of maize + faba bean. Sole cropping of faba bean led to the greatest yield components and grain and biological yields. With increasing faba bean density in intercropping treatments, above mentioned traits (except number of pods per plant were increased significantly. The great values for weed control efficiency (73% and total relative value (1.14 were achieved at M+45%F treatment. Results of this experiment indicated that additive intercropping of faba bean (especially with a high planting density as a companion crop with maize may, potentially, lead to sufficient weed suppression concomitant to an acceptable level of grain yield.

  4. The metabolism of ageing seeds: changes in the raffinose family oligosaccharides during storage of field bean (Vicia faba var. minor Harz seeds

    Directory of Open Access Journals (Sweden)

    Kazimierz Zalewski

    2014-01-01

    Full Text Available Seeds of field bean cv. Nadwiślański harvested in 1980, 1986 and 1992 were studied. Results of investigations showed that the four analysed sugars (saccharine, verbascose, raffinose and stachyose made up from 60.1 mg of 1 g dry matter of seeds harvested in 1992 to 67 mg of seeds collected in 1986. After three years of storage in laboratory conditions we observed a decline of the amount of these oligosaccharides. The saccharose:raffinose family oligosaccharides ratio grows with the seed age.

  5. Response of bean (Vicia faba L. plants to low sink demand by measuring the gas exchange rates and chlorophyll a fluorescence kinetics.

    Directory of Open Access Journals (Sweden)

    Bo-Fang Yan

    Full Text Available BACKGROUND: The decline of photosynthesis in plants under low sink demand is well known. Previous studies focused on the relationship between stomatal conductance (gs and net photosynthetic rate (Pn. These studies investigated the effect of changes in Photosystem II (PSII function on the Pn decline under low sink demand. However, little is known about its effects on different limiting steps of electron transport chain in PSII under this condition. METHODOLOGY/PRINCIPAL FINDING: Two-month-old bean plants were processed by removing pods and flowers (low sink demand. On the 1(st day after low sink demand treatment, a decline of Pn was accompanied by a decrease in gs and internal-to-ambient CO2 concentration ratio (Ci/Ca. From the 3(rd to 9(th day, Pn and gs declined continuously while Ci/Ca ratio remained stable in the treatment. Moreover, these values were lower than that of control. Wk (a parameter reflecting the damage to oxygen evolving complex of the donor side of PSII values in the treatment were significantly higher than their corresponding control values. However, RCQA (a parameter reflecting the number of active RCs per excited cross-section of PSII values in the treatment were significantly lower than control from the 5(th day. From the 11(th to 21(st day, Pn and gs of the treatment continued to decline and were lower than control. This was accompanied by a decrease of RCQA, and an increase of Wk. Furthermore, the quantum yield parameters φPo, φEo and ψEo in the treatment were lower than in control; however, Ci/Ca values in the treatment gradually increased and were significantly higher than control on the 21(st day. CONCLUSIONS: Stomatal limitation during the early stage, whereas a combination of stomatal and non-stomatal limitation during the middle stage might be responsible for the reduction of Pn under low sink demand. Non-stomatal limitation during the late stages after the removal of the sink of roots and pods may also cause Pn reduction. The non-stomatal limitation was associated with the inhibition of PSII electron transport chain. Our data suggests that the donor side of PSII was the most sensitive to low sink demand followed by the reaction center of PSII. The acceptor side of PSII may be the least sensitive.

  6. Oxidative Damage and Mutagenic Potency of Fast Neutron and UV-B Radiation in Pollen Mother Cells and Seed Yield of Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Ekram Abdel Haliem

    2013-01-01

    Full Text Available In recent years, there has been a great deal of attention toward free radicals, reactive oxygen species (ROS generated by exposure of crop plant cells to physical radiations. Henceforth, the current study was planned to compare oxidative stress and mutagenic potential of different irradiation doses of fast neutron (FN and UV-B on meiotic-pollen mother cells (PMCs, pollen grains (PGs and seeds yielded from irradiated faba beans seedlings. On the cytogenetic level, each irradiation type had special interference with DNA of PMC and exhibited wide range of mutagenic action on the frequency and type of chromosomal anomalies, fertility of PGs and seed yield productivity based on the irradiation exposure dose and radiation sensitivity of faba bean plants compared with un-irradiated ones. On the molecular level, SDS-PAGE and RPAD-PCR analyses of seeds yielded from irradiated seedlings exhibited distinctive polymorphisms based on size, intensity, appearance, and disappearance of polypeptides bands compared with un-irradiated ones. The total values of protein and DNA polymorphisms reached 88% and 90.80% respectively. The neutron fluency (2.3 × 106 n/cm2 and UV-B dose for 1 hr were recorded as bio-positive effects. The present study proved that genetic variations revealed by cytogenetic test could be supported by gene expression (alterations in RAPD and protein profiles.

  7. The fungi communities of the soil environment of Triticum aestivum and its forecrops: Hordeum vulgare, Vicia faba ssp. minor and Trifolium pratense

    Directory of Open Access Journals (Sweden)

    Elżbieta Pląskowska

    2014-08-01

    Full Text Available The species spectrum and abundance of the fungi communities were affected by the soil environment developed by wheat and its forecrops, and by atmospheric conditions. The fungi of the genus Fusarium were the greatest threat to winter wheat regardless of the forecrop. The field bean was the best forecrop to the wheat whereas spring barley was the worst.

  8. Protective role of α-tocopherol on two Vicia faba cultivars against seawater-induced lipid peroxidation by enhancing capacity of anti-oxidative system

    Directory of Open Access Journals (Sweden)

    Salwa A. Orabi

    2016-06-01

    Full Text Available To examine the effect of seawater stress on growth, yield, physiological and antioxidant responses of faba bean plant and whether the exogenous application with vitamin E could mitigate the adverse effect of salinity stress or not, a pot experiment was carried out during 2011/12 winter season under green house of the National Research Centre, Dokki, Cairo, Egypt. Two faba bean cultivars (Giza 3 and Giza 843 irrigated with diluted seawater (Tap water, 3.13 or 6.25 dS m−1 and α-tocopherol (0, 50 or 100 mg L−1 were used. At 75 days after sowing, growth sample was taken for vegetative growth measurement, proline, carotenoids, antioxidant enzyme activities (SOD, CAT, POX and PAL, lipid peroxidation, and inorganic ions as well as seed yield and yield attributes were determined. The results revealed that seawater triggered significant inhibitory effects on faba bean growth and yield especially for Giza 3 cultivar with obvious increments in MDA and Na+ ion contents. Foliar application with α-tocopherol at rate of 100 mg L−1 followed by 50 mg L−1 on faba bean plants exerted certain alleviative effects on these indices in particular on Giza 843. α-Tocopherol could play an important role in alleviation of injury of faba bean irrigated with diluted seawater through the enhancement of the protective parameters such as antioxidant enzymes, proline, carotenoids, and inorganic ions (K+ and Ca2+ to be effective in decreasing MDA content, lessening the harmful effect of salinity, and improving faba bean growth, seed yield and seed yield quality.

  9. Effect of different Planting Pattern of Wheat (Triticum aestivum and Bean (Vicia faba on Grain Yield, Dry Matter Production and Weed Biomass

    Directory of Open Access Journals (Sweden)

    Hamdollah ESKANDARI

    2010-12-01

    Full Text Available An experiment was conducted in University of London, Kent, UK during the year 2003. The aim of experiment was to investigate the effects of planting pattern on performance of wheat and bean intercrops. A complete randomized block design with four replications was employed to compare the treatments. Treatments included wheat sole crop (W, Bean sole crop (B, within row intercropping (M1, row intercropping (M2 and mix cropping (M3. The density of intercropping was according to replacement design (one wheat replaced by three bean plants. The results showed that total dry matter achieved by intercrops was significantly higher than those achieved by either wheat or bean sole crop. Regarding to weed control, intercrops were more effective than sole crops, especially bean sole crop. Crops performance in terms dry weight, height and percentage of leaf, stem pod and ear was affected by cropping systems depending on crop species, where wheat showed more changes compared to bean . Grain yield, harvest index and thousand grain weights of wheat were decreased in intercropping while bean had reduction only in grain yield.

  10. Weed Control Efficiency of wild Safflower (Carthamus oxyacanthus M. Bieb in Replacement Series Technique of Barley (Hordeum vulgare L. and Common Vetch (Vicia sativa L.

    Directory of Open Access Journals (Sweden)

    abdolreza ahmadi

    2017-01-01

    Full Text Available Introduction In agronomy, natural outlook has been expressed in different forms which stable agriculture is an example. Stable agriculture is ascribed to the authentic management of agricultural resources, which in addition to fulfilling the ever-changing needs of humans, maintains the health of environment and capacity of water and soil resources. Application of herbicides, besides being costly, resulted in the selection of herbicide resistant weed species and has become an environmental contamination factor. However, reduction of herbicide consumption is one of the goals of modern agriculture, with several methods being suggested, including intercropping. In natural conditions of production, environment conservation of weed existence requires cost. One of the important preparations in weed control from the perspective of sustainable agriculture, is using intercropping system. The aim of this study was to determine the role of crop diversity on weed and crop production based on the beneficial effects of intercropping system than pure. Materials and methods In order to study effects of mixed and sole cropping of barley with common vetch on their biologic yield and utilization indices, an experiment was conducted in Agricultural college of the University of Lorestan, during the growing season of 2013-2014 with 24 treatments using the method of rows replacement series technique by the randomized complete block design in a factorial arrangement with three replications. First factor included 6 levels of intercropping: sole cropping of common vetch (100%, 55-45 (Common vetch-barley, 35-65, 45-55, 65-35 and sole cropping of barley and second factor included 4 levels of weed wild safflower, control, 10, 15 and 20 plants per m2. In this experiment WCE, LER and CR were measured. The data were subjected to analysis of variance (ANOVA using Mstat-C computer software. Mean comparisons were performed using Duncan’s multiple range test at two levels of significant 1% and 5%. Results and discussion There was significant difference between minimum and maximum dry weight of weeds, the results showed that barley have important role in weed control wild safflower. Therefore, weed control efficiency in 15 plant in m2 was higher than two 10 and 20 plant in m2. The lowest WCE (161.27% was found at 15-35-65 treatment, but, the highest WCE (51.99 was obtained from 15-65-35 (Wild safflower-common vetch-barley treatment. Computes showed that WCE, in 15 plants of wild safflower/m2, was more than 10 and 20 p/m2. The reduction in weed population and biomass in intercropping systems with barley may be attributed to shading effect and competition stress created by the canopy. Thus, result showed that reduction rate of common vetch in intercropping, with bearing compatibility power to weeds reduced LER. CR for common vetch intercropping component in comparison with barley in total treatments was>1. The highest CR, for vetch obtained from treatment 45-55-control (2.64 and for barley from seed ratio 65-35-control (1.83. Conclusion The results in this study showed various seed rate had noticeable effect on forage yield, LER and weed control. In this experiment changing seed rate in two tested plants (barly- commen vetch changed the number and weed species, as a result noticeable changing was created in their competitive power. Result showed that seed rate (35% barley-65% common vetch was better than other treatment, not only in use efficiency of environment, but also it had more dry forage yield. Also, former seed rate had effective role in decreasing the weed biomass. This important result was related to reduced light penetrate at the bottom of cover crop and probably lack of competition in access to environmental resources was also affected. So using this seed density for mentioned area is recommended for reducing weed competition and improving the quality and quantity of dry forage. Acknowledgments The authors gratefully acknowledge the teachers of College of Agriculture of Lorestan University, for their critical review of the manuscript.

  11. Composting of rice straw with oilseed rape cake and poultry manure and its effects on faba bean (Vicia faba L.) growth and soil properties.

    Science.gov (United States)

    Abdelhamid, Magdi T; Horiuchi, Takatsugu; Oba, Shinya

    2004-06-01

    Composting of rice straw with poultry manure and oilseed rape cake and its effects on growth and yield of faba bean and soil properties was studied in pot experiments at Gifu University, Japan in 2001/2002. The composts reached maturity in 90 days, were rich in organic matter and mineral nutrients, had a high level of stability, and no phytotoxicity. The addition of compost (20-200 g pot(-1)) improved selected soil chemical (increased total N, total C and CEC), physical (decreased particle density) and biological (increased soil respiration rate) properties. Application of composts at a rate of 20 g pot(-1) significantly increased growth, yield, yield components and total crude protein of faba bean plants. The benefit of this compost without chemical fertilizer demonstrated the validity and possibility of sustainable agronomic performance of faba bean using locally available recycled organic materials. Copyright 2003 Elsevier Ltd.

  12. Chemical composition and some anti-nutrient content of raw and processed bitter vetch (Vicia ervilia) seed for use as feeding stuff in poultry diet.

    Science.gov (United States)

    Sadeghi, Gh; Pourreza, J; Samei, A; Rahmani, H

    2009-01-01

    An experiment was conducted to determine chemical composition of raw and treated bitter vetch seed for use in poultry diets. Processing methods were: soaked in water for 12 h, then autoclaved and dried (SA); coarsely ground, soaked in water for 24 h, autoclaved and dried (GSA); coarsely ground, soaked in water for 47 h with exchange of water every 12 h, cooked and dried (GSC); coarsely ground, soaked in solution of 1% acetic acid for 24 h at 60 degrees C and dried (GAA). Raw bitter vetch seed was contained 94.52, 26.56, 0.4, 58.86, 3.38, 5.32, 12.28 and 14.20 percent DM, CP, EE, NFE, Ash, CF, ADF and NDF, respectively. Its GE, AME, AMEn, TME and TMEn values were 18.10, 13.15, 14.38, 14.10 and 14.69 MJ/kg, respectively. Results indicated that bitter vetch is a good source of Fe (340 ppm) and Cu (46.7 ppm). It s amino acid profile was suitable and methionine was the first limiting amino acid when compared with broiler and layer chicks requirements. Its canavanine and tannin content were 0.78 and 6.7 mg/kgDM, respectively. Processing methods improved CP and in some cases AMEn. All processing methods especially GSC resulted in a significant (P < 0.05) reduction in canavanine and tannin.

  13. Intercropped oats (Avena sativa) - common vetch (Vicia sativa) silage in the dry season for small-scale dairy systems in the highlands of central Mexico.

    Science.gov (United States)

    Garduño-Castro, Y; Espinoza-Ortega, A; González-Esquivel, C E; Mateo-Salazar, B; Arriaga-Jordán, C M

    2009-06-01

    Small-scale dairy systems in the highlands of central Mexico require feeding strategies based on quality home-grown forage that may reduce high concentrate costs. Eight Holstein cows paired by parity and date of calving were used in a split-plot experiment to evaluate supplementing 6 kg DM/cow/d of oat-vetch silage (OVS) in comparison to maize silage (MS) as dry season feeding, for a more intensive use of the land through an oat-vetch catch crop. Cows had 9 h/d access to continuous grazing of perennial ryegrass - white clover pasture and 4 kg/d of commercial concentrate. The 9 week experiment, recorded weekly milk yield and composition, and body condition score and live-weight every fortnight. Milk yield was 20.1 kg/cow/d for OVS and 15.4 for MS (SEM +/-2.9, P > 0.05), with no differences for fat or protein content, body condition score, or live-weight (P > 0.05). The economic analysis showed that although feeding costs were higher for OVS, margins were greater than for MS, with feeding cost per litre of $0.21 for MS and $0.16 for OVS. OVS is a viable catch crop after the MS harvest that can substitute MS in the dry season enabling a more intensive use of the land.

  14. A chitotetrose specific lectin from Luffa acutangula: Physico ...

    Indian Academy of Sciences (India)

    tribpo

    chemical properties and the assignment of orientation of sugars in the lectin binding site. VELLAREDDY .... The macromolecular properties of the lectin are listed in table 1. The sedimentation equilibrium ... specific lectins such as wheat germ, (Allen, 1973) Datura stramonium and Solanum tuberosum (Desai et al., 1981) ...

  15. Surface binding properties of aged and fresh (recently excreted) Toxoplasma gondii oocysts

    Science.gov (United States)

    The surface properties of aged (stored for 10 years) and fresh (recently excreted) oocysts of Toxoplasma gondii were investigated using monoclonal antibody (mAb) and lectin-binding assays. Fresh oocysts bound a wall-specific mAb labeled with fluorescein isothiocyanate while aged oocysts did not. In ...

  16. Role of Gal and GalNAc containing glycans in various physiological ...

    African Journals Online (AJOL)

    Muhammad Ramzan Manwar Hussain

    2011-09-28

    Sep 28, 2011 ... GalNAc, which has its specific physiological role in lectin binding or recognition process [23,46–53]. Physiological efficacy of these modifications and their association in various cellular phenomena are given below. 5.1. Physiological significance of sulfated Gal and GalNAc. Sulfated glycoconjugates occur ...

  17. The impact of fixatives on the binding of lectins to N-acetyl-glucosamine residues of human syncytiotrophoblast: a quantitative histochemical study

    DEFF Research Database (Denmark)

    Høyer, P E; Kirkeby, S

    1996-01-01

    binding to N-acetyl-galactosamine, mannose, galactose, and fucose was also significantly higher in sections from tissues fixed in an acid fixative compared with a neutral buffered fixative. Unfixed cryosections revealed a considerably lower degree of specific lectin binding compared with sections from...

  18. Chemical Blistering: Cellular and Macromolecular Components.

    Science.gov (United States)

    1987-11-15

    Ulex europeus lectin. In tissue sections of skin, this lectin binds to the epidermal spinous cells (cf Brabec, et al., 1980). The methodology of...the surface of basal cell and the cells of the lower two spinous layers. On the other hand, Ulex europeus Agglutinin I (UEA) was seen to bind to the

  19. Survival of Newcastle disease virus (NDV) strain V4- UPM coated on ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... A comparative evaluation of millet, sorghum and other delivery systems for oral Newcastle disease V4 vaccination. Bull. Anim. Prod. Afr., 50: 21-29. McMillan BC, Rehmani SF, Hanson RP (1986). Lectin binding and carbohydrate moieties present on Newcastle disease virus strains. Avian Dis., 30: 340-344.

  20. Galactose/N-acetylgalactosamine lectin: the coordinator of host cell ...

    Indian Academy of Sciences (India)

    This killing involves the amoebic surface protein referred to as the Gal/GalNAc lectin. The Gal/GalNAc lectin binds galactose and N-acetylgalactosamine allowing the adherence of amoebas to host cells. Involvement of the lectin in the pathogenesis of E. histolytica infection will be reviewed in this paper. The lectin has been ...

  1. Stimulated macrophages express a new glycoprotein receptor reactive with Griffonia simplicifolia I-B4 isolectin.

    Science.gov (United States)

    Maddox, D E; Shibata, S; Goldstein, I J

    1982-01-01

    This paper presents data on reactions of murine macrophages with a variety of lectins, with special focus on Griffonia simplicifolia I-B4 isolectin, the only lectin we tried that distinguishes stimulated macrophages from resident populations. Specificity of Griffonia simplicifolia I reaction with carbohydrate determinants at the cell surface is shown by (i) ability of alpha-galactosidase treatment of intact cells to abolish all lectin binding whereas beta-galactosidase has no effect on lectin binding, (ii) ability of methyl alpha-D-galactopyranoside to completely inhibit lectin binding with methyl alpha-D-galactopyranoside having no effect on lectin binding, (iii) ability of brief treatment of intact cells with trypsin to liberate a glycopeptide but reacts with G. simplicifolia I to form a precipitate that is dissolved by addition of methyl-alpha-D-galactopyranoside or alpha-galactosidase, (iv) ability of methyl alpha-D-galactopyranoside (but no other monosaccharide) to completely inhibit avid binding of macrophages to G. simplicifolia I lectin immobilized on an insoluble support, and (v) ability of immobilized lectin to separate macrophages into highly pure subpopulations of lectin-reactive and lectin-unreactive cells, as shown by examination of fluorescein-labeled lectin-treated cells with phase-contrast/fluorescence microscopy.

  2. Is hexamerin receptor a GPI-anchored protein in Achaea janata ...

    Indian Academy of Sciences (India)

    2011-07-08

    Jul 8, 2011 ... ... glycosylphosphatidylinositol (GPI)-anchored protein and, further, that the hexamerin binding to HBP was inhibited after digestion. Hexamerin overlay assay (HOA) of co-immunoprecipitated in vitro phosphorylated HBP showed exclusive binding to ∼120 kDa protein. Lectin-binding analysis of hexamerins ...

  3. Flow cytometry analysis of FITC-labeled concanavalin A binding to human blood cells as an indicator of radiation-induced membrane alterations

    Energy Technology Data Exchange (ETDEWEB)

    Donnadieu-Claraz, M.; Paillole, N.; Voisin, P. [CEA Centre d`Etudes de Fontenay-aux-Roses, 92 (France). Dept. de Protection de la Sante de l`Homme et de Dosimetrie; Djounova, J. [National Centre of Radiobiology and Radiation Protection, Sofia (Bulgaria)

    1995-12-31

    The {sup 3}H concanavalin-A binding to human blood cells have been described as a promising biological indicator of radiation overexposure. Flow cytometry adaptation of this technique using fluorescein-labelled concanavalin-A were performed to estimate time-dependent changes in binding on human blood cells membranes after in vitro {gamma} irradiation ({sup 60}Co). Result revealed significant enhanced lectin-binding to platelets and erythrocytes in a dose range of 0,5-5 Gy, 1 and 3 hours after irradiation. However for both platelets and erythrocytes, it was impossible to discriminate between the different doses. Further studies are necessary to confirm the suitability of lectin-binding as a biological indicator for radiation dose assessment. (authors). 5 refs., 1 fig.

  4. EFFECT OF PLANT LECTINS ON HUMAN BLOOD GROUP ANTIGENS WITH SPECIAL FOCUS ON PLANT FOODS AND JUICES

    OpenAIRE

    B. Venkata Raman; B. Sravani; P. Phani Rekha; K.V.N. Lalitha; B. Narasimha Rao

    2012-01-01

    Different plant lectins have been studied for lectin binding activity on ABO blood group system individually to study their suitability for consumption. 45% of plants were found to show blood group agglutination activity against A, B, AB and O groups. These results showed more suitability for consumption of investigated plants and their products to entire human population. Data also alarming human to be more careful about the plant lectins reacting with blood groups as the similar reactions ...

  5. Fluorescein Isothiocyanate-Labeled Lectin Analysis of the Surface of the Nitrogen-Fixing Bacterium Azospirillum brasilense by Flow Cytometry

    OpenAIRE

    Yagoda-Shagam, Janet; Barton, Larry L.; Reed, William P.; Chiovetti, Robert

    1988-01-01

    The cell surface of Azospirillum brasilense was probed by using fluorescein isothiocyanate (FITC)-labeled lectins, with binding determined by fluorescence-activated flow cytometry. Cells from nitrogen-fixing or ammonium-assimilating cultures reacted similarly to FITC-labeled lectins, with lectin binding in the following order: Griffonia simplicifolia II agglutinin > Griffonia simplicifolia I agglutinin > Triticum vulgaris agglutinin > Glycine max agglutinin > Canavalia ensiformis agglutinin >...

  6. Stimulated macrophages express a new glycoprotein receptor reactive with Griffonia simplicifolia I-B4 isolectin.

    OpenAIRE

    Maddox, D E; Shibata, S; Goldstein, I J

    1982-01-01

    This paper presents data on reactions of murine macrophages with a variety of lectins, with special focus on Griffonia simplicifolia I-B4 isolectin, the only lectin we tried that distinguishes stimulated macrophages from resident populations. Specificity of Griffonia simplicifolia I reaction with carbohydrate determinants at the cell surface is shown by (i) ability of alpha-galactosidase treatment of intact cells to abolish all lectin binding whereas beta-galactosidase has no effect on lectin...

  7. Carbohydrate Nanotechnology: Hierarchical Assemblies and Information Processing from Oligosaccharide-Synthetic Lectin Host-Guest

    Science.gov (United States)

    2014-09-17

    does not compete for H- bonding between host and guest, thereby enhancing polar noncovalent bonds . These titrations revealed that the selectivity of 1...synthetic lectin binding pairs that bind specifically and strongly through noncovalent interactions, (2) utilize the information encoded by the...substrate-binding proteins, use water desolvation, hydrogen bonding (H- bonding ), and C–H•••π interactions to selectively recognize glycans that may

  8. An increase in renal dopamine does not stimulate natriuresis after fava bean ingestion123

    OpenAIRE

    Garland, Emily M; Cesar, Tericka S; Lonce, Suzanna; Ferguson, Marcus C; Robertson, David

    2013-01-01

    Background: Fava beans (Vicia faba) contain dihydroxyphenylalanine (dopa), and their ingestion may increase dopamine stores. Renal dopamine regulates blood pressure and blood volume via a natriuretic effect.

  9. In vitro investigations of the potential health benefits of Australian-grown faba beans (Vicia faba L.): chemopreventative capacity and inhibitory effects on the angiotensin-converting enzyme, α-glucosidase and lipase.

    Science.gov (United States)

    Siah, Siem D; Konczak, Izabela; Agboola, Samson; Wood, Jennifer A; Blanchard, Christopher L

    2012-08-01

    The functional properties, including antioxidant and chemopreventative capacities as well as the inhibitory effects on angiotensin-converting enzyme (ACE), α-glucosidase and pancreatic lipase, of three Australian-grown faba bean genotypes (Nura, Rossa and TF(Ic*As)*483/13) were investigated using an array of in vitro assays. Chromatograms of on-line post column derivatisation assay coupled with HPLC revealed the existence of active phenolics (hump) in the coloured genotypes, which was lacking in the white-coloured breeding line, TF(Ic*As)*483/13. Roasting reduced the phenolic content, and diminished antioxidant activity by 10-40 % as measured by the reagent-based assays (diphenylpicrylhydrazyl, 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) and oxygen radical absorbance capacity) in all genotypes. Cell culture-based antioxidant activity assay (cellular antioxidant activity) showed an increase of activity in the coloured genotypes after roasting. Faba bean extracts demonstrated cellular protection ability against H₂O₂-induced DNA damage (assessed using RAW264.7 cells), and inhibited the proliferation of all human cancer cell lines (BL13, AGS, Hep G2 and HT-29) evaluated. However, the effect of faba bean extracts on the non-transformed human cells (CCD-18Co) was negligible. Flow cytometric analyses showed that faba bean extracts successfully induced apoptosis of HL-60 (acute promyelocytic leukaemia) cells. The faba bean extracts also exhibited ACE, α-glucosidase and pancreatic lipase inhibitory activities. Overall, extracts from Nura (buff-coloured) and Rossa (red-coloured) were comparable, while TF(Ic*As)*483/13 (white-coloured) contained the lowest phenolic content and exhibited the least antioxidant and enzyme inhibition activities. These results are important to promote the utilisation of faba beans in human diets for various health benefits.

