National Research Council Canada - National Science Library
Sharon, Nathan; Lis, H
2003-01-01
... been discovered only during the last decade and the functions of several of which have been clarified, especially as to their key role in innate immunity. Another is the structure of lectins and of their combining sites. Thus, whereas at that time the three-dimensional structures of just three lectins and a few of their complexes with sugars had been elucidated, their numbers have increased to about 160 and over 200, respectively, and continue to grow unabated. Updating the information on these and other topics resulted in...
Ojima, H
1993-04-01
In order to characterize the dendritic field of a number of interneurons in the cerebral cortex, the labeling of extracellular sugar chains which define a subset of interneurons was combined with the subsequent intracellular filling of dyes in aldehyde-fixed tissue. Neurons whose cell body had been outlined by a lectin, Vicia villosa (VVA), which recognizes terminal N-acetylgalactosamine, were intracellularly injected with a fluorescent tracer, Lucifer yellow (LY), in the rat parietal cortex under direct visualization. After immunohistochemical detection of LY, somal morphology and the dendritic fields of injected neurons were reconstructed from serial sections and characterized in each of the layers II/III, IV, V and VI. Multipolar, flask-shaped and bitufted somata were VVA-positive. Multipolar neurons with round soma and spherical dendritic field were found in layers II/III, IV and V, while those with vertically elongated dendritic fields were found in layer VI. Cell bodies were located roughly in the center of the spherical or cylindrical dendritic fields. Neurons with apparently multipolar but flask- or pear-shaped soma were found frequently in layer IV, and much less frequently in layer II/III and VI. The majority of the dendrites originated from the neck portion of flask and formed a roughly spherical dendritic field with the cell body located more or less eccentrically. Some neurons in layer IV had an oval, somewhat vertically elongated soma and displayed a typical bitufted dendritic arborization pattern with vertically elongated dendritic fields. The overall dendritic field sizes of the cells gradually increased at deeper layers of the cortex.(ABSTRACT TRUNCATED AT 250 WORDS)
Compositional gradients in Gramineae genes
DEFF Research Database (Denmark)
Wong, Gane Ka-Shu; Wang, Jun; Tao, Lin
2002-01-01
In this study, we describe a property of Gramineae genes, and perhaps all monocot genes, that is not observed in eudicot genes. Along the direction of transcription, beginning at the junction of the 5'-UTR and the coding region, there are gradients in GC content, codon usage, and amino-acid usage...
Lectin cDNA and transgenic plants derived therefrom
Raikhel, Natasha V.
1994-01-04
Transgenic plants containing cDNA encoding Gramineae lectin are described. The plants preferably contain cDNA coding for barley lectin and store the lectin in the leaves. The transgenic plants, particularly the leaves exhibit insecticidal and fungicidal properties. GOVERNMENT RIGHTS This application was funded under Department of Energy Contract DE-AC02-76ER01338. The U.S. Government has certain rights under this application and any patent issuing thereon.
African Journals Online (AJOL)
user
2011-02-07
Feb 7, 2011 ... Haciseferogullari H, Gezer I, Bahtiyarca Y, Menges HO (2003). Determination of some chemical and physical properties of sakis faba bean (Vicia faba L. var. major). J. Food .Eng. 60: 475-479. Hanelt P, Mettin D (1989). Biosystematics of the Genus vicia L. (Leguminosae). Annu. Rev. Ecol. Syst. 20: 199-223.
7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).
2010-01-01
... family, Poaceae (Gramineae). Kinds of seed: Bentgrasses, bluegrasses, bluestems, bromes, cereals, fescues... 7 Agriculture 3 2010-01-01 2010-01-01 false Grass family, Poaceae (Gramineae). 201.56-5 Section... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED...
African Journals Online (AJOL)
Buzayehu
Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of ..... of the isolates were utilized all amino acids sources.
Barbieri, L; Lorenzoni, E; Stirpe, F
1979-08-15
Protein synthesis by a rabbit reticulocyte lysate is inhibited by the haemagglutinating lectins from Momordica charantia and Crotalaria juncea seeds and from the roe of Rutilus rutilus, and by a commercial preparation of the mitogenic lectin from Phytolacca americana. The haemagglutinins from the seeds of Ricinus communis and of Vicia cracca acquired inhibitory activity after their reduction with 2-mercaptoethanol.
A revision of Oryza (Gramineae) in Malesia and Australia
Duistermaat, Helena
1987-01-01
In Malesia and Australia there are nine species of Oryza L. (Gramineae). Oryza meyeriana (Zoll. & Mor.) Baillon has two varieties. Oryza schlechteri Pilg. is only known from Irian Jaya (Indonesian New Guinea). Oryza australiensis Dom. and O. meridionalis Ng are endemic to Australia. The numerous
Yamashita, Keishi; Kuno, Atsushi; Matsuda, Atsushi; Ikehata, Yuzuru; Katada, Natsuya; Hirabayashi, Jun; Narimatsu, Hisashi; Watanabe, Masahiko
2016-04-01
Although various molecular profiling technologies have the potential to predict specific tumor phenotypes, the comprehensive profiling of lectin-bound glycans in human cancer tissues has not yet been achieved. We examined 242 advanced gastric cancer (AGC) patients without or with lymph node metastasis-N0 (n = 62) or N+ (n = 180)-by lectin microarray, and identified the specific lectins highly associated with AGC phenotypes. In seven gastric cancer cell lines, in contrast to expressed-in-cancer lectins, not-expressed-in-cancer (NEC) lectins were tentatively designated by lectin microarray. Binding signals of the specific lectins were robustly reduced in AGC patients with N+ status as compared with those with N0 status. The receiver operating characteristic curve determined the optimal cutoff value to differentiate N0 status from N+ status, and subsequent profiling of NEC lectins identified Vicia villosa agglutinin (VVA) association with the significant other lectins involved in lymph node metastasis. VVA reaction was clearly found on cancer cells, suggesting that it may result from carcinoma-stroma interaction in primary AGC, because VVA is an NEC lectin. Most intriguingly, VVA reaction was remarkably attenuated in the tumor cells of the metastatic lymph nodes, even if it was recognized in primary AGC. In AGC, histological type was strongly associated with soybean agglutinin and Bauhinia purpurea lectin, whereas p53 mutation was the best correlated with Griffonia simplicifolia lectin II. Lectin microarrays can be used to very accurately quantify the reaction of glycans with tumor tissues, and such profiles may represent the specific phenotypes, including N+ status, histological type, or p53 mutation of AGC.
DEFF Research Database (Denmark)
Hansen, J E; Nielsen, C M; Nielsen, C
1989-01-01
The binding of 13 different lectins to gp120 partially purified from two HIV-1 isolates and one HIV-2 isolate was studied by in situ staining on electrophoretically separated and electroblotted HIV antigens. The lectins concanavalin A, wheat germ agglutinin, Lens culinaris agglutinin, Vicia faba...
Are Vicilins Another Major Class of Legume Lectins?
Directory of Open Access Journals (Sweden)
Ana C. Ribeiro
2014-12-01
Full Text Available Legume lectins comprise a structurally related, Ca/Mn-dependent, widespread, abundant and well characterized lectin family when compared to the large number of lectins from other sources described in the literature. Strangely enough, no specific function has been assigned to them aside from a possible role in storage and/or defense. Using a recent and fine-tuned methodology capable of specific lectin identification, β-conglutin, Vicia faba vicilin and β-lathyrin, the vicilin storage globulins from Lupinus albus, V. faba and Lathyrus sativus, respectively, were shown to be capable of affinity binding to thoroughly washed erythrocyte membranes and of specific elution with appropriate sugars. Based on this evidence and on sparse data published in the literature, a second family of legume lectins is proposed: the 7S family of storage proteins from leguminous seeds, or family II of legume lectins. These lectins are also structurally related, widespread and well characterized. In addition, they self-aggregate in a Ca/Mg, electrostatic dependent manner and are even more abundant than the family I of legume lectins. Using the same evidence, reserve and defense roles may be attributed to family II of legume lectins.
Lectins discriminate between pathogenic and nonpathogenic South American trypanosomes
Energy Technology Data Exchange (ETDEWEB)
de Miranda Santos, I.K.; Pereira, M.E.
1984-09-01
Cell surface carbohydrates of Trypanosoma cruzi, Trypanosoma rangeli, and Trypanosoma conorhini were analyzed by a micro-agglutination assay employing 27 highly purified lectins and by binding assays using various /sup 125/I-labeled lectins. The following seven lectins discriminated between the trypanosomes: 1) tomato lectin (an N-acetyl-D-glucosamine-binding protein), both in purified form and as crude tomato juice; 2) Bauhinea purpurea and Sophora japonica lectins (both N-acetyl-D-galactosamine-binding proteins), which selectively agglutinated T. cruzi; 3) Vicia villosa (an N-acetyl-D-galactosamine-binding protein) which was specific for T. rangeli; 4) peanut lectin (a D-galactose-binding protein) both in purified form and as crude saline extract; and 5) Ulex europaeus and Lotus tetragonolobus (both L-fucose-binding proteins) lectins which reacted only with T. conorhini. Binding studies with 125I-labeled lectins were performed to find whether unagglutinated cells of the three different species of trypanosomes might have receptors for these lectins, in which case absence of agglutination could be due to a peculiar arrangement of the receptors. These assays essentially confirmed the agglutination experiments.
Hierochloë repens (Host Simonk. (Gramineae in Serbia
Directory of Open Access Journals (Sweden)
Perić Ranko
2017-04-01
Full Text Available During a field study of steppic flora and vegetation conducted on the [Veliki] Rimski Šanac in the vicinity of Gospođinci and on the Deliblato Sands (Serbia: Vojvodina Province, we found Hierochloë repens, a Eurasian species from the family Gramineae that is autochthonous on the Pannonian Plain as well and was for a long time neglected in the flora of Serbia. After examination of herbarium specimens from Serbia belonging to the H. odorata complex, we conclude that the only member of the complex present in Serbia is H. repens, which was formerly misinterpreted as H. odorata s.str.
Reactivities of N-acetylgalactosamine-specific lectins with human IgA1 proteins
DEFF Research Database (Denmark)
Moore, J.S.; Kulhavy, R.; Tomana, M.
2007-01-01
of IgA1 and, as controls, IgA2 and IgG myeloma proteins. These lectins originated from snails Helix aspersa (HAA) and Helix pomatia (HPA), and the plant Vicia villosa (VV). Only HAA and HPA bound exclusively to IgA1, with its O-linked glycans composed of GalNAc, galactose, and sialic acid. In contrast...
Lectins identify distinct populations of coelomocytes in Strongylocentrotus purpuratus.
Directory of Open Access Journals (Sweden)
Wen-Yun Liao
Full Text Available Coelomocytes represent the immune cells of echinoderms, but detailed knowledge about their roles during immune responses is very limited. One major challenge for studying coelomocyte biology is the lack of reagents to identify and purify distinct populations defined by objective molecular markers rather than by morphology-based classifications that are subjective at times. Glycosylation patterns are known to differ significantly between cell types in vertebrates, and furthermore they can vary depending on the developmental stage and activation states within a given lineage. Thus fluorescently labeled lectins that recognize distinct glycan structures on cell surface proteins are routinely used to identify discrete cell populations in the vertebrate immune system. Here we now employed a panel of fifteen fluorescently-labeled lectins to determine differences in the glycosylation features on the surface of Strongylocentrotus purpuratus coelomocytes by fluorescence microscopy and flow cytometry. Eight of the lectins (succinylated wheat germ agglutinin, Len culinaris lectin, Pisum sativum agglutinin, Saphora japonica agglutinin, Solanum tuberosum lectin, Lycopersicon esculentum lectin, Datura stramonium lectin, Vicia villosa lectin showed distinct binding patterns to fixed and live cells of three major coelomocyte classes: phagocytic cells, red spherule cells, and vibratile cells. Importantly, almost all lectins bound only to a subgroup of cells within each cell type. Lastly, we established fluorescently-labeled lectin-based fluorescence activated cell sorting as a strategy to purify distinct S. purpuratus coelomocyte (sub-populations based on molecular markers. We anticipate that this will become a routine approach in future studies focused on dissecting the roles of different coelomocytes in echinoderm immunity.
High level of microsynteny and purifying selection affect the evolution of WRKY family in Gramineae.
Jin, Jing; Kong, Jingjing; Qiu, Jianle; Zhu, Huasheng; Peng, Yuancheng; Jiang, Haiyang
2016-01-01
The WRKY gene family, which encodes proteins in the regulation processes of diverse developmental stages, is one of the largest families of transcription factors in higher plants. In this study, by searching for interspecies gene colinearity (microsynteny) and dating the age distributions of duplicated genes, we found 35 chromosomal segments of subgroup I genes of WRKY family (WRKY I) in four Gramineae species (Brachypodium, rice, sorghum, and maize) formed eight orthologous groups. After a stepwise gene-by-gene reciprocal comparison of all the protein sequences in the WRKY I gene flanking areas, highly conserved regions of microsynteny were found in the four Gramineae species. Most gene pairs showed conserved orientation within syntenic genome regions. Furthermore, tandem duplication events played the leading role in gene expansion. Eventually, environmental selection pressure analysis indicated strong purifying selection for the WRKY I genes in Gramineae, which may have been followed by gene loss and rearrangement. The results presented in this study provide basic information of Gramineae WRKY I genes and form the foundation for future functional studies of these genes. High level of microsynteny in the four grass species provides further evidence that a large-scale genome duplication event predated speciation.