  10. Pea (Pisum sativum and faba bean (Vicia faba L. seeds as protein sources in growing-finishing heavy pig diets: effect on growth performance, carcass characteristics and on fresh and seasoned Parma ham quality

    Directory of Open Access Journals (Sweden)

    Francesco Masoero

    2011-10-01

    Full Text Available The effect of pea and faba bean inclusion in growing-finishing heavy pig diets was evaluated. The following iso-lysinic and iso-energetic diets offered to the pigs in three phases (40-80; 80-120; 120-160 kg were compared: CTR, control diet with soybean meal (SBM as protein source; RP, CTR diet where pea replaced SBM; RF, CTR diet where faba bean replaced SBM. 126 animals were randomly distributed in 3 homogeneous groups with 42 animals each (7 pens with 6 animals each per treatment. The RP and RF diets did not negatively affect the carcass characteristics both of the pigs slaughtered at the conventional weight (127.5 kg and heavy pigs (158.5 kg. The pigs fed the RP and RF diets ate similarly to the pigs fed the CTR overall the trial but RF pigs grew better than CTR animals. The subcutaneous fat of the fresh hams destined for Parma ham production and obtained from pigs fed RP diet had a higher omega 3 fatty acid percentage. Moreover, the RP and RF diets resulted in fat with better omega 3/omega 6 ratio compared with CTR. All the fat samples had iodine numbers within the limit value (70 reported by the Production Disciplinary of Parma ham. No treatment effect was found on the analytical and sensorial characteristics of the Parma hams, except for the aged taste which was more intense in the hams obtained from pigs fed the RF diet. These results indicate that pea and faba bean may be used as an alternative to imported SBM.

  11. Pea (Pisum sativum) and faba bean (Vicia faba L.) seeds as protein sources in growing-finishing heavy pig diets: effect on growth performance, carcass characteristics and on fresh and seasoned Parma ham quality

    OpenAIRE

    Francesco Masoero; Carla Cerioli; Samantha Sigolo; Mauro Morlacchini; Aldo Prandini

    2011-01-01

    The effect of pea and faba bean inclusion in growing-finishing heavy pig diets was evaluated. The following iso-lysinic and iso-energetic diets offered to the pigs in three phases (40-80; 80-120; 120-160 kg) were compared: CTR, control diet with soybean meal (SBM) as protein source; RP, CTR diet where pea replaced SBM; RF, CTR diet where faba bean replaced SBM. 126 animals were randomly distributed in 3 homogeneous groups with 42 animals each (7 pens with 6 animals each per treatment). The RP...

  12. Phylogeny, phylogeography and genetic diversity of Pisum genus

    Science.gov (United States)

    Tribe Fabeae (formerly Vicieae) contains some of humanity's most important grain legume crops, namely Lathyrus; Lens; Pisum; Vicia and the monotypic genus Vavilovia. Our study based on molecular data, have positioned Pisum between Vicia and Lathyrus and being closely allied to Vavilovia. Study of p...

  13. Fungicide, antibiotic, heavy metal resistance and salt tolerance of ...

    African Journals Online (AJOL)

    Fungicide, antibiotic, heavy metal resistance and salt tolerance of root nodule isolates from Vicia palaestina. ... African Journal of Biotechnology ... The objective of this study was to investigate the effects of fungicides, antibiotics, heavy metal and salt on growth of Rhizobium isolates which isolated from the Vicia palaestina ...

  14. Lower Mississippi River Environmental Program. Report 2. A Physical Description of Main Stem Levee Borrow Pits along the Lower Mississippi River

    Science.gov (United States)

    1988-02-01

    Melilotus officinalis Yellow sweet clover Mikania scandens Climbing hempweed Morus rubra Red mulberry Myrica cerifera Wax myrtle Nelumbo lutea Lotus...Verbena brasiliensis Wild verbena Vicia americana Common vetch Vicia lanceolata Narrowleaf vetch Viola spp. Violets Vitis aestivalis Summer grape Vitis

  15. Lectin Microarray Reveals Binding Profiles of Lactobacillus casei Strains in a Comprehensive Analysis of Bacterial Cell Wall Polysaccharides▿†

    Science.gov (United States)

    Yasuda, Emi; Tateno, Hiroaki; Hirabarashi, Jun; Iino, Tohru; Sako, Tomoyuki

    2011-01-01

    We previously showed a pivotal role of the polysaccharide (PS) moiety in the cell wall of the Lactobacillus casei strain Shirota (YIT 9029) as a possible immune modulator (E. Yasuda M. Serata, and T. Sako, Appl. Environ. Microbiol. 74:4746-4755, 2008). To distinguish PS structures on the bacterial cell surface of individual strains in relation to their activities, it would be useful to have a rapid and high-throughput methodology. Recently, a new technique called lectin microarray was developed for rapid profiling of glycosylation in eukaryotic polymers and cell surfaces. Here, we report on the development of a simple and sensitive method based on this technology for direct analysis of intact bacterial cell surface glycomes. The method involves labeling bacterial cells with SYTOX Orange before incubation with the lectin microarray. After washing, bound cells are directly detected using an evanescent-field fluorescence scanner in a liquid phase. Using this method, we compared the cell surface glycomes from 16 different strains of L. casei. The patterns of lectin-binding affinity of most strains were found to be unique. There appears to be two types of lectin-binding profiles: the first is characterized by a few lectins, and the other is characterized by multiple lectins with different specificities. We also showed a dramatic change in the lectin-binding profile of a YIT 9029 derivative with a mutation in the cps1C gene, encoding a putative glycosyltransferase. In conclusion, the developed technique provided a novel strategy for rapid profiling and, more importantly, differentiating numerous bacterial strains with relevance to the biological functions of PS. PMID:21602390

  16. Microvessel changes in hypertension measured by Griffonia simplicifolia I lectin.

    Science.gov (United States)

    Greene, A S; Lombard, J H; Cowley, A W; Hansen-Smith, F M

    1990-06-01

    Commonly used methods for assessing reductions in microvascular density (rarefaction) in hypertension detect only perfused microvessels. In the present study, samples of cremaster and spinotrapezius muscles were taken from rats with chronic (4-week) reduced renal mass hypertension and normotensive sham-operated control rats, as well as from 12-week-old spontaneously hypertensive rats and their normotensive Wistar-Kyoto control strain. Mean arterial pressure was 149 +/- 8 mm Hg in the rats with reduced renal mass hypertension, 114 +/- 7 mm Hg in sham-operated rats, 177 +/- 9 mm Hg in spontaneously hypertensive rats, and 95 +/- 4 mm Hg in Wistar-Kyoto rats. Muscle samples were incubated with rhodamine-labeled Griffonia simplicifolia I lectin, which identifies both perfused and nonperfused microvessels. Microvascular density was assessed by counting intersections with a 20-microns grid. Microvessel density was significantly reduced in cremaster muscles of both spontaneously hypertensive and reduced renal mass hypertensive rats, and in the spinotrapezius muscle of spontaneously hypertensive rats, compared with their respective normotensive controls. Further studies in the reduced renal mass rats on low salt diets indicated that lectin binding was also decreased as salt intake was increased, independent of blood pressure. This change was not due to an alteration in lectin-binding affinity. These studies indicate that lectin binding can be a useful tool for assessing microvessel density that does not depend on the perfusion state of the vessels and that rarefaction due to hypertension is not evenly distributed in all vascular beds. These results also provide evidence that dietary salt intake alone can influence microvessel density, as measured by the lectin technique.

  17. Sialic acid receptor detection in the human respiratory tract: evidence for widespread distribution of potential binding sites for human and avian influenza viruses

    Directory of Open Access Journals (Sweden)

    Guan Yi

    2007-10-01

    Full Text Available Abstract Background Influenza virus binds to cell receptors via sialic acid (SA linked glycoproteins. They recognize SA on host cells through their haemagglutinins (H. The distribution of SA on cell surfaces is one determinant of host tropism and understanding its expression on human cells and tissues is important for understanding influenza pathogenesis. The objective of this study therefore was to optimize the detection of α2,3-linked and α2,6-linked SA by lectin histochemistry by investigating the binding of Sambucus nigra agglutinin (SNA for SAα2,6Gal and Maackia amurensis agglutinin (MAA for SAα2,3Gal in the respiratory tract of normal adults and children. Methods We used fluorescent and biotinylated SNA and MAA from different suppliers on archived and prospectively collected biopsy and autopsy specimens from the nasopharynx, trachea, bronchus and lungs of fetuses, infants and adults. We compared different methods of unmasking for tissue sections to determine if these would affect lectin binding. Using serial sections we then compared the lectin binding of MAA from different suppliers. Results We found that unmasking using microwave treatment in citrate buffer produced increased lectin binding to the ciliated and glandular epithelium of the respiratory tract. In addition we found that there were differences in tissue distribution of the α2,3 linked SA when 2 different isoforms of MAA (MAA1 and MAA2 lectin were used. MAA1 had widespread binding throughout the upper and lower respiratory tract and showed more binding to the respiratory epithelium of children than in adults. By comparison, MAA2 binding was mainly restricted to the alveolar epithelial cells of the lung with weak binding to goblet cells. SNA binding was detected in bronchial and alveolar epithelial cells and binding of this lectin was stronger to the paediatric epithelium compared to adult epithelium. Furthermore, the MAA lectins from 2 suppliers (Roche and EY Labs tended

  18. Human Neural Cell-Based Biosensor

    Science.gov (United States)

    2010-04-26

    95 eGFP pCMV PSD-95 mCherry pECFP PSD-95 CFP Discs, large homolog 4 (PSD-95) Post synaptic density protein ; post- synaptic marker pKv4.2-eGFP...NLGN4) Brain-specific, post synaptic membrane protein pNICENeurexin1 beta – CFP Neurexin-1-beta (NRXN1) role in synaptogenesis; interacts with...localization of lectin binding. Lectins are carbohydrate binding proteins that recognize diverse sugar structures. Here we used a panel of 8 lectins to

  19. Conglutinin binds the HIV-1 envelope glycoprotein gp 160 and inhibits its interaction with cell membrane CD4

    DEFF Research Database (Denmark)

    Andersen, Ove; Sørensen, A M; Svehag, S E

    1991-01-01

    The highly glycosylated envelope glycoprotein (gp 160) of human immunodeficiency virus (HIV) interacts with the CD4 molecule present on the membrane of CD4+ cells and is involved in the pathobiology of HIV infection. Lectins bind glycoproteins through non-covalent interactions with specific hexose...... of the binding of rgp160 to the CD4 receptor on CEM 13 cells, as demonstrated by FACS analyses. These results indicate that conglutinin may inhibit the infection with HIV-1 through its interaction with the viral envelope glycoprotein....

  20. African Journal of Food, Agriculture, Nutrition and Development - Vol ...

    African Journals Online (AJOL)

    Vicia sativa l.) mixtures under irrigated conditions of Madagascar · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. V.B Rahetlah, J.M Randrianaivoarivony, L.H Razafimpamoa, V.L ...

  1. A study on the qualitative and quantitative traits of barley ( Hordeum ...

    African Journals Online (AJOL)

    A study on the qualitative and quantitative traits of barley ( Hordeum vulgare L.) and narbon vetch ( Vicia narbonensis L.) in intercropping and sole cropping system under the interference and control of weeds in dry land farming...

  2. Evaluating a core germplasm collection of the cover crop hairy vetch for use in sustainable farming systems

    Science.gov (United States)

    Understanding linkage between genotype and agronomically important phenotypes (early flowering, hard seed and winter hardiness) will facilitate cultivar selection and inform breeding programs concerned with the cover crop hairy vetch (Vicia villosa). . We used molecular and biochemical techniques to...

  3. Significance of genetic resources of cool season annual legumes: II: Neglected and underutilised crops

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2014-01-01

    Full Text Available Plant genetic resources are a live treasury of both one country and the whole mankind, although their ex situ preservation and in situ conservation are very demanding in numerous ways, especially if human resources and financial issues are considered. Legumes (Fabaceae Lindl. are facing the bottlenecks caused by breeding emphasizing yield and quality, raising the questions how to solve the issue of this narrowing the genetic basis of cultivated legume species. The reintroduction of neglected and underutilised crops, such as red vetchling (Lathyrus cicera, Cyprus vetchling (Lathyrus ochrus, French serradella (Ornithopus sativus, Ethiopian pea (Pisum abyssinicum, field pea (Pisum sativum var. arvense, fenugreek (Trigonella phoenum-graecum, bitter vetch (Vicia ervilia, Narbonne vetch (Vicia narbonensis, Hungarian vetch (Vicia pannonica and hairy vetch (Vicia villosa may significantly assist many contemporary farming systems by diversifying their needs and improve the efficiency of environment resources.

  4. Verteerbaarheid en voederwaarde van eiwitrijke grondstoffen bij biologische biggen = Digestibility and nutritive value of protein-rich raw materials in organically housed piglets

    NARCIS (Netherlands)

    Peet-Schwering, van der C.M.C.; Binnendijk, G.P.; Diepen, van J.T.M.

    2011-01-01

    At the Experimental Farm Raalte, the nutrient composition, digestibiltiy and energy value of canola protein concentrate, pea protein concentrate, wheat gluten meal and vicia faba protein concentrate were investigated in organically housed piglets. The results are described in this report.

  5. A comparison of different legume seeds as protein supplement to optimise the use of low quality forages by ruminants

    DEFF Research Database (Denmark)

    Yánez-Ruiz, David R; Martin-Garcia, Antonio I; Weisbjerg, Martin Riis

    2009-01-01

    The potential of different legume seeds species, including recently new developed varieties (Vicia faba: a commercial variety and varieties Alameda, Palacio and Baraka; Lupinus angustifolius; Pisum sativum and Cicer arietinum: varieties Fardon and Zegr ) as protein supplements to low quality...

  6. Mapping of quantitative trait loci controlling Orobanche foetida Poir ...

    African Journals Online (AJOL)

    Mapping of quantitative trait loci controlling Orobanche foetida Poir. resistance in faba bean (Vicia faba L.) R Díaz-Ruiz, A Torres, MV Gutierrez, D Rubiales, JI Cubero, M Kharrat, Z Satovic, B Román ...

  7. Author Details

    African Journals Online (AJOL)

    Uromyces viciae-fabae) with Environmental Factors and Cultural Practices in the Hararghe Highlands, Eastern Ethiopia Abstract. ISSN: 1992-0407. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

  8. Evaluation of Vetch Species and their Accessions for Agronomic ...

    African Journals Online (AJOL)

    . Ginchi respectively. Among vetch species, Vicia dasycarpa have higher crude protein and digestibility but lower fiber contents. Correlation analysis indicated that forage dry matter yield was positively associated with days to forage and seed.

  9. Final Environmental Assessment Addressing New Construction and Demolition at Beale Air Force Base, California

    Science.gov (United States)

    2014-04-01

    at Beale AFB include mostly naturalized annual grass species including ripgut brome (Bromus diandrus), Italian rye grass (Lolium multiflorum), soft...Vicia sp.), Ripgut brome (Bromus diandrus.), white brodiaea (Triteleia 30  hyacinthina), English plantain (Plantago lanceolata), annual bluegrass (Poa

  10. Efectos combinados del estres por salinidad y la nicotinamida sobre parametros bioquimicos y fisiologicos en plantas de haba

    National Research Council Canada - National Science Library

    Abdelhamid, Magdi T; Sadak, Mervat Sh; Schmidhalter, Urs; Saady, Abdel-Kareem M. El

    2013-01-01

    .... One of these compounds is nicotinamide (vitamin B3/niacin). The effect of exogenous application of nicotinamide with different concentrations (0, 200 or 400 mg [l.sup.-1]) on faba bean (Vicia faba L...

  11. The effect of endogenous hydrogen peroxide induced by cold treatment in the improvement of tissue regeneration efficiency

    NARCIS (Netherlands)

    Szechynska-Hebda, M.; Skrzypek, E.; Dabrowska, G.; Wedzony, M.; Lammeren, van A.A.M.

    2012-01-01

    We propose that oxidative stress resulting from an imbalance between generation and scavenging hydrogen peroxide contributes to tissue regeneration efficiency during somatic embryogenesis of hexaploid winter wheat (Triticum aestivum cv. Kamila) and organogenesis of faba bean (Vicia faba ssp. minor

  12. The development rhythm of the flower-bud in some Papilionaceae species. III. Macrosporogenesis, microsporogenesis and early gametogenesis in several species of the Vicieae tribe

    Directory of Open Access Journals (Sweden)

    Wanda Wojciechowska

    2014-01-01

    Full Text Available Each of the examined species of the tribe Vicieae (Vicia faba, V. sativa, V, villosa, Lathyrus silvester, L. pratensis and Pisum sativum has its peculiar characteristic development rhythm of the bud. A similarity has been demonstrated between the development rhythms of flower buds of Vicia faba and Pisum sativum. It was found that mature flowers of autogamous species had long calyces, whereas those of the allogamous species were short as compared with the petals of the corolla.

  13. Effects of erythromycin, trimethoprim and clindamycin on attached microbial communities from an effluent dominated prairie stream.

    Science.gov (United States)

    Waiser, M J; Swerhone, G D W; Roy, J; Tumber, V; Lawrence, J R

    2016-10-01

    In this study, differing metrics were utilized to measure effects of erythromycin (ER), trimethoprim (TR) and clindamycin (CL) on the structure and function of attached Wascana Creek, SK microbial communities. All three test antibiotics, especially ER, affected community structure and function of biofilms grown in rotating annular reactors. Biofilm thickness, bacterial biomass, and lectin binding biovolume (exopolymeric substances) were consistently less in ER treated biofilms when compared to the control. As well negative effects on protozoan numbers, and carbon utilization were detected. Finally, PCA analyses of DGGE results indicated that bacterial community diversity in ER exposed biofilms was always different from the control. ER exhibited toxic effects even at lower concentrations. Observations on TR and CL exposed biofilms indicated that bacterial biomass, lectin binding biovolume and carbon utilization were negatively affected as well. In terms of bacterial community diversity, however, CL exposed biofilms tended to group with the control while TR grouped with nutrient additions suggesting both nutritive and toxic effects. This study results represent an important step in understanding antibiotic effects, especially ER, on aquatic microbial communities. And because ER is so ubiquitous in receiving water bodies worldwide, the Wascana study results suggest the possibility of ecosystem disturbance elsewhere. Erythromycin (ER) is ubiquitous in waterbodies receiving sewage effluent. Structure and function of microbial communities from an effluent dominated stream were negatively affected by ER, at realistic concentrations. Crown Copyright © 2016. Published by Elsevier Inc. All rights reserved.

  14. [Isolation, culture and identification of two types of endothelial progenitor cells from peripheral blood in rabbits].

    Science.gov (United States)

    Xiao, Fang-Yi; Zhang, Huai-Qin; Yu, Hua; Yang, De-Ye; Huang, Wei-Jian; Zhou, Hao

    2007-04-01

    To investigate how to isolate, culture and identify two types of endothelial progenitor cells from peripheral blood in rabbits. Mononuclear cells(MNCs) were isolated from rabbit peripheral blood. Endothelial progenitor cells (EPCs) and endothelial outgrowth cells (EOCs) were obtained from MNCs through different ways of isolation and culture. Two types of cells were assessed by DiI-ac-LDL uptake and lectin binding, and then they were identified by immunofluorescence of flk-1, immunocytochemistry of CD34 and VIII factor related antigen and vasculogenesis activity in vitro. Two types of endothelial progenitor cells were obtained from rabbit peripheral blood through different ways of isolation and culture. EPCs on the seventh day and EOCs on the sixteenth day were positive for ac-LDL uptake and lectin binding, and both of them expressed CD34, flk-1 and VIII factor related antigen. EOCs were assembled into primitive vascular tube-like structures when plated in matrigel. EPCs and EOCs could be obtained from rabbit peripheral blood when different ways of isolation and culture were performed. The system of cell culture can be applied to subsequent experiments in cell transplantation.

  15. Histochemical analyses of hepatic architecture of the hagfish with special attention to periportal biliary structures.

    Science.gov (United States)

    Umezu, Arisa; Kametani, Harunobu; Akai, Yusuke; Koike, Toru; Shiojiri, Nobuyoshi

    2012-07-01

    The hagfish liver was histochemically examined with special attention to biliary structures around the portal veins. Hepatocytes were organized into tubular structures surrounded by sinusoids. Biliary ductule structures, which resemble the ductal plates transiently appearing in mammalian liver development, were observed around the portal veins, but they did not appear around central veins. Thus, the hagfish liver demonstrates the same basic structure as the mammalian liver; that is, a vascular system from portal to central veins via sinusoids, and portal triad structures consisting of portal veins, hepatic arteries, and intrahepatic bile ducts. The epithelial cells of the ductal platelike structures strongly expressed cytokeratin, had some lectin-binding sites, and were delineated by the basal lamina, which was reactive for periodic acid-Schiff (PAS) staining and Iectin histochemistry. The lumina of the ductal plate-like structures were comparatively small and heterogeneous in diameter around the portal veins, suggesting that the biliary structures may not be efficient for bile secretion. The epithelial cells of the gall bladder had a simple columnar shape and were a PAS-positive cytoplasm. Those of bile ducts near the hilus, including extrahepatic and hepatic ducts, were simple columnar or cuboidal cells, and had large lumina. The cytoplasm in these cells was PAS-positive. These phenotypes with the expression of lectin-binding sites were clearly different from those of the ductal plate-like structures in the liver proper, suggesting that the extrahepatic and intrahepatic biliary structures may have different developmental origins.

  16. Prospeção da diversidade de fungos micorrízicos arbusculares em 2 espécies agrícolas (Phaseolus vulgaris L. e Vicia faba L.) e 2 espécies nativas (Teline maderensis Webb & Berthel e Genista tenera (Jacq. Ex Murray) Kuntze) da Madeira

    OpenAIRE

    Oliveira, Maria Cristina Ornelas

    2016-01-01

    Tese de mestrado, Microbiologia Aplicada, Universidade de Lisboa, Faculdade de Ciências, 2016 O Filo Glomeromycota compreende um grupo de fungos que se considera no geral serem biotróficos obrigatórios e que se associam a cerca de 80% das plantas. O fungo e a planta formam uma associação simbiótica conhecida como micorriza arbuscular. Desta associação, o fungo absorve entre 5 a 20% do carbono fotossintetizado pela planta e por outro lado a planta pode beneficiar do aumento da absorção de n...

  17. Distribution of terminal sugar residues in the testis of the spotted ray Torpedo marmorata.

    Science.gov (United States)

    Liguoro, Annamaria; Prisco, Marina; Mennella, Clotilde; Ricchiari, Loredana; Angelini, Francesco; Andreuccetti, Piero

    2004-08-01

    Lectins represent a class of proteins/glycoproteins binding specifically to terminal sugar residues. The present investigation aims to identify lectin-binding sites in testis of Torpedo marmorata. Using a panel of lectins coupled with fluoresceine isothiocyanate, we demonstrated that germ and somatic cells present in Torpedo testis contain glycoconjugates, whose distribution at the level of the surface, the cytoplasm and the nucleus changes during germ cell differentiation. Moreover our observations demonstrate that the germ cells undergoing apoptosis (Prisco et al., 2003a: Mol Reprod Dev 64:341-348) overexpress a residual sugar recognised by WFA lectin that can be considered a specific marker for apoptotic germ cells. Finally, our results indicate that there is a progressive increase in glycosilation during spermatogenesis, especially at the level of the acrosome in the spermatocyte-spermatid step, and that Leydig cells are differently stained in relation to the spermatogenetic cycle. Copyright 2004 Wiley-Liss, Inc.

  18. M-ficolin binds selectively to the capsular polysaccharides of Streptococcus pneumoniae serotypes 19B and 19C and of a S. mitis strain

    DEFF Research Database (Denmark)

    Kjær, Troels Rønn; Hansen, Annette G; Sørensen, Uffe B S

    2012-01-01

    of infections. We investigated the binding selectivity by examining the binding of M-ficolin to a panel of more than 100 different streptococcal strains (Streptococcus pneumoniae and Streptococcus mitis) each expressing distinct polysaccharide structures. M-ficolin binding was observed for three strains only......, the pneumococcal serotypes 19B and 19C and a single mitis strain expressing a similar polysaccharide structure. The bound M-ficolin, in association with MASP-2, mediated complement factor C4 cleavage. Binding to the bacteria was inhibitable by N-acetyl glucosamine indicating that the interaction with the bacterial...... surface takes place via the fibrinogen-like domain. The common N-acetyl mannosamine residue present in the structures of the four capsular polysaccharides of group 19 is linked via a phosphodiester bond. This residue is apparently not a ligand for M-ficolin since the lectin binds to two of the group 19...

  19. Covalent immobilization of carbohydrates on sol-gel-coated microplates.

    Science.gov (United States)

    Zou, Lan; Pang, Hei-Leung; Chan, Pak-Ho; Huang, Zhi-Shu; Gu, Lian-Quan; Wong, Kwok-Yin

    2008-09-01

    Carbohydrate microarrays have attracted increasing attention in recent years because of their ability to monitor biologically important protein-carbohydrate interactions in a high-throughput manner. Here we have developed an effective approach to immobilizing intact carbohydrates directly on polystyrene microtiter plates coated with amine-functionalized sol-gel monolayers. Lectin binding was monitored by fluorescence spectroscopy using these covalent arrays of carbohydrates that contained six mono- and di-saccharides on the microplates. In addition, binding affinities of lectin to carbohydrates were also quantitatively analyzed by determining IC(50) values of lectin-specific antibody with these arrays. Our results indicate that microplate-based carbohydrate arrays can be efficiently fabricated by covalent immobilization of intact carbohydrates on sol-gel-coated microplates. The microplate-based carbohydrate arrays can be applied for screening of protein-carbohydrate interactions in a high-throughput manner.

  20. Ulex europeus agglutinin-I binding as a potential prognostic marker in ovarian cancer.

    Science.gov (United States)

    Blonski, Katharina; Milde-Langosch, Karin; Bamberger, Ana-Maria; Osterholz, Tina; Utler, Christian; Berger, Jürgen; Löning, Thomas; Schumacher, Udo

    2007-01-01

    Ovarian cancer represents the malignant tumour of the female genital tract with the worst prognosis, mainly caused by early intraperitoneal spread. Cell-to-cell and cell-to-matrix interactions play a functionally important role in this spread and are both mediated by the cell membrane. Changes in the glycosylation of the cell membrane, as detected by lectin histochemistry, are sometimes associated with a poor prognosis. The expression of lectin binding of 164 ovarian cancer patients was analysed and the staining results were correlated with the clinical data of the patients. The univariate and multivariate statistical analysis revealed an independent prognostic significance for Ulex europeus agglutinin-I (UEA-I) binding. These findings indicate that UEA-I binding can serve as a prognostic factor in ovarian cancer.

  1. The fertilization layer mediated block to polyspermy in Xenopus laevis: isolation of the cortical granule lectin ligand.

    Science.gov (United States)

    Quill, T A; Hedrick, J L

    1996-09-15

    The fertilization layer of Xenopus laevis eggs is formed by the cortical granule lectin binding to its ligand. The binding requires Ca2+, is specific for galactose, and functionally establishes a block to polyspermy at fertilization. We have designed a new enzyme-linked lectin assay for the cortical granule lectin (CGL) ligand which can detect the presence of the CGL ligand at a sensitivity of 1-2 ng/ml. This assay is specifically inhibited with galactose, 50% inhibition at 9.9 mM, and produces a linear response between 2 and 20 ng of jelly adsorbed to the microtiter plate. Using this assay, the CGL ligand was purified through gel filtration, anion-exchange, and CGL affinity chromatography. Hydrolysis of the purified CGL ligand with a series of exoglycosidases showed that a terminal alpha-galactose is the ligand structure required for recognition by CGL.

  2. Characterization of surface associated antigens of axenic Giardia lamblia trophozoites & their recognition by human sera.

    Science.gov (United States)

    Kum, K; Khanna, R; Vinayak, V K

    1991-01-01

    Two surface associated antigens (GLSA-82 and GLSA-56) of axenically grown G. lamblia trophozoites (PI strain) were affinity purified from its sonic extract. Both GLSA-82 and GLSA-56 were heat labile, sensitive to treatment with pronase, trypsin and were also sodium metaperiodate modifiable as assessed by micro ELISA. Lectin binding studies revealed that GLSA-82 specifically bound concanavalin A and pokeweed mitogen, and had alpha-methyl mannoside and n-acetyl-B-d-glucosamine sugar moieties. However, GLSA-56 selectively bound Ricinus communis agglutinin and phytohaemagglutinin, and had B-d-galactose and n-acetyl-B-d-galastosamine as sugar moieties. Human sera obtained during acute G. lamblia infection recognised GLSA-82 and GLSA-56 antigens. However, the antibody levels to GLSA-82 were significantly lower (P less than 0.05) during active giardiasis infection. Such surface associated antigens may be target of antiparasitic immune responses and thus, may modulate disease processes.

  3. Carbohydrate Moieties and Cytoenzymatic Characterization of Hemocytes in Whiteleg Shrimp Litopenaeus vannamei

    Science.gov (United States)

    Velázquez, Edwin; Rodríguez-Jaramillo, Carmen; Ascencio, Felipe

    2016-01-01

    Hemocytes represent one of the most important defense mechanisms against foreign material in Crustacea and are also involved in a variety of other physiological responses. Fluorescent lectin-binding assays and cytochemical reactions were used to identify specificity and distribution of carbohydrate moieties and presence of several hydrolytic enzymes, in hemocytes of whiteleg shrimp Litopenaeus vannamei. Two general classes of circulating hemocytes (granular and agranular) exist in L. vannamei, which express carbohydrates residues for FITC-conjugated lectins WGA, LEA, and PNA; UEA and Con-A were not observed. Enzymatic studies indicated that acid phosphatase, nonspecific esterase, and specific esterases were present; alkaline phosphatase was not observed. The enzymes and carbohydrates are useful tools in hemocyte classification and cellular defense mechanism studies. PMID:27833641

  4. Glycosylation of the major human Pneumocystis carinii surface antigen

    DEFF Research Database (Denmark)

    Lundgren, Bettina; Koch, C; Mathiesen, Lars Reinhardt

    1993-01-01

    It has recently been shown that the major rat P. carinii surface antigen is important for initial host-organism attachment, possibly through binding to fibronectin, mannose-binding protein, or surfactant protein A. Since a carbohydrate/lectin interaction may be involved in adhesion, we undertook...... this study to characterize the glycosylation of the major human P. carinii surface glycoprotein (gp95). We have used purified gp95 as a source of antigen, and in lectin binding and deglycosylation studies it was found that approximately 9% of gp95 consists of N-linked carbohydrates of mainly high......-mannose and bisected complex-type glycans. Using a polyclonal antibody raised against purified gp95 and crossed affinoimmunoelectrophoresis and the lectins Con A and WGA, gp95 exhibited carbohydrate-dependent microheterogeneity. We therefore suggest that gp95 is composed of subtypes which differ in N...

  5. Clicked and long spaced galactosyl- and lactosylcalix[4]arenes: new multivalent galectin-3 ligands

    Directory of Open Access Journals (Sweden)

    Silvia Bernardi

    2014-07-01

    Full Text Available Four novel calix[4]arene-based glycoclusters were synthesized by conjugating the saccharide units to the macrocyclic scaffold using the CuAAC reaction and using long and hydrophilic ethylene glycol spacers. Initially, two galactosylcalix[4]arenes were prepared starting from saccharide units and calixarene cores which differ in the relative dispositions of the alkyne and azido groups. Once the most convenient synthetic pathway was selected, two further lactosylcalix[4]arenes were obtained, one in the cone, the other one in the 1,3-alternate structure. Preliminary studies of the interactions of these novel glycocalixarenes with galectin-3 were carried out by using a lectin-functionalized chip and surface plasmon resonance. These studies indicate a higher affinity of lactosyl- over galactosylcalixarenes. Furthermore, we confirmed that in case of this specific lectin binding the presentation of lactose units on a cone calixarene is highly preferred with respect to its isomeric form in the 1,3-alternate structure.

  6. Mice lacking pituitary tumor transforming gene show elevated exposure of DGalNAc carbohydrate determinants

    Directory of Open Access Journals (Sweden)

    Lutsyk A. D.

    2012-04-01

    Full Text Available Aim. To investigate the influence of pituitary tumor transforming gene (pttg-1 knockout on glycome of parenchimal organs by means of lectin histochemistry. Methods. DGalNAc, DGlcNAc, NeuNAc carbohydrate determinants were labelled with soybean agglutinin (SBA and wheat germ agglutinin (WGA, conjugated to peroxidase, with subsequent visualization of the lectin-binding sites with diaminobenzidine. The testes and kidneys of murine strain BL6/C57 with the pttg-1 gene knockout (PTTG-KO were compared to the wild type (PTTG-WT animals, both groups 1 month of age. Results. Knockout of the pttg-1 gene was accompanied by enhanced exposure of the DGalNAc sugar residues within the Golgi complex of secondary spermatocytes, in a brush border of renal tubules and on the lumenal surface of collecting ducts. Conclusions. This study suggests that knockout of the pttg-1 gene may lead to the changes in carbohydrate processing in mammalian organism.

  7. Glycopattern analysis and structure of the egg extra-cellular matrix in the Apennine yellow-bellied toad, Bombina pachypus (Anura: Bombinatoridae

    Directory of Open Access Journals (Sweden)

    Maria Mastrodonato

    2011-07-01

    Full Text Available We studied the glycopatterns and ultrastructure of the extra-cellular matrix (ECM of the egg of the Apennine yellow-bellied toad Bombina pachypus, by light and electron microscopy in order to determine structure, chemical composition and function. Histochemical techniques in light microscopy included PAS and Alcian Blue pH 2.5 and 1.0, performed also after b-elimination. Lectin-binding was tested with nine lectins (AAA, ConA, DBA, HPA, LTA, PNA, SBA, UEA-I, WGA. An inner fertilization envelope (FE and five jelly layers (J1–J5 were observed, differing in histochemical staining, lectin binding and ultrastructure. Most glycans were O-linked, with many glucosamylated and fucosylated residues. The fertilization envelope presented a perivitelline space and a fertilization layer, with mostly neutral glycans. The jelly layers consisted of fibers and granules, whose number and orientation differed between layers. Fibers were densely packed in J1 and J4 layers, whereas a looser arrangement was observed in the other layers. Jelly-layer glycans were mostly acidic and particularly abundant in the J1 and J4 layers. In the J1, J2 and J5 layers, neutral, N-linked glycans were also observed. Mannosylated and/or glucosylated as well as galactosyl/galactosaminylated residues were more abundant in the outer layers. Many microorganisms were observed in the J5 layer. We believe that, apart from their functions in the fertilization process, acidic and fucosylated glycans could act as a barrier against pathogen penetration. (Folia Histochemica et Cytobiologica 2011; Vol. 49, No. 2, pp. 306–316

  8. Preventing Pseudomonas aeruginosa and Chromobacterium violaceum infections by anti-adhesion-active components of edible seeds

    Science.gov (United States)

    2012-01-01

    Background Pseudomonas aeruginosa adhesion to animal/human cells for infection establishment involves adhesive proteins, including its galactose- and fucose-binding lectins PA-IL (LecA) and PA-IIL (LecB). The lectin binding to the target-cell receptors may be blocked by compatible glycans that compete with those of the receptors, functioning as anti-adhesion glycodecoys. The anti-adhesion treatment is of the utmost importance for abrogating devastating antibiotic-resistant P. aeruginosa infections in immunodeficient and cystic fibrosis (CF) patients. This strategy functions in nature in protecting embryos and neonates. We have shown that PA-IL, PA-IIL, and also CV-IIL (a PA-IIL homolog produced in the related pathogen Chromobacterium violaceum) are highly useful for revealing natural glycodecoys that surround embryos in diverse avian eggs and are supplied to neonates in milks and royal jelly. In the present study, these lectins were used as probes to search for seed embryo-protecting glycodecoys. Methods The lectin-blocking glycodecoy activities were shown by the hemagglutination-inhibition test. Lectin-binding glycoproteins were detected by Western blotting with peroxidase-labeled lectins. Results The present work reports the finding - by using PA-IL, PA-IIL, and CV-IIL - of rich glycodecoy activities of low ( 10 kDa) compounds (including glycoproteins) in extracts of cashew, cocoa, coffee, pumpkin, and tomato seeds, resembling those of avian egg whites, mammal milks, and royal jelly. Conclusions Edible seed extracts possess lectin-blocking glycodecoys that might protect their embryos from infections and also might be useful for hampering human and animal infections. PMID:22336073

  9. Preventing Pseudomonas aeruginosa and Chromobacterium violaceum infections by anti-adhesion-active components of edible seeds

    Directory of Open Access Journals (Sweden)

    Rachmaninov Ofra

    2012-02-01

    Full Text Available Abstract Background Pseudomonas aeruginosa adhesion to animal/human cells for infection establishment involves adhesive proteins, including its galactose- and fucose-binding lectins PA-IL (LecA and PA-IIL (LecB. The lectin binding to the target-cell receptors may be blocked by compatible glycans that compete with those of the receptors, functioning as anti-adhesion glycodecoys. The anti-adhesion treatment is of the utmost importance for abrogating devastating antibiotic-resistant P. aeruginosa infections in immunodeficient and cystic fibrosis (CF patients. This strategy functions in nature in protecting embryos and neonates. We have shown that PA-IL, PA-IIL, and also CV-IIL (a PA-IIL homolog produced in the related pathogen Chromobacterium violaceum are highly useful for revealing natural glycodecoys that surround embryos in diverse avian eggs and are supplied to neonates in milks and royal jelly. In the present study, these lectins were used as probes to search for seed embryo-protecting glycodecoys. Methods The lectin-blocking glycodecoy activities were shown by the hemagglutination-inhibition test. Lectin-binding glycoproteins were detected by Western blotting with peroxidase-labeled lectins. Results The present work reports the finding - by using PA-IL, PA-IIL, and CV-IIL - of rich glycodecoy activities of low ( 10 kDa compounds (including glycoproteins in extracts of cashew, cocoa, coffee, pumpkin, and tomato seeds, resembling those of avian egg whites, mammal milks, and royal jelly. Conclusions Edible seed extracts possess lectin-blocking glycodecoys that might protect their embryos from infections and also might be useful for hampering human and animal infections.

  10. Suppression of adiponectin by aberrantly glycosylated IgA1 in glomerular mesangial cells in vitro and in vivo.

    Directory of Open Access Journals (Sweden)

    Tatsuyuki Inoue

    Full Text Available The pathogenesis of IgA nephropathy (IgAN may be associated with the mesangial deposition of aberrantly glycosylated IgA1. To identify mediators affected by aberrantly glycosylated IgA1 in cultured human mesangial cells (HMCs, we generated enzymatically modified desialylated and degalactosylated (deSial/deGal IgA1. The state of deglycosylated IgA1 was confirmed by lectin binding to Helix aspersa (HAA and Sambucus nigra (SNA. In the cytokine array analysis, 52 proteins were upregulated and 34 were downregulated in HMCs after stimulation with deSial/deGal IgA1. Among them, the secretion of adiponectin was suppressed in HMCs after stimulation with deSial/deGal IgA1. HMCs expressed mRNAs for adiponectin and its type 1 receptor, but not the type 2 receptor. Moreover, we revealed a downregulation of adiponectin expression in the glomeruli of renal biopsy specimens from patients with IgAN compared to those with lupus nephritis. We also demonstrated that aberrantly glycosylated IgA1 was deposited in the mesangium of patients with IgAN by dual staining of HAA and IgA. Moreover, the urinary HAA/SNA ratio of lectin binding was significantly higher in IgAN compared to other kidney diseases. Since adiponectin has anti-inflammatory effects, including the inhibition of adhesion molecules and cytokines, these data suggest that the local suppression of this adipokine by aberrantly glycosylated IgA1 could be involved in the regulation of glomerular inflammation and sclerosis in IgAN.

  11. Binding of Griffonia simplicifolia 1 isolectin B4 (GS1 B4) to alpha-galactose antigens.

    Science.gov (United States)

    Kirkeby, S; Moe, D

    2001-04-01

    Glycoconjugates with terminal Galalpha1-3Galbeta1-4GlcNAc sequences (alpha-galactosyl epitopes, natural xenoreactive antigens) are present on various tissues in pigs and are recognized by human anti-alphagalactosyl (alphaGal) antibodies1. Hence xenotransplantation (pig-to-human) would trigger immune reactions involving complement activation and lead to the hyperactute rejection of the graft. Xenoreactive antigens are often studied by using the lectin Griffonia simplicifolia 1 isolectin B4 (GS1 B4), which shows high affinity to galactose. We here estimate the specificity of GS1 B4 for detecting various galactosyl epitopes by measuring lectin binding to neoglycoproteins, thyroglobulin and pig skeletal muscle. Enzyme linked lectin assays confirmed that GS1 B4 was highly specific to alpha-galactosylated neoglycoproteins while the lectin did not detect a beta-galactosylated ligand. The length of the sugar chains influenced the lectin-carbohydrate interaction. A monosaccharide linked to serum albumin showed higher lectin affinity than did neoglycoproteins with di- and tri-alpha-galactosyl epitopes. When the carbohydrate was extended, as in the xenoreactive pentasaccharide (Galalpha1-3Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc), the carbohydrate- lectin interaction was meagre. Not only the terminal, but also the subterminal sugar affected the lectin binding because the GS1 B4 affinity to Galalpha1-3Gal was much stronger than to Galalpha1-3GalNAc. In bovine and porcine thyroglobulin most alphaGal epitopes appear to be cryptic, but are unmasked by a heat denaturation. In pig skeletal muscle there was lectin reaction not only in the muscle capillaries, but also in the connective tissue and intracellularly in muscle fibres. In Western blots of isolated proteins from pig muscle at least three bands were strongly stained after incubation with lectin.

  12. Terminal N-Acetylgalactosamine-Specific Leguminous Lectin from Wisteria japonica as a Probe for Human Lung Squamous Cell Carcinoma

    Science.gov (United States)

    Soga, Keisuke; Teruya, Futaba; Tateno, Hiroaki; Hirabayashi, Jun; Yamamoto, Kazuo

    2013-01-01

    Millettia japonica was recently reclassified into the genus Wisteria japonica based on chloroplast and nuclear DNA sequences. Because the seed of Wisteria floribunda expresses leguminous lectins with unique N-acetylgalactosamine-binding specificity, we purified lectin from Wisteria japonica seeds using ion exchange and gel filtration chromatography. Glycan microarray analysis demonstrated that unlike Wisteria floribunda and Wisteria brachybotrys lectins, which bind to both terminal N-acetylgalactosamine and galactose residues, Wisteria japonica lectin (WJA) specifically bound to both α- and β-linked terminal N-acetylgalactosamine, but not galactose residues on oligosaccharides and glycoproteins. Further, frontal affinity chromatography using more than 100 2-aminopyridine-labeled and p-nitrophenyl-derivatized oligosaccharides demonstrated that the ligands with the highest affinity for Wisteria japonica lectin were GalNAcβ1-3GlcNAc and GalNAcβ1-4GlcNAc, with Ka values of 9.5 × 104 and 1.4 × 105 M-1, respectively. In addition, when binding was assessed in a variety of cell lines, Wisteria japonica lectin bound specifically to EBC-1 and HEK293 cells while other Wisteria lectins bound equally to all of the cell lines tested. Wisteria japonica lectin binding to EBC-1 and HEK293 cells was dramatically decreased in the presence of N-acetylgalactosamine, but not galactose, mannose, or N-acetylglucosamine, and was completely abrogated by β-hexosaminidase-digestion of these cells. These results clearly demonstrate that Wisteria japonica lectin binds to terminal N-acetylgalactosamine but not galactose. In addition, histochemical analysis of human squamous cell carcinoma tissue sections demonstrated that Wisteria japonica lectin specifically bound to differentiated cancer tissues but not normal tissue. This novel binding characteristic of Wisteria japonica lectin has the potential to become a powerful tool for clinical applications. PMID:24349556

  13. Terminal N-acetylgalactosamine-specific leguminous lectin from Wisteria japonica as a probe for human lung squamous cell carcinoma.

    Directory of Open Access Journals (Sweden)

    Keisuke Soga

    Full Text Available Millettia japonica was recently reclassified into the genus Wisteria japonica based on chloroplast and nuclear DNA sequences. Because the seed of Wisteria floribunda expresses leguminous lectins with unique N-acetylgalactosamine-binding specificity, we purified lectin from Wisteria japonica seeds using ion exchange and gel filtration chromatography. Glycan microarray analysis demonstrated that unlike Wisteria floribunda and Wisteria brachybotrys lectins, which bind to both terminal N-acetylgalactosamine and galactose residues, Wisteria japonica lectin (WJA specifically bound to both α- and β-linked terminal N-acetylgalactosamine, but not galactose residues on oligosaccharides and glycoproteins. Further, frontal affinity chromatography using more than 100 2-aminopyridine-labeled and p-nitrophenyl-derivatized oligosaccharides demonstrated that the ligands with the highest affinity for Wisteria japonica lectin were GalNAcβ1-3GlcNAc and GalNAcβ1-4GlcNAc, with K(a values of 9.5 × 10(4 and 1.4 × 10(5 M(-1, respectively. In addition, when binding was assessed in a variety of cell lines, Wisteria japonica lectin bound specifically to EBC-1 and HEK293 cells while other Wisteria lectins bound equally to all of the cell lines tested. Wisteria japonica lectin binding to EBC-1 and HEK293 cells was dramatically decreased in the presence of N-acetylgalactosamine, but not galactose, mannose, or N-acetylglucosamine, and was completely abrogated by β-hexosaminidase-digestion of these cells. These results clearly demonstrate that Wisteria japonica lectin binds to terminal N-acetylgalactosamine but not galactose. In addition, histochemical analysis of human squamous cell carcinoma tissue sections demonstrated that Wisteria japonica lectin specifically bound to differentiated cancer tissues but not normal tissue. This novel binding characteristic of Wisteria japonica lectin has the potential to become a powerful tool for clinical applications.

  14. faba bean and field pea seed proportion for intercropping system

    African Journals Online (AJOL)

    Administrator

    Intercropping of Faba bean (Vicia fabae) and field pea (Pisum sativum) is an important cropping system in the. Horro highlands of Ethiopia, but seed proportions balance is important to intercrop productivity. An experiment was conducted to determine the optimum seed rates on component crop yield and land equivalent ...

  15. Moisture dependent of some physical and morphological properties ...

    African Journals Online (AJOL)

    user

    2011-04-11

    Apr 11, 2011 ... properties of sainfoin (Onobrychis sativa Lam.), grasspea (Lathyrus sativus L.) and bitter vetch (Vicia ervilia (L.) Willd.) seeds. J. Appl. Sci. 6(6): 1373-1379. Altuntas E (2007). Some physical properties of pumpkin (Cucurbita pepo L.) and watermelon (Citrullus lanatus L.) seeds. Tarım Bilimleri. Dergisi. 14(1): ...

  16. Feasibility of winter cover crop production under rainfed conditions ...

    African Journals Online (AJOL)

    Low winter rainfall poses a challenge to production of high biomass from cover crops, which is necessary for the success of conservation agriculture systems in the Eastern Cape Province of South Africa. An experiment was conducted to evaluate the adaptability of white oats (Avena sativa), grazing vetch (Vicia dasycarpa), ...

  17. Author Details

    African Journals Online (AJOL)

    Rahetlah, V.B. Vol 10, No 10 (2010) - Articles Effects of seeding rates on forage yield and quality of oat (Avena sativa l.) vetch (Vicia sativa l.) mixtures under irrigated conditions of Madagascar Abstract PDF. ISSN: 1684-5374. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors.

  18. Short Communication: A preliminary evaluation of annual ...

    African Journals Online (AJOL)

    Keywords: above-ground phytomass; adg; afrikaans; animal production; availability; avena sativa; average daily gain; continuous grazing; daily gain; dryland; eastern cape; food availability; grazing; lambs; oats; pastures; phytomass; production; production potential; sourveld; south africa; stocking rate; stocking rates; vicia ...

  19. potential antagonistic fungal species from ethiopia for biological ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Chocolate spot disease (Botrytis fabae Sard) is one of most yield limiting constraints of faba bean (Vicia faba). There is promise in using biological control agents to control chocolate spot diseases, nevertheless, this strategy has not been fully exploited. The objective of this study was to assess the prevalence of different ...

  20. Effects of nano-TiO2 on the agronomically-relevant Rhizobium-legume symbiosis

    Science.gov (United States)

    The impact of nano-TiO2 on Rhizobium-legume symbiosis was studied using garden peas and the compatible bacterial partner Rhizobium leguminosarum bv. viciae 3841. Exposure to nano-TiO2 did not affect the germination of peas grown aseptically, nor did it impact the gross root structure. However, nano-...

  1. GenBank blastx search result: AK110582 [KOME

    Lifescience Database Archive (English)

    Full Text Available ltransferase/uridylyl-removing enzyme (glnD) gene, complete cds; and MviN (mviN) gene, partial cds.|BCT BCT 1e-40 +2 ... ...AK110582 002-168-E10 AF155830.1 Rhizobium leguminosarum bv. viciae putative uridyly

  2. AcEST: DK961423 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 52 2e-06 sp|P56625|LEC_VICVI Lectin B4 (Fragments) OS=Vicia villosa PE=1 ... 52 3e-06 sp|P16404|LEC_ERYCO Lectin OS=Erythrina coral...lodendron PE=1 SV=3 52 3e-06 sp|P93535|LECS_SOPJA Seed lectin OS=Sophora japonica P

  3. 8Wambi heritability.pmd

    African Journals Online (AJOL)

    ACSS

    as a percentage of the mean (GAM) and heritability were estimated using variance components. Phenotypic. Coefficient of Variation ... exhibited moderate GCV values. Broad and narrow sense heritability estimates for GRD disease score ..... in some faba bean genotypes (Vicia faba L.) grown in Northwestern Ethiopia.

  4. Milk yield and quality of crossbred dairy cows fed with different ...

    African Journals Online (AJOL)

    Milk yield and quality of crossbred dairy cows fed with different levels of vetch ( Vicia dasycarpa ) hay and concentrate on a basal diet of fresh cut napier grass ... and T5 concentrate mix (55% wheat bran, 43% noug seed cake (Gizotia abysinica) and 2% salt) was supplemented at the rate of 0.5 kg per liter of milk produced.

  5. Cover crop and nitrogen fertilization influence soil carbon and nitrogen under bioenergy sweet sorghum

    Science.gov (United States)

    Cover crop and N fertilization may maintain soil C and N levels under sweet sorghum (Sorghum bicolor [L.] Moench) biomass harvested for bioenergy production. The effect of cover crops (hairy vetch [Vicia villosa Roth], rye [Secaele cereale L.], hairy vetch/rye mixture, and the control [no cover crop...

  6. Identification of markers associated with genes for rust resistance in lens culinaris medik

    Science.gov (United States)

    Lentil rust caused by Uromyces vicia-fabae (Pers.) Schroet is one of the most important diseases of lentil in South Asia, North Africa and East Africa. This disease is usually observed during late flowering and early podding stages. Early infection accompanied by favorable environmental conditions c...

  7. Replacing Stipa trichotoma Nees (nasella) in the Eastern Cape | le ...

    African Journals Online (AJOL)

    The most effective grasses were Dactylis glomerata (cocksfoot), Phalaris tuberosa, Lolium multiflorum (Italian ryegrass), Lolium hybridum (Ariki ryegrass), Agrostis tenuis and Festuca arundinacea (Tall fescue). The most effective legumes were Vicia villosa (hairy vetch) and Trifolium pratense (red clover) Overseeding and ...

  8. Santé et diversité alimentaire au Yémen | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Review report : health and dietary diversity in Yemen; traditional Yemeni rural diets and local food systems: enhancing contributions to health and environment. Studies. Estimation genetic variation in faba bean (Vicia faba L.) landraces in Yemen : a thesis. Reports. Health and dietary diversity in Yemen : traditional Yemeni ...

  9. Publications | Page 493 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4921 - 4930 of 6364 ... Estimation genetic variation in faba bean (Vicia faba L.) landraces in Yemen : a thesis (restricted access). The study investigates genetic variations between and within Yemeni faba bean landraces, estimates correlations and coefficients for the most important traits, and characterizes phenotypic ...