A revision of Themeda (Gramineae) in Malesia with a new species from Laos
Veldkamp, J.F.
2016-01-01
Themeda Forssk. (Gramineae) has 11 taxa in Malesia. A revision is provided with keys, synonymy, where necessary lectotypifications, descriptions, and notes. Themeda gigantea nearly is a Philippine endemic, but with a single collection from Halmahera, and one as far away as the Solomon Islands.
Lectin typing of Campylobacter concisus
DEFF Research Database (Denmark)
Aabenhus, Rune Munck; Hynes, Sean O; Permin, Henrik
2002-01-01
A total of 44 clinical isolates and the type strain of the putative pathogen Campylobacter concisus were grouped based on their reactions with plant lectins. The optimized lectin typing system used C. concisus strains proteolytically pretreated and subsequently typed by using a panel of four...... lectins. The system grouped all 45 strains into 13 lectin reaction patterns, leaving no strain untypeable due to autoagglutination. Lectin types were both stable and reproducible....
( Vicia peregrina ) seed as protein source for mirror carp ( Cyprinus ...
African Journals Online (AJOL)
An 80-day feeding trial was conducted in a recirculation system aquarium operating at 26 ± 0.3 °C, to evaluate the nutritive value of Vicia peregrina seed as a possible protein source in the diet of mirror carp (Cyprinus carpio) fingerlings. Vicia peregrina seed was included in the diets at different levels, viz. 100, 200, 300 g ...
[Photosystem II characteristics of nine Gramineae species in southern Taklamakan Desert].
Li, Lei; Li, Xiang-yi; Lin, Li-sha; Wang, Ying-ju; Xue, Wei
2011-10-01
Taking the Gramineae species Elytrigia intermedia, Avena sativa, Bromus inermis, Elymus sibiricus, Leymus tianschanicus, Elymus dahuricus, Festuca elata, Agropyron cristatum, and Puccinellia distans at the edge of Cele Oasis in southern Taklimakan Desert as test objects, this paper monitored their fast chlorophyll fluorescence kinetics after 20 minutes adaptation in darkness, compared their photosystem II (PS II) characteristics, and analyzed their adaptability to the local environment. Among the nine Gramineae species, L. tianschanicus and E. dahuricus had markedly higher values of maximum fluorescence yield (F(m)), maximum photochemical efficiency of PS II (F(v)/F(m)), and active reaction centers per cross-section (RC/CS0), but lower values of minimum fluorescence yield (F0), absorption flux per reaction center (ABC/RC), maximal trapping flux per reaction center (TR0/RC), flux of dissipated excitation energy per reaction center (DI0/RC), and initial slope of fluorescence intensity (M0), as compared to F. elata, A. cristatum, and P. distans, whereas E. intermedia, A. sativa, B. inermis, and E. sibiricus had a medium level of the values. These results suggested that all the test pasture species were suffered from the severe environmental conditions of Cele Oasis to some extent, as indicated by the inactivation of PS II reaction center and the depression of electron transport chain. L. tianschanicus and E. dahuricus were least impacted, while F. elata, A. cristatum, and P. distans were most impacted.
Kerketze, K; Blaschuk, O W; Farookhi, R
1996-07-01
The hormone-mediated maturation of ovarian follicles is apparently accompanied by position-specific differentiation of cells of the membrana granulosa. We have assessed the extent of this cellular heterogeneity by flow cytometry using a variety of fluorescein isothiocyanate-labeled lectins as probes. Follicular development was stimulated in immature rats by treatment with either diethylstilbestrol (DES) or equine CG (eCG). Lectin binding to monodispersed rat granulosa cells was then analyzed by flow cytometry. Our results demonstrate that there are two distinct populations of small (4-7 microM) and large (9-12 microM) granulosa cells in follicles from DES- and eCG-treated animals. Both populations appear to be mitotically active and show specific lectin-binding characteristics. Six lectins (canavalia ensiforms, triticum vulgaris, maclura pomifera, erythrina cristagalli, jacalin, and vicia villosa) bind equally to both small and large granulosa cells from the DES- and eCG-treated rats. In contrast, no binding to either cell population was detected with six other lectins (dolichos biflorus, griffonia simplicifolia-II, lycopersicon esculentum, datura stramonium, solanum tuberosum, and ulex europaeus). Furthermore, four galactose-binding lectins (bauhinia purpurea, glysine maximus, griffonia simplicifolia-I, and arachis hypogaea) were found to identify specific subsets of granulosa cells. Three of these lectins (bauhinia purpurea, glysine maximus, and griffonia simplicifolia-I) bind to only small granulosa cells from either DES- or eCG- treated immature rats. The fourth lectin (arachis hypogaea) identifies subpopulations of both small and large granulosa cells. Application of the four galactose-specific lectins to fixed sections of frozen ovaries demonstrated binding to the perioocyte and cumulus granulosa cells. We conclude that cellular heterogeneity exists within the follicular epithelium at various stages-specific lectin-binding sites.
DEFF Research Database (Denmark)
Hansen, J E; Nielsen, C M; Nielsen, C
1989-01-01
agglutinin, Pisum sativum agglutinin and phytohaem(erythro)agglutinin bound to gp120 of all three isolates. The carbohydrate of gp120 recognized by lectins was thus arranged in at least four types of glycans: a high mannose type glycan, a bisected hybrid or complex type glycan, a biantennary fucosylated...... complex type glycan and a triantennary bisected complex type glycan. Only lectins which bound at least one of the four types of glycans were capable of inhibiting fusion of HIV-infected cells with CD4 cells by a carbohydrate-specific interaction with the HIV-infected cells. Thus, several different glycan......The binding of 13 different lectins to gp120 partially purified from two HIV-1 isolates and one HIV-2 isolate was studied by in situ staining on electrophoretically separated and electroblotted HIV antigens. The lectins concanavalin A, wheat germ agglutinin, Lens culinaris agglutinin, Vicia faba...
Variations of Leaf Cuticular Waxes Among C3 and C4 Gramineae Herbs.
He, Yuji; Gao, Jianhua; Guo, Na; Guo, Yanjun
2016-11-01
Modern C4 plants are commonly distributed in hot and dry environments whereas C3 plants predominate in cool and shade areas. At the outmost of plant surface, the deposition and chemical composition of cuticular waxes vary under different environmental conditions. However, whether such variation of cuticular wax is related to the distribution of C3 and C4 under different environmental conditions is still not clear. In this study, leaves of six C3 Gramineae herbs distributed in spring, Roegneria kamoji, Polypogon fugax, Poa annua, Avena fatua, Alopecurus aequalis, and Oplismenus undulatifolius, and four C4 and one C3 Gramineae herbs distributed in summer, Digitaria sanguinalis, Eleusine indica, Setaria viridis, S. plicata, and O. undulatifolius, were sampled and analyzed for cuticular wax. Plates were the main epicuticular wax morphology in both C3 and C4 plants except S. plicata. The plates melted in C4 plants but not in C3 plants. The total cuticular wax amounts in C4 plants were significantly lower than those in C3 plants, except for O. undulatifolius. Primary alcohols were the most abundant compounds in C3 plants, whereas n-alkanes were relatively the most abundant compounds in C4 plants. C29 was the most abundant n-alkane in C3 plants except for O. undulatifolius, whereas the most abundant n-alkane was C31 or C33 in C4 plants. The average chain length (ACL) of n-alkanes was higher in C4 than in C3 plants, whereas the ACL of n-alkanoic acids was higher in C3 than C4 plants. The cluster analysis based on the distribution of n-alkanes clearly distinguished C3 and C4 plants into two groups, except for O. undulatifolius which was grouped with C4 plants. These results suggest that the variations of cuticular waxes among C3 and C4 Gramineae herbs are related to the distribution of C3 and C4 plants under different environmental conditions. © 2016 Wiley-VHCA AG, Zurich, Switzerland.
Lectins with Anti-HIV Activity: A Review
Directory of Open Access Journals (Sweden)
Ouafae Akkouh
2015-01-01
Full Text Available Lectins including flowering plant lectins, algal lectins, cyanobacterial lectins, actinomycete lectin, worm lectins, and the nonpeptidic lectin mimics pradimicins and benanomicins, exhibit anti-HIV activity. The anti-HIV plant lectins include Artocarpus heterophyllus (jacalin lectin, concanavalin A, Galanthus nivalis (snowdrop agglutinin-related lectins, Musa acuminata (banana lectin, Myrianthus holstii lectin, Narcissus pseudonarcissus lectin, and Urtica diocia agglutinin. The anti-HIV algal lectins comprise Boodlea coacta lectin, Griffithsin, Oscillatoria agardhii agglutinin. The anti-HIV cyanobacterial lectins are cyanovirin-N, scytovirin, Microcystis viridis lectin, and microvirin. Actinohivin is an anti-HIV actinomycete lectin. The anti-HIV worm lectins include Chaetopterus variopedatus polychaete marine worm lectin, Serpula vermicularis sea worm lectin, and C-type lectin Mermaid from nematode (Laxus oneistus. The anti-HIV nonpeptidic lectin mimics comprise pradimicins and benanomicins. Their anti-HIV mechanisms are discussed.
Van der Poel, A F; Dellaert, L M; Van Norel, A; Helsper, J P
1992-11-01
Seed samples from two near-isogenic faba bean (Vicia faba L.) lines were examined for the levels of so-called anti-nutritional factors (ANF). From the ANF known to be present in faba beans, trypsin inhibitor activity, functional lectins, condensed tannins and pyrimidine glycosides were analysed. It was concluded that the lines differed only in the content of condensed tannins being 0.05). A multienzyme technique was used to predict the in vitro protein digestibility (IVPD) of the two lines. The IVPD of the LT line was 0.965 and about 0.05 higher than the HT line, confirming the difference in digestibility as measured in vivo. The present study shows the positive effects on digestibility of removal of condensed tannins in faba beans which was achieved by plant breeding.
Directory of Open Access Journals (Sweden)
Neculai Dragomir
2010-10-01
Full Text Available This work presents the potential and real seed producing capacity in some Romanian varieties of legumes and perennial gramineae: Trifolium repens, Lotus corniculatus, Lolium perenne, Festuca pratensis, Festuca arundinacea and Dactylis glomerata. To calculate the potential production, we performed determinations and analyses on each variety, regarding floral apparatus’ morphological and anatomic structure (number of inflorescences, number of flowers, number of ovules/ovary, and the real production was determined „in situ”.
Lectins from Mycelia of Basidiomycetes
Directory of Open Access Journals (Sweden)
Valentina E. Nikitina
2017-06-01
Full Text Available Lectins are proteins of a nonimmunoglobulin nature that are capable of specific recognition of and reversible binding to the carbohydrate moieties of complex carbohydrates, without altering the covalent structure of any of the recognized glycosyl ligands. They have a broad range of biological activities important for the functioning of the cell and the whole organism and, owing to the high specificity of reversible binding to carbohydrates, are valuable tools used widely in biology and medicine. Lectins can be produced by many living organisms, including basidiomycetes. Whereas lectins from the fruit bodies of basidiomycetes have been studied sufficiently well, mycelial lectins remain relatively unexplored. Here, we review and comparatively analyze what is currently known about lectins isolated from the vegetative mycelium of macrobasidiomycetes, including their localization, properties, and carbohydrate specificities. Particular attention is given to the physiological role of mycelial lectins in fungal growth and development.
The lectin pathway of complement
DEFF Research Database (Denmark)
Ballegaard, Vibe Cecilie Diederich; Haugaard, Anna Karen; Garred, P
2014-01-01
The pattern recognition molecules of the lectin complement pathway are important components of the innate immune system with known functions in host-virus interactions. This paper summarizes current knowledge of how these intriguing molecules, including mannose-binding lectin (MBL), Ficolin-1, -2...
In vitro plant regeneration from Turkish Narbon Vetch (Vicia ...
African Journals Online (AJOL)
STORAGESEVER
2009-02-18
Feb 18, 2009 ... containing peat moss and acclimatized in the greenhouse. Acclimatization was done by covering pots with polyethylene bags to maintain initial humidity for 1 .... Vicia L. In Davis PH (Ed.), Flora of Turkey and the East Aegean Islands. Edinburgh, Edinburgh University Press. 3: 274-325. Diallo MS, Ndiaye A, ...
In vitro plant regeneration from Narbon Vetch ( Vicia narbonensis L ...
African Journals Online (AJOL)
Narbon vetch (Vicia narbonensis L.) is an agriculturally important forage plant that widely grows in an area extending from Central Europe to various parts of Asia. The study reports axillary shoot regeneration from cotyledonary node explants obtained from, in vitro raised seeds of 4 - 5 and 14 - 15 days old seedlings on MS ...
Chemical composition and in vitro gas production of vetch ( Vicia ...
African Journals Online (AJOL)
Chemical composition and in vitro gas production of vetch (Vicia sativa) and some browse and grass species from northern Ethiopia were investigated. Vetch (fresh cut) was sampled in September and vetch hay samples were taken in October both during the early dry period. Samples of the browse and grass species were ...
In vitro plant regeneration from Turkish Narbon Vetch ( Vicia ...
African Journals Online (AJOL)
Narbon vetch (Vicia narbonensis L.) is an important forage species among vetches of central Europe, Mediterranean, Near East, Ethiopia, central Asia and India. The study reports in vitro micropropagation of narbon vetch using cotyledon node, shoot tip and zygotic embryo explants on MS medium containing 0.25, 0.50, ...
Lectin binding profiles of SSEA-4 enriched, pluripotent human embryonic stem cell surfaces
Directory of Open Access Journals (Sweden)
Shin Soojung
2005-07-01
Full Text Available Abstract Background Pluripotent human embryonic stem cells (hESCs have the potential to form every cell type in the body. These cells must be appropriately characterized prior to differentiation studies or when defining characteristics of the pluripotent state. Some developmentally regulated cell surface antigens identified by monoclonal antibodies in a variety of species and stem cell types have proven to be side chains of membrane glycolipids and glycoproteins. Therefore, to examine hESC surfaces for other potential pluripotent markers, we used a panel of 14 lectins, which were chosen based on their specificity for a variety of carbohydrates and carbohydrate linkages, along with stage specific embryonic antigen-4 (SSEA-4, to determine binding quantitation by flow cytometry and binding localization in adherent colonies by immunocytochemistry. Results Enriching cells for SSEA-4 expression increased the percentage of SSEA-4 positive cells to 98–99%. Using enriched high SSEA-4-expressing hESCs, we then analyzed the binding percentages of selected lectins and found a large variation in binding percentages ranging from 4% to 99% binding. Lycopersicon (tomatoesculetum lectin (TL, Ricinus communis agglutinin (RCA, and Concanavalin A (Con A bound to SSEA-4 positive regions of hESCs and with similar binding percentages as SSEA-4. In contrast, we found Dolichos biflorus agglutinin (DBA and Lotus tetragonolobus lectin (LTL did not bind to hESCs while Phaseolus vulgaris leuco-agglutinin (PHA-L, Vicia villosa agglutinin (VVA, Ulex europaeus agglutinin (UEA, Phaseolus vulgaris erythro-agglutinin (PHA-E, and Maackia amurensis agglutinin (MAA bound partially to hESCs. These binding percentages correlated well with immunocytochemistry results. Conclusion Our results provide information about types of carbohydrates and carbohydrate linkages found on pluripotent hESC surfaces. We propose that TL, RCA and Con A may be used as markers that are associated with the
Use of lectins in immunohematology
Directory of Open Access Journals (Sweden)
Ajit C Gorakshakar
2016-01-01
Full Text Available Lectins are carbohydrate binding proteins present in seeds of many plants, especially corals and beans, in fungi and bacteria, and in animals. Apart from their hemagglutinating property, a wide range of functions have been attributed to them. Their importance in the area of immunohematology is immense. They are used to detect specific red cell antigens, to activate different types of lymphocytes, in order to resolve problems related to polyagglutination and so on. The introduction of advanced biotechnological tools generates new opportunities to exploit the properties of lectins, which were not used earlier. Stem cell research is a very important area in transplant medicine. Certain lectins detect surface markers of stem cell. Hence, they are used to understand the developmental biology of stem cells. The role of various lectins in the areas of transfusion and transplant medicine is discussed in detail in this review.
Lectin binding by trypanosoma equiperdum.
Jackson, P R
1977-02-01
Agglutination studies with 6 plant lectins indicated that the unaltered surface coat of Trypanosoma equiperdum isolated from rat blood lacks the carbohydrate molecules preferentially bound by these proteins. However, trypsin, pronase, chymopapain, or papain treatments exposed the binding sites for Concanavalin A and the phytohemagglutinins M and P and trypsinized cells were attached to Concanavalin A immobilized on agarose beads. Lipolytic, amylytic, and other proteolytic enzymes or other agents did not reduce or induce lectin agglutination and wheat germ, Anti A, and Anti H lectins did not clump the trypanosomes under any of the conditions employed. Carbohydrate residues resembling D-mannose or n-acetyl-D-galactosamine are therefore within the surface coat of T. equiperdum or on the cell membrane underneath it. The results are contrasted with the lectin induced agglutination of other parasite species and mammalian cells.
Lectins in human pathogenic fungi.
Gallegos, Belém; Martínez, Ruth; Pérez, Laura; Del Socorro Pina, María; Perez, Eduardo; Hernández, Pedro
2014-01-01
Lectins are carbohydrate-binding proteins widely distributed in nature. They constitute a highly diverse group of proteins consisting of many different protein families that are, in general, structurally unrelated. In the last few years, mushroom and other fungal lectins have attracted wide attention due to their antitumour, antiproliferative and immunomodulatory activities. The present mini-review provides concise information about recent developments in understanding lectins from human pathogenic fungi. A bibliographic search was performed in the Science Direct and PubMed databases, using the following keywords "lectin", "fungi", "human" and "pathogenic". Lectins present in fungi have been classified; however, the role played by lectins derived from human pathogenic fungi in infectious processes remains uncertain; thus, this is a scientific field requiring more research. This manuscript is part of the series of works presented at the "V International Workshop: Molecular genetic approaches to the study of human pathogenic fungi" (Oaxaca, Mexico, 2012). Copyright © 2013 Revista Iberoamericana de Micología. Published by Elsevier Espana. All rights reserved.
Nutritional response of growing rats to faba beans (Vicia faba L., minor) and faba bean fractions.
Rubio, L A; Grant, G; Bardocz, S; Dewey, P; Pusztai, A
1991-11-01
The effects of raw faba bean (Vicia faba L., minor) meal (VFM) and its fractions on the growth and nitrogen utilization of rats have been determined in two experiments. Two commercial varieties of VFM were tested, local VFM (409-439 g/kg diet) and Troy VFM (439 g/kg diet). The bean fractions tested were V. faba lectin-depleted protein (VFDP), V. faba lectin (VFL) and V. faba cotyledon residue (VFCR). All diets were supplemented with amino acids to target requirements. Body-weight, body N and lipid contents of rats fed on VFM were reduced significantly in comparison with control rats fed on lactalbumin. This was due, in part, to the lower digestibility of the protein, lipid and dry matter (DM) of VFM diets. As a result, net protein utilization (NPU) and biological value (BV) of faba bean proteins were less than expected. Urine and urea-N outputs of the VFM-fed rats were also elevated in both experiments. Increasing the energy content of local VFM diets led to significantly higher dry body-weight, body N and lipid contents, with the result that the NPU and BV values of the protein also increased. However, the NPU values for VFM-fed rats were still significantly lower than those for the controls in both experiments. In contrast, true N, lipid and DM digestibilities in rats given local VFM were not significantly affected by the difference in the energy content of the diets. The replacement of two-thirds of the lactalbumin in the diet with VFDP (65 g/kg) reduced dry body-weight, N and lipid contents, NPU and BV compared with the control rats, even though N, lipid and DM digestibilities were not significantly different. The nutritional performance of rats fed on lactalbumin-based diets containing 7 g VFL/kg was similar to that of the controls. Similarly, the inclusion of the cotyledon residue (237 g VFCR/kg diet) had no appreciable effect on any of the variables studied. As VFL and VFCR had no antinutritional effects in these rats, it appears that the low nutritional
Korourian, Soheila; Siegel, Eric; Kieber-Emmons, Thomas; Monzavi-Karbassi, Behjatolah
2008-01-01
Background The number of breast cancer patients diagnosed with ductal carcinoma in situ (DCIS) continues to grow. Laboratory and clinical data indicate that DCIS can progress to invasive disease. Carbohydrate-mediated cell-cell adhesion and tumor-stroma interaction play crucial roles in tumorigenesis and tumor aggressive behavior. Breast carcinogenesis may reflect quantitative as well as qualitative changes in oligosaccharide expression, which may provide a useful tool for early detection of breast cancer. Because tumor-associated carbohydrate antigens (TACA) are implicated in tumor invasion and metastasis, the purpose of this study was to assess the expression of selected TACA by lectin histochemistry on DCIS specimens from the archival breast cancer tissue array bank of the University of Arkansas for Medical Sciences. Methods For detection of TACA expression, specimens were stained with Griffonia simplicifolia lectin-I (GS-I) and Vicia vilosa agglutinin (VVA). We studied associations of lectin reactivity with established prognostic factors, such as tumor size, tumor nuclear grade, and expression of Her-2/neu, p53 mutant and estrogen and progesterone receptors. Results We observed that both lectins showed significant associations with nuclear grade of DCIS. DCIS specimens with nuclear grades II and III showed significantly more intense reactivity than DCIS cases with nuclear grade I to GS-1 (Mean-score chi-square = 17.60, DF = 2; P = 0.0002) and VVA (Mean-score chi-square = 15.72, DF = 2; P = 0.0004). Conclusion The results suggest that the expression of VVA- and GS-I-reactive carbohydrate antigens may contribute to forming higher grade DCIS and increase the recurrence risk. PMID:18479514
Directory of Open Access Journals (Sweden)
Kieber-Emmons Thomas
2008-05-01
Full Text Available Abstract Background The number of breast cancer patients diagnosed with ductal carcinoma in situ (DCIS continues to grow. Laboratory and clinical data indicate that DCIS can progress to invasive disease. Carbohydrate-mediated cell-cell adhesion and tumor-stroma interaction play crucial roles in tumorigenesis and tumor aggressive behavior. Breast carcinogenesis may reflect quantitative as well as qualitative changes in oligosaccharide expression, which may provide a useful tool for early detection of breast cancer. Because tumor-associated carbohydrate antigens (TACA are implicated in tumor invasion and metastasis, the purpose of this study was to assess the expression of selected TACA by lectin histochemistry on DCIS specimens from the archival breast cancer tissue array bank of the University of Arkansas for Medical Sciences. Methods For detection of TACA expression, specimens were stained with Griffonia simplicifolia lectin-I (GS-I and Vicia vilosa agglutinin (VVA. We studied associations of lectin reactivity with established prognostic factors, such as tumor size, tumor nuclear grade, and expression of Her-2/neu, p53 mutant and estrogen and progesterone receptors. Results We observed that both lectins showed significant associations with nuclear grade of DCIS. DCIS specimens with nuclear grades II and III showed significantly more intense reactivity than DCIS cases with nuclear grade I to GS-1 (Mean-score chi-square = 17.60, DF = 2; P = 0.0002 and VVA (Mean-score chi-square = 15.72, DF = 2; P = 0.0004. Conclusion The results suggest that the expression of VVA- and GS-I-reactive carbohydrate antigens may contribute to forming higher grade DCIS and increase the recurrence risk.
Lectin-probed western blot analysis.
Sato, Takeshi
2014-01-01
Lectin-probed western blot analysis, the so-called lectin blot analysis, is a useful method to yield basic information on the glycan structures of glycoproteins, based on the carbohydrate-binding specificities of lectins. By lectin blot analysis, researchers can directly analyze the glycan structures without releasing the glycans from glycoproteins. Here, the author describes protocols for standard analysis, and applies analysis in combination with glycosidase digestion of blot.
Purification of the lectin from Datura stramonium.
Kilpatrick, D C; Yeoman, M M
1978-01-01
The lectin from Datura stramonium can be inhibited by oligomers of N-acetylglucosamine. This property was exploited to purify the lectin by affinity chromatography on Sepharosefetuin. The purified lectin is a glycoprotein in having subunits of 40 000 and 45 000 mol.wt. PMID:743232
Improvement of faba bean ( Vicia faba L .) yield and quality through ...
African Journals Online (AJOL)
Improvement of faba bean ( Vicia faba L .) yield and quality through biotechnological approach: A review. ... yield and quality. This review work examines the role of various techniques with reference to faba bean improvement. Key words: Vicia faba, faba bean, grain quality, resistance breeding, nitrogen fixation, zero tannin.
Vicia vulcanorum (Fabaceae a new species from the island of Lanzarote (Canary Islands
Directory of Open Access Journals (Sweden)
Morales-Mateos, J. B.
2012-12-01
Full Text Available Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, a new species of subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. is described and illustrated from the island of Lanzarote, Canary Islands, north-west of Africa. It is related to and compared with Vicia cirrhosa C. Sm. ex Webb & Berthel. and Vicia filicaulis Webb & Berthel., two endemic species from the western and central group of the Canary Islands, and Vicia ferreirensis Goyder, an endemic species from Porto Santo Island, Madeira Archipelago.Se describe e ilustra Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, una nueva especie y endemismo de la isla de Lanzarote, Islas Canarias, perteneciente al subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. Se encuentra relacionada y es comparada con Vicia cirrhosa C. Sm. ex Webb & Berthel. y Vicia filicaulis Webb & Berthel., especies endémicas de las islas centrales y occidentales del archipiélago canario, y con Vicia ferreirensis Goyder, especie endémica de la isla de Porto Santo, en el archipiélago de Madeira.
Sueyoshi, S; Tsuji, T; Osawa, T
1988-07-15
The carbohydrate-binding specificities of lectins purified from Agaricus bisporus (ABA-I), Arachis hypogaea (PNA), Bauhinia purpurea (BPA), Glycine max (SBA), and Vicia villosa (VVA-B4) have been studied by affinity chromatography on columns of the immobilized lectins, and quantitatively analyzed by frontal affinity chromatography. These five lectins could be classified into two groups with respect to their reactivities with typical mucin-type glycopeptides, beta-D-Galp-(1----3)-alpha-D-GalpNAc-(1----3)-Ser/Thr (2) and alpha-D-GalpNAc-(1----3)-Ser/Thr (3). One group, which consists of ABA-I, PNA, and BPA, preferentially binds to 2, and the other, which consists of SBA and VVA-B4, shows higher affinity for 3 than for 2. Among the lectins tested, only ABA-I was found to bind to a sialylated glycopeptide, whic which was prepared from human erythrocyte glycophorin A and contains three three tetrasaccharide chains having the structure of alpha-NeuAc-(2----3)-beta-D-GAlp-(1----3)-NeuAC-(2----6)]-alpha-D-Galp NAc-(1----, with an association constant of 15 microM, whereas the association constants of the other four lectins for this sialylated glycopeptide were less than 3.5 mM. On the other hand, removal of the beta-D-galactopyranosyl group from a glycopeptide containing sequence 2 resulted in decreased association constants for the three lectins of the first group, especially ABA-I and PNA. The two lectins of the second group showed a high affinity for 3, but SBA preferentially interacted with oligosaccharides containing the alpha-D-GalpNAc-(1----3)-beta-D-Galp-(1----3)-D-GlapNAc sequence, prepared from a blood group A-active oligosaccharide.