  10. Interactions of a hairy vetch-corn rotation and P fertilizer on the NPK ...

    African Journals Online (AJOL)

    Vicia villosa Roth) and corn (Zea mays L.) rotation system in a highland area of Yunnan Province, China. Effects of phosphate (P) fertilization, combined with hairy vetch returned to the soil, on crop yield and soil fertility were studied, and the ...

  11. Effect of Environment on Protein, Mineral and Fat Composition of ...

    African Journals Online (AJOL)

    BACKGROUND: Faba bean (Vicia faba L.) is one of the most important high land pulse crops of Ethiopia. It is an excellent source of protein supplement for the majority of the population, used in various popular Ethiopian dishes. It also contains fat and appreciable amount of minerals. Data on the effect of environment on the ...

  12. Of mice and men

    CERN Multimedia

    1973-01-01

    At the end of March , sixty mice were irradiated at the synchro-cyclotron in the course of an experimental programme studying radiation effects on mice and plants (Vicia faba bean roots) being carried out by the CERN Health Physics Group.

  13. Benefits of Vetch and Rye Cover Crops to Sweet Corn under No-Tillage

    NARCIS (Netherlands)

    Zotarelli, L.; Avila, L.; Scholberg, J.M.S.; Alves, B.J.R.

    2009-01-01

    Leguminous cover crops (CCs) may reduce N fertilizer requirements by fixing N biologically and storing leftover N-fertilizer applied in the previous year. The objective of this study was to determine the contribution of CCs [rye (Secale cereal L.) and hairy vetch (Vicia villosa Roth)] on plant N

  14. EJST V9N2

    African Journals Online (AJOL)

    aestivum) horse beans (Vicia faba), peas (Pisum sativum), potato (Solanum tubersoum,), teff. (Eragrostis tef), and maize (Zea mays) crops grown under rain fed ...... He, Z.L., Alva, A.K., Calvert, D.V., Li Y.C and Banks, D.J (1999). Effects of nitrogen fertilization of grapefruit trees on soil acidification and nutrient availability in.

  15. Nieuwe eiwitgewassen voor de voeding van varkens in de biologische houderij

    NARCIS (Netherlands)

    Balkema, A.

    2004-01-01

    Voor biologische veehouders geldt vanaf 2005 de eis dat alle voeders van biologische oorsprong dienen te zijn. In deze deskstudie worden de eigenschappen en potentie van alternatieve eiwitgewassen beschreven. Zaden van in ons land passendeleguminosen (erwt ( Pisum sativum), veldboon ( Vicia faba),

  16. Effect of nitrogenous fertilizer on the yield of various annual fodder ...

    African Journals Online (AJOL)

    The practice of applying N fertiliser to legumes at seeding was critically studied in Lupinus angustifolius, L. albus, Ornithopus sativus, Pisum sativum arvense, Vicia dasycarpa and Vigna unguiculata in a series of field and pot trials. In addition, the theory that N fertiliser at flowering in pulses promotes seed yield, was tested.

  17. PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA

    NARCIS (Netherlands)

    VANZEIST, W; DEROLLER, GJ

    Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)

  18. Arabidopsis CDS blastp result: AK103075 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103075 J033118C16 At3g17020.1 universal stress protein (USP) family protein simil...ar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 2e-42 ...

  19. Arabidopsis CDS blastp result: AK063611 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063611 001-118-D04 At3g17020.1 universal stress protein (USP) family protein simi...lar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 6e-38 ...

  20. Arabidopsis CDS blastp result: AK108499 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108499 002-143-H02 At3g03270.2 universal stress protein (USP) family protein / ea...rly nodulin ENOD18 family protein contains Pfam profile PF00582: universal stress protein family; similar to early nodulin ENOD18 (GI:11602747) [Vicia faba] 2e-52 ...

  1. Arabidopsis CDS blastp result: AK065771 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065771 J013041K03 At3g17020.1 universal stress protein (USP) family protein simil...ar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 2e-42 ...

  2. Environmental, genetic and cellular toxicity of tenuazonic acid ...

    African Journals Online (AJOL)

    Alternaria alternata, an important pathogen of many plants, produces tenuazonic acid (TeA) with bioactivity to microbes, plants and animals. TeA is one of the main mycotoxin to humans and other organisms. Using Chlamydomonas reinhardtii, Vicia faba root tip and three mammalian normal cell lines as target materials, ...

  3. Variation of L-DOPA in the leaf and flower tissues of seven faba bean accessions with different flower colors

    Science.gov (United States)

    Faba bean (Vicia faba L.) has been selected to adapt to a wide range of environments worldwide and is grown for different end-uses such as food, feed, forage and green manure. Particularly noteworthy in faba bean is the medicinally important component L-3,4-dihydroxy phenylalanine (L-DOPA), the majo...

  4. Factors associated with Leguminous Green Manure Incorporation and Fusarium wilt suppression in watermelon

    Science.gov (United States)

    A fall planted Vicia villosa cover crop incorporated in spring as a green manure can suppress Fusarium wilt [Fusarium oxysporum f. sp. niveum (FON)] of watermelon in Maryland and Delaware. Experiments were conducted to determine whether the mechanism of this suppression was general or specific, and ...

  5. Progress report on enhancing faba bean germplasm for improved winter-hardiness at Pullman, Washington

    Science.gov (United States)

    Faba bean (Vicia faba L.) has been cultivated from early Neolithic times. Numerous varieties have been selected for adaptation to a wide range of environments worldwide and for different end-uses such as dry grain, vegetable, feed, forage and green manure. The USDA faba bean germplasm collection con...

  6. Reactivities of N-acetylgalactosamine-specific lectins with human IgA1 proteins

    DEFF Research Database (Denmark)

    Moore, J.S.; Kulhavy, R.; Tomana, M.

    2007-01-01

    of IgA1 and, as controls, IgA2 and IgG myeloma proteins. These lectins originated from snails Helix aspersa (HAA) and Helix pomatia (HPA), and the plant Vicia villosa (VV). Only HAA and HPA bound exclusively to IgA1, with its O-linked glycans composed of GalNAc, galactose, and sialic acid. In contrast...

  7. Resistance source to cowpea aphid (Aphis craccivora Koch) in ...

    African Journals Online (AJOL)

    The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854. These landraces from the region of Biskra (in the south of Algeria) were selected in an initial field trial and subjected to further testing in the greenhouse. Landrace V51 proved to be the ...

  8. Interactions between extrafloral nectaries, aphids and ants: are there competition effects between plant and homopteran sugar sources?

    NARCIS (Netherlands)

    Engel, V.; Fischer, M.D.; Wäckers, F.L.; Volkl, W.

    2001-01-01

    Broad bean (Vicia faba), an annual plant bearing extrafloral nectaries (EFN) at the base of the upper leaves, is regularly infested by two aphid species, Aphis fabae and Acyrthosiphon pisum. EFN and A. fabae are commonly attended by the ant, Lasius niger, while Ac. pisum usually remains uninfested.

  9. South African Journal of Animal Science - Vol 25, No 2 (1995)

    African Journals Online (AJOL)

    Evaluation of faba beans (Vicia faba cv. Fiord) and sweet lupins (Lupizus albus cv. Kiev) as protein sources for growing pigs · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.S Brand, R.C. Olckers, J.P. van der Merwe, 31-35 ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 106 of 106 ... Vol 27, No 2 (2017), Vermicompost application as affected by Rhizobium inoculation on nodulation and yield of Faba bean (Vicia Faba L.) Abstract PDF. Anteneh Argaw, Abere Mnalku. Vol 27, No 2 (2017), Vulnerability of smallholder farmers to climate change in the central rift valley of Ethiopia: a ...

  11. Download this PDF file

    African Journals Online (AJOL)

    sunflower genotypes (Helianthus annuus L.) to different concentrations of sodium chloride, Helia,. Vol. 22 (30) ... Ion uptake, osmoregulation and plant-water relations in faba beans (Vicia faba L.) under salt stress, Die ... assimilates by wheat as affected by nitrogen source and salinity, Agronomy Journal, Vol. 85, 1044-1049.

  12. Common vetch-wheat intercropping: Haylage yield and quality ...

    African Journals Online (AJOL)

    The winter-sowing genotypes of common vetch (Vicia sativa L.) are very susceptible to lodging and therefore are sown in mixtures with small grains that serve as supporting crops. ... There were no significant differences among treatments for acid detergent fiber content, digestible dry matter and net energy for lactation.

  13. Author Details

    African Journals Online (AJOL)

    Selcuk, Z. Vol 47, No 5 (2017) - Articles Effects of various inulin levels on in vitro digestibility of corn silage, perennial ryegrass (Lolium perenne L.) and common vetch (Vicia sativa L.)/oat (Avena sativa L.) hay. Abstract PDF. ISSN: 2221-4062. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  14. Download this PDF file

    African Journals Online (AJOL)

    HBOLU

    2015-05-13

    May 13, 2015 ... Vicia sativa. 12. 25. Lactuca saligna. 12. 50. Xanthium strumarium. 15. Table 2. Fresh and dry weed weights. Applications. Total. (count/m2). Weight (g/m2). Fresh. Dry. Solarization (Sol). Non solarized (-Sol). 27.05. 2229. 440. Solarized (+Sol). 16.44. 1866. 347. Fresh chicken manure (FCM). Control. 24.79.

  15. Potential antagonistic fungal species from Ethiopia for biological ...

    African Journals Online (AJOL)

    Chocolate spot disease (Botrytis fabae Sard) is one of most yield limiting constraints of faba bean (Vicia faba). There is promise in using biological control agents to control chocolate spot diseas`es, nevertheless, this strategy has not been fully exploited. The objective of this study was to assess the prevalence of different ...

  16. East African Journal of Sciences - Vol 10, No 2 (2016)

    African Journals Online (AJOL)

    Efficacy of Pepper Tree (Schinus molle) Extracts to Suppress Growth of Botrytis fabae and Manage Chocolate Spot Severity on Faba Bean (Vicia faba) at Sinana, Bale Zone, Southeastern Ethiopia · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Addisu Tegegn, Meseret ...

  17. Chickpea regeneration and genetic transformation

    African Journals Online (AJOL)

    STORAGESEVER

    2010-02-08

    Feb 8, 2010 ... induction period on shoot differentiation from seeding explants of chickpea (Cicer arietinum L.). J. Plant Biol. 27: 235-239. Pickardt T, Saalbach I, Waddell D, Meixner M, Müntz K and Schieder O. (1995). Seed specific expression of the 2S albumin gene from Brazil nut (Bertholletia excelsa) in transgenic Vicia ...

  18. In vitro inhibition of ETEC K88 adhesion by pea hulls and of LT enterotoxin binding by faba bean hulls

    NARCIS (Netherlands)

    Becker, P.M.; Meulen, van der J.; Jansman, A.J.M.; Wikselaar, van P.G.

    2012-01-01

    Enterotoxigenic Escherichia coli (ETEC) expressing K88 (F4) adhesins are associated with post-weaning diarrhoea in piglets. Different grain fractions from pea (Pisum sativum) and faba bean (Vicia faba) were tested in vitro for their capacity to counteract aetiological factors, which contribute to

  19. AcEST: BP919185 [AcEST

    Lifescience Database Archive (English)

    Full Text Available its) Value sp|P42653|1433A_VICFA 14-3-3-like protein A OS=Vicia faba PE=2 SV=1 31 3.6 sp|Q6C443|OXR1_YARLI Oxidation... 158 YKSAQDIANTELPPTHP-IRLGLALNFSVFYYEILNSPDRAC 198 >sp|Q6C443|OXR1_YARLI Oxidation resistance protein 1 OS=

  20. Environmental, genetic and cellular toxicity of tenuazonic acid ...

    African Journals Online (AJOL)

    SERVER

    2008-04-17

    Apr 17, 2008 ... Alternaria alternata, an important pathogen of many plants, produces tenuazonic acid (TeA) with bioactivity to microbes, plants and animals. TeA is one of the main mycotoxin to humans and other organisms. Using Chlamydomonas reinhardtii, Vicia faba root tip and three mammalian normal cell lines.

  1. Effects of faba bean and faba bean hulls on expression of selected genes in the small intestine of piglets

    NARCIS (Netherlands)

    Jansman, A.J.M.; Baal, van J.; Meulen, van der J.; Smits, M.A.

    2012-01-01

    In a small intestinal segment perfusion (SISP) study in pigs, effects were studied of intestinal perfusion of ground faba beans (Vicia faba), faba bean hulls, or saline on intestinal net fluid absorption in intestinal segments either challenged or not with an enterotoxigenic Escherichia coli (ETEC).

  2. Correlation between carbohydrate structures on the envelope glycoprotein gp120 of HIV-1 and HIV-2 and syncytium inhibition with lectins

    DEFF Research Database (Denmark)

    Hansen, J E; Nielsen, C M; Nielsen, C

    1989-01-01

    The binding of 13 different lectins to gp120 partially purified from two HIV-1 isolates and one HIV-2 isolate was studied by in situ staining on electrophoretically separated and electroblotted HIV antigens. The lectins concanavalin A, wheat germ agglutinin, Lens culinaris agglutinin, Vicia faba...

  3. Municipal landfill leachates induced chromosome aberrations in rat ...

    African Journals Online (AJOL)

    user

    2006-11-16

    Nov 16, 2006 ... leachate induced chromosome aberration in rat. Other reports on leachate induced genotoxicity in Allium cepa. (Cabrera and Rodriguez, 1999; Bakare and Wale-. Adeyemo, 2004; Chandra et al., 2005.), Vicia faba. (Radetski et al., 2004; Sang and Li, 2004), Drosophila melanogaster (Siddique et al., 2005) ...

  4. The use of reproductive vigor descriptors in studying genetic ...

    African Journals Online (AJOL)

    A collection of nine Tunisian faba bean (Vicia faba) populations belonging to three botanical classes (Var. minor, var. equina and var. major) was evaluated using twenty seven agro-morphological traits. Analysis of variance, correlation coefficients and principal components analysis (PCA) were performed based on MVSP ...

  5. Rhizobium leguminosarum exoB mutants are deficient in the synthesis of UDP-glucose 4'-epimerase

    NARCIS (Netherlands)

    CREMERS, HCJC; Batley, M; Redmond, J W; Eijdems, Elisabeth; BREEDVELD, MW; ZEVENHUIZEN, LPTM; Pees, Elisabeth; Wijffelman, C A; Lugtenberg, Ben J.J.

    1990-01-01

    Rhizobium leguminosarum bv. viciae Exo- mutant strains RBL5523,exo7::Tn5,RBL5523,exo8::Tn5 and RBL5523,exo52::Tn5 are affected in nodulation and in the syntheses of lipopolysaccharide, capsular polysaccharide, and exocellular polysaccharide. These mutants were complemented for nodulation and for the

  6. A novel type of DNA-binding protein interacts with a conserved sequence in an early nodulin ENOD12 promoter

    DEFF Research Database (Denmark)

    Christiansen, H; Hansen, A C; Vijn, I

    1996-01-01

    The pea genes PsENOD12A and PsENOD12B are expressed in the root hairs shortly after infection with the nitrogen-fixing bacterium Rhizobium leguminosarum bv. viciae or after application of purified Nod factors. A 199 bp promoter fragment of the PsENOD12B gene contains sufficient information for Nod...

  7. Phylogenetic analysis of 23S rRNA gene sequences of some ...

    African Journals Online (AJOL)

    The phylogenetic relationships among thirteen Rhizobium leguminosarum bv. viciae isolates collected from various geographical regions were studied by analysis of the 23S rRNA sequences. The average of genetic distance among the studied isolates was very narrow (ranged from 0.00 to 0.04) and the studied isolates ...

  8. Nutritional, eco-physiological and symbiotic characteristics of ...

    African Journals Online (AJOL)

    Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of Ethiopia. A total of hundred rhizobial isolates were ...

  9. Flavonoids induce Rhizobium leguminosarum to produce nodDABC gene-related factors that cause thick, short roots and root hair responses on common vetch

    NARCIS (Netherlands)

    Zaat, S. A.; van Brussel, A. A.; Tak, T.; Pees, E.; Lugtenberg, B. J.

    1987-01-01

    Rhizobium leguminosarum produced a factor(s) that caused thick, short roots (Tsr phenotype) as well as root hair induction (Hai phenotype) and deformation (Had phenotype) in Vicia sativa plants upon incubation with root exudate or with one of the nod gene inducers naringenin or apigenin; this was a

  10. Effect of municipal sewage effluent on soil and crops cultivated on a ...

    African Journals Online (AJOL)

    The effects of sewage effluent from Sebha Municipal Area in the Fezzan region of Libya on certain physicochemical properties of a hyper-arid zone sandy soil and growth of two plants were studied. The soil had been treated daily with 25, 50, 75 and 100% effluent; and barley (Hordeum vulgare) and broad beans (Vicia faba) ...

  11. Fungicide, antibiotic, heavy metal resistance and salt tolerance of ...

    African Journals Online (AJOL)

    user

    2011-03-28

    Mar 28, 2011 ... of fungicides, antibiotics, heavy metal and salt on growth of Rhizobium isolates. MATERIALS AND METHODS. Twenty Rhizobium bacteria were isolated by standard method. (Jordan, 1984) from nodules of Vicia palaestina in Şanliurfa,. Turkey. In all cases, large sized randomly chosen active (pink.

  12. Formulation of a complementary food fortified with broad beans ...

    African Journals Online (AJOL)

    Sixty percent of mothers did not provide bean-based food for their children, with the most frequently reported reason being lack of knowledge of its nutrient value for young children. To a typical complementary food of barley-maize porridge, 10, 20 and 30% of cereal was replaced by processed broad beans (Vicia faba), ...

  13. Resistance source to cowpea aphid (Aphis craccivora Koch) in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... ²INRA Centre de Biologie et de Gestion des Populations (CBGP), Campus International de Baillarguet, 34988,. Montferrier / Lez cedex, France. Accepted 3 June, 2008. The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854.

  14. Author Details

    African Journals Online (AJOL)

    Egigu, Meseret Chimdessa. Vol 10, No 2 (2016) - Articles Efficacy of Pepper Tree (Schinus molle) Extracts to Suppress Growth of Botrytis fabae and Manage Chocolate Spot Severity on Faba Bean (Vicia faba) at Sinana, Bale Zone, Southeastern Ethiopia Abstract. ISSN: 1992-0407. AJOL African Journals Online. HOW TO ...

  15. Effect of condensed tannins in hulls of faba beans (Vivia faba L.) on the activities of trypsin (EC 2.4.21.4) and chymotrypsin (EC 2.4.21.1) in digesta collected from the small intestine of pigs

    NARCIS (Netherlands)

    Jansman, A.J.M.; Enting, H.; Verstegen, M.W.A.; Huisman, J.

    1994-01-01

    The effects of condensed tannins in hulls of faba beans (Vicia faba L.) on the activities of trypsin (EC 3.4.21.4) and chymotrypsin (EC 3.4.21.1) in digesta obtained from the small intestine of pigs were studied. Using four castrated male pigs (mean body weight 83 kg) fitted with both a simple

  16. Salt tolerance analysis of chickpea, faba bean and durum wheat varieties. I. Chickpea and faba bean

    NARCIS (Netherlands)

    Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Oweis, T.

    2005-01-01

    Two varieties of chickpea (Cicer arietinum L.) and faba bean (Vicia faba), differing in drought tolerance according to the classification of the International Center for Agronomic Research in Dry Areas (ICARDA), were irrigated with waters of three different salinity levels in a lysimeter experiment

  17. Inhibition of protein synthesis in vitro by a lectin from Momordica charantia and by other haemagglutinins.

    Science.gov (United States)

    Barbieri, L; Lorenzoni, E; Stirpe, F

    1979-08-15

    Protein synthesis by a rabbit reticulocyte lysate is inhibited by the haemagglutinating lectins from Momordica charantia and Crotalaria juncea seeds and from the roe of Rutilus rutilus, and by a commercial preparation of the mitogenic lectin from Phytolacca americana. The haemagglutinins from the seeds of Ricinus communis and of Vicia cracca acquired inhibitory activity after their reduction with 2-mercaptoethanol.

  18. South African Journal of Animal Science - Vol 22, No 5 (1992)

    African Journals Online (AJOL)

    An evaluation of fababean (Vicia faba) and lupin (Lupinus albus) stubble and seed for sheep · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.S. Brand, F Franck, A.A. Brand, A Durand, J Coetzee, 170-174 ...

  19. Author Details

    African Journals Online (AJOL)

    Abstract PDF · Vol 36, No 4 (2006) - Articles Raw and heat-treated culban (Vicia peregrina) seed as protein source for mirror carp (Cyprinus carpio) fingerlings. Abstract PDF · Vol 37, No 1 (2007) - Articles Partial replacement of fish and soyabean meal protein in mirror carp (Cyprinus carpio) diets by protein in hazelnut meal

  20. Pulse diversity for polyphenolic secondary metabolites

    Science.gov (United States)

    The pulse species including guar (Cyamopsis tetragonoloba L. Taub.), Lablab purpureus L. Sweet, Macrotyloma uniflorum (Lam.) Verdc., Teramnus labialis (L.f.) Spreng, alfalfa (Medicago sativa ssp. sativa), green beans (Phaseolus vulgaris L.), fava beans (Vicia faba L.), blackeye pea (Vigna unguiculat...

  1. A comparison of a number of annual cool season legumes under ...

    African Journals Online (AJOL)

    Fifteen annual cool season legumes were compared under dryland conditions on two sites in the Dohne Sourveld. These sites were Dohne, with a mild but dry winter and an average rainfall of 743 mm per year, and Grasslands, a colder, wetter site. Vicia spp were among the highest-yielding cultivars at both sites. At Dohne ...

  2. The Effects of Hormones and Vaginal Microflora on the Glycome of the Female Genital Tract: Cervical-Vaginal Fluid.

    Science.gov (United States)

    Moncla, Bernard J; Chappell, Catherine A; Debo, Brian M; Meyn, Leslie A

    2016-01-01

    In this study, we characterized the glycome of cervical-vaginal fluid, collected with a Catamenial cup. We quantified: glycosidase levels; sialic acid and high mannose specific lectin binding; mucins, MUC1, MUC4, MUC5AC, MUC7; and albumin in the samples collected. These data were analyzed in the context of hormonal status (day of menstrual cycle, hormonal contraception use) and role, if any, of the type of the vaginal microflora present. When the Nugent score was used to stratify the subjects by microflora as normal, intermediate, or bacterial vaginosis, several important differences were observed. The activities of four of six glycosidases in the samples from women with bacterial vaginosis were significantly increased when compared to normal or intermediate women: sialidase, P = <0.001; α-galactosidase, P = 0.006; β-galactosidase, P = 0.005; α-glucosidase, P = 0.056. Sialic acid binding sites as measured by two lectins, Maackia amurensis and Sambucus nigra binding, were significantly lower in women with BV compared to women with normal and intermediate scores (P = <0.0001 and 0.008 respectively). High mannose binding sites, a measure of innate immunity were also significantly lower in women with BV (P = <0.001). Additionally, we observed significant increases in MUC1, MUC4, MUC5AC, and MUC7 concentrations in women with BV (P = <0.001, 0.001, <0.001, 0.02 respectively). Among normal women we found that the membrane bound mucin MUC4 and the secreted MUC5AC were decreased in postmenopausal women (P = 0.02 and 0.07 respectively), while MUC7 (secreted) was decreased in women using levonorgestrel-containing IUDs (P = 0.02). The number of sialic acid binding sites was lower in the postmenopausal group (P = 0.04), but the number of high mannose binding sites, measured with Griffithsin, was not significantly different among the 6 hormonal groups. The glycosidase levels in the cervical-vaginal mucus were rather low in the groups, with exception of α-glucosidase activity

  3. The Effects of Hormones and Vaginal Microflora on the Glycome of the Female Genital Tract: Cervical-Vaginal Fluid.

    Directory of Open Access Journals (Sweden)

    Bernard J Moncla

    Full Text Available In this study, we characterized the glycome of cervical-vaginal fluid, collected with a Catamenial cup. We quantified: glycosidase levels; sialic acid and high mannose specific lectin binding; mucins, MUC1, MUC4, MUC5AC, MUC7; and albumin in the samples collected. These data were analyzed in the context of hormonal status (day of menstrual cycle, hormonal contraception use and role, if any, of the type of the vaginal microflora present. When the Nugent score was used to stratify the subjects by microflora as normal, intermediate, or bacterial vaginosis, several important differences were observed. The activities of four of six glycosidases in the samples from women with bacterial vaginosis were significantly increased when compared to normal or intermediate women: sialidase, P = <0.001; α-galactosidase, P = 0.006; β-galactosidase, P = 0.005; α-glucosidase, P = 0.056. Sialic acid binding sites as measured by two lectins, Maackia amurensis and Sambucus nigra binding, were significantly lower in women with BV compared to women with normal and intermediate scores (P = <0.0001 and 0.008 respectively. High mannose binding sites, a measure of innate immunity were also significantly lower in women with BV (P = <0.001. Additionally, we observed significant increases in MUC1, MUC4, MUC5AC, and MUC7 concentrations in women with BV (P = <0.001, 0.001, <0.001, 0.02 respectively. Among normal women we found that the membrane bound mucin MUC4 and the secreted MUC5AC were decreased in postmenopausal women (P = 0.02 and 0.07 respectively, while MUC7 (secreted was decreased in women using levonorgestrel-containing IUDs (P = 0.02. The number of sialic acid binding sites was lower in the postmenopausal group (P = 0.04, but the number of high mannose binding sites, measured with Griffithsin, was not significantly different among the 6 hormonal groups. The glycosidase levels in the cervical-vaginal mucus were rather low in the groups, with exception of

  4. Histochemical study of expression of lectin-reactive carbohydrate epitopes and glycoligand-binding sites in normal human appendix vermiformis, colonic mucosa, acute appendicitis and colonic adenoma.

    Science.gov (United States)

    Brinck, U; Bosbach, R; Korabiowska, M; Schauer, A; Gabius, H J

    1996-10-01

    In a glycohistochemical analysis of human appendix vermiformis we report the assessment of lectin binding in cells of the Gut Associated Lymphoid Tissue of normal samples and in acute appendicitis using a panel of plant, invertebrate and mammalian lectins with specificity for alpha-L-Fuc (UEA-I), alpha-D-Gluc and alpha-D-Man (Con A), alpha-D-GalNAc (DBA), GalNAc (SBA, HPA), beta-Gal (RCA-I, 14 kDa = galectin-1) and alpha-, beta-Gal (VAA). Moreover, we initiate the study of expression of carbohydrate-binding sites in this tissue and in colonic mucosa, employing several types of carrier-immobilized carbohydrate ligands as suitable probes for this purpose. Within the three populations of macrophages intra-/subepithelial macrophages of the dome region, the lamina propria of the intercryptal region and the follicle-associated epithelium were apparently reactive with most of the lectins and also with mannose and fucose residues of the tested neoglycoproteins. Distinguishing features of germinal center macrophages in relation to intra-/subepithelial phagocytes were the lack of binding of UEA-I and DBA. In comparison to all other types of phagocytes, macrophages of the T-region displayed a rather restricted binding capacity only to Con A and RCA-I. Labeling of macrophages with SBA, HPA and VAA in this location was only rarely found. With respect to dendritic cells no consistently positive reaction was seen for follicular cells, whereas interdigitating cells of the T-region bound Con A, HPA and RCA-I, and, less frequently, SBA. Lymphocytes in all anatomical subsites of the Gut Associated Lymphoid Tissue, centrocytes, centroblasts and plasma cells had binding sites for Con A and RCA-I in common. Notably, a small number of lymphocytes mostly in the T-region but also in B-cell-rich areas expressed intranuclear binding sites for fucose and mannose residues. Intraepithelial lymphocytes and lymphatic cells of the T-region differed from lymphocytes in other regions by a more

  5. Redistribution of phosphorus in soil through cover crop roots

    Directory of Open Access Journals (Sweden)

    Júlio C. Franchini

    2004-07-01

    Full Text Available The objective of this study was to evaluate if cover crops can absorb P from the upper layers and transport it in their roots to subsoil layers. Samples of an Oxisol were placed in PVC columns. Super phosphate fertilizer was applied to the 0-10 cm soil surface layers. The cover crops tested were: Avena strigosa, Avena sativa, Secale cereale, Pisum sativum subsp arvense, Pisum sativum, Vicia villosa, Vicia sativa, Lupinus angustifoliu, Lupinus albus, and Triticum aestivum. After a growth period of 80 days the cover crop shoots were cut off and the soil was divided into 10cm layers and the roots of each layer were washed out. The roots and shoots were analyzed separated for total P contribution to the soil. Considerable amount of P was present in the roots of cover crops. Vicia sativa contained more than 60% of total plant P in the roots. The contribution of Vicia sativa to soil P bellow the fertilized zone was about 7 kg ha-1. It thus appeared that there existed a possibility of P redistribution into the soil under no tillage by using cover crops in rotation with cash crops. Vicia sativa was the most efficient cover crop species as P carrier into the roots from superficial layer to lower layers.Em plantio direto o P acumula-se próximo da subsuperfície do solo. Devido a importância do P para o desenvolvimento do sistema radicular é benéfico a sua transferência da superfície para a subsuperfície do solo. O objetivo foi avaliar se as plantas de cobertura do solo podem absorver P na superfície e transferi-la através das raízes para a subsuperfície do solo. Amostras de um latossolo com baixo teor de P disponível foram transferidas para colunas de PVC. Superfosfato triplo foi aplicado na camada de 0 a 10 cm de profundidade. Avaliaram-se as seguintes plantas de cobertura: Avena strigosa, Avena sativa, Secale cereale, Pisum sativum subsp arvense, Pisum sativum, Vicia villosa, Vicia sativa, Lupinus angustifoliu, Lupinus albus, e Triticum

  6. Materiales carpológicos del yacimiento de Peñalosa (Baños de la Encina, Jaén

    Directory of Open Access Journals (Sweden)

    Arnanz Carrero, Ana

    1991-12-01

    Full Text Available In this paper the results of fruits and seeds remains analysed from Peñalosa are presented. Cultivated products such as wheat (Triticum aestivum, L., barley (Hordeum vulgare, L., fieldpeas (Pisum sativum L. and horsebeans (Vicia faba, L. have been found almost exclusively.

    En el artículo se presentan los resultados de los análisis paleucarpológicus efectuados en el yacimiento de Peñalosa. Se documenta una presencia casi exclusiva de productos cultivares que se reducen a cariópsides dl' trigo (Triticun aestivun L. y cebada (Hordeun vulgare L. junto a legumbres como el guisante (Pisum sativun L. y las habas (Vicia faba L., fundamentalmente.

  7. Pisum & Ervilia Tetovac: Made in Early Iron Age Leskovac, Part one: Two charred pulse crop storages of the fortified hill fort settlement Hissar in Leskovac, South Serbia

    Directory of Open Access Journals (Sweden)

    Medović Aleksandar

    2011-01-01

    Full Text Available A lucky find of 2,572 charred pea (Pisum sativum L seeds in a single archaeobotanical sample from the hill fort settlement Hissar near Leskovac represents a unique example in Bronze / Iron Age research in South East Europe. Another mass storage of bitter vetch (Vicia ervilia (L Willd from the same site and period (Brnjica cultural group, beginning of the Iron Age in the Morava valley confirms a long tradition of the city of Leskovac region as a pulse crop production centre in modern Serbia. Both pulse storages were almost pure with small amount of admixture from other crops mainly cereals, other pulses, such as lentil (Lens culinaris Medik and broad bean (Vicia faba L, and oil/fibre plants. Both pulses were cultivated as main crops and were stored separately.

  8. IDENTIFICATION AND OCCURRENCE OF FUSARIUM SPECIES ON SEEDS OF COMMON WETCH, WHITE LUPINE AND SOME WILD LEGUMES

    Directory of Open Access Journals (Sweden)

    Tihomir Miličević

    2013-06-01

    Full Text Available The presence and occurrence of Fusarium species was examined on the seeds of cultivated legumes – common vetch (Vicia sativa, white lupine (Lupinus albus, and wild legumes: bird’s-foot trefoil (Lotus corniculatus, wild alfalfa (Medicago sativa, black locust (Robinia pseudoacacia, honey locust (Gleditsia triacanthos, sweet clover (Melilotus officinalis, bird vetch (Vicia cracca and meadow vetchling (Lathyrus pratensis. Thirteen Fusarium species were identified - F. verticillioides, F. acuminatum, F. avenaceum, F. tricinctum F. oxysporum, F. scirpi, F. semitectum, F. culmorum, F. proliferatum, F. pseudograminearum, F. sporotrichioides, F. sambucinum and F. heterosporum. Species F. verticillioides and F. proliferatum were determined on seeds of the cultivated legumes (common vetch and white lupine. Other 11 Fusarium species were determined on seeds of wild legumes (bird’s-foot trefoil, wild alfalfa, sweet clover and bird vetch among which the most prevalent were species F. avenaceum and F. acuminatum.

  9. Management of faba bean gall in faba bean producing area of Eastern Amhara, Ethiopia

    Directory of Open Access Journals (Sweden)

    Bogale Nigir Hailemariam

    2017-12-01

    Full Text Available Faba bean new disease (faba bean gall (Olpidium viciae (Kusano is the most destructive disease of faba bean ((Vicia faba L. in Ethiopia, particularly in Amhara, Tigray and some part of Oromia region. This problem needs immediate sound management strategy to maximize faba bean productivity. A field study was carried out in Geregera and Jama during the 2013 and 2014 main crop season and Maybar watershed in 2014 to verify the fungicide to faba bean gall. The objective of this study was evaluating effective fungicides for the management of faba bean new disease. The treatments were baylaton in the form of seed dressing and foliar spray; mancozeb, redomil, chlorotalonin and cruzet in the form of foliar spray and apron star and theram used as a foliar spray and also untreated check used as a comparison. The result showed that significantly differ between treatments (p

  10. Génomique végétale : partenariats public- privé visant à assurer la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Kayje Booker

    http://dx.doi.org/10.1038/nbt.2022. Luzerne. Medicago truncatula. Légume modèle. Formation de nodules et fixation de l'azote. Nature. 2011. 22 décembre. DOI : 10.1038/nature10625. Gourgane. Pois. Vicia faba. Pisum sativum. Vivrière et fourragère. BMC Genomics. 2012. 20 mars. DOI : 10.1186/1471-2164-13-104.

  11. Evaluation of Plant Growth Regulators for Use in Grounds Maintenance at Military Installations

    Science.gov (United States)

    1992-07-01

    Shepherd’s purse - Capsella bursa-pastons (L.) Medic. Sheep Sorrel - Rumnex acetosella L. Sulfur Cinquefol - Potentilla recta L. Vetch - Vicia spp...Sweetclover - Melilotus officinalis (L.) Lam. Yellow Wood-sorrel - Oxalis stfi cta A2 Appendix A Table A2 Common and Scientific Names and Average Percent...clover - Trifolium repens L. Wood sorrel - Oxalis spp. Yellow nutsedge - Cypenus esculentus; L. Appendix A A3 Table A3 Common and Scientific Names and

  12. Sterling C. Robertson Dam and Limestone Lake on the Navasota River, Texas (Leon, Limestone and Robertson Counties).

    Science.gov (United States)

    1976-04-01

    drumrw’on- dii), Paspulum sp., coast sandbur (Cenchrus incertus). sedge (Carex sp.). Oxalis sp.. and vetch (Vicia sp.). 2.36 There are no known species in the...coast sandbur (Cenchrus incertus), sedge Carex sp.), Oxalis , and vetch (Vivia sp.). There are no known species in the project area classified as...St. Peterswort, Ea mne t-riandra Waterwort Utricularia inflata Floating Bladderwort ~pe-LCUIl sp. St. Johnswort Rurnex acetosella Sheep Sorrel

  13. Yield and quality attributes of faba bean inbred lines grown under marginal environmental conditions of Sudan

    OpenAIRE

    Gasim, Seif; Hamad, Solafa A.A.; Abdelmula, Awadalla; Mohamed Ahmed, Isam A.

    2015-01-01

    Abstract Faba beans (Vicia faba L.) represent an essential source of food protein for many people in Sudan, especially those who cannot afford to buy animal meat. The demand for faba bean seeds is greatly increased in recent years, and consequently its production area was extended southward where the climate is marginally suitable. Therefore, this study was aimed to evaluate seed yield and nutritional quality of five faba bean inbred lines grown under marginal environmental conditions of Suda...

  14. Polyphenol content and glycemic load of pasta enriched with Faba bean flour

    OpenAIRE

    Imma Turco; Tiziana Bacchetti; Cecilia Bender; Ganiyu Oboh; Benno Zimmermann; Gianna Ferretti

    2016-01-01

    Background: Legumes contain elevated levels of health functional components. The objective of the present paper was to evaluate the nutritional properties and the post-prandial glycaemic responses of pasta obtained using 35% Vicia Faba (VF) bean flour, which is an important source of fiber and phytochemical compounds. Results: Protein and fiber content were higher in VF pasta compared with durum wheat semolina (DWS) pasta. The total phenol content in VF pasta was about two...

  15. Role of Symbiotic Auxotrophy in the Rhizobium-Legume Symbioses

    OpenAIRE

    Jurgen Prell; Alexandre Bourdès; Shalini Kumar; Emma Lodwig; Arthur Hosie; Seonag Kinghorn; James White; Philip Poole

    2010-01-01

    Background Rhizobium leguminosarum bv. viciae mutants unable to transport branched-chain amino acids via the two main amino acid ABC transport complexes AapJQMP and BraDEFGC produce a nitrogen starvation phenotype when inoculated on pea (Pisum sativum) plants [1], [2]. Bacteroids in indeterminate pea nodules have reduced abundance and a lower chromosome number. They reduce transcription of pathways for branched-chain amino acid biosynthesis and become dependent on their provision by the host....

  16. Analysis of the Variation Potential Induced by Wounding in Plants

    OpenAIRE

    G., Roblin; Universite de Poitiers, Station Biologique de Beau-Site

    1985-01-01

    Following burning of a leaf portion, a bioelectrical wave called "variation potential" spread throughout the whole plant. Bioelectrical variations are recorded by two types of electrodes (platinum wires and Ag/AgCl nonpolarizable electrodes) in the stem of Vicia faba and in the petiole of Lycopersicon esculentum and Mimosa pudica. The time course of the variation potential thus recorded can be divided into two components respectrvely called components "A" and "B". Component A looks like a neg...

  17. A New Family of Biuret Hydrolases Involved in S-Triazine Ring Metabolism

    OpenAIRE

    Cameron, Stephan M.; Durchschein, Katharina; Richman, Jack E.; Sadowsky, Michael J.; Wackett, Lawrence P

    2011-01-01

    Biuret is an intermediate in the bacterial metabolism of s-triazine ring compounds and is occasionally used as a ruminant feed supplement. We used bioinformatics to identify a biuret hydrolase, an enzyme that has previously resisted efforts to stabilize, purify and characterize. This newly discovered enzyme is a member of the cysteine hydrolase superfamily, a family of enzymes previously not found to be involved in s-triazine metabolism. The gene from Rhizobium leguminosarum bv. viciae strain...

  18. Selección de abonos verdes para los suelos de Turmequé (Boyacá

    Directory of Open Access Journals (Sweden)

    Viteri Silvio

    2008-08-01

    Full Text Available

    El objetivo de este estudio fue identificar asociaciones de abonos verdes con el mejor potencial como fuente de materia orgánica para los suelos del municipio de Turmequé (Boyacá. Los experimentos se desarrollaron en tres fincas, ubicadas a 2.300, 2.650 y 2.860 msnm. De cada finca se tomó una muestra representativa de suelo, que se envió al laboratorio para análisis de fertilidad. Los tratamientos incluyeron 10 asociaciones triples y 3 cuádruples. Las asociaciones se conformaron con la leguminosa vicia atropurpúrea (Vicia sativa L. en combinación con avena caldas (Avena sativa L., girasol (híbrido Hi Doris (Helianthus annus L., higuerilla (Ricinus communis L., nabo forrajero (Raphanus sativus L. o quinua (Chenopodium quinua. El porcentaje de semilla leguminosa respecto a las otras especies en las asociaciones triples fue 40:30:30 y en las cuádruples 40:20:20:20. El porcentaje de semilla de cada especie se calculó con base en la cantidad recomendada para siembra en monocultivo. Se utilizó el diseño de bloques completos al azar, con 13 tratamientos y 3 repeticiones. Las variables determinadas fueron producción de materia verde por especie, por asociación y por las plantas arvenses y materia seca por asociación. Además, se observó la tolerancia de las especies al ataque de plagas y enfermedades. Los resultados indicaron que entre las especies estudiadas las más promisorias son el nabo forrajero, la avena y la vicia, conformando la asociación vicia × avena × nabo forrajero.

  19. Mining the phytomicrobiome to understand how bacterial coinoculations enhance plant growth

    OpenAIRE

    Maymon, M; Martínez-Hidalgo, P; Tran, SS; Ice, T; Craemer, K; Anbarchian, T; Sung, T; Hwang, LH; Chou, M; Fujishige, NA; Villella, W; Ventosa, J; Sikorski, J; Sanders, ER; Faull, KF

    2015-01-01

    © 2015 Maymon, Martínez-Hidalgo, Tran, Ice, Craemer, Anbarchian, Sung, Hwang, Chou, Fujishige, Villella, Ventosa, Sikorski, Sanders, Faull and Hirsch. In previous work, we showed that coinoculating Rhizobium leguminosarum bv. viciae 128C53 and Bacillus simplex 30N-5 onto Pisum sativum L. roots resulted in better nodulation and increased plant growth. We now expand this research to include another alpha-rhizobial species as well as a beta-rhizobium, Burkholderia tuberum STM678. We first determ...

  20. Microbiological Control of Eurasian Watermilfoil

    Science.gov (United States)

    1990-06-01

    occurring endemic infestation. Two other pathogenic fungi, Fusarium sporotrichoides and Acre- monium curvulum, were also shown to be potent...t. Green bean (Phaseolus vulgaris), pea (Pisun satimw L.), vetch (Vicia sp.), and wheat (Triticum satiwn) plants were exposed to M. t. grown in PDSB...of Weeds," Aquatic Botany, Vol 3, No. 2, pp 111-123. Andrews, J. H., and Hecht, E. P. 1981. "Evidence of Pathogenicity of Fusarium sporotrichoides to

  1. evaluation of pathogenic isolates in ethiopia for the control of ...

    African Journals Online (AJOL)

    Administrator

    Key Words: Bacillus spp., Biocontrol, Botrytis fabae, Ethiopia. RÉSUMÉ. Le haricot faba (Vicia faba L.) est l'un des premiers domestiqués légumineuses alimentaires en Ethiopie et en est maintenant cultivé sur de grandes superficies dans de nombreux pays. La production de plant est toutefois limitée par des infections de ...

  2. (Cyprinus carpio) diets by protein

    African Journals Online (AJOL)

    USER

    nutritional value of HM replacing the protein in SBM in the diets of carp fingerlings. Details ... 1000. Composition (g/kg). Dry matter. 891.2. 887.0. 885.3. 890.0. Crude protein. 371.0. 370.2. 369.6. 373.2. Crude fat. 165.5. 170.0. 168.8. 173.3. Crude ash. 72.0 ..... Raw and heat treated Culban (Vicia peregrine) seeds as dietary.

  3. THE INFLUENCE OF HERBICIDES ON GROWTH OF PEA (Pisum sativum L.) NODULATING RHIZOBIAL STRAINS

    OpenAIRE

    Blažinkov, Mihaela; Šnajdar, Ana; Barić, Klara; Sikora, Sanja; Rajnović, Ivana; Sulejman REDŽEPOVIĆ

    2015-01-01

    Biological nitrogen fixation in legume cultivation has an important role in sustainable agriculture production. An important forage legume is the field pea (Pisum sativum L.). Together with nitrogen-fixing bacteria Rhizobium leguminosarum sv. viciae and Rhizobium pisi, field peas provide use of abundant amounts of atmospheric nitrogen, the limiting factor in agricultural production. In order to increase the utilization of biological nitrogen fixation, the inoculation of forage pea seeds is re...

  4. Effects of irradiation and tunicamycin on the surface glycoproteins Schistosoma mansoni

    Directory of Open Access Journals (Sweden)

    J. R. Kusel

    1989-01-01

    Full Text Available The cercarial glycocalyx and schistosomulum surface contains a number of glycoproteins which are expressed in very variable amounts within a parasite population. Tunicamycin inhibits glycoprotein synthesis of schistosomula if the parasites are incubated for 24hr with the drug (10µg ml[raised to the power of -1]. An unexpected increase in lectin binding to the parasite surface was observed but no other changes were detected. Schistosomula treated in this way did not develop in the host past the lung stage. Ultraviolet irradiation (400µW min cm[raised to the power of-2] also inhibited glycoprotein synthesis. Synthesis of other proteins, and in particular heat shock proteins, were also inhibited. Sera from mice (NIH strain infected with irradiated cercariae contained antibodies which bound to normal schistosomula with lower affinity than to irradiated parasites. This is evidence that irradiation modifies the surface and secreted glycoproteins of schistosomula, so they are processed in a different way to normal glycoproteins by the host's immune system. The effects of irradiation on heat shock protein synthesis may allow the parasite to release a variety of proteins and glycoproteins in abnormal conformations. This may explain the enhanced immunogenicity of irradiated cercariae.

  5. Glycosylation analysis of an aggregated antibody produced by Chinese hamster ovary cells in bioreactor culture.

    Science.gov (United States)

    Onitsuka, Masayoshi; Kawaguchi, Akira; Asano, Ryutaro; Kumagai, Izumi; Honda, Kohsuke; Ohtake, Hisao; Omasa, Takeshi

    2014-05-01

    N-Glycosylation of therapeutic antibodies contributes not only to their biological function, but also to their stability and tendency to aggregate. Here, we investigated the impact of the glycosylation status of an aggregated antibody that accumulated during the bioreactor culture of Chinese hamster ovary cells. High-performance liquid chromatography analysis showed that there was no apparent difference in the glycosylation patterns of monomeric, dimeric, and large aggregated forms of the antibody. In contrast, lectin binding assays, which enable the total amounts of specific sugar residues to be detected, showed that both galactose and fucose residues in dimers and large aggregates were reduced to 70-80% of the amount in monomers. These results strongly suggest that the lack of N-linked oligosaccharides, a result of deglycosylation or aglycosylation, occurred in a proportion of the dimeric and large aggregated components. The present study demonstrates that glycosylation heterogeneities are a potential cause of antibody aggregation in cell culture of Chinese hamster ovary cells, and that the lack of N-glycosylation promotes the formation of dimers and finally results in large aggregates. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  6. The Toxoplasma gondii cyst wall protein CST1 is critical for cyst wall integrity and promotes bradyzoite persistence

    Energy Technology Data Exchange (ETDEWEB)

    Tomita, Tadakimi; Bzik, David J.; Ma, Yan Fen; Fox, Barbara A.; Markillie, Lye Meng; Taylor, Ronald C.; Kim, Kami; Weiss, Louis M.

    2013-12-26

    Toxoplasma gondii infects up to one third of the world’s population. A key to the success of T.gondii is its ability to persist for the life of its host as bradyzoites within tissue cysts. The glycosylated cyst wall is the key structural feature that facilitates persistence and oral transmission of this parasite. We have identified CST1 (TGME49_064660) as a 250 kDa SRS (SAG1 related sequence) domain protein with a large mucin-like domain. CST1 is responsible for the Dolichos biflorus Agglutinin (DBA) lectin binding characteristic of T. gondii cysts. Deletion of CST1 results in a fragile brain cyst phenotype revealed by a thinning and disruption of the underlying region of the cyst wall. These defects are reversed by complementation of CST1. Additional complementation experiments demonstrate that the CST1-mucin domain is necessary for the formation of a normal cyst wall structure, the ability of the cyst to resist mechanical stress and binding of DBA to the cyst wall. RNA-seq transcriptome analysis demonstrated dysregulation of bradyzoite genes within the various cst1 mutants. These results indicate that CST1 functions as a key structural component that reinforces the cyst wall structure and confers essential sturdiness to the T. gondii tissue cyst.

  7. Characterization of Cell Surface and EPS Remodeling of Azospirillum brasilense Chemotaxis-like 1 Signal Transduction Pathway mutants by Atomic Force Microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Billings, Amanda N [ORNL; Siuti, Piro [ORNL; Bible, Amber [University of Tennessee, Knoxville (UTK); Alexandre, Gladys [University of Tennessee, Knoxville (UTK); Retterer, Scott T [ORNL; Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must quickly sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the modulation of multiple cellular responses, including motility, EPS production, and cell-to-cell interactions. Recently, the Che1 chemotaxis-like pathway from Azospirillum brasilense was shown to modulate flocculation. In A. brasilense, cell surface properties, including EPS production, are thought to play a direct role in promoting flocculation. Using atomic force microscopy (AFM), we have detected distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains that are absent in the wild type strain. Whereas the wild type strain produces a smooth mucosal extracellular matrix, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition and lectin-binding assays suggest that the composition of EPS components in the extracellular matrix differs between the cheA1 and cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that mutations in the Che1 pathway that result in increased flocculation are correlated with distinctive changes in the extracellular matrix structure produced by the mutants, including likely changes in the EPS structure and/or composition.

  8. A novel bifunctional hybrid with marine bacterium alkaline phosphatase and Far Eastern holothurian mannan-binding lectin activities.

    Directory of Open Access Journals (Sweden)

    Larissa Balabanova

    Full Text Available A fusion between the genes encoding the marine bacterium Cobetia marina alkaline phosphatase (CmAP and Far Eastern holothurian Apostichopus japonicus mannan-binding C-type lectin (MBL-AJ was performed. Expression of the fusion gene in E. coli cells resulted in yield of soluble recombinant chimeric protein CmAP/MBL-AJ with the high alkaline phosphatase activity and specificity of the lectin MBL-AJ. The bifunctional hybrid CmAP/MBL-AJ was produced as a dimer with the molecular mass of 200 kDa. The CmAP/MBL-AJ dimer model showed the two-subunit lectin part that is associated with two molecules of alkaline phosphatase functioning independently from each other. The highly active CmAP label genetically linked to MBL-AJ has advantaged the lectin-binding assay in its sensitivity and time. The double substitution A156N/F159K in the lectin domain of CmAP/MBL-AJ has enhanced its lectin activity by 25 ± 5%. The bifunctional hybrid holothurian's lectin could be promising tool for developing non-invasive methods for biological markers assessment, particularly for improving the MBL-AJ-based method for early detection of a malignant condition in cervical specimens.

  9. Mannose derivative and lipid A dually decorated cationic liposomes as an effective cold chain free oral mucosal vaccine adjuvant-delivery system.

    Science.gov (United States)

    Wang, Ning; Wang, Ting; Zhang, Meiling; Chen, Ruonan; Niu, Ruowen; Deng, Yihui

    2014-09-01

    To develop convenient, effective cold chain-free subunit vaccines, a mannose-PEG-cholesterol conjugate (MPC) was synthesized as a lectin binding molecule and anchored onto liposomes which entrapped lipid A and model antigen to form a vaccine adjuvant-delivery system targeting antigen presenting cells. With MPC, soy phosphatidylcholine, stearylamine and monophosphoryl lipid A as emulsifiers dissolved in oil phase (O), and sucrose and BSA in water phase (W), the O/W emulsions were prepared and subsequently lyophilized. The lyophilized product was stable enough to be stored at room temperature and, upon rehydration, formed MPC-/lipid A-liposomes (MLLs) with a size under 300 nm and antigen association rates of around 36%. The MLLs given to mice via oral mucosal (o.m.) administration showed no side effects but induced potent immune responses as evidenced by the high levels of IgG in the sera and IgA in the salivary, intestinal and vaginal secretions of mice. High levels of IgG2a and IFN-γ in treated mice revealed that MLLs via o.m. vaccination induced a mixed Th1/Th2 response against antigens, establishing both humoral and cellular immunity. Thus, the MLLs may be a potent cold chain-free oral mucosal vaccine adjuvant-delivery system. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Spine and test skeletal matrices of the Mediterranean sea urchin Arbacia lixula--a comparative characterization of their sugar signature.