Biological role of lectins: A review
Directory of Open Access Journals (Sweden)
K Kiran Kumar
2012-01-01
Full Text Available Lectins comprise a stracturally vary diverse class of proteins charecterized by their ability to selectively bind carbohydrate moieties of the glycoproteins of the cell surface. Lectins may be derived from plants, microbial or animal sources and may be soluble or membrane bound. Lectins is a tetramer made up of four nearly identical subunits. In human, lectins have been reported to cause food poisoning, hemolytic anemia, jaundice, digestive distress, protein and carbohydrate malabsorption and type I allergies. The present review focuses on the classification, structures, biological significance and application of lectins.
Observaciones cariológicas en Vicia amphicarpa sensu lato
Directory of Open Access Journals (Sweden)
Tardío Pato, F. Javier
1998-12-01
Full Text Available Cytological studies were carried out on twenty four amphicarpic wild populations of Vicia sativa group from different sites (19 from Spain, 4 from Syria and 1 from Turkey. Morphologically, 19 accessions can be attributed to taxon Dorthes and 5 to V. angustifolia subsp. pseudoangustifolia (Rouy Tardío, comb. nov. In our studies, these two taxa show different chromosome numbers, V. amphicarpa Dorthes, has 14 chromosomes, while V. angustifolia subsp. pseudoangustifolia has only 12. Furthermore, the form of the chromosomes in the karyotypes of both taxa is quite different. The chromosome number and the morphology of the karyotype found in the first taxon agree with most of previous reports on V. amphicarpa, with a very characteristic short metacentric and six acrocentric chromosomes, one of them satellited. However, the second taxon has a very different karyotype with three large chromosomes, one of them submetacentric and another satellited, plus another three chromosomes which are significantly smaller. Therefore, we can conclude that within the genus Vicia, at least two amphicarpic taxa exist, clearly differentiated, both in morphological and karyotypical characteristics.Se estudian cariológicamente 24 poblaciones anficárpicas silvestres pertenecientes al grupo Vicia sativa, de distinta procedencia (19 españolas, cuatro de Siria y una de Turquía. Se encuentran diferencias en los números cromosomáticos y en los cariótipos. Diecinueve poblaciones presentan 14 cromosomas y cariotipo como el observado por otros autores, constituido por un pequeño cromosoma metacéntrico y seis acrocéntricos, uno de ellos con satélite. Éstas corresponden a V. amphicarpa Dorthes. Las otras cinco, con 2n = 12 y cariotipo con tres cromosomas grandes, uno de ellos submetacéntrico, otro con satélite, y otros tres mucho más pequeños, corresponden a V. angustifolia subsp. pseudoangustifolia (Rouy Tardío. Esta anterior se propone como combinación nueva. Por
[Studies on the chemical constitutens of Vicia amoena Fisch].
Wei, F; Yan, W M
1997-10-01
One new flavonoide was isolated from Vicia amoena Fisch. On the basis of spectral (UV, MS, NMR) and chemical reactions, it was elucidated to be kaempferol-3-O-beta-D-mannoside, named amoenin(A3). Moreover, five known compounds have been isolated and identified as quercetin, kaempferol, quercetin-3-O-alpha-L-rhamoside, quercetin-3-O-beta-D-glucoside, kaempferol-3, 7-O-alpha-L-dirhamoside. The total flavonoides showed significant effects on inducing hyperlipidemia and increasing micro-blood vessel elasticity.
Rhizobium laguerreae sp. nov. nodulates Vicia faba on several continents.
Saïdi, Sabrine; Ramírez-Bahena, Martha-Helena; Santillana, Nery; Zúñiga, Doris; Álvarez-Martínez, Estela; Peix, Alvaro; Mhamdi, Ridha; Velázquez, Encarna
2014-01-01
Several fast-growing strains nodulating Vicia faba in Peru, Spain and Tunisia formed a cluster related to Rhizobium leguminosarum. The 16S rRNA gene sequences were identical to that of R. leguminosarum USDA 2370(T), whereas rpoB, recA and atpD gene sequences were phylogenetically distant, with sequence similarities of less than 96 %, 97 % and 94 %, respectively. DNA-DNA hybridization analysis showed a mean relatedness value of 43 % between strain FB206(T) and R. leguminosarum USDA 2370(T). Phenotypic characteristics of the novel strains also differed from those of the closest related species of the genus Rhizobium. Therefore, based on genotypic and phenotypic data obtained in this study, we propose to classify this group of strains nodulating Vicia faba as a novel species of the genus Rhizobium named Rhizobium laguerreae sp. nov. The type strain is FB206(T) ( = LMG 27434(T) = CECT 8280(T)).
Mathematical modeling of biological growth for some Vicia faba varieties
Ionel, Samfira; Andreea, Ghica; Marius, Boldea; Monica, Butnariu; Marius, Sendroni; Andrei, M.-Kiss
2013-10-01
Vicia faba is one of the legume species of importance for human and animal nutrition. Over the past decade, the areas cultivated with this species have significantly increased. Given that the levels of the yield and quality obtained from this species depend largely on the specific soil and climate conditions, the present paper focuses on the study of the morpho-productive features under the conditions in Banat Plain, in the west of Romania. A collection of varieties and genetic lines was studied, with focus on the interdependence between plant height, characteristics of the foliage and in the end the foliar surface of the leaf and of the entire plant. The observations led to the conclusion that variety Melodie has the best response of biological growth on the plain.
Sugared biomaterial binding lectins: achievements and perspectives
Czech Academy of Sciences Publication Activity Database
Bojarová, Pavla; Křen, Vladimír
2016-01-01
Roč. 4, č. 8 (2016), s. 1142-1160 ISSN 2047-4830 R&D Projects: GA ČR GC15-02578J Institutional support: RVO:61388971 Keywords : C-TYPE LECTINS * AMPHIPHILIC JANUS GLYCODENDRIMERS * BIOMEDICALLY RELEVANT LECTINS Subject RIV: CE - Biochemistry Impact factor: 4.210, year: 2016
Lectin binding patterns and immunohistochemical antigen detection ...
African Journals Online (AJOL)
Ibrahim Eldaghayes
2018-02-09
Feb 9, 2018 ... the effect of infection with Brucella abortus on the pattern of lectin binding in bovine fetal lungs (n=6) and bovine placentas (n=5). Fetal lungs and placenta from heifers experimentally inoculated with B. abortus, strain 2308 were examined by histological, lectin-histochemical, immunohistochemical and ...
Assessing biosafety of GM plants containing lectins
DEFF Research Database (Denmark)
Poulsen, Morten; Pedersen, Jan W.
2010-01-01
of the lectins that are potentially useful for insect resistance will pose no health risk in genetically modified (GM) plants. Since some lectins are known for their toxicity to humans, the insertion of lectin genes in food crop plants will have to be assessed carefully. It is expected that in some cases......The introduction of genetic engineering has already shown its benefits in transferring genes into crop plants and conferring resistance towards pests. Most of these crop plants on the market have been transformed with the cry genes from Bacillus species, conferring resistance towards certain...... insects. However, since the cry genes are not active against all insects, e.g. sap-sucking insects, other genes coding for proteins such as lectins show promise of complementing the cry genes for insect resistance. As with other novel plants, lectin-expressing plants will need to be assessed...
Galactose/N-acetylgalactosamine lectin: the coordinator of host cell ...
Indian Academy of Sciences (India)
This killing involves the amoebic surface protein referred to as the Gal/GalNAc lectin. The Gal/GalNAc lectin binds galactose and N-acetylgalactosamine allowing the adherence of amoebas to host cells. Involvement of the lectin in the pathogenesis of E. histolytica infection will be reviewed in this paper. The lectin has been ...
Recent Progress in Lectin-Based Biosensors
Directory of Open Access Journals (Sweden)
Baozhen Wang
2015-12-01
Full Text Available This article reviews recent progress in the development of lectin-based biosensors used for the determination of glucose, pathogenic bacteria and toxins, cancer cells, and lectins. Lectin proteins have been widely used for the construction of optical and electrochemical biosensors by exploiting the specific binding affinity to carbohydrates. Among lectin proteins, concanavalin A (Con A is most frequently used for this purpose as glucose- and mannose-selective lectin. Con A is useful for immobilizing enzymes including glucose oxidase (GOx and horseradish peroxidase (HRP on the surface of a solid support to construct glucose and hydrogen peroxide sensors, because these enzymes are covered with intrinsic hydrocarbon chains. Con A-modified electrodes can be used as biosensors sensitive to glucose, cancer cells, and pathogenic bacteria covered with hydrocarbon chains. The target substrates are selectively adsorbed to the surface of Con A-modified electrodes through strong affinity of Con A to hydrocarbon chains. A recent topic in the development of lectin-based biosensors is a successful use of nanomaterials, such as metal nanoparticles and carbon nanotubes, for amplifying output signals of the sensors. In addition, lectin-based biosensors are useful for studying glycan expression on living cells.
Words denoting faba bean (Vicia faba in European languages
Directory of Open Access Journals (Sweden)
Mikić Aleksandar
2011-01-01
Full Text Available Faba bean (Vicia faba L took part in the 'agricultural revolution' of post-glacial Europe along with other grain legumes and cereals. In order to assess the diversity and the origin of the words denoting faba bean in the languages of Europe, a lexicological study was carried out with emphasis upon etymological dictionaries. The words in almost all modern Indo-European languages in Europe owe their origin to the Proto-Indo-European root *bhabh bhabhā, also denoting faba bean. The Proto-Altaic root *bŭkrV, denoting pea nut and cone, through the Proto-Turkic *burčak, denoting both pea and bean is responsible for the words in several modern Altaic languages of Europe while the others are borrowings from Arabic. The origin of the words in modern Caucasian languages is the Proto-Caucasian root *howł[ā], meaning both bean and lentil. The words in Uralic languages are either borrowings, mostly from Slavic, or derived from their own words denoting pea.
Legume Lectins: Proteins with Diverse Applications
Lagarda-Diaz, Irlanda; Guzman-Partida, Ana Maria; Vazquez-Moreno, Luz
2017-01-01
Lectins are a diverse class of proteins distributed extensively in nature. Among these proteins; legume lectins display a variety of interesting features including antimicrobial; insecticidal and antitumor activities. Because lectins recognize and bind to specific glycoconjugates present on the surface of cells and intracellular structures; they can serve as potential target molecules for developing practical applications in the fields of food; agriculture; health and pharmaceutical research. This review presents the current knowledge of the main structural characteristics of legume lectins and the relationship of structure to the exhibited specificities; provides an overview of their particular antimicrobial; insecticidal and antitumor biological activities and describes possible applications based on the pattern of recognized glyco-targets. PMID:28604616
Lectin Complement Pathway Proteins in Healthy Individuals
DEFF Research Database (Denmark)
Troldborg, Anne; Hansen, Annette Gudmann; Hansen, Søren W K
2017-01-01
Since the discovery of the lectin pathway of complement activation, numerous clinical cohorts have been examined for one or more of the proteins, with the intention of uncovering the functions of the proteins or with the aim of discovering new biomarkers or diagnostic tools. To unveil the abnormal......, it is pivotal to know the normal. Our aim was to describe the concentrations of the eleven known proteins of the lectin pathway in serum and plasma and to uncover possible gender differences, age and diurnal variations, which must be taken into account for investigations in different cohorts. We examined...... the concentrations of all lectin pathway proteins (mannan-binding lectin (MBL), H-ficolin, L-ficolin, M-ficolin, collectin-K1, collectin-L1, MBL-associated serine protease 2 (MASP-2), MASP-3, MBL associated protein of 44 kDa (MAp44) and MAp19 in 300 Danish blood donors in serum and EDTA plasma in established assays...
The Lectin Pathway of Complement and Biocompatibility
DEFF Research Database (Denmark)
Hein, Estrid; Garred, Peter
2015-01-01
activation, the coagulation system and the complement system. The complement system is an important part of the initial immune response and consists of fluid phase molecules in the blood stream. Three different activation pathways can initiate the complement system, the lectin, the classical...... been broadly documented. However, the specific role of lectin pathway and the pattern recognition molecules initiating the pathway has only been transiently investigated. Here we review the current data on the field....
Carbopol-lectin conjugate coated liposomes for oral peptide delivery.
Werle, Martin; Makhlof, Abdallah; Takeuchi, Hirofumi
2010-03-01
Within the current study, a delivery system based on a novel polymer-lectin conjugate (carbopol-lectin) was evaluated for the oral delivery of therapeutic peptides and proteins. It was demonstrated that covalent attachment of lectin to carbopol does neither decrease nor abolish the specific binding properties of lectin. Bioadhesion studies revealed that liposomes coated with carbopol lectin are more bioadhesive than liposomes coated with unmodified carbopol. Finally, the in vivo data suggest that carbopol-lectin conjugate coated liposomes are effective oral peptide delivery systems which are capable of increasing the pharmacological effect of orally administered calcitonin.
Role of bioinoculants in development of salt-tolerance of Vicia faba ...
African Journals Online (AJOL)
Through biological inoculation technology, the bacterial-mycorrhizal-legume tripartite symbiosis in saline conditions was documented and the effects of dual inoculation with Azospirillum brasilense (NFB) and Arbuscular mycorrhizal (Am) fungus Glomus clarum on the host plants (Vicia faba) in pot cultures were investigated ...
Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals
Jansman, A.J.M.
1993-01-01
Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid
On the presence of Vicia vicioides in Alicante
Directory of Open Access Journals (Sweden)
Pérez-Haase, A.
2008-12-01
Full Text Available Please read the Spanish version of this Abstract.
En el presente trabajo se actualiza el conocimiento corológico de la leguminosa Vicia vicioides (Desf. Cout. en la provincia de Alicante, aportando información sobre cinco nuevas poblaciones, que se añaden a la única localidad conocida previamente.
Lectin interactions with alpha-galactosylated xenoantigens
DEFF Research Database (Denmark)
Kirkeby, Svend; Moe, Dennis
2002-01-01
alpha-Galactosylated xenoantigens (Galalpha1-3Galbeta1-4GlcNAcbeta1 and Galalpha1-3Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc) are often detected with the alpha-Gal specific lectin Griffonia simplicifolia 1 isolectin B4 (GS1 B4). However, this lectin exhibits a broad and variable specificity......-galactophilic lectins to alpha-galactosylated neoglycoproteins. The lectins were: Euonymus europaeus agglutinin (EEA), Griffonia simplicifolia 1 isolectin B4 (GS1 B4), Maclura pomifera agglutinin (MPA) and Pseudomonas aeruginosa agglutinin (PA-IL). Although both GS1 B4 and MPA strongly bound glycoconjugates terminating...... in Gal there seems to be some differentiation in their sugar binding preferences. MPA was the only lectin that showed high affinity for the pentasaccharide Galalpha1-3Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc and for the Galalpha-glycans on non-primate thyroglobulin. The length of the xenoantigenic...
Identification and characterization of a novel legume-like lectin ...
Indian Academy of Sciences (India)
logical research (Pinto et al. 2009). Many lectins are useful for viral inhibitors, such as N-acetylglucosamine-binding lectin extracted from the stinging nettle root of Urtica dioica, which has displayed pronounced antiviral properties (Shibuya et al. 1986). Also, mannose-binding lectins, such as cyanovirin-N derived from the ...
A chitotetrose specific lectin from Luffa acutangula: Physico ...
Indian Academy of Sciences (India)
tribpo
chemical properties and the assignment of orientation of sugars in the lectin binding site. VELLAREDDY .... The macromolecular properties of the lectin are listed in table 1. The sedimentation equilibrium ... specific lectins such as wheat germ, (Allen, 1973) Datura stramonium and Solanum tuberosum (Desai et al., 1981) ...
Unfolding energetics and stability of banana lectin.
Gupta, Garima; Sinha, Sharmistha; Surolia, Avadhesha
2008-08-01
The unfolding pathway of banana lectin from Musa paradisiaca was determined by isothermal denaturation induced by the chaotrope GdnCl. The unfolding was found to be a reversible process. The data obtained by isothermal denaturation provided information on conformational stability of banana lectin. The high values of DeltaG of unfolding at various temperatures indicated the strength of intersubunit interactions. It was found that banana lectin is a very stable and denatures at high chaotrope concentrations only. The basis of the stability may be attributed to strong hydrogen bonds of the order 2.5-3.1 A at the dimeric interface along with the presence of water bridges. This is perhaps very unique example in proteins where subunit association is not a consequence of the predominance of hydrophobic interactions. (c) 2008 Wiley-Liss, Inc.
Doubell, Marcé; Grant, Paul B C; Esterhuizen, Nanike; Bazelet, Corinna S; Addison, Pia; Terblanche, John S
2017-12-01
Katydids produce acoustic signals via stridulation, which they use to attract conspecific females for mating. However, direct estimates of the metabolic costs of calling to date have produced diverse cost estimates and are limited to only a handful of insect species. Therefore, in this study, we investigated the metabolic cost of calling in an unstudied sub-Saharan katydid, Plangia graminea Using wild-caught animals, we measured katydid metabolic rate using standard flow-through respirometry while simultaneously recording the number of calls produced. Overall, the metabolic rate during calling in P. graminea males was 60% higher than the resting metabolic rate (0.443±0.056 versus 0.279±0.028 ml CO 2 h -1 g -1 ), although this was highly variable among individuals. Although individual call costs were relatively inexpensive (ranging from 0.02 to 5.4% increase in metabolic rate per call), the individuals with cheaper calls called more often and for longer than those with expensive calls, resulting in the former group having significantly greater cumulative costs over a standard amount of time (9.5 h). However, the metabolic costs of calling are context dependent because the amount of time spent calling greatly influenced these costs in our trials. A power law function described this relationship between cumulative cost ( y ) and percentage increase per call ( x ) ( y =130.21 x -1.068 , R 2 =0.858). The choice of metric employed for estimating energy costs (i.e. how costs are expressed) also affects the outcome and any interpretation of costs of sexual signalling. For example, the absolute, relative and cumulative metabolic costs of calling yielded strongly divergent estimates, and any fitness implications depend on the organism's energy budget and the potential trade-offs in allocation of resources that are made as a direct consequence of increased calling effort. © 2017. Published by The Company of Biologists Ltd.
National Research Council Canada - National Science Library
Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P
2008-01-01
... identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba...
Cholesterol Crystals Activate the Lectin Complement Pathway via Ficolin-2 and Mannose-Binding Lectin
DEFF Research Database (Denmark)
Pilely, Katrine; Rosbjerg, Anne; Genster, Ninette
2016-01-01
Cholesterol crystals (CC) play an essential role in the formation of atherosclerotic plaques. CC activate the classical and the alternative complement pathways, but the role of the lectin pathway is unknown. We hypothesized that the pattern recognition molecules (PRMs) from the lectin pathway bind...... CC and function as an upstream innate inflammatory signal in the pathophysiology of atherosclerosis. We investigated the binding of the PRMs mannose-binding lectin (MBL), ficolin-1, ficolin-2, and ficolin-3, the associated serine proteases, and complement activation products to CC in vitro using...... recombinant proteins, specific inhibitors, as well as deficient and normal sera. Additionally, we examined the deposition of ficolin-2 and MBL in human carotid plaques by immunohistochemistry and fluorescence microscopy. The results showed that the lectin pathway was activated on CC by binding of ficolin-2...
Rapid identification of Mycobacterium species by lectin agglutination.
Athamna, Abed; Cohen, Dani; Athamna, Muhammad; Ofek, Itzhak; Stavri, Henriette
2006-05-01
The purpose of the present study is to explore the possibility that plant lectins can be used for the development of rapid and inexpensive technique for differentiation of mycobacterial species. The method is based on interaction between mycobacteria and lectins as visualized by agglutination in a microtiter plate. We employed 18 mycobacterium species and determined the minimal lectin concentration (MLC) of 23 different lectins. For some of the bacteria as a high as 1000 microg/ml of one or more lectins were required to induce agglutination, while for other strains as low as 1.95 microg/ml of the lectin were needed. A unique pattern of agglutination was observed for each species over a range of 62-1000 microg/ml lectin concentrations. There were little or no variations in MLC within strains (intraspecies) of each of two species tested. In contrast, there were marked interspecies variations in MLC. Analysis of the MLC showed that the highest score of interspecies differences with 23 lectins was obtained at 125 microg/ml lectin concentration. At this concentration it was found that the pattern of agglutinations with only two lectins was sufficient to differentiate mycobacterium species from each other. Because the bacteria-lectin interaction is adaptable to various methods of visualization, our findings may set the stage for developing a rapid and reliable tool to differentiate mycobacterium species.
IDENTIFICATION OF LECTINS OF ZEA MAYS RAW MATERIAL AND THE STUDY OF LECTIN ACTIVITY
Directory of Open Access Journals (Sweden)
Karpiuk UV
2013-03-01
Full Text Available The aime of the study was to identify lectins in the Zea mays raw material: roots, stems, heads, leaves and corn silk and study their activity. Lectins activity has been studied using the biological method of ratuserytroagglutination. This method is based on formation of aggregates of lectins and rats erythrocytes. The activity unit was the floor amount of lectins that agglutinate erythrocytes. The protein nature of extracts that agglutinate has been determined using Bradford method. The lectins activity of Zea mays roots was 6,21±0,11 unit/mg of protein; of heads – 2,61±0,17 unit/mg of protein; of leaves – 0,62 ±0,05 unit/mg of protein; of corn silk – 1,06±0,08 unit/mg of protein; of stems – 0,97±0,09 unit/mg of protein. The greatest lectins activity was in leaves, stems and corn silk.
Animal lectins: potential receptors for ginseng polysaccharides
Directory of Open Access Journals (Sweden)
So Hee Loh
2017-01-01
Full Text Available Panax ginseng Meyer, belonging to the genus Panax of the family Araliaceae, is known for its human immune system-related effects, such as immune-boosting effects. Ginseng polysaccharides (GPs are the responsible ingredient of ginseng in immunomodulation, and are classified as acidic and neutral GPs. Although GPs participate in various immune reactions including the stimulation of immune cells and production of cytokines, the precise function of GPs together with its potential receptor(s and their signal transduction pathways have remained largely unknown. Animal lectins are carbohydrate-binding proteins that are highly specific for sugar moieties. Among many different biological functions in vivo, animal lectins especially play important roles in the immune system by recognizing carbohydrates that are found exclusively on pathogens or that are inaccessible on host cells. This review summarizes the immunological activities of GPs and the diverse roles of animal lectins in the immune system, suggesting the possibility of animal lectins as the potential receptor candidates of GPs and giving insights into the development of GPs as therapeutic biomaterials for many immunological diseases.
Peanut lectin crystallography and macromolecular structural studies ...
Indian Academy of Sciences (India)
2007-08-06
Aug 6, 2007 ... Home; Journals; Journal of Biosciences; Volume 32; Issue 6. Peanut lectin crystallography and macromolecular structural studies in India. M Vijayan. Perspectives Volume 32 Issue 6 September 2007 pp 1059-1066. Fulltext. Click here to view fulltext PDF. Permanent link:
Lectin status, protein contents and ammonium assimilating ...
African Journals Online (AJOL)
PRECIOUS
2009-11-16
Nov 16, 2009 ... Lectin status, protein contents and ammonium assimilating enzymatic activity of two indigenous cultivars of mulberry species, Morus alba and Morus nigra. Muhammad Zahoor*, Zakia Javaid, Muhammad Ali, Saleem Khan, Farhad Ali and Zahoor A. Swati. Institute of Biotechnology and Genetic Engineering, ...
Young, N M; Williams, R E; Roy, C; Yaguchi, M
1982-01-01
The D-mannose specific lectin from sainfoin was prepared by affinity chromatography on Sephadex G-75, and its circular dichroism (CD), metal content, antigenic character, and N-terminal amino acid sequence were compared with those of four lectins from Vicieae plants and concanavalin A. The sainfoin lectin was only slightly more closely related to these other D-mannose specific lectins, than to lectins of leguminous plants in general. The CD and antigenic experiments also confirmed the close relationship of the four Vicieae lectins. The N-terminal sequence showed sainfoin has two isolectins, differing in sequence at residue four. The sequence was homologous to N-terminal sequences of several other lectins; hence, despite some structural and specificity similarities, the sainfoin lectin does not show the circular permutation of sequence unique to concanavalin A. This region also contained the sole cysteine residue, at position 33. The carbohydrate-binding properties of the sainfoin lectin were studied by gradient affinity chromatography. Its apparent Ka for methyl alpha-D-glucoside was approximately 10(3) M-1, close to the Ka of the pea lectin. However, in the relative binding behaviour of methyl alpha-D-mannoside, maltose, and methyl alpha-D-glucoside, it resembled concanavalin A more than the pea lectin.
The search for lectin isolated from the mycelial cultures of Laetiporus sulphureus
Directory of Open Access Journals (Sweden)
Grażyna Końska
2014-08-01
Full Text Available This study proved the presence of lectin in mycelial cultures of Laetiporus sulphureus. Lectin was excreted into the medium and its erythroagglutinating activity was not high. No active lectin was detected in hyphae using both extraction and immunofluorescence method. Comparative studies based on immunological methods indicate~ that the lectin synthesised in vitro differed from the lectin produced in fruit-bodies.