    Science.gov (United States)

    Kanold, Julia M; Guichard, Nathalie; Immel, Françoise; Plasseraud, Laurent; Corneillat, Marion; Alcaraz, Gérard; Brümmer, Franz; Marin, Frédéric

    2015-05-01

    Calcified structures of sea urchins are biocomposite materials that comprise a minor fraction of organic macromolecules, such as proteins, glycoproteins and polysaccharides. These macromolecules are thought to collectively regulate mineral deposition during the process of calcification. When occluded, they modify the properties of the mineral. In the present study, the organic matrices (both soluble and insoluble in acetic acid) of spines and tests from the Mediterranean black sea urchin Arbacia lixula were extracted and characterized, in order to determine whether they exhibit similar biochemical signatures. Bulk characterizations were performed by mono-dimensional SDS/PAGE, FT-IR spectroscopy, and an in vitro crystallization assay. We concentrated our efforts on characterization of the sugar moieties. To this end, we determined the monosaccharide content of the soluble and insoluble organic matrices of A. lixula spines and tests by HPAE-PAD, together with their respective lectin-binding profiles via enzyme-linked lectin assay. Finally, we performed in situ localization of N-acetyl glucosamine-containing saccharides on spines and tests using gold-conjugated wheatgerm agglutinin. Our data show that the test and spine matrices exhibit different biochemical signatures with regard to their saccharidic fraction, suggesting that future studies should analyse the regulation of mineral deposition by the matrix in these two mineralized structures in detail. This study re-emphasizes the importance of non-protein moieties, i.e. sugars, in calcium carbonate systems, and highlights the need to clearly identify their function in the biomineralization process. © 2015 FEBS.

  11. Glyco-centric lectin magnetic bead array (LeMBA − proteomics dataset of human serum samples from healthy, Barrett׳s esophagus and esophageal adenocarcinoma individuals

    Directory of Open Access Journals (Sweden)

    Alok K. Shah

    2016-06-01

    Full Text Available This data article describes serum glycoprotein biomarker discovery and qualification datasets generated using lectin magnetic bead array (LeMBA – mass spectrometry techniques, “Serum glycoprotein biomarker discovery and qualification pipeline reveals novel diagnostic biomarker candidates for esophageal adenocarcinoma” [1]. Serum samples collected from healthy, metaplastic Barrett׳s esophagus (BE and esophageal adenocarcinoma (EAC individuals were profiled for glycoprotein subsets via differential lectin binding. The biomarker discovery proteomics dataset consisting of 20 individual lectin pull-downs for 29 serum samples with a spiked-in internal standard chicken ovalbumin protein has been deposited in the PRIDE partner repository of the ProteomeXchange Consortium with the data set identifier PRIDE: http://www.ebi.ac.uk/pride/archive/projects/PXD002442. Annotated MS/MS spectra for the peptide identifications can be viewed using MS-Viewer (〈http://prospector2.ucsf.edu/prospector/cgi-bin/msform.cgi?form=msviewer〉 using search key “jn7qafftux”. The qualification dataset contained 6-lectin pulldown-coupled multiple reaction monitoring-mass spectrometry (MRM-MS data for 41 protein candidates, from 60 serum samples. This dataset is available as a supplemental files with the original publication [1].

  12. Glyco-centric lectin magnetic bead array (LeMBA) - proteomics dataset of human serum samples from healthy, Barrett׳s esophagus and esophageal adenocarcinoma individuals.

    Science.gov (United States)

    Shah, Alok K; Lê Cao, Kim-Anh; Choi, Eunju; Chen, David; Gautier, Benoît; Nancarrow, Derek; Whiteman, David C; Baker, Peter R; Clauser, Karl R; Chalkley, Robert J; Saunders, Nicholas A; Barbour, Andrew P; Joshi, Virendra; Hill, Michelle M

    2016-06-01

    This data article describes serum glycoprotein biomarker discovery and qualification datasets generated using lectin magnetic bead array (LeMBA) - mass spectrometry techniques, "Serum glycoprotein biomarker discovery and qualification pipeline reveals novel diagnostic biomarker candidates for esophageal adenocarcinoma" [1]. Serum samples collected from healthy, metaplastic Barrett׳s esophagus (BE) and esophageal adenocarcinoma (EAC) individuals were profiled for glycoprotein subsets via differential lectin binding. The biomarker discovery proteomics dataset consisting of 20 individual lectin pull-downs for 29 serum samples with a spiked-in internal standard chicken ovalbumin protein has been deposited in the PRIDE partner repository of the ProteomeXchange Consortium with the data set identifier PRIDE: PXD002442. Annotated MS/MS spectra for the peptide identifications can be viewed using MS-Viewer (〈http://prospector2.ucsf.edu/prospector/cgi-bin/msform.cgi?form=msviewer〉) using search key "jn7qafftux". The qualification dataset contained 6-lectin pulldown-coupled multiple reaction monitoring-mass spectrometry (MRM-MS) data for 41 protein candidates, from 60 serum samples. This dataset is available as a supplemental files with the original publication [1].

  13. Visualization and analysis of EPS glycoconjugates of the thermoacidophilic archaeon Sulfolobus metallicus.

    Science.gov (United States)

    Zhang, Ruiyong; Neu, Thomas R; Zhang, Yutong; Bellenberg, Sören; Kuhlicke, Ute; Li, Qian; Sand, Wolfgang; Vera, Mario

    2015-09-01

    Biofilms are surface-associated colonies of microorganisms embedded in a matrix of extracellular polymeric substances (EPS). As EPS mediate the contact between cells and surfaces, an understanding of their composition and production is of particular interest. In this study, the EPS components of Sulfolobus metallicus DSM 6482(T) forming biofilms on elemental sulfur (S(0)) were investigated by confocal laser scanning microscopy (CLSM). In order to visualize cell and EPS distributions, biofilm cells were stained with various dyes specific for glycoconjugates, proteins, nucleic acids and lipids. Biofilm cells on S(0) were heterogeneously distributed and characterized as individual cells, microcolonies, and large clusters up to a hundred micrometers in diameter. The glycoconjugates in biofilms were detected by fluorescence lectin-binding analysis (FLBA). Screening of 72 commercially available lectins resulted in the selection of 21 lectins useful for staining biofilms of S. metallicus (T). Capsular EPS from planktonic cells were mainly composed of carbohydrates and proteins. In contrast, colloidal EPS from planktonic cells were dominated by carbohydrates. Proteins were found to be major components in EPS from biofilms on S(0). Using specific probes combined with CLSM, we showed that extracellular proteins and nucleic acids were present in the EPS matrix. Finally, we showed that S. metallicus (T) cells were embedded in a flexible EPS matrix. This study provides new insights into archaeal biofilms and EPS composition and properties with respect to their interactions with S(0).

  14. Lectinhistochemical staining of granuloma induced by bacillus Calmette-Guerin in Piaractus mesopotamicus

    Directory of Open Access Journals (Sweden)

    Wilson G. Manrique

    2013-11-01

    Full Text Available Objetive. This study was conducted to evaluate, by means of lectinhistochemistry (LHC, the expression of carbohydrates in granulomas induced by the bacillus Calmette-Guerin (BCG in muscle tissue of Piaractus mesopotamicus after 33 days. Material and methods. Histological sections with 3 μm thick were incubated with the following lectins :WGA (Wheat germ agglutinin, DBA (Dolichos biflorus agglutinin and HPA (Helix pomatia agglutinin, and the results were evaluated by light microscopy. Results. Acid fast bacilli were stained by Ziehl Neelsen (ZN and strong labeled by WGA in the cytoplasm of macrophages. Labeling with DBA was intense in fibroblasts and weak in macrophages. On the other hand, HPA binding was stronger in macrophages, especially in those that were in close contact with epithelioid cells, without evidence of binding to fibroblasts. The epithelioid cells were not labeled by the used lectins, but they were identified by Hematoxilin-Eosin (HE. The lectins labeled specific type saccharides in glycoproteins, as N-acetylglucosamine present in bacilli and macrophages, as well as N-acetyl-galactosamine in macrophages. The control group showed no inflammation or lectin binding. Conclusions. This technique may be useful in identifying receptors for WGA, DBA and the HPA lectins in epithelioid granuloma induced by BCG in P. mesopotamicus.

  15. Application of Lectin Array Technology for Biobetter Characterization: Its Correlation with FcγRIII Binding and ADCC.

    Science.gov (United States)

    Roucka, Markus; Zimmermann, Klaus; Fido, Markus; Nechansky, Andreas

    2016-12-24

    Lectin microarray technology was applied to compare the glycosylation pattern of the monoclonal antibody MB311 expressed in SP2.0 cells to an antibody-dependent cellular cytotoxic effector function (ADCC)-optimized variant (MB314). MB314 was generated by a plant expression system that uses genetically modified moss protoplasts (Physcomitrella patens) to generate a de-fucosylated version of MB311. In contrast to MB311, no or very low interactions of MB314 with lectins Aspergillus oryzae l-fucose (AOL), Pisum sativum agglutinin (PSA), Lens culinaris agglutinin (LCA), and Aleuria aurantia lectin (AAL) were observed. These lectins are specific for mono-/biantennary N-glycans containing a core fucose residue. Importantly, this fucose indicative lectin-binding pattern correlated with increased MB314 binding to CD16 (FcγRIII; receptor for the constant region of an antibody)-whose affinity is mediated through core fucosylation-and stronger ADCC. In summary, these results demonstrate that lectin microarrays are useful orthogonal methods during antibody development and for characterization.

  16. Hidden IgG Antibodies to the Tumor-Associated Thomsen-Friedenreich Antigen in Gastric Cancer Patients: Lectin Reactivity, Avidity, and Clinical Relevance

    Science.gov (United States)

    Kurtenkov, Oleg

    2017-01-01

    Natural antibodies to the tumor-associated Thomsen-Friedenreich antigen (TF) are related to tumor immunosurveillance and cancer patients' survival. Hidden IgG antibodies (HAbs) to TF, their lectin reactivity, avidity, and clinical relevance were studied. HAbs were present in cancer patients and controls. A decreased level of IgG HAbs was detected in cancer. The HAbs level positively correlated with the sialospecific SNA lectin binding in purified total IgG (tIgG) in donors and cancer patients, indicating that HAbs are higher sialylated. The avidity of anti-TF IgG in tIgG samples was lower in cancer patients (P = 0.025) while no difference in the avidity of free anti-TF IgG was established. A negative correlation between the avidity of anti-TF IgG in tIgG and SNA binding in both groups was observed (P IgG avidity in tIgG only in donors (P = 0.003). Changes in the level of HAbs and Abs avidity showed a rather good stage- and gender-dependent diagnostic accuracy. Cancer patients with a lower anti-TF IgG avidity in tIgG showed a benefit in survival. Thus the TF-specific HAbs represent a particular subset of anti-TF IgG that differ from free serum anti-TF IgG in SNA reactivity, avidity, diagnostic potential, and relation to survival. PMID:28316982

  17. Adenoid Reservoir for Pathogenic Biofilm Bacteria▿

    Science.gov (United States)

    Nistico, L.; Kreft, R.; Gieseke, A.; Coticchia, J. M.; Burrows, A.; Khampang, P.; Liu, Y.; Kerschner, J. E.; Post, J. C.; Lonergan, S.; Sampath, R.; Hu, F. Z.; Ehrlich, G. D.; Stoodley, P.; Hall-Stoodley, L.

    2011-01-01

    Biofilms of pathogenic bacteria are present on the middle ear mucosa of children with chronic otitis media (COM) and may contribute to the persistence of pathogens and the recalcitrance of COM to antibiotic treatment. Controlled studies indicate that adenoidectomy is effective in the treatment of COM, suggesting that the adenoids may act as a reservoir for COM pathogens. To investigate the bacterial community in the adenoid, samples were obtained from 35 children undergoing adenoidectomy for chronic OM or obstructive sleep apnea. We used a novel, culture-independent molecular diagnostic methodology, followed by confocal microscopy, to investigate the in situ distribution and organization of pathogens in the adenoids to determine whether pathogenic bacteria exhibited criteria characteristic of biofilms. The Ibis T5000 Universal Biosensor System was used to interrogate the extent of the microbial diversity within adenoid biopsy specimens. Using a suite of 16 broad-range bacterial primers, we demonstrated that adenoids from both diagnostic groups were colonized with polymicrobial biofilms. Haemophilus influenzae was present in more adenoids from the COM group (P = 0.005), but there was no significant difference between the two patient groups for Streptococcus pneumoniae or Staphylococcus aureus. Fluorescence in situ hybridization, lectin binding, and the use of antibodies specific for host epithelial cells demonstrated that pathogens were aggregated, surrounded by a carbohydrate matrix, and localized on and within the epithelial cell surface, which is consistent with criteria for bacterial biofilms. PMID:21307211

  18. Isolation and characterization of calcium binding glycoproteins of cardiac sarcolemmal vesicles

    Energy Technology Data Exchange (ETDEWEB)

    Michalak, M.; Fliegel, L.; Wlasichuk, K. (Univ. of Alberta, Edmonton (Canada))

    1990-04-05

    Two major Ca2(+)-binding glycoproteins Mr 120,000 and 100,000 were isolated from 3-((3-cholamidopropyl)dimethylammonio)-1-propanesulfonic acid -solubilized bovine heart sarcolemma membrane. Peroxidase-conjugated concanavalin A and wheat germ agglutinin lectins bind strongly to the isolated 120- and 100-kDa glycoproteins. Treatment with endoglycosidase F resulted in conversion of the 120-kDa glycoprotein to a form migrating at about 97 kDa. Treatment of the 100-kDa band with endoglycosidase F produced form of about 80 kDa. Endoglycosidase H digestion removes only 5% of the mass of both glycoproteins. the carbohydrate structure of both glycoproteins, is therefore, predicted to be at least 75% complex structure and 25% high mannose or hybrid structure. The 120- and 100-kDa glycoproteins are the major Ca2(+)-binding proteins in the sarcolemma membranes. Intact and endoglycosidase-treated glycoproteins bind 45Ca2+ as analyzed by a 45Ca2+ overlay technique. Using polyclonal antibodies, the 120- and 100-kDa glycoproteins were identified in muscle plasma membranes (ventricles, atria, and uterus smooth muscle). They were, however, not present in non-muscle tissues such as pancreas, liver, and kidney. The 120- and 100-kDa glycoproteins appear to be homologous molecules as judged by their similar V8 protease peptide maps, cross-reactivity with polyclonal antibody, and other physicochemical properties.

  19. Biophysical studies on calcium and carbohydrate binding to carbohydrate recognition domain of Gal/GalNAc lectin from Entamoeba histolytica: insights into host cell adhesion.

    Science.gov (United States)

    Yadav, Rupali; Verma, Kuldeep; Chandra, Mintu; Mukherjee, Madhumita; Datta, Sunando

    2016-09-01

    Entamoeba histolytica, an enteric parasite expresses a Gal/GalNAc-specific lectin that contributes to its virulence by establishing adhesion to host cell. In this study, carbohydrate recognition domain of Hgl (EhCRD) was purified and biophysical studies were conducted to understand the thermodynamic basis of its binding to carbohydrate and Ca(++) Here, we show that carbohydrate recognition domain (CRD) of the lectin binds to calcium through DPN motif. To decipher the role of calcium in carbohydrate binding and host cell adhesion, biophysical and cell-based studies were carried out. We demonstrated that the presence of the cation neither change the affinity of the lectin for carbohydrates nor alters its conformation. Mutation of the calcium-binding motif in EhCRD resulted in complete loss of ability to bind calcium but retained its affinity for carbohydrates. Purified EhCRD significantly diminished adhesion of the amebic trophozoites to Chinese Hamster Ovary (CHO) cells as well as triggered red blood cell agglutination. The calcium-binding defective mutant abrogated amebic adhesion to CHO cells similar to the wild-type protein, but it failed to agglutinate RBCs suggesting a differential role of the cation in these two processes. This study provides the first molecular description of the role of calcium in Gal/GalNAc mediated host cell adhesion. © The Authors 2016. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

  20. Analysis of density-dependent binding of glycans by lectins using carbohydrate microarrays.

    Science.gov (United States)

    Tian, Xizhe; Pai, Jaeyoung; Shin, Injae

    2012-09-01

    To investigate the density-dependent binding of glycans by lectins using carbohydrate microarrays, a number of C-terminal hydrazide-conjugated neoglycopeptides with various valences and different spatial arrangements of the sugar ligands were prepared on a solid support. The synthetic strategy includes (1) assembly of alkyne-linked peptides possessing C-terminal hydrazide on a solid support, (2) coupling of azide-linked, unprotected sugars to the alkyne-linked peptides on the solid support utilizing click chemistry, and (3) release of the neoglycopeptides from the solid support. By using this synthetic methodology, sixty five neoglycopeptides with a valency ranging from 1 to 4 and different spatial arrangements of the carbohydrate ligands were generated. Carbohydrate microarrays were constructed by immobilizing the prepared neoglycopeptides on epoxide-derivatized glass slides and were used to analyze the density-dependent binding of glycans by lectins. The results of binding property determinations show that lectin binding is highly dependent on the surface glycan density. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Microarray-based study of carbohydrate-protein binding by gold nanoparticle probes.

    Science.gov (United States)

    Gao, Jingqing; Liu, Dianjun; Wang, Zhenxin

    2008-11-15

    In order to develop a novel high-throughput tool for monitoring carbohydrate-protein interactions, we prepared carbohydrate or glycoprotein microarrays by immobilizing amino modified carbohydrates on aldehyde-derivatized glass slides or glycoprotein on epoxide-derivatized glass slides and carried out lectin binding experiments by using these microarrays, respectively. The interaction events are marked by attachment of gold nanoparticles followed by silver deposition for signal enhancement. The attachment of the gold nanoparticles is achieved by standard avidin-biotin chemistry. The detection principle is resonance light scattering (RLS). The well-defined recognition systems, namely, three monosaccharides (Man-alpha, Glc-beta and Gal-beta) or three glycoproteins (Asf, RNase A and RNase B) with two lectins (ConA and RCA120), were chosen here to establish the RLS assay, respectively. Highly selective recognition of carbohydrate-protein down to 25.6 pg/mL for RCA120 in solution and 8 microM for Gal-beta and 32 ng/mL for Asf on the microarray spots is demonstrated.

  2. Carbohydrate chips for studying high-throughput carbohydrate-protein interactions.

    Science.gov (United States)

    Park, Sungjin; Lee, Myung-ryul; Pyo, Soon-Jin; Shin, Injae

    2004-04-21

    Carbohydrate-protein interactions play important biological roles in living organisms. For the most part, biophysical and biochemical methods have been used for studying these biomolecular interactions. Less attention has been given to the development of high-throughput methods to elucidate recognition events between carbohydrates and proteins. In the current effort to develop a novel high-throughput tool for monitoring carbohydrate-protein interactions, we prepared carbohydrate microarrays by immobilizing maleimide-linked carbohydrates on thiol-derivatized glass slides and carried out lectin binding experiments by using these microarrays. The results showed that carbohydrates with different structural features selectively bound to the corresponding lectins with relative binding affinities that correlated with those obtained from solution-based assays. In addition, binding affinities of lectins to carbohydrates were also quantitatively analyzed by determining IC(50) values of soluble carbohydrates with the carbohydrate microarrays. To fabricate carbohydrate chips that contained more diverse carbohydrate probes, solution-phase parallel and enzymatic glycosylations were performed. Three model disaccharides were in parallel synthesized in solution-phase and used as carbohydrate probes for the fabrication of carbohydrate chips. Three enzymatic glycosylations on glass slides were consecutively performed to generate carbohydrate microarrays that contained the complex oligosaccharide, sialyl Le(x). Overall, these works demonstrated that carbohydrate chips could be efficiently prepared by covalent immobilization of maleimide-linked carbohydrates on the thiol-coated glass slides and applied for the high-throughput analyses of carbohydrate-protein interactions.

  3. The lipid raft-bound alkaline phosphatase activity increases and the level of transcripts remains unaffected in liver of merosin-deficient LAMA2dy mouse.

    Science.gov (United States)

    Montenegro, María Fernanda; Moral-Naranjo, María Teresa; Campoy, Francisco J; Muñoz-Delgado, Encarnación; Vidal, Cecilio J

    2014-06-05

    Alkaline phosphatase (AP) and other proteins add glycosylphosphatidylinositol (GPI) before addressing to raft domains of the cell membrane. Our previous report showing an increased density of lipid rafts in muscle of dystrophic Lama2dy mice prompted us to compare livers of normal (NL) and dystrophic mice (DL) for their levels of rafts. With this aim, hepatic rafts were isolated as Triton X-100 resistant membranes, and identified by their abundance of flotillin-2, alkaline phosphatase (AP) and other raft markers. The comparable abundance of cholesterol and flotillin-2 in rafts of NL and DL contrasted with the double AP activity both in rafts of DL and whole DL. The AP mRNA level was the same in NL and DL. Sedimentation analysis profiles revealed AP activity of NL distributed between dimeric (dAP) and monomeric AP (mAP), whose proportions and lectin-binding extent changed in DL. The increased AP activity and changed AP glycosylation in DL, the prevalence of mAP in NL and the enhanced stability of dAP in DL demonstrated the critical role that glycosylation and oligomerization play for AP catalysis. The higher AP activity of DL probably arises from dystrophy-associated changes in glycosyl transferases, which alter AP glycosylation and subunit folding with profitable effects for AP stability and catalysis. Copyright © 2014. Published by Elsevier Ireland Ltd.

  4. Sclerotium rolfsii lectin exerts insecticidal activity on Spodoptera litura larvae by binding to membrane proteins of midgut epithelial cells and triggering caspase-3-dependent apoptosis.

    Science.gov (United States)

    H, Vishwanathreddy; Bhat, Ganapati G; Inamdar, Shashikala R; Gudihal, Ravindra K; Swamy, Bale M

    2014-02-01

    The insect pest Spodoptera litura is considered a major threat to many economically important food and commercial crops. The present study establishes the toxic effects of Sclerotium rolfsii lectin (SRL) against S. litura larvae fed an artificial diet containing the purified lectin. The toxicity of SRL, as determined by feeding assays using different concentrations of the lectin, showed marginal effects on larval growth but a remarkable mortality rate of 68.52 ± 8.48% at the highest lectin concentration, 0.06% (600 μg/g), with an LC50 value of 430 μg/g of artificial diet. SRL is resistant to proteolysis by larval gut proteases even after 24-h incubation. Histochemical studies and western blot analyses of lectin binding revealed the interaction of the lectin with specific membrane glycoproteins on epithelial cells of the midgut. Identification of SRL-interacting midgut membrane proteins using lectin affinity chromatography and ESI-Q-TOF analysis revealed the involvement of these proteins in immunomodulatory responses in insects. Active caspase-3-like activity and DNA fragmentation observed in the midgut epithelial cells of larvae fed a lectin-containing diet supported the mechanism of apoptosis-induced death. These findings suggested that SRL can be a valuable tool in plant biotechnology for developing insect-resistant transgenic crops. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Legume Lectins Inhibit Human Parainfluenza Virus Type 2 Infection by Interfering with the Entry

    Directory of Open Access Journals (Sweden)

    Myles O’Brien

    2012-07-01

    Full Text Available Three lectins with different sugar binding specificities were investigated for anti-viral activity against human parainfluenza virus type 2 (hPIV-2. The lectins, concanavalin A (Con A, lens culinaris agglutinin (LCA and peanut agglutinin (PNA, inhibited cell fusion and hemadsorption induced by hPIV-2. Virus nucleoprotein (NP gene synthesis was largely inhibited, but fusion (F and hemagglutinin-neuraminidase (HN gene syntheses were not. An indirect immunofluorescence study showed that Con A inhibited virus NP, F and HN protein syntheses, but LCA did not completely inhibit them, and that PNA inhibited only NP protein synthesis. Using a recombinant green fluorescence protein-expressing hPIV-2, without matrix protein (rghPIV-2ΔM, it was found that virus entry into the cells was not completely prevented. The lectins considerably reduced the number of viruses released compared with that of virus infected cells. The lectins bound to cell surface within 10 min, and many aggregates were observed at 30 min. Con A and LCA slightly disrupted actin microfilaments and microtubules, but PNA had almost no effect on them. These results indicated that the inhibitory effects of the lectins were caused mainly by the considerable prevention of virus adsorption to the cells by the lectin binding to their receptors.

  6. Application of Lectin Array Technology for Biobetter Characterization: Its Correlation with FcγRIII Binding and ADCC

    Directory of Open Access Journals (Sweden)

    Markus Roucka

    2016-12-01

    Full Text Available Lectin microarray technology was applied to compare the glycosylation pattern of the monoclonal antibody MB311 expressed in SP2.0 cells to an antibody-dependent cellular cytotoxic effector function (ADCC-optimized variant (MB314. MB314 was generated by a plant expression system that uses genetically modified moss protoplasts (Physcomitrella patens to generate a de-fucosylated version of MB311. In contrast to MB311, no or very low interactions of MB314 with lectins Aspergillus oryzae l-fucose (AOL, Pisum sativum agglutinin (PSA, Lens culinaris agglutinin (LCA, and Aleuria aurantia lectin (AAL were observed. These lectins are specific for mono-/biantennary N-glycans containing a core fucose residue. Importantly, this fucose indicative lectin-binding pattern correlated with increased MB314 binding to CD16 (FcγRIII; receptor for the constant region of an antibody—whose affinity is mediated through core fucosylation—and stronger ADCC. In summary, these results demonstrate that lectin microarrays are useful orthogonal methods during antibody development and for characterization.

  7. Increased activity of a specific sialyltransferase in chronic myelogenous leukemia.

    Science.gov (United States)

    Baker, M A; Taub, R N; Kanani, A; Brockhausen, I; Hindenburg, A

    1985-11-01

    Granulocytes from patients with chronic myelogenous leukemia (CML) are morphologically identical to their normal counterparts but show marked differences in circulation patterns and in some membrane properties. We have previously shown that there is abnormal lectin binding to CML granulocytes, and aberrant sialylation of membrane glycoproteins. To examine the changes in sialylation of CML granulocytes further, we have studied membrane preparations from CML and normal granulocytes for specific sialyltransferase activity. Because sialyltransferase enzymes are specific for the configuration of the acceptor group, enzyme activity was assayed by measuring transfer of sialic acid from CMP-14C-sialic acid to substrates of defined structure. As compared with those of normal counterparts, CML extracts catalyzed a 50% higher overall rate of sialylation of asialofetuin, a substrate possessing both N- and O-linked acceptors. Studies of enzyme specificity utilizing porcine and ovine submaxillary mucins, antifreeze glycoprotein and alpha-1 acid glycoprotein as acceptors showed that the increased sialylation by CML extracts was due primarily to substrates with the O-linked Gal beta 1----3GaINAc acceptor group. These data suggest that sialyltransferase activity is increased in CML granulocytes compared to normal granulocytes and that the increased enzyme activity is specific for O-linked Gal beta 1----3GaINAc. This enzyme activity may be directly responsible for the abnormal membrane sialylation and pathophysiological behavior of these cells.