Abd-Alla, Mohamed Hemida; El-Enany, Abdel-Wahab Elsadek; Nafady, Nivien Allam; Khalaf, David Mamdouh; Morsy, Fatthy Mohamed
2014-01-20
Egyptian soils are generally characterized by slightly alkaline to alkaline pH values (7.5-8.7) which are mainly due to its dry environment. In arid and semi-arid regions, salts are less concentrated and sodium dominates in carbonate and bicarbonate forms, which enhance the formation of alkaline soils. Alkaline soils have fertility problems due to poor physical properties which adversely affect the growth and the yield of crops. Therefore, this study was devoted to investigating the synergistic interaction of Rhizobium and arbuscular mycorrhizal fungi for improving growth of faba bean grown in alkaline soil. A total of 20 rhizobial isolates and 4 species of arbuscular mycorrhizal fungi (AMF) were isolated. The rhizobial isolates were investigated for their ability to grow under alkaline stress. Out of 20 isolates 3 isolates were selected as tolerant isolates. These 3 rhizobial isolates were identified on the bases of the sequences of the gene encoding 16S rRNA and designated as Rhizobium sp. Egypt 16 (HM622137), Rhizobium sp. Egypt 27 (HM622138) and Rhizobium leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The best alkaline tolerant was R. leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The effect of R. leguminosarum bv. viciae STDF-Egypt 19 and mixture of AMF (Acaulospora laevis, Glomus geosporum, Glomus mosseae and Scutellospora armeniaca) both individually and in combination on nodulation, nitrogen fixation and growth of Vicia faba under alkalinity stress were assessed. A significant increase over control in number and mass of nodules, nitrogenase activity, leghaemoglobin content of nodule, mycorrhizal colonization, dry mass of root and shoot was recorded in dual inoculated plants than plants with individual inoculation. The enhancement of nitrogen fixation of faba bean could be attributed to AMF facilitating the mobilization of certain elements such as P, Fe, K and other minerals that involve in synthesis of nitrogenase and leghaemoglobin. Thus it is
Induction of sister-chromatid exchanges in Vicia faba by arsenic-contaminated drinking water.
Gómez-Arroyo, S; Hernández-García, A; Villalobos-Pietrini, R
1988-07-01
Arsenic-contaminated drinking water from various towns of Comarca Lagunera, Coahuila, Mexico, was tested for its ability to induce sister-chromatid exchanges (SCE) in Vicia faba. 3-h treatments were applied and the differential staining technique of Tempelaar et al. (1982) was used. Atomic absorption spectrophotometry showed that the arsenic concentration in drinking water was 0.11-0.695 ppm, well over the maximum limit of 0.05 ppm (EPA, 1984). In all cases the SCE frequencies were significantly different from the controls. Some concentrations (0.2, 0.3, 0.5 and 1.0 ppm) of sodium arsenate (V) and potassium arsenite (III) were also applied to Vicia faba and all produced significant SCE frequencies, except 0.2 ppm of sodium arsenate.
Isolation and biological activity of a new plant growth regulator of Vicia faba L
Energy Technology Data Exchange (ETDEWEB)
Sembdner, G.; Dathe, W.; Bergner, C.; Roensch, H. (Akademie der Wissenschaften der DDR, Halle/Saale. Inst. fuer Biochemie der Pflanzen)
1983-01-01
Jasmonic acid was identified as a plant growth inhibitor of the pericarp of Vicia faba by means of gas-liquid chromatography, high resolution mass spectrometry as well as /sup 1/H and /sup 13/C NMR. The highest level of jasmonic acid was reached during intensive pericarp growth. Jasmonic acid is a plant growth inhibitor possessing a relative activity in the wheat seedling bioassay of 1-2.5 % compared to ABA (=100%). Contrary to ABA, jasmonic acid does not cause retardation of leaf emergence. In the dwarf rice gibberellin bioassay relative low concentrations of jasmonic acid inhibit both autonomous and GA/sub 3/-stimulated growth. Jasmonic acid does not influence seed germination of Amaranthus caudatus. The possible physiological role of jasmonic acid in the Vicia pericarp and the distribution in plants of this new plant growth regulator type are discussed.
Purification and Characterization of Griffonia simplicifolia Leaf Lectins.
Lamb, J E; Shibata, S; Goldstein, I J
1983-04-01
Leaves from mature Griffonia simplicifolia plants were examined for the presence of leaf lectins possessing sugar binding specificities similar to the four known seed lectins (GS-I, GS-II, GS-III, GS-IV). Three (GS-I, -II, -IV) of the four known G. simplicifolia seed lectins were present in the leaves. Leaf G. simplicifolia lectins I and IV were similar to the respective seed lectins. Leaf GS-II, however, was composed of two types of subunits (M(r) = 33,000 and 19,000), whereas the seed lectin consists of only one type of subunit (M(r) 32,500). Seed and leaf GS-II lectins also had different isoelectric points. All leaf and seed lectins were similar with respect to their hemagglutination and glycoconjugate precipitation properties and all subunits contained covalently bound carbohydrate. Leaf GS-IV appeared slightly under-glycosylated compared to seed GS-IV.The fate of GS-I and GS-II seed lectins in aging cotyledons was investigated. GS-I isolectins usually contain isolectin subtypes associated with each main isolectin. Upon inbibition and germination, these GS-I isolectin subtypes disappeared. Over time, GS-II lectin did not change its disc gel electrophoretic properties.
Purification and Characterization of Griffonia simplicifolia Leaf Lectins 1
Lamb, Jamie E.; Shibata, Satoaki; Goldstein, Irwin J.
1983-01-01
Leaves from mature Griffonia simplicifolia plants were examined for the presence of leaf lectins possessing sugar binding specificities similar to the four known seed lectins (GS-I, GS-II, GS-III, GS-IV). Three (GS-I, -II, -IV) of the four known G. simplicifolia seed lectins were present in the leaves. Leaf G. simplicifolia lectins I and IV were similar to the respective seed lectins. Leaf GS-II, however, was composed of two types of subunits (Mr = 33,000 and 19,000), whereas the seed lectin consists of only one type of subunit (Mr 32,500). Seed and leaf GS-II lectins also had different isoelectric points. All leaf and seed lectins were similar with respect to their hemagglutination and glycoconjugate precipitation properties and all subunits contained covalently bound carbohydrate. Leaf GS-IV appeared slightly under-glycosylated compared to seed GS-IV. The fate of GS-I and GS-II seed lectins in aging cotyledons was investigated. GS-I isolectins usually contain isolectin subtypes associated with each main isolectin. Upon inbibition and germination, these GS-I isolectin subtypes disappeared. Over time, GS-II lectin did not change its disc gel electrophoretic properties. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 PMID:16662923
Leaf traits associated with drought adaptation in faba bean (Vicia faba L.)
Khazaei, Hamid
2014-01-01
The potential for use of faba bean (Vicia faba L.) is increasing worldwide due to its positive environmental impact and nutritional interest, but there are many challenges for faba bean breeding and cultivation. These include its mixed breeding system, its unknown origin and wild progenitor, its large genome being the biggest diploid genome among field crops, and its relative sensitivity to biotic and abiotic stresses (e.g., drought). Little is known about the ecological adaptation of faba be...
Combination of different methods for direct control of Vicia hirsuta in winter wheat
Lukashyk, P.; Köpke, U.
2005-01-01
Combinations of three different direct methods for controlling Vicia hirsuta (kainite application, flame weeding and harrowing) were investigated in field experiments. They were based on different strategies at early growth stages of V. hirsuta and standardised harrowing at late growth stages. The highest efficacy of kainite application and flame weeding was achieved at the one leaf stage of V. hirsuta. Winter wheat regeneration from damage caused by both kainite and thermal control was satis...
Meiotic changes in Vicia faba L. subsequent to treatments of hydrazine hydrate and maleic hydrazide
Directory of Open Access Journals (Sweden)
Shaheen Husain
2013-01-01
Full Text Available Assessing the impact of mutagens for creating variations in crops like faba bean (Vicia faba L. is an important criterion in the contemporary world where food insecurity and malnutrition is alarming at the doors of various nations. Impact of two chemical mutagens viz. hydrazine hydrate (HZ and maleic hydrazide (MH on the two varieties (NDF-1 and HB-405 of Vicia faba were analysed in terms of meiotic behavior and pollen sterility. Since there are not enough data about the effect of these mutagens on the chromosomal behaviors of Vicia faba, this study presents the role of hydrazine hydrate and maleic hydrazide as well as various types of chromosomal aberrations in crop improvement. The lower concentration of mutagens showed less pollen sterility compared to the higher concentrations. Manipulation of plant structural component to induce desirable alternations provides valuable material for the breeders and could be used favorably for increasing mutation rate and obtaining a desirable spectrum of mutation in faba beans based on preliminary studies of cell division.
Rhizobium anhuiense sp. nov., isolated from effective nodules of Vicia faba and Pisum sativum.
Zhang, Yu Jing; Zheng, Wen Tao; Everall, Isobel; Young, J Peter W; Zhang, Xiao Xia; Tian, Chang Fu; Sui, Xin Hua; Wang, En Tao; Chen, Wen Xin
2015-09-01
Four rhizobia-like strains, isolated from root nodules of Pisum sativum and Vicia faba grown in Anhui and Jiangxi Provinces of China, were grouped into the genus Rhizobium but were distinct from all recognized species of the genus Rhizobium by phylogenetic analysis of 16S rRNA and housekeeping genes. The combined sequences of the housekeeping genes atpD, recA and glnII for strain CCBAU 23252(T) showed 86.9 to 95% similarity to those of known species of the genus Rhizobium. All four strains had nodC and nifH genes and could form effective nodules with Pisum sativum and Vicia faba, and ineffective nodules with Phaseolus vulgaris, but did not nodulate Glycine max, Arachis hypogaea, Medicago sativa, Trifolium repens or Lablab purpureus in cross-nodulation tests. Fatty acid composition, DNA-DNA relatedness and a series of phenotypic tests also separated these strains from members of closely related species. Based on all the evidence, we propose a novel species, Rhizobium anhuiense sp. nov., and designate CCBAU 23252(T) ( = CGMCC 1.12621(T) = LMG 27729(T)) as the type strain. This strain was isolated from a root nodule of Vicia faba and has a DNA G+C content of 61.1 mol% (Tm).
Lessons learned from mice deficient in lectin complement pathway molecules
DEFF Research Database (Denmark)
Genster, Ninette; Takahashi, Minoru; Sekine, Hideharu
2014-01-01
The lectin pathway of the complement system is initiated when the pattern-recognition molecules, mannose-binding lectin (MBL), ficolins or collectin-11, bind to invading pathogens or damaged host cells. This leads to activation of MBL/ficolin/collectin-11 associated serine proteases (MASPs), which...... in turn activate downstream complement components, ultimately leading to elimination of the pathogen. Mice deficient in the key molecules of lectin pathway of complement have been generated in order to build knowledge of the molecular mechanisms of the lectin pathway in health and disease. Despite...... differences in the genetic arrangements of murine and human orthologues of lectin pathway molecules, the knockout mice have proven to be valuable models to explore the effect of deficiency states in humans. In addition, new insight and unexpected findings on the diverse roles of lectin pathway molecules...
Subunit heterogeneity in the lima bean lectin.
Roberts, D D; Etzler, M E; Goldstein, I J
1982-08-10
Three forms of lectin (components I, II, and III) from lima beans (Phaseolus lunatus) have been purified on an affinity support containing the synthetic type A blood group trisaccharide alpha-D-GalNAc-(1 leads to 3)-[alpha-L-Fuc-(1 leads to 2)]-beta-D-Gal-(1 leads to). Conversion of components I and II to component III has been achieved by reduction in 10(-2) M dithiothreitol. Isoelectric focusing of lima bean lectin in the presence of 8 M urea and beta-mercaptoethanol revealed charge heterogeneity of the lectin subunits. Three major subunit classes of apparent pI 7.05, 6.65, and 6.45, designated alpha, beta, and alpha', respectively, were identified; they occur in a relative abundance of 2:5:3. Green lima beans harvested before maturity lacked the alpha' subunit (pI 6.45) which appears to accumulate during seed maturation. The three subunits are glycoproteins of identical size and immunochemical reactivity. Identical NH2-terminal sequences were found for the three subunits. Amino acid analysis and tryptic peptide mapping indicated that the observed charge heterogeneity is probably due to differences in the primary structure of the subunits. Studies of subunit composition of charge isolectins provided evidence of nonrandom subunit assembly. A model is proposed involving pairing of a pI 6.65 subunit with either a pI 7.06 or 6.45 subunit to form dimeric units. Possible roles for subunit heterogeneity and ordered subunit assembly in determining the metal and sugar binding properties of lima bean lectin are discussed.
Lectin complement pathway proteins in healthy individuals.
Troldborg, A; Hansen, A; Hansen, S W K; Jensenius, J C; Stengaard-Pedersen, K; Thiel, S
2017-04-01
Since the discovery of the lectin pathway of complement activation, numerous clinical cohorts have been examined for one or more proteins, with the intention of uncovering the functions of the proteins or with the aim of discovering new biomarkers or diagnostic tools. To unveil the abnormal, it is pivotal to know the normal. Our aim was to describe the concentrations of the 11 known proteins of the lectin pathway in serum and plasma and to uncover possible gender differences, age and diurnal variations, which must be taken into account for investigation in different cohorts. We examined the concentrations of all lectin pathway proteins mannan-binding lectin (MBL), H-ficolin, L-ficolin, M-ficolin, collectin-K1, collectin-L1, MBL-associated serine protease 2 (MASP-2), MASP-3, MBL-associated protein of 44 kDa (MAp44) and MAp19 in 300 Danish blood donors in serum and ethylenediamine tetraacetic acid (EDTA) plasma in established assays, and we further developed a new assay to measure MASP-1 in the same samples. We found significant differences in concentrations between serum and plasma for all proteins except for MBL and MASP-3. H-ficolin, M-ficolin and MAp19 displayed convincing diurnal variation. H-ficolin, in particular, halved from morning to the middle of the night. There were gender differences for most proteins, whereas age did not seem to influence concentration. The present study underlines the necessity of considering which material to use, correct matching and a trial design that takes the nature of the protein into account in order for the outcome of cohort studies to have significant relevance. © 2016 British Society for Immunology.
Application of lectins to tumor imaging radiopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
Kojima, Shuji; Jay, M.
1986-11-01
We investigated the in vitro binding of /sup 125/I-lectins to Ehrlich ascites tumor (EAT) cells and in vivo uptake of /sup 125/I-lectins in Ehrlich solid tumor (EST) bearing mice. In in vitro binding assays, phaseolus vulgaris agglutinin (PHA), pisum sativum agglutinin (PSA), and concanavalia agglutinin (Con A) showed a high affinity for EAT cells. The in vivo biodistribution of /sup 125/I-lectins showed /sup 125/I-PSA to be significantly taken up into EST tissues 24 h postinjection. After IV injection of /sup 125/I-PSA, uptake of the radioactivity into the tumor tissues reached a maximum at 6 h, and thereafter decreased. Rapid disappearance of the radioactivity from blood and its excretion into kidney soon after injection of /sup 125/I-PSA were observed. When compared with the biodistribution of /sup 67/Ga-citrate in EST bearing mice 24 h postinjection, tumor to liver (T/B), tumor to muscle (T/M), and tumor to blood (T/B) ratios were superior for /sup 125/I-PSA. At 6 h postinjection, the T/B-ratio of /sup 125/I-PSA was 2.5, and this value may be sufficient to enable discernable diagnostic images. Our results suggest that PSA might be a useful tumor imaging radiopharmaceutical.
A comparison of tomato (Lycopersicon esculentum) lectin with its deglycosylated derivative.
Kilpatrick, D C; Graham, C; Urbaniak, S J; Jeffree, C E; Allen, A K
1984-06-15
A deglycosylated derivative of tomato (Lycopersicon esculentum) lectin was prepared with the use of trifluoromethanesulphonic acid. Its properties were generally similar to those of the native lectin, but differences were evident in terms of relative agglutinating activity towards sheep, (untreated) human and trypsin-treated human erythrocytes. The two forms of tomato lectin were used in conjunction with a battery of specific antisera to investigate structural relatedness among solanaceous lectins. Immunological cross-reactivity between tomato, potato and Datura lectins depends on the integrity of the glycosylated region of those lectins; that between Datura lectin and other seed lectins, however, has a separate structural basis.
Cheung, Allen H K; Wong, Jack H; Ng, T B
2009-06-01
A homodimeric, fructose-binding lectin was isolated from Del Monte bananas by using a protocol that involved ion-exchange chromatography on DEAE-cellulose and SP-Sepharose, and gel filtration by fast protein liquid chromatography on Superdex 75. Not only fructose, but also glucose, mannose, rhamnose and glucosamine could inhibit the lectin. The N-terminal amino acid sequence of its identical 15-kDa subunits was similar to lectins from other Musa species except for the deletion of the N-terminal glycine residue in Del Monte banana lectin. The hemagglutinating activity was stable up to 80 degrees C and also stable in the range pH 1-13. However, the hemagglutinating activity dwindled to an undetectable level at 90 degrees C. The lectin was capable of eliciting a mitogenic response in murine splenocytes and inducing the expression of the cytokines interferon-gamma, tumor necrosis factor-alpha, and interleukin-2 in splenocytes. The lectin also inhibited proliferation of leukemia (L1210) cells and hepatoma (HepG2) cells and the activity of HIV-1 reverse transcriptase. The additional information obtained in the present study includes demonstration of fructose-binding activity and cytokine-inducing activity of Del Monte banana lectin. Fructose binding is an unusual characteristic of plant lectins. It is possible that the banana lectin can be developed into a useful anti-HIV, immunopotentiating and antitumor agent in view of its trypsin stability and thermostability.
Nakamura-Tsuruta, Sachiko; Kominami, Junko; Kamei, Masugu; Koyama, Yu; Suzuki, Takuji; Isemura, Mamoru; Hirabayashi, Jun
2006-08-01
Lectin-based structural glycomics requires a search for useful lectins and their biochemical characterization to profile complex features of glycans. In this paper, two GlcNAc-binding lectins are reported with their detailed oligosaccharide specificity. One is a classic plant lectin, Griffonia simplicifolia lectin-II (GSL-II), and the other is a novel fungal lectin, Boletopsis leucomelas lectin (BLL). Their sugar-binding specificity was analyzed by frontal affinity chromatography using 146 glycans (125 pyridylaminated and 21 p-nitrophenyl saccharides). As a result, it was found that both GSL-II and BLL showed significant affinity toward complex-type N-glycans, which are either partially or completely agalactosylated. However, their branch-specific features differed significantly: GSL-II strongly bound to agalacto-type, tri- or tetra-antennary N-glycans with its primary recognition of a GlcNAc residue transferred by GlcNAc-transferase IV, while BLL preferred N-glycans with fewer branches. In fact, the presence of a GlcNAc residue transferred by GlcNAc-transferase V abolishes the binding of BLL. Thus, GSL-II and BLL forms a pair of complementally probes to profile a series of agalacto-type N-glycans.
Comparing mannose binding lectin genetic diversity in intracellular ...
African Journals Online (AJOL)
SERVER
2007-09-05
Sep 5, 2007 ... Human mannose binding lectin is derived from a single gene on chromosome 10 (Sastry et al., 1989); the normal structural mannose binding lectin allele is named A, while the common designation for the 3 variant structural alleles. B (mutation in codon 54, Gly to ASP), C (mutation in codon 57, Gly to Glu), ...
Mannan-binding lectin activates C3 and the
DEFF Research Database (Denmark)
Selander, B.; Martensson, U.; Weintraub, A.
2006-01-01
Lectin pathway activation of C3 is known to involve target recognition by mannan-binding lectin (MBL) or ficolins and generation of classical pathway C3 convertase via cleavage of C4 and C2 by MBL-associated serine protease 2 (MASP-2). We investigated C3 activation in C2-deficient human sera...
Mannose-binding lectin genetics: from A to Z
DEFF Research Database (Denmark)
Garred, Peter
2008-01-01
MBL (mannose-binding lectin) is primarily a liver-derived collagen-like serum protein. It binds sugar structures on micro-organisms and on dying host cells and is one of the four known mediators that initiate activation of the complement system via the lectin pathway. Common variant alleles...
Lectins, Mitogenicity and Seed Germination: A Comparative Study ...
African Journals Online (AJOL)
Dr J. T. Ekanem
2007-05-24
May 24, 2007 ... day respectively for T. occidentalis, C. papaya and A. communis) was preceded, 24 hours earlier, by the appearance of lectin in the developing tissues. The data suggest that the mitogenic lectins: Telfairia occidentalis Agglutinin (TOA) and Artocarpin accelerates the process of germination relative to that ...
Activation of the lectin complement pathway on human renal ...
African Journals Online (AJOL)
This study aimed to investigate the roles of high glucose and mannose-binding lectin (MBL) on the activation of the lectin complement pathway (LCP) on human renal glomerular endothelial cells (HRGECs) in vitro. Flow cytometry analysis, immunofluorescence staining and Western blot were used to detect the cell surface ...
Porifera Lectins: Diversity, Physiological Roles and Biotechnological Potential
Directory of Open Access Journals (Sweden)
Johan Gardères
2015-08-01
Full Text Available An overview on the diversity of 39 lectins from the phylum Porifera is presented, including 38 lectins, which were identified from the class of demosponges, and one lectin from the class of hexactinellida. Their purification from crude extracts was mainly performed by using affinity chromatography and gel filtration techniques. Other protocols were also developed in order to collect and study sponge lectins, including screening of sponge genomes and expression in heterologous bacterial systems. The characterization of the lectins was performed by Edman degradation or mass spectrometry. Regarding their physiological roles, sponge lectins showed to be involved in morphogenesis and cell interaction, biomineralization and spiculogenesis, as well as host defense mechanisms and potentially in the association between the sponge and its microorganisms. In addition, these lectins exhibited a broad range of bioactivities, including modulation of inflammatory response, antimicrobial and cytotoxic activities, as well as anticancer and neuromodulatory activity. In view of their potential pharmacological applications, sponge lectins constitute promising molecules of biotechnological interest.
Antiproliferative activity of cytotoxic tuber lectins from Solanum ...
African Journals Online (AJOL)
Twenty (20) kDa chitin-binding lectins from Solanum tuberosum tubers, STL-S and STL-D were purified through ion-exchange and affinity chromatographic methods, hemagglutinating activity and blood group specificity of the lectins were checked whereas the cytotoxicity was determined using brine shrimp (Artemia salina ...
An alpha-glucosidase inhibitory activity of thermostable lectin ...
African Journals Online (AJOL)
An alpha-glucosidase inhibitory activity of thermostable lectin protein from Archidendron jiringa Nielsen seeds. ... A novel GI lectin was enriched from the seeds of the Djenkol bean, A. jiringa, to apparent homogeneity by 90% saturation ammonium sulfate precipitation and Con A-Sepharose affinity column chromatography.
Directory of Open Access Journals (Sweden)
Lana Zoric
2015-06-01
Full Text Available The effect of intercropping on stem anatomy of both supporting (Lupinus albus and supported (Vicia narbonnensis and V. sativa annual forage legumes was investigated using stereological method. Intercropped plants showed minimal differences in volume densities (Vv of stem tissues and forage chemical composition compared to sole crops. The proportions of lignin and NDF (Neutral Detergent Fiber positively correlated with xylem Vv. The proportions of ADF (Acid Detergent Fiber, cellulose and ash in intercropped plants were increased or decreased mostly by less than 10% compared to those in pure stands. The Anatomical Equivalent Ratio (AER defined as the ratio based on anatomical quality-determining parameters, can assist in the evaluation of the benefits of specific intercropping systems. Intercropping of the legume species studied in this work, especially L. albus with V. sativa, showed encouraging results from anatomical perspective since it would not cause a decline of forage quality.
Energy Technology Data Exchange (ETDEWEB)
Andres, A.; Millan, R.; Esteban, E.
2010-03-08
This study is framed in the project Recuperation de suelos contaminados por mercurio: recomendaciones de uso de suelos y plantas en la comarca minera de Almaden (REUSA), funded by Spanish Ministry of Education and Science. Moreover, this article is the result of the work carried out by Andres Andres for his Bachelors dissertation. Soils from the Almaden mining district are contaminated with high mercury concentrations, due to the extraction activities of that metal through the years. After the end of mining exploitation, which was the main source of wealth in the region, alternative uses of soils are needed in order to promote the socio-economic development of the studied area. The project here intends to evaluate the viability of the common vetch (Vicia sativa L.) crop in a substrate under similar conditions to the ones observed in the Almaden soils, by studying the mercury absorption capacity of the above mentioned species. (Author) 20 refs.
Current status of lectin-based cancer diagnosis and therapy
Directory of Open Access Journals (Sweden)
Fohona S. Coulibaly
2017-01-01
Full Text Available Lectins are carbohydrate recognizing proteins originating from diverse origins in nature, including animals, plants, viruses, bacteria and fungus. Due to their exceptional glycan recognition property, they have found many applications in analytical chemistry, biotechnology and surface chemistry. This manuscript explores the current use of lectins for cancer diagnosis and therapy. Moreover, novel drug delivery strategies aiming at improving lectin’s stability, reducing their undesired toxicity and controlling their non-specific binding interactions are discussed. We also explore the nanotechnology application of lectins for cancer targeting and imaging. Although many investigations are being conducted in the field of lectinology, there is still a limited clinical translation of the major findings reported due to lectins stability and toxicity concerns. Therefore, new investigations of safe and effective drug delivery system strategies for lectins are warranted in order to take full advantage of these proteins.
Use of amaranthus leucocarpus lectin to differentiate cervical dysplasia (CIN).
Santaella-Verdejo, Arturo; Gallegos, Belem; Pérez-Campos, Eduardo; Hernández, Pedro; Zenteno, Edgar
2007-01-01
Alterations in O-glycosylation of proteins in cell surfaces can originate disorder in cellular function, as well as in cell transformation and tumoral differentiation. In this work, we investigate changes in O-glycosylation in cervical intraepithelial dysplasia (CIN) at different stages of differentiation (CIN I, CIN II, and CIN III) using lectins specific for O-glycosidically linked glycans. Twenty cases with CIN I, CIN II, and CIN III dysplasias each, and 20 normal cases were studied by lectin histochemistry and evaluated under optical microscopy. The lectins from Glycine max and Griffonia simplicifolia showed no differences in their recognition pattern among the different CIN stages and normal tissue. Dolichos Biflorus lectin recognized CIN I dysplasia. Lectin from Amaranthus leucocarpus showed increased reactivity in the presence of CIN II dysplasia, compared with CIN I and CIN III. These results suggest that subtle modifications in the O-glycosylation pattern could be considered in diagnosis or prognosis of cervical precancerous stages.
Directory of Open Access Journals (Sweden)
Krehenbrink Martin
2008-01-01
Full Text Available Abstract Background Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Results Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP, a twin-arginine translocase (TAT secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP were generated, but only mutations affecting the PrsDE (Type I and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. Conclusion None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V is required for establishing the symbiosis with legumes. The PrsDE (Type I system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to
Krehenbrink, Martin; Downie, J Allan
2008-01-29
Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP), a twin-arginine translocase (TAT) secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP) were generated, but only mutations affecting the PrsDE (Type I) and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V) is required for establishing the symbiosis with legumes. The PrsDE (Type I) system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to the genes encoding the secretion system itself.
Influence of salicylic acid on seed germination of Vicia faba L. under salt stress
Fatima Anaya; Rachid Fghire; Said Wahbi; Kenza Loutfi
2018-01-01
Seed germination is the critical stage for species survival. Salinity affects germination and seedling growth and yield of several crop species, such as broad bean. That is why this study was carried to evaluate the effects of NaCl on seed germination and influence of salicylic acid on seed in order to improving salt tolerant on broad bean. Vicia faba L. is an important pulse crop in the Mediterranean region. In many cases broad bean is grown on saline soils where growth and yield are limited...