  8. Targeting the Cryptococcus neoformans var. grubii Cell Wall Using Lectins: Study of the Carbohydrate-Binding Domain

    Directory of Open Access Journals (Sweden)

    Pamella de Brito Ximenes

    2015-02-01

    Full Text Available Cryptococcus neoformans var. grubii is considered to be the major cause of cryptococcosis in immunosuppressed patients. Understanding cell wall glycoproteins using lectins is of medical interest and can contribute to specific therapy. The aim of this study was to evaluate the carbohydrates on the cell wall of Cryptococcus neoformans var. grubii clinical isolates, using a fluorescein isothiocyanate-lectin binding protocol. Thirty yeast strains stocked in the culture collection were cultivated for 2 days at 30 °C with shaking. Cells were obtained by centrifugation, washed in phosphate-buffered saline, and a suspension of 107 cells/mL was obtained. To determine the binding profile of lectins, concanavalin A (Con A, wheat germ agglutinin (WGA, Ulex europaeus agglutinin I (UEA-I, and peanut agglutinin (PNA conjugated to fluorescein were used. All the tested clinical isolates of Cryptococcus neoformans var. grubii were intensely stained by WGA, moderately stained by Con A, and weakly stained by PNA and UEA-I. Thus, Cryptococcus can be detected in clinical specimens such as blood and cerebrospinal fluid using the fluorescent lectin WGA, which may be considered as an option for detection in cases of suspected cryptococcosis with low laboratory sensitivity. Future applications may be developed using this basic tool.

  9. Effect of the lectins wheat germ agglutinin (WGA) and Ulex europaeus agglutinin (UEA-I) on the alpha-amylase secretion of rat pancreas in vitro and in vivo.

    Science.gov (United States)

    Mikkat, U; Damm, I; Schröder, G; Schmidt, K; Wirth, C; Weber, H; Jonas, L

    1998-05-01

    Lectins are able to bind to cholecystokinin (CCK) receptors and other glycosylated membrane proteins. The lectins wheat germ agglutinin (WGA) and Ulex europaeus agglutinin (UEA-I) are used for affinity chromatography to isolate the highly glycosylated CCK-A receptor of pancreatic acinar cells. According to the working hypothesis that lectin binding to the CCK receptor should alter the ligand-receptor interaction, the effect of WGA and UEA-I on CCK-8-induced enzyme secretion was studied on isolated rat pancreatic acini in vitro. In vitro both lectins showed a dosage-dependent inhibition of CCK-8-induced alpha-amylase secretion of acini over 60 min. WGA showed a strong inhibitory effect on amylase secretion, approximately 40%, in vitro. UEA-I caused a smaller, but significant decrease, approximately 20%, in enzyme secretion of isolated acini. Additionally, both lectins inhibited cerulein/secretin- or cerulein-induced pancreatic secretion of rats in vivo, but not after secretin alone. The results are discussed with respect to a possible influence of both lectins on the interaction of CCK or cerulein with the CCK-A receptor.

  10. Forces in yeast flocculation

    Science.gov (United States)

    El-Kirat-Chatel, Sofiane; Beaussart, Audrey; Vincent, Stéphane P.; Abellán Flos, Marta; Hols, Pascal; Lipke, Peter N.; Dufrêne, Yves F.

    2015-01-01

    In the baker's yeast Saccharomyces cerevisiae, cell-cell adhesion (``flocculation'') is conferred by a family of lectin-like proteins known as the flocculin (Flo) proteins. Knowledge of the adhesive and mechanical properties of flocculins is important for understanding the mechanisms of yeast adhesion, and may help controlling yeast behaviour in biotechnology. We use single-molecule and single-cell atomic force microscopy (AFM) to explore the nanoscale forces engaged in yeast flocculation, focusing on the role of Flo1 as a prototype of flocculins. Using AFM tips labelled with mannose, we detect single flocculins on Flo1-expressing cells, showing they are widely exposed on the cell surface. When subjected to force, individual Flo1 proteins display two distinct force responses, i.e. weak lectin binding forces and strong unfolding forces reflecting the force-induced extension of hydrophobic tandem repeats. We demonstrate that cell-cell adhesion bonds also involve multiple weak lectin interactions together with strong unfolding forces, both associated with Flo1 molecules. Single-molecule and single-cell data correlate with microscale cell adhesion behaviour, suggesting strongly that Flo1 mechanics is critical for yeast flocculation. These results favour a model in which not only weak lectin-sugar interactions are involved in yeast flocculation but also strong hydrophobic interactions resulting from protein unfolding.

  11. Probing lectin-mucin interactions by isothermal titration microcalorimetry.

    Science.gov (United States)

    Dam, Tarun K; Brewer, C Fred

    2015-01-01

    Isothermal titration microcalorimetry (ITC) can directly determine the thermodynamic binding parameters of biological molecules including affinity constant, binding stoichiometry, and heat of binding (enthalpy) and indirectly the entropy and free energy of binding. ITC has been extensively used to study the binding of lectins to mono- and oligosaccharides, but limited applications to lectin-glycoprotein interactions. Inherent experimental challenges to ITC include sample precipitation during the experiment and relative high amount of sample required, but careful design of experiments can minimize these problems and allow valuable information to be obtained. For example, the thermodynamics of binding of lectins to multivalent globular and linear glycoproteins (mucins) have been described. The results are consistent with a dynamic binding mechanism in which lectins bind and jump from carbohydrate to carbohydrate epitope in these molecules leading to increased affinity. Importantly, the mechanism of binding of lectins to mucins appears similar to that for a variety of protein ligands binding to DNA. Recent results also show that high affinity lectin-mucin cross-linking interactions are driven by favorable entropy of binding that is associated with the bind and jump mechanism. The results suggest that the binding of ligands to biopolymers, in general, may involve a common mechanism that involves enhanced entropic effects that facilitate binding interactions.

  12. Technical Report for DE-FG02-03ER46029 Sugar-Coated PPEs, Novel Nanomaterials and Sensing Modules for Disease and Bioterrorism Related Threats

    Energy Technology Data Exchange (ETDEWEB)

    Uwe Bunz

    2003-08-27

    The detection and sensing of biological warfare agents (Ricin, Anthrax toxin), of disease agents (cholera, botulinum and tetanus toxins, influenza virus etc) and of biologically active species is important for national security and disease control. A premiere goal would be the simple colorimetric or fluorimetric detection of such toxins by a dipstick test. It would be desirable to sense 5,000-10,000 toxin molecules, i.e. 10-100 fg of a toxin contained 1-5 mL of sample. Fluorescent conjugated polymers should be particularly interesting in this regard, because they can carry multiple identical and/or different recognition units. Such an approach is particularly valuable for the detection of lectin toxins, because these bind to oligomeric carbohydrate displays. Lectins bind multivalently to sugars, i.e. several covalently connected sugar moieties have to be exposed to the lectin at the same time to obtain binding. The requirement of multivalency of the lectin-sugar interactions should allow a very sensitive detection of lectins with sugar coated conjugated polymers in an agglutination type assay, where the fluorescence of the PPEs disappears upon binding to the lectins. High molecular weights of the used PPEs would mean high sensitivity. Herein we present our progress towards that goal up to date.

  13. Localization of glycoconjugates at the tegument of the tapeworms Hymenolepis nana and H. microstoma with gold labelled lectins.

    Science.gov (United States)

    Schmidt, J; Peters, W

    1987-01-01

    Gold labelled lectins were used for electron microscopic localization of carbohydrate components of the tegument surface of two tapeworm species, Hymenolepis nana and H. microstoma. WGA, succinylated WGA, SBA, APA, PNA and, to a lesser extent, Con A were preferentially bound to the spines of the microtrichs. UEA-I and DBA were not adsorbed. The results indicate that the surface coat of both species has exposed N-acetylglucosamine, galactose and perhaps glucose and/or mannose residues. The location of lectin-binding glycoconjugates within the tegument and parenchyma was found using the light microscope on sections of material embedded in Lowikryl K4M after lectin-gold labelling and silver enhancement of the gold grains. The tegument selectively adsorbs WGA and SBA and strongly; adsorbtion of PNA and Con A is less intense. Strong adsorbtion of DBA and PNA was confined to the basal lamina. The parenchyma adsorbed Con A, PNA and DBA, but little WGA and SBA. The results indicate that many glycoconjugates are present in the tegument. They have similar terminal sugar residues to those of the surface coat. The significance of these carbohydrates for host-parasite interactions is discussed.

  14. Increased Avidity of the Sambucus nigra Lectin-Reactive Antibodies to the Thomsen-Friedenreich Antigen as a Potential Biomarker for Gastric Cancer

    Directory of Open Access Journals (Sweden)

    Oleg Kurtenkov

    2015-01-01

    Full Text Available Aim. To determine whether the naturally occurring Thomsen-Friedenreich (TF antigen-specific antibodies differ in avidity between cancer patients and controls to find a novel biomarker for stomach cancer. Methods. Serum samples were taken from patients with cancer and controls. The level of TF-specific antibodies and their sialylation were determined using ELISA with synthetic TF-polyacrylamide conjugate as antigen and sialic acid-specific Sambucus nigra agglutinin (SNA. The avidity was determined using ammonium thiocyanate as a chaotrope. Results. A significantly higher SNA lectin binding to anti-TF antibodies was found in cancer patients irrespective of disease stage. The avidity of only IgM TF-specific antibodies was significantly higher in cancer patients compared to controls. The SNA-positive anti-TF antibodies of cancer patients showed a significantly higher avidity, P<0.001. The sensitivity and specificity of this increase for gastric cancer were 73.53% and 73.08%, respectively, with a 73.2% diagnostic accuracy. The higher avidity of SNA-reactive anti-TF antibodies was associated with a benefit in survival of stage 3 cancer patients. Conclusion. The SNA-reactive TF-specific antibodies display a significantly higher avidity in gastric cancer patients compared to controls, which can be used as a potential serologic biomarker for gastric cancer. It appears that IgM is the main target responsible for the above changes.

  15. Characterization of cell surface and extracellular matrix remodeling of Azospirillum brasilense chemotaxis-like 1 signal transduction pathway mutants by atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the regulation of multiple behaviors in response to changes in the environment, including motility patterns, exopolysaccharide production, and cell-to-cell interactions. In Azospirillum brasilense, cell surface properties, including exopolysaccharide production, are thought to play a direct role in promoting flocculation. Recently, the Che1 chemotaxis-like pathway from A. brasilense was shown to modulate flocculation, suggesting an associated modulation of cell surface properties. Using atomic force microscopy, distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains were detected. Whereas the wild-type strain produces a smooth mucosal extracellular matrix after 24 h, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition, lectin-binding assays, and comparison of lipopolysaccharides profiles suggest that the extracellular matrix differs between the cheA1 and the cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that disruption of the Che1 pathway is correlated with distinctive changes in the extracellular matrix, which likely result from changes in surface polysaccharides structure and/or composition.

  16. The concurrent expression of Griffonia simplicifolia-IB4 binding and tumor necrosis factor-alpha differs between alveolar and peritoneal macrophages.

    Science.gov (United States)

    Tabor, D R; Theus, S A; Barnett, J B; Tryka, A F; Jacobs, R F

    1992-03-01

    As a corollary to their anatomic location, alveolar macrophages (AM) have a lower threshold for generating some physiologic functions than peritoneal macrophages (PM). In this study, we examined both of these populations for their ability to bind the lectin Griffonia simplicifolia-IB4 (GSIB4) and to produce tumor necrosis factor (TNF)-alpha. The results showed that these two responses were concurrently expressed in activated macrophages, although they differed in magnitude when AM and PM were compared. Following in vitro incubation, AM from lipopolysaccharide-treated rats demonstrated a higher percentage of GSIB4 positivity and TNF production when compared with their respective PM. Since prostaglandin E2 can regulate the expression of some macrophage activities, experiments were conducted to determine whether this could also affect the ability of macrophages to bind the GSIB4 lectin. Neither the administration of indomethacin nor exogenous prostaglandin E2 altered the expression of this marker. Conversely, these treatments produced significant changes in TNF-alpha production in both alveolar and peritoneal macrophages. When the concurrent expression of GSIB4 lectin binding and TNF-alpha production was analyzed, AM from lipopolysaccharide-treated rats demonstrated both superior GSIB4 positivity and TNF-alpha production compared with all other macrophages examined. The results of this work show that AM and PM differ in their expression of GSIB4 binding and TNF-alpha production. These differential responses may be important in determining the level of activity of macrophages that are participating in an immune response.

  17. Griffonia simplicifolia I: fluorescent tracer for microcirculatory vessels in nonperfused thin muscles and sectioned muscle.

    Science.gov (United States)

    Hansen-Smith, F M; Watson, L; Lu, D Y; Goldstein, I

    1988-11-01

    Previous studies on mice have revealed that the Griffonia simplicifolia I (GSI) lectin selectively binds to capillaries in a number of microvascular beds. These observations suggest that the lectin might be a suitable microvascular marker for physiological studies of skeletal muscle, particularly when fluorescent visualization of vessels is desired independently of their perfusion status. Since species and strain heterogeneity has been demonstrated for certain lectins associated with the microcirculatory vessels, lectin binding was studied in a number of muscles taken from the major species of mammals used for experimental purposes. Staining of cryostat sections confirmed the utility of GSI as a marker for capillaries from muscle of mice, rats, hamsters, rabbits, dogs, and monkeys. Differential staining of arterioles and veins was revealed by double labeling with GSI and antisera to Factor VIII-related antigen. Double labeling for GSI binding and alkaline phosphatase activity revealed that the GSI method detects many more capillaries and terminal arterioles than does the alkaline phosphatase method. GSI binding to unfixed whole mounts of thin skeletal muscles (hamster cheek pouch, mouse diaphragm, and rat cremaster) was studied to determine whether the GSI lectin would be a suitable marker for intravital studies. An extensive microvascular bed, including terminal arterioles, venules, and capillaries, was revealed which could be visualized in the complete absence of perfusion with fluorescent markers. These observations suggest that the GSI lectin may be extremely useful as a probe for the microcirculation of skeletal muscle in many types of physiological experiments.

  18. Isolation and Characterization of IgM and IgY Antibodies from Plasma of Magellanic Penguins (Spheniscus magellanicus).

    Science.gov (United States)

    Bizelli, Camila C; Silva, A Sandriana R; da Costa, Jessica D; Vanstreels, Ralph E T; Atzingen, Marina V; Santoro, Marcelo L; Fernandes, Irene; Catão-Dias, José L; Faquim-Mauro, Eliana L

    2015-03-01

    Infectious diseases such as aspergillosis, avian malaria, and viral infections are significant threats to the conservation of penguins, leading to morbidity and mortality of these birds both in captivity and in the wild. The immune response to such infectious diseases is dependent on different mechanisms mediated by cells and soluble components such as antibodies. Antibodies or immunoglobulins are glycoproteins that have many structural and functional features that mediate distinct effector immune functions. Three distinct classes of antibodies have been identified in birds: immunoglobulin A (IgA), immunoglobulin M (IgM), and immunoglobulin Y (IgY). In this study we aim to establish an efficient laboratory method to obtain IgM and IgY antibodies from plasma samples of healthy adult Magellanic penguins (Spheniscus magellanicus). The protocol was developed combining plasma delipidation, sequential precipitation with caprylic acid and ammonium sulfate, and size-exclusion chromatography. The efficiency of the protocol and the identity of the purified IgM and IgY antibodies were confirmed through enzyme-linked immunosorbent assay, Western blotting, one-dimensional and two-dimensional polyacrylamide gel electrophoresis, and lectin binding assay. Structural and physicochemical properties of IgM and IgY from Magellanic penguins were consistent with those of other avian species. This purification protocol will allow for more detailed studies on the humoral immunity of penguins and for the development of high specificity serologic assays to test Magellanic penguins for infectious pathogens.

  19. Chitinases are negative regulators of Francisella novicida biofilms.

    Science.gov (United States)

    Chung, Myung-Chul; Dean, Scott; Marakasova, Ekaterina S; Nwabueze, Albert O; van Hoek, Monique L

    2014-01-01

    Biofilms, multicellular communities of bacteria, may be an environmental survival and transmission mechanism of Francisella tularensis. Chitinases of F. tularensis ssp. novicida (Fn) have been suggested to regulate biofilm formation on chitin surfaces. However, the underlying mechanisms of how chitinases may regulate biofilm formation are not fully determined. We hypothesized that Fn chitinase modulates bacterial surface properties resulting in the alteration of biofilm formation. We analyzed biofilm formation under diverse conditions using chitinase mutants and their counterpart parental strain. Substratum surface charges affected biofilm formation and initial attachments. Biophysical analysis of bacterial surfaces confirmed that the chi mutants had a net negative-charge. Lectin binding assays suggest that chitinase cleavage of its substrates could have exposed the concanavalin A-binding epitope. Fn biofilm was sensitive to chitinase, proteinase and DNase, suggesting that Fn biofilm contains exopolysaccharides, proteins and extracellular DNA. Exogenous chitinase increased the drug susceptibility of Fn biofilms to gentamicin while decreasing the amount of biofilm. In addition, chitinase modulated bacterial adhesion and invasion of A549 and J774A.1 cells as well as intracellular bacterial replication. Our results support a key role of the chitinase(s) in biofilm formation through modulation of the bacterial surface properties. Our findings position chitinase as a potential anti-biofilm enzyme in Francisella species.

  20. Concanavalin A-mediated cell agglutinability induced by Vaccinia virions. [Uv radiation, /sup 125/I tracer technique

    Energy Technology Data Exchange (ETDEWEB)

    Mbuy, G.; Bubel, H.C.

    1978-12-01

    The induction of enhanced concanavalin A (Con A)-mediated cellular agglutinability by purified vaccinia virus was examined quantitatively. Increased HEp-2 cell agglutinability by the lectin occurred within the first hour of infection and persisted without further change throughout the virus infectious cycle. Ultraviolet, but not heat-inactivated, virus was as effective as infectious virus in causing increased Con A agglutinability. Inhibition of viral and host cell protein synthesis by Streptovitacin A failed to alter the lectin response to vaccinia virus infection. Fluorescein-labeled Con A was observed to form clusters and large fluorescent patches on the infected cell surface during the earliest stage of infection. Studies with /sup 125/I-labeled Con A revealed an early but minimal increase in lectin binding to infected cells. After the first hour of infection, no further increase in Con A binding was observed. When cells were exposed to purified vaccinia virus surface tubules increased Con A agglutinability comparable to that obtained with native virus was demonstrated. Con A-mediated agglutinability of cells was temperature-dependent and displayed a higher temperature transition in infected cells. These data suggest that upon contact with the host cell, vaccinia virions or surface tubules induce alterations in the plasma membrane which are reflected in an enhanced agglutinability by Con A.

  1. The acid soluble extracellular polymeric substance of aerobic granular sludge dominated by Defluviicoccus sp.

    Science.gov (United States)

    Pronk, M; Neu, T R; van Loosdrecht, M C M; Lin, Y M

    2017-10-01

    A new acid soluble extracellular polymeric substance (acid soluble EPS) was extracted from an acetate fed aerobic granular sludge reactor operated at 35 °C. Acid soluble EPS dominated granules exhibited a remarkable and distinctive tangled tubular morphology. These granules are dominated by Defluviicoccus Cluster II organisms. Acetic acid instead of the usually required alkaline extraction medium was needed to dissolve the granules and solubilise the polymeric matrix. The extracted acid soluble EPS was analysed and identified using various instrumental analysis including 1H and 13C Nuclear Magnetic Resonance, Fourier Transform Infrared Spectroscopy and Raman spectroscopy. In addition, the glycoconjugates were characterized by fluorescence lectin-binding analysis. The acid soluble EPS is α-(1 → 4) linked polysaccharide, containing both glucose and galactose as monomers. There are OCH3 groups connected to the glucose monomer. Transmission and scanning electron microscopy (TEM, SEM) as well as confocal laser scanning microscopy (CLSM) showed that the acid soluble EPS was present as a tightly bound capsular EPS around bacterial cells ordered into a sarcinae-like growth pattern. The special granule morphology is decided by the acid soluble EPS produced by Defluviicoccus Cluster II organisms. This work shows that no single one method can be used to extract all possible extracellular polymeric substances. Results obtained here can support the elucidation of biofilm formation and structure in future research. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  2. Use of Aleuria alantia Lectin Affinity Chromatography to Enrich Candidate Biomarkers from the Urine of Patients with Bladder Cancer

    Directory of Open Access Journals (Sweden)

    Sarah R. Ambrose

    2015-09-01

    Full Text Available Developing a urine test to detect bladder tumours with high sensitivity and specificity is a key goal in bladder cancer research. We hypothesised that bladder cancer-specific glycoproteins might fulfill this role. Lectin-ELISAs were used to study the binding of 25 lectins to 10 bladder cell lines and serum and urine from bladder cancer patients and non-cancer controls. Selected lectins were then used to enrich glycoproteins from the urine of bladder cancer patients and control subjects for analysis by shotgun proteomics. None of the lectins showed a strong preference for bladder cancer cell lines over normal urothlelial cell lines or for urinary glycans from bladder cancer patients over those from non-cancer controls. However, several lectins showed a strong preference for bladder cell line glycans over serum glycans and are potentially useful for enriching glycoproteins originating from the urothelium in urine. Aleuria alantia lectin affinity chromatography and shotgun proteomics identified mucin-1 and golgi apparatus protein 1 as proteins warranting further investigation as urinary biomarkers for low-grade bladder cancer. Glycosylation changes in bladder cancer are not reliably detected by measuring lectin binding to unfractionated proteomes, but it is possible that more specific reagents and/or a focus on individual proteins may produce clinically useful biomarkers.

  3. Histological and histochemical study of female germ cell development in the dusky grouper Epinephelus marginatus (Lowe, 1834).

    Science.gov (United States)

    Mandich, A; Massari, A; Bottero, S; Marino, G

    2002-01-01

    The developmental stages of female germ cells were analysed in a wild population of the protogynous teleost Epinephelus marginatus (Lowe, 1834). 321 wild dusky grouper females were collected in the South Mediterranean Sea during the spawning season and their ovaries analysed using histological and histochemical techniques. Oocyte morphology, nucleus-cytoplasm ratio (N/C) range, location and movements of cytoplasmic inclusions during primary growth, vitellogenesis and final oocyte maturation were described. The distribution of proteins, lipids and carbohydrates through oocyte development was also investigated in 50 females. Lipid vesicles appeared firstly in the mid ooplasm of oocytes larger than 130 microm, at the beginning of the secondary growth phase. Immediately afterwards, small carbohydrate granules (PAS and Alcian blue positive) appeared before the occurrence of the first yolk granules. Tyrosine-enriched proteins were especially evidenced in the zona radiata interna of late vitellogenic oocytes. Specific lectin binding patterns reflected characteristic differences in the content and distribution of specific sugar moieties expressed in the oocytes during vitellogenesis and final maturation. At the end of vitellogenesis and during final maturation, follicular cells, zona radiata, and cortical alveoli were characterised by a strong increase of specific binding for WGA.

  4. Histological and histochemical study of female germ cell development in the dusky grouper Epinephelus marginatus (Lowe, 1834

    Directory of Open Access Journals (Sweden)

    A Mandich

    2009-12-01

    Full Text Available The developmental stages of female germ cells were analysed in a wild population of the protogynous teleost Epinephelus marginatus (Lowe, 1834. 321 wild dusky grouper females were collected in the South Mediterranean Sea during the spawning season and their ovaries analysed using histological and histochemical techniques. Oocyte morphology, nucleus-cytoplasm ratio (N/C range, location and movements of cytoplasmic inclusions during primary growth, vitellogenesis and final oocyte maturation were described. The distribution of proteins, lipids and carbohydrates through oocyte development was also investigated in 50 females. Lipid vesicles appeared firstly in the mid ooplasm of oocytes larger than 130mm, at the beginning of the secondary growth phase. Immediately afterwards, small carbohydrate granules (PAS and Alcian blue positive appeared before the occurrence of the first yolk granules. Tyrosine-enriched proteins were especially evidenced in the zona radiata interna of late vitellogenic oocytes. Specific lectin binding patterns reflected characteristic differences in the content and distribution of specific sugar moieties expressed in the oocytes during vitellogenesis and final maturation. At the end of vitellogenesis and during final maturation, follicular cells, zona radiata, and cortical alveoli were characterised by a strong increase of specific binding for WGA.

  5. Carbohydrate specificity of lectin, purified from the fruiting bodies of Mycena pura /Fr./ Kumm. and its use in histochemical investigation

    Directory of Open Access Journals (Sweden)

    Ambarova N. O.

    2009-12-01

    Full Text Available Aim. The purpose of this investigation was to research carbohydrate specificity of a new lectin from fruiting body of Mycena pura and possibilities of its application in histochemical studies. Methods. The lectin has been purified by affinity chromatography on «îvomucine». The lectin carbohydrate specificity has been determined by a reaction of inhibiting haemagglutination by haptens. Histological materials were fixed in 4 % neutral formalin solution. Alkaline phosphatase was revealed in the cryostat unfixed microscopical sections. Results. The lectin yield from fresh fruit bodies of raw material was 9 mg/kg. Mol. mass of the lectin is 40 kDa. The lectin poorly interacted with D-glucose and D-mannose in contrast to lectins from Pisum sativum and Leucojum vernum. The peculiarity of this lectin is its strong interaction with alkaline phosphatase, the highest among twenty tested lectins. However, the receptors for Mycena lectin binding in mammalian tissues are not limited by this enzyme being presented also by glycoconjugates of another structure, as it was shown for fetus calf small intestine and kidney of rat. Conclusions. An important role in the lectin interaction with glycoproteins probably belongs to the disaccharide links of GlcNAcb(1-2Mana(1-6 or GlcNAcb(1- 2Mana(1-2, which not necessarily are terminal

  6. Role of male reproductive tract CD52 (mrt-CD52) in reproduction.

    Science.gov (United States)

    Koyama, Koji; Ito, Koichi; Hasegawa, Akiko

    2007-01-01

    Human CD52 antigen is a highly glycosylated molecule with an unusually small core peptide exclusively expressed on lymphocytes and mature sperm. In the male reproductive tract, it is secreted mainly from the epididymis and inserted into the sperm membrane via the glycosyl-phosphatidyl inositol (GPI) anchor during the passage of the spermatozoa through the epididymis. It has recently been found that the male reproductive tract CD52 (mrt-CD52) is a target antigen of human monoclonal antibody (Mab H6-3C4) obtained from an antisperm antibody-mediated infertile woman. The Mab H6-3C4 shows strong sperm-immobilizing activity with complement and specifically recognizes the N-linked carbohydrate epitope of sperm CD52 but not lymphocyte CD52. Lectin binding assays have revealed the presence of both O-linked as well as N-linked carbohydrate moieties in human mrt-CD52. Mouse monoclonal antibody (1 G12) reacting to human mrt-CD52 strongly inhibits penetration of human spermatozoa to the zona denuded hamster oocyte. Mouse CD52 is similar to human CD52 in biological and immunological characteristics. Male and female mice immunized with naturally-occurring mouse mrt-CD52 molecules produce antibodies against the cognate antigen yielding antisera with complement-dependent mouse sperm immobilizing activities.

  7. The N-linked carbohydrate moiety of male reproductive tract CD52 (mrt-CD52) interferes with the complement system via binding to C1q.

    Science.gov (United States)

    Hardiyanto, Lutfi; Hasegawa, Akiko; Komori, Shinji

    2012-06-01

    Antisperm antibody detected in infertile female patients' sera has been shown to correlate with reduced fertility. The antibody showed strong complement-dependent cytotoxicity as determined by the sperm immobilization test (SIT). CD52 is a human glycosylphosphatidylinositol (GPI)-anchored antigen present in lymphocytes and male reproductive tracts (mrt), including mature sperm and seminal plasma. Recently, purified mrt-CD52 from human seminal plasma has been reported to interfere with the classical complement pathway, but not lectin binding or alternative pathways of the complement system. The purpose of this study is to determine which stage of the classical pathway mrt-CD52 regulates. mrt-CD52 was purified from human seminal plasma or intact sperm membrane. Immunoprecipitation assay was performed with the reaction of mrt-CD52, human complement and mAb H6-3C4. Immunoprecipitate was formed by the carbohydrate moiety of mrt-CD52, but not by the GPI-anchor peptide. The C1q molecule (29 kDa) was detected in the immunoprecipitates by Western blotting analysis probed with anti C1q antibody, indicating that the carbohydrate moiety of mrt-CD52 binds to C1q. Also, the complement-dependent SIT revealed that purified CD52 inhibited sperm immobilization activity by antisperm antibody. These results suggest that mrt-CD52 protects sperm function from complement attack if antisperm antibody is generated in the female reproductive tracts. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  8. Prospects of using leguminous species in phytoremediation of total petroleum hydrocarbons polluted soils

    Directory of Open Access Journals (Sweden)

    Smaranda Masu

    2014-05-01

    Full Text Available Selecting the plant species to grow on aged petroleum hydrocarbons polluted soils is an important factor for a successful phytoremediation. Phytoremediation is a green technology that can become a promising solution for decontaminating polluted soils and ecological restoration of the landscape. Our comparative studies evaluate the effect of oil hydrocarbon pollution with high initial concentration on the growth leguminous plant species: Vicia sativa and Glycine max. The experimental block contains control variants, polluted soil unfertilized / fertilized with municipal sludge anaerobically stabilized in absence/presence of modified volcanic tuff amendment. After period of time the experiment’s soil in which plant species had grown well was sampled and analyzed for petroleum hydrocarbons removal. Both species showed promising efficiency in the phytoremediation of petroleum hydrocarbon highly polluted soils but a reduced growth of the surveyed plants was noticed. The efficiency of the petroleum hydrocarbons diminution is increased in the case of the addition of fertilizer 16.6 % for Vicia sativa and 30 % for Glycine max vs. the initial quantity. In the case of the phytoremediation of polluted soils treated with fertilizer and volcanic tuff, the efficiency of the petroleum hydrocarbons reduction was 72.9 % for Vicia sativa and 53.7 % for Glycine max.

  9. The center for plant and microbial complex carbohydrates at the University of Georgia Complex Carbohydrate Research Center. Annual report, September 15, 1990--December 31, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Albersheim, P.; Darvill, A.

    1991-08-01

    Research from the Complex Carbohydrates Research Center at the University of Georgia is presented. Topics include: Structural determination of soybean isoflavones which specifically induce Bradyrhizobium japonicum nodD1 but not the nodYABCSUIJ operon; structural analysis of the lipopolysaccharides (LPSs) from symbiotic mutants of Bradyrhizobium japonicum; structural characterization of lipooligosaccharides from Bradyrhizobium japonicum that are required for the specific nodulation of soybean; structural characterization of the LPSs from R. Leguminosarum biovar phaseoli, the symbiont of bean; characterization of bacteroid-specific LPS epitopes in R. leguminosarum biovar viciae; analysis of the surface polysaccharides of Rhizobium meliloti mutants whose lipopolysaccharides and extracellular polysaccharides can have the same function in symbiosis; characterization of a polysaccharide produced by certain Bradyrhizobium japonicum strains within soybean nodules; structural analysis of a streptococcal adhesin polysaccharide receptor; conformational studies of xyloglucan, the role of the fucosylated side chain in surface-specific cellulose-xyloglucan interactions; the structure of an acylated glucosamine oligosaccharide signal molecule (nod factor) involved in the symbiosis of Rhizobium leguminosarum biovar viciae with its host Vicia sativa; investigating membrane responses induced by oligogalacturonides in cultured cells; the polygalacturonase inhibitor protein; characterization of the self-incompatability glycoproteins from Petunia hybrida; investigation of the cell wall polysaccharide structures of Arabidopsis thaliana; and the glucan inhibition of virus infection of tabacco.

  10. The center for plant and microbial complex carbohydrates at the University of Georgia Complex Carbohydrate Research Center

    Energy Technology Data Exchange (ETDEWEB)

    Albersheim, P.; Darvill, A.

    1991-08-01

    Research from the Complex Carbohydrates Research Center at the University of Georgia is presented. Topics include: Structural determination of soybean isoflavones which specifically induce Bradyrhizobium japonicum nodD1 but not the nodYABCSUIJ operon; structural analysis of the lipopolysaccharides (LPSs) from symbiotic mutants of Bradyrhizobium japonicum; structural characterization of lipooligosaccharides from Bradyrhizobium japonicum that are required for the specific nodulation of soybean; structural characterization of the LPSs from R. Leguminosarum biovar phaseoli, the symbiont of bean; characterization of bacteroid-specific LPS epitopes in R. leguminosarum biovar viciae; analysis of the surface polysaccharides of Rhizobium meliloti mutants whose lipopolysaccharides and extracellular polysaccharides can have the same function in symbiosis; characterization of a polysaccharide produced by certain Bradyrhizobium japonicum strains within soybean nodules; structural analysis of a streptococcal adhesin polysaccharide receptor; conformational studies of xyloglucan, the role of the fucosylated side chain in surface-specific cellulose-xyloglucan interactions; the structure of an acylated glucosamine oligosaccharide signal molecule (nod factor) involved in the symbiosis of Rhizobium leguminosarum biovar viciae with its host Vicia sativa; investigating membrane responses induced by oligogalacturonides in cultured cells; the polygalacturonase inhibitor protein; characterization of the self-incompatability glycoproteins from Petunia hybrida; investigation of the cell wall polysaccharide structures of Arabidopsis thaliana; and the glucan inhibition of virus infection of tabacco.

  11. Cover crops for managing weeds, soil chemical fertility and nutritional status of organically grown orange orchard in Sicily

    Directory of Open Access Journals (Sweden)

    Rosario Paolo Mauro

    2015-06-01

    Full Text Available Cover crops can offer significant advantages in the agronomic management of citrus orchards in Mediterranean environments. Therefore, a three-year research was conducted in eastern Sicily aimed at studying the effects of four cover crop sequences (Sinapis arvensis-Trigonella foenum-graecum-T. foenum-graecum; Medicago scutellata-Avena sativa-Lolium perenne; Vicia faba minor-A. sativa-A. sativa; A. sativa-V. faba. minor-L. perenne on weeds, major soil chemical properties and nutritional status of an organically grown orange orchard. The results highlighted that, among the studied cover crop sequences, Vicia faba-Avena-Avena was the most beneficial for weeds control within the orchard (92%, of cover crop cover, and 586 and 89 g DW m–2 of cover crop aboveground biomass and weeds aboveground biomass, respectively. Overall, the chemical fertility of the soil was positively influenced. In particular, it was observed an increase of the content of total nitrogen and available phosphorus in the soil by both Sinapis-Trigonella-Trigonella (0.75 g kg–1 and 59.0 mg kg–1, respectively and Vicia faba-Avena-Avena (0.70 g kg–1 and 56.0 mg kg–1, respectively cover crop sequences. Medicago-Avena-Lolium sequence seemed to be the most useful to ensure a better nutritional status of the orange orchard.

  12. N-acyl-homoserine lactone inhibition of rhizobial growth is mediated by two quorum-sensing genes that regulate plasmid transfer.

    Science.gov (United States)

    Wilkinson, A; Danino, V; Wisniewski-Dyé, F; Lithgow, J K; Downie, J A

    2002-08-01

    The growth of some strains of Rhizobium leguminosarum bv. viciae is inhibited by N-(3-hydroxy-7-cis tetradecenoyl)-L-homoserine lactone (3OH-C(14:1)-HSL), which was previously known as the small bacteriocin before its characterization as an N-acyl homoserine lactone (AHL). Tn5-induced mutants of R. leguminosarum bv. viciae resistant to 3OH-C(14:1)-HSL were isolated, and mutations in two genes were identified. These genes, bisR and triR, which both encode LuxR-type regulators required for plasmid transfer, were found downstream of an operon containing trb genes involved in the transfer of the symbiotic plasmid pRL1JI. The first gene in this operon is traI, which encodes an AHL synthase, and the trbBCDEJKLFGHI genes were found between traI and bisR. Mutations in bisR, triR, traI, or trbL blocked plasmid transfer. Using gene fusions, it was demonstrated that bisR regulates triR in response to the presence of 3OH-C(14:1)-HSL. In turn, triR is then required for the induction of the traI-trb operon required for plasmid transfer. bisR also represses expression of cinI, which is chromosomally located and determines the level of production of 3OH-C(14:1)-HSL. The cloned bisR and triR genes conferred 3OH-C(14:1)-HSL sensitivity to strains of R. leguminosarum bv. viciae normally resistant to this AHL. Furthermore, bisR and triR made Agrobacterium tumefaciens sensitive to R. leguminosarum bv. viciae strains producing 3OH-C(14:1)-HSL. Analysis of patterns of growth inhibition using mutant strains and synthetic AHLs revealed that maximal growth inhibition required, in addition to 3OH-C(14:1)-HSL, the presence of other AHLs such as N-octanoyl-L-homoserine lactone and/or N-(3-oxo-octanoyl)-L-homoserine lactone. In an attempt to identify the causes of growth inhibition, a strain of R. leguminosarum bv. viciae carrying cloned bisR and triR was treated with an AHL extract containing 3OH-C(14:1)-HSL. N-terminal sequencing of induced proteins revealed one with significant similarity to

  13. Structural, functional, and lectin histochemical characteristics of rat ovaries and endometrium in experimental hyper- and hypothyroidism Structural, functional, and lectin histochemical characteristics of rat ovaries and endometrium in experimental hyper- and hypothyroidism

    Directory of Open Access Journals (Sweden)

    Alexander Lutsyk

    2012-10-01

    Full Text Available Twenty lectins with different carbohydrate affinities, including five new lectins purified from fungi,
    were used for histochemical examination of carbohydrate determinants in rat ovaries and endometrium under
    experimental hyper- and hypothyroidism. In the ovaries of control rats, lectin binding was detected predominantly
    in the zona pellucida and corona radiata of growing follicles, luteocytes, and leucocytes. Within the endometrium,
    lectins reacted strongly with the luminal surface, epitheliocytes and secretions of the uterine glands,
    pre-decidual cells, leucocytes, and collagen fibers. As revealed on general morphology and estrous cycle studies,
    hyperthyroidism induced ovarian luteinization, and increased the content of pre-decidual cells and of collagen
    fibers in the endometrium, with no reliable effect on the estrous cycle. Hypothyroidism was accompanied by
    retardation of the estrous cycle, enhanced folliculogenesis and leucocyte infiltration of ovarian and endometrial
    stroma. Both hyper- and hypothyroidism significantly affected the tissue carbohydrates of the ovaries and endometrium:
    specific and differential redistribution of DMan, LFuc, NeuNAc, DGlcNAc, DGalNAc, and DGal
    determinants was detected under both pathological conditions. Hyperthyroidism induced more severe alterations
    of glycoconjugates than hypothyroidism; the endometrium was more susceptible to thyroxin-modulated
    impairments than the ovaries. These results give new insights into the pathogenetic mechanisms of the effects of
    thyroid disorders on the female reproductive organs and demonstrate the suitability of lectin histochemistry
    methods for monitoring the efficacy of hormonal imbalance correction therapy, as well as the applicability of
    new lectin preparations for the selective labeling of ovarian and endometrial constituents.Twenty lectins with different carbohydrate affinities, including five

  14. Structural Variation of Chondroitin Sulfate Chains Contributes to the Molecular Heterogeneity of Perineuronal Nets

    Directory of Open Access Journals (Sweden)

    Shinji Miyata

    2018-02-01

    Full Text Available Aggrecan, a chondroitin sulfate (CS proteoglycan, forms lattice-like extracellular matrix structures called perineuronal nets (PNNs. Neocortical PNNs primarily ensheath parvalbumin-expressing inhibitory neurons (parvalbumin, PV cells late in brain development. Emerging evidence indicates that PNNs promote the maturation of PV cells by enhancing the incorporation of homeobox protein Otx2 and regulating experience-dependent neural plasticity. Wisteria floribunda agglutinin (WFA, an N-acetylgalactosamine-specific plant lectin, binds to the CS chains of aggrecan and has been widely used to visualize PNNs. Although PNNs show substantial molecular heterogeneity, the importance of this heterogeneity in neural plasticity remains unknown. Here, in addition to WFA lectin, we used the two monoclonal antibodies Cat315 and Cat316, both of which recognize the glycan structures of aggrecan, to investigate the molecular heterogeneity of PNNs. WFA detected the highest number of PNNs in all cortical layers, whereas Cat315 and Cat316 labeled only a subset of PNNs. WFA+, Cat315+, and Cat316+ PNNs showed different laminar distributions in the adult visual cortex. WFA, Cat315 and Cat316 detected distinct, but partially overlapping, populations of PNNs. Based on the reactivities of these probes, we categorized PNNs into four groups. We found that two subpopulation of PNNs, one with higher and one with lower WFA-staining are differentially labeled by Cat316 and Cat315, respectively. CS chains recognized by Cat316 were diminished in mice deficient in an enzyme involved in the initiation of CS-biosynthesis. Furthermore, WFA+ and Cat316+ aggrecan were spatially segregated and formed microdomains in a single PNN. Otx2 co-localized with Cat316+ but not with WFA+ aggrecan in PNNs. Our results suggest that the heterogeneity of PNNs around PV cells may affect the functional maturation of these cells.

  15. Pathogenic bacteria prime the induction of Toll-like receptor signalling in human colonic cells by the Gal/GalNAc lectin Carbohydrate Recognition Domain of Entamoeba histolytica.

    Science.gov (United States)

    Galván-Moroyoqui, José Manuel; Del Carmen Domínguez-Robles, M; Meza, Isaura

    2011-08-15

    In mixed intestinal infections with Entamoeba histolytica trophozoites and enteropathogenic bacteria, which are wide-spread in areas of endemic amoebiasis, interaction between the pathogens could be an important factor in the occurrence of invasive disease. It has been reported that exposure of human colonic cells to enteropathogenic bacteria increased trophozoite adherence to the cells and their subsequent damage. We report here that the Carbohydrate Recognition Domain (CRD) of the amoebic Gal/GalNAc lectin binds to Toll-like receptors TLR-2 and TLR-4 in human colonic cells, activating the "classic" signalling pathway of these receptors. Activation induced expression of TLR-2 and TLR-4 mRNAs and the mRNAs of pro-inflammatory cytokines, as well as an increase in the corresponding proteins. Direct correlation was observed between the increased expression of TLRs and pro-inflammatory cytokines, the enhanced adhesion of trophozoites to the cells and the inflicted cell damage. When cells were exposed to pathogenic bacteria Staphylococcus aureus (Gram⁺) or Shigella dysenteriae (Gram⁻), elements of an innate immune response were induced. CRD by itself elicited a similar cell response, while exposure to a commensal Escherichia coli had a null effect. Pre-exposure of the cells to pathogenic bacteria and then to CRD rendered an inflammatory-like microenvironment that after addition of trophozoites facilitated greater cell destruction. Our results suggest that CRD is recognised by human colonic cells as a pathogen-associated-molecular-pattern-like molecule and as such can induce the expression of elements of an innate immune response. In the human host, an exacerbated inflammatory environment, derived from pathogen interplay, may be an important factor for development of invasive disease. Copyright © 2011 Australian Society for Parasitology Inc. Published by Elsevier Ltd. All rights reserved.

  16. CD45-mediated signaling pathway is involved in Rhizoctonia bataticola lectin (RBL)-induced proliferation and Th1/Th2 cytokine secretion in human PBMC

    Energy Technology Data Exchange (ETDEWEB)

    Pujari, Radha [National Centre for Cell Science, Ganeshkhind, Pune 411007 (India); Eligar, Sachin M. [Department of Biochemistry, Karnatak University, Dharwad, 580003 Karnataka (India); Kumar, Natesh [National Centre for Cell Science, Ganeshkhind, Pune 411007 (India); Nagre, Nagaraja N.; Inamdar, Shashikala R.; Swamy, Bale M. [Department of Biochemistry, Karnatak University, Dharwad, 580003 Karnataka (India); Shastry, Padma, E-mail: padma@nccs.res.in [National Centre for Cell Science, Ganeshkhind, Pune 411007 (India)

    2012-03-23

    Highlights: Black-Right-Pointing-Pointer RBL, a potent mitogenic and complex N-glycan specific lectin binds to CD45 on PBMC. Black-Right-Pointing-Pointer RBL triggers CD45-mediated signaling involved in activation of p38MAPK and STAT-5. Black-Right-Pointing-Pointer Inhibition of CD45 PTPase signaling blocks RBL-induced ZAP70 phosphorylation. Black-Right-Pointing-Pointer RBL-CD45 mediated signaling is crucial for RBL-induced immunodulatory activities. -- Abstract: We earlier reported the mitogenic and immunostimulatory activities of Rhizoctonia bataticola lectin (RBL), purified from phytopathogenic fungus R. bataticola in human PBMC. The lectin demonstrates specificity towards glycoproteins containing complex N-glycans. Since CD45-protein tyrosine phosphatase that abundantly expresses N-glycans is important in T-cell signaling, the study aimed to investigate the involvement of CD45 in the immunomodulatory activities of RBL. Flowcytometry and confocal microscopy studies revealed that RBL exhibited binding to PBMC and colocalized with CD45. The binding was comparable in cells expressing different CD45 isoforms-RA, -RB and -RO. CD45 blocking antibody reduced the binding and proliferation of PBMC induced by RBL. CD45-PTPase inhibitor dephostatin inhibited RBL-induced proliferation, expression of CD25 and pZAP-70. RBL-induced secretion of Th1/Th2 cytokines were significantly inhibited in presence of dephostatin. Also, dephostatin blocked phosphorylation of p38MAPK and STAT-5 that was crucial for the biological functions of RBL. The study demonstrates the involvement of CD45-mediated signaling in RBL-induced PBMC proliferation and Th1/Th2 cytokine secretion through activation of p38MAPK and STAT-5.

  17. Three-dimensional structure of lectin from Dioclea violacea and comparative vasorelaxant effects with Dioclea rostrata

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, B.A.M.; Bezerra, M.J.B.; Bezerra, G.A.; Alencar, K.L.L.; Nascimento, K.S.; Naganao, C.S.; Sampaio, A.H.; Cavada, B.S. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil); Delatorre, P. [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil); Rodrigues, N.V.; Pires, A.F.; Assreuy, A.M.S. [Universidade Estadual do Ceara (UECE), Fortaleza, CE (Brazil); Marins, J.L. [Universidade Federal de Pelotas (UFPel), Pelotas, RS (Brazil)

    2012-07-01

    Full text: Lectins are a structural heterogeneous group of proteins possessing at least one non-catalytic domain that binds reversibly to a specific mono or oligosaccharide. Diocleinae lectins exhibit glucose/mannose monosaccharide binding specificity and studies of their chemical and physicochemical properties revealed a high degree of identity in their amino acid sequences and three dimensional structures. This study investigated structural/functional relationships between lectins obtained from Dioclea violacea (DVL) and Dioclea rostrata (DRL). The purified lectin (DVL) was solubilized in 20 mM Tris-HCl pH 7.6 with 5 mM CaCl{sub 2} and MnCl{sub 2} buffer and incubated during one hour before the crystallization experiments with the ligand X-Man (5-bromo-4-chloro-3-indolyl-{alpha}-D-mannose) at 3 mM. Crystals of DVL grew in condition 33 of Crystal Screen I (4M Sodium formate) and belong to the orthorhombic space group I222. The structure of DVL at 2.6 resolution was obtained by molecular replacement using the coordinates of DRL (PDB code 2ZBJ), after the last refinement the structure presented R factor of 0.23 and R free of 0.27. The crystal structures reveal differences between them and could be related to relaxant activity. The conformation of residues HIS51, HIS131 and GLU205 and others positioned at CRD lead to different lectin binding activities. In fact, the pocket in DVL is small and deep and promotes weak interaction with carbohydrates, while DRL pocket is large and shallow, allowing strong interaction between CRD and sugars. This can explain why DVL and DRL elicited different degrees of aorta relaxation showing maximal effects of 43 % and 96 %, respectively. (author)

  18. IFN regulatory factor 8 is a key constitutive determinant of the morphological and molecular properties of microglia in the CNS.

    Directory of Open Access Journals (Sweden)

    Carsten Minten

    Full Text Available IFN regulatory factor (IRF 8 is a transcription factor that has a key role in the cellular response to IFN-γ and is pivotal in myeloid cell differentiation. Whether IRF8 plays a role in the development and function of microglia, the tissue-resident myeloid cells of the brain, is unknown. Here, we show IRF8 is a constitutively produced nuclear factor in microglia, which suggested that IRF8 might also be a key homeostatic transcriptional determinant of the microglial cell phenotype. In support of this, in mice with a targeted disruption of the IRF8 gene, microglia were increased in number and showed gross alterations in morphology and surface area. In situ analysis of some key myeloid markers revealed that IRF8-deficient microglia had significantly reduced levels of Iba1, but increased levels of CD206 (mannose receptor and F4/80 as well as increased tomato lectin binding. Analysis of microglia ex vivo revealed IRF8-deficient microglia had significantly increased levels of CD45, CD11b and F4/80, but significantly decreased levels of the chemokine receptors CCR2, CCR5 and CX3CR1. The known involvement of some of these molecular markers in membrane dynamics and phagocytosis led us to examine the phagocytic capacity of cultured IRF8-deficient microglia, however, this was found to be similar to wild type microglia. We conclude IRF8 is a constitutively produced nuclear factor in resident microglia of the CNS being a crucial transcriptional determinant of the phenotype of these cells in the healthy brain.

  19. Multiple Modes of Binding Enhance the Affinity of DC-SIGN for High-Mannose N-Linked Glycans Found on Viral Glycoproteins

    Energy Technology Data Exchange (ETDEWEB)

    Feinberg, H.; Castelli, R.; Drickamer, K.; Seeberger, P.H.; Weis, W.I.; /Stanford U., Med. School /Zurich, ETH /Imperial Coll., London

    2007-07-09

    The dendritic cell surface receptor DC-SIGN and the closely related endothelial cell receptor DC-SIGNR specifically recognize high mannose N-linked carbohydrates on viral pathogens. Previous studies have shown that these receptors bind the outer trimannose branch Man{alpha}1-3[Man{alpha}1-6]Man{alpha} present in high mannose structures. Although the trimannoside binds to DC-SIGN or DC-SIGNR more strongly than mannose, additional affinity enhancements are observed in the presence of one or more Man{alpha}1-2Man{alpha} moieties on the nonreducing termini of oligomannose structures. The molecular basis of this enhancement has been investigated by determining crystal structures of DC-SIGN bound to a synthetic six-mannose fragment of a high mannose N-linked oligosaccharide, Man{alpha}1-2Man{alpha}1-3[Man{alpha}1-2Man{alpha}1-6]Man{alpha}1-6Man and to the disaccharide Man{alpha}1-2Man. The structures reveal mixtures of two binding modes in each case. Each mode features typical C-type lectin binding at the principal Ca{sup 2+}-binding site by one mannose residue. In addition, other sugar residues form contacts unique to each binding mode. These results suggest that the affinity enhancement displayed toward oligosaccharides decorated with the Man{alpha}1-2Man{alpha} structure is due in part to multiple binding modes at the primary Ca{sup 2+} site, which provide both additional contacts and a statistical (entropic) enhancement of binding.

  20. Puncture mechanics of cnidarian cnidocysts: a natural actuator

    Science.gov (United States)

    Oppegard, Shawn C; Anderson, Peter A; Eddington, David T

    2009-01-01

    Background Cnidocysts isolated from cnidarian organisms are attractive as a drug-delivery platform due to their fast, efficient delivery of toxins. The cnidocyst could be utilized as the means to deliver therapeutics in a wearable drug-delivery patch. Cnidocysts have been previously shown to discharge upon stimulation via electrical, mechanical, and chemical pathways. Cnidocysts isolated from the Portuguese Man O' War jellyfish (Physalia physalis) are attractive for this purpose because they possess relatively long threads, are capable of puncturing through hard fish scales, and are stable for years. Results As a first step in using cnidocysts as a functional component of a drug delivery system, the puncture mechanics of the thread were characterized. Tentacle-contained cnidocysts were used as a best-case scenario due to physical immobilization of the cnidocysts within the tentacle. Ex vivo tentacle-contained cnidocysts from Physalia possessed an elastic modulus puncture threshold of approximately 1-2 MPa, based on puncture tests of materials with a gamut of hardness. Also, a method for inducing discharge of isolated cnidocysts was found, utilizing water as the stimulant. Preliminary lectin-binding experiments were performed using fluorophore-conjugated lectins as a possible means to immobilize the isolated cnidocyst capsule, and prevent reorientation upon triggering. Lectins bound homogeneously to the surface of the capsule, suggesting the lectins could be used for cnidocyst immobilization but not orientation. Conclusion Cnidocysts were found to puncture materials up to 1 MPa in hardness, can be discharged in a dry state using water as a stimulant, and bind homogeneously to lectins, a potential means of immobilization. The information gained from this preliminary work will aid in determining the materials and design of the patch that could be used for drug delivery. PMID:19785761