Genetic diversity and population structure of faba bean (Vicia faba) from Turkey
Göl, Şurhan; DOĞANLAR, Sami; FRARY, Anne
2016-01-01
Faba bean (Vicia faba L.) is an important food and feed legume because of the nutritional value of its seed protein and starch content, good biomass, and high efficiency nitrogen fixation.This study analyzed the molecular genetic diversity and population structure of 101 Turkish faba bean accessions using simple sequence repeat (SSR) markers.A total of 32 SSR markers yielded 281 loci of which 277 (98.6%) were polymorphic.Mean dissimilarity between genotypes was 0.355, a relatively high value ...
Weihua, WU; Sarah M., ASSMANN; The Biological Laboratories, Harvard University:(Current)Biology Department, Pennsylvania State University
1993-01-01
The properties of photosynthetic O_2 evolution by mesophyll cell chloroplasts (MCC) and guard cell chloroplasts (GCC) isolated from protoplasts of Vicia faba L. have been studied and effects on O_2 evolution of factors known to regulate stomatal movements have been compared. The O_2 evolution of GCC was CO_2-dependent. The saturating light intensity for O_2 evolution was between 150 and 200 μmol m^ s^ for MCC and was between 400 and 1,000μmol m^ s^ for GCC. Light quality (red vs. blue) had no...
DmeRF system is required for nickel and cobalt resistance in Rhizobium leguminosarum bv. viciae.
Rubio Sanz, Laura; Prieto Carbajo, Rosa Isabel; Palacios Alberti, Jose Manuel; Brito Lopez, Maria Belen
2013-01-01
A member of the Cation Diffusion Facilitator (CDF) family with high sequence similarity to DmeF (Divalent metal efflux) from Cupridavirus metallidurans was identified in Rhizobium leguminosarum bv. viciae UPM1137. The R. leguminosarum dmeF mutant strain was highly sensitive to Co2+ and moderately sensitive to Ni2+, but its tolerance to other metals such as Zn2+, Cu2+ or Mn2+ was unaffected. An open reading frame located upstream of R. leguminosarum dmeF, designated dmeR, encodes a protein hom...
Stefan Martyniuk; Monika Kozieł; Anna Gałązka
2015-01-01
The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv) in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv) i...
Lectin activity in mycelial extracts of Fusarium species
Directory of Open Access Journals (Sweden)
Ranjeeta Bhari
Full Text Available ABSTRACT Lectins are non-immunogenic carbohydrate-recognizing proteins that bind to glycoproteins, glycolipids, or polysaccharides with high affinity and exhibit remarkable ability to agglutinate erythrocytes and other cells. In the present study, ten Fusarium species previously not explored for lectins were screened for the presence of lectin activity. Mycelial extracts of F. fujikuroi, F. beomiformii, F. begoniae, F. nisikadoi, F. anthophilum, F. incarnatum, and F. tabacinum manifested agglutination of rabbit erythrocytes. Neuraminidase treatment of rabbit erythrocytes increased lectin titers of F. nisikadoi and F. tabacinum extracts, whereas the protease treatment resulted in a significant decline in agglutination by most of the lectins. Results of hapten inhibition studies demonstrated unique carbohydrate specificity of Fusarium lectins toward O-acetyl sialic acids. Activity of the majority of Fusarium lectins exhibited binding affinity to D-ribose, L-fucose, D-glucose, L-arabinose, D-mannitol, D-galactosamine hydrochloride, D-galacturonic acid, N-acetyl-d-galactosamine, N-acetyl-neuraminic acid, 2-deoxy-D-ribose, fetuin, asialofetuin, and bovine submaxillary mucin. Melibiose and N-glycolyl neuraminic acid did not inhibit the activity of any of the Fusarium lectins. Mycelial extracts of F. begoniae, F. nisikadoi, F. anthophilum, and F. incarnatum interacted with most of the carbohydrates tested. F. fujikuroi and F. anthophilum extracts displayed strong interaction with starch. The expression of lectin activity as a function of culture age was investigated. Most species displayed lectin activity on the 7th day of cultivation, and it varied with progressing of culture age.
DEFF Research Database (Denmark)
Sørensen, GL; Petersen, I; Thiel, Steffen
2007-01-01
The lectin pathway of the complement system is activated when Mannan-binding lectin (MBL) in complex with MASP-2 binds microorganisms. Polymorphisms in both genes are responsible for low serum levels, which associate with increased risk of infection and autoimmune disease. The present study...
DEFF Research Database (Denmark)
Sorensen, Grith L; Petersen, Inge; Thiel, Steffen
2007-01-01
The lectin pathway of the complement system is activated when Mannan-binding lectin (MBL) in complex with MASP-2 binds microorganisms. Polymorphisms in both genes are responsible for low serum levels, which associate with increased risk of infection and autoimmune disease. The present study...
Rosén, S.; Kata, M.; Persson, Y.; Lipniunas, P.H.; Wikström, M.; Hondel, C.A.M.J.J. van den; Brink, J.M. van den; Rask, L.; Hedén, L.O.; Tunlid, A.
1996-01-01
It has been proposed that the interactions between several parasite and pathogenic fungi and their hosts are mediated by soluble lectins present in the fungus. We have cloned and analyzed a gene encoding such a lectin (AOL) from the nematophagous fungus Arthrobotrys oligospora (deuteromycete). The
Directory of Open Access Journals (Sweden)
B. Lorestani
2012-11-01
Full Text Available Pollution results when a change in the environment harmfully affects the quality of human life including effect on animals, microorganisms and plants. Among the broad range of organic pollutants contaminating soil-water environment, polycyclic aromatic hydrocarbons are of great environment concern. Oil contaminated soil will affect germination, plant height, leaf area and biomass production. The aim of this research was to elucidate effects of oil pollution on morphological characteristics in Fabaceae family. For this purpose species of Faba vulgaris and Vicia ervilia were planted in different concentrations of oil in soil. For morphological studies, studied species were removed from polluted and non polluted soils separately and some morphological characters were studied in these species, then these characters were compared in plants, collected from polluted and non polluted soil. Finally, the level of significance of these differences was elucidated by using of SPSS. Obtained results showed that oil pollution can cause some abnormalities in structure of vegetative parts in plants grown on polluted soils. Decreasing of plant length and stem diameter and changing the leaf shape was among the most important effects of oil on morphological characteristics in Faba vulgaris and Vicia ervilia.
[Effect of soil compaction on Vicia faba of growth in the Loess Plateau].
Nan, Zhibiao; Zhao, Hongyang; Nie, Bin
2002-08-01
The effect of soil compaction on the growth of Vicia faba was studied by pot experiment, field plot experiment, and farmers' field production during two consecutive years. The results showed that increasing soil bulk density at 0-7 cm depth significantly decreased the root and shoot dry weight per plant, increased plant mortality caused by Fusarium species, and decreased seed yields. Field experiments indicated that compared to the plants grown on the plots with soil bulk density of 1.55 and 1.64 g.cm-3, the root and shoot dry weight of plants grown on the plots with soil bulk density of 1.84 g.cm-3 decreased by 30.8% and 27.9%, respectively, while the plant mortality rate increased by 21.0-48.7%, and seed yields decreased by 19.8%. The trials conducted on eight farmers' land illustrated that there existed significant negative correlations between soil bulk density in Spring and root and shoot dry weight of Vicia faba seedlings, and between soil bulk density in Autumn and seed yields. The causes of high soil compaction were discussed, and suggestions for improving soil quality were presented.
Lectin domains at the frontiers of plant defense
Directory of Open Access Journals (Sweden)
Nausicaä eLANNOO
2014-08-01
Full Text Available Plants are under constant attack from pathogens and herbivorous insects. To protect and defend themselves, plants evolved a multi-layered surveillance system, known as the innate immune system. Plants sense their encounters upon perception of conserved microbial structures and damage-associated patterns using cell-surface and intracellular immune receptors. Plant lectins and proteins with one or more lectin domains represent a major part of these receptors. The whole group of plant lectins comprises an elaborate collection of proteins capable of recognizing and interacting with specific carbohydrate structures, either originating from the invading organisms or from damaged plant cell wall structures. Due to the vast diversity in protein structures, carbohydrate recognition domains and glycan binding specificities, plant lectins constitute a very diverse protein superfamily. In the last decade, new types of nucleocytoplasmic plant lectins have been identified and characterized, in particular lectins expressed inside the nucleus and the cytoplasm of plant cells often as part of a specific plant response upon exposure to different stress factors or changing environmental conditions. In this review, we provide an overview on plant lectin motifs used in the constant battle against pathogens and predators during plant defenses.
Lectins stain cells differentially in the coral, Montipora capitata
Work, Thierry M.; Farah, Yael
2014-01-01
A limitation in our understanding of coral disease pathology and cellular pathogenesis is a lack of reagents to characterize coral cells. We evaluated the utility of plant lectins to stain tissues of a dominant coral, Montipora capitata, from Hawaii. Of 22 lectins evaluated, nine of these stained structures in the upper or basal body wall of corals. Specific structures revealed by lectins that were not considered distinct or evident on routine hematoxylin and eosin sections of coral tissues included apical and basal granules in gastrodermis and epidermis, cnidoglandular tract and actinopharynx cell surface membranes, capsules of mature holotrichous isorhizas, and perivitelline and periseminal cells. Plant lectins could prove useful to further our understanding of coral physiology, anatomy, cell biology, and disease pathogenesis.
Isolation and characterization of a lectin from Annona muricata seeds.
Damico, D C S; Freire, M G M; Gomes, V M; Toyama, M H; Marangoni, S; Novello, J C; Macedo, M L R
2003-11-01
A lectin with a high affinity for glucose/mannose was isolated from Annona muricata seeds (Annonaceae) by gel filtration chromatography on Sephacryl S-200, ion exchange chromatography on a DEAE SP-5 PW column, and molecular exclusion on a Protein Pak Glass 300 SW column. Sodium dodecyl sulfate polyacrylamide gel electrophoresis (PAGE) yielded two protein bands of approximately 14 kDa and 22 kDa. However, only one band was seen in native PAGE. The Mr of the lectin estimated by fast-performance liquid chromatography-gel filtration on Superdex 75 was 22 kDa. The lectin was a glycoprotein with 8% carbohydrate (neutral sugar) and required divalent metal cations (Ca2+, Mg2+, and Mn2+) for full activity. Amino acid analysis revealed a large content of Glx, Gly, Phe, and Lys. The lectin agglutinated dog, chicken, horse, goose, and human erythrocytes and inhibited the growth of the fungi Fusarium oxysporum, Fusarium solani, and Colletotrichum musae.
Antiproliferative activity of cytotoxic tuber lectins from Solanum ...
African Journals Online (AJOL)
SAM
2014-04-09
tumor potential against experimentally induced Ehrlich ascites carcinoma in Swiss albino mice was evaluated. Twenty. (20) kDa chitin-binding lectins from Solanum tuberosum tubers, STL-S and STL-D were purified through.
Antiproliferative activity of cytotoxic tuber lectins from Solanum ...
African Journals Online (AJOL)
SAM
2014-04-09
Apr 9, 2014 ... 2Laboratory of Glycobiology and Marine Biochemistry, Department of Life and Environmental System ... Plant lectins have been widely studied for pharmaco- ... hevein domains, the type 2 ribosome-inactivating proteins.
Directory of Open Access Journals (Sweden)
Juliana Montezuma Barbosa Monteiro Tínel
2014-01-01
Full Text Available Leishmaniasis is a vector-borne disease transmitted by phlebotomine sand fly. Susceptibility and refractoriness to Leishmania depend on the outcome of multiple interactions that take place within the sand fly gut. Promastigote attachment to sand fly midgut epithelium is essential to avoid being excreted together with the digested blood meal. Promastigote and gut sand fly surface glycans are important ligands in this attachment. The purpose of the present study was to evaluate the interaction of three lectins isolated from leguminous seeds (Diocleinae subtribe, D-glucose and D-mannose-binding, with glycans on Lutzomyia migonei midgut. To study this interaction the lectins were labeled with FITC and a fluorescence assay was performed. The results showed that only Dioclea violacea lectin (DVL was able to interact with midgut glycans, unlike Cratylia floribunda lectin (CFL and Canavalia gladiata lectin (CGL. Furthermore, when DVL was blocked with D-mannose the interaction was inhibited. Differences of spatial arrangement of residues and volume of carbohydrate recognition domain (CRD may be the cause of the fine specificity of DVL for glycans in the surface on Lu. migonei midgut. The findings in this study showed the presence of glycans in the midgut with glucose/mannose residues in its composition and these residues may be important in interaction between Lu. migonei midgut and Leishmania.
Identification and characterization of a novel legume-like lectin ...
Indian Academy of Sciences (India)
A legume-type lectin (L-lectin) gene of the red algae Gracilaria fisheri (GFL) was cloned by rapid amplification of cDNA ends (RACE). The full-length cDNA of GFL was 1714 bp and contained a 1542 bp open reading frame encoding 513 amino acids with a predicted molecular mass of 56.5 kDa. Analysis of the putative ...
"Click" saccharide/beta-lactam hybrids for lectin inhibition.
Palomo, Claudio; Aizpurua, Jesus M; Balentová, Eva; Azcune, Itxaso; Santos, J Ignacio; Jiménez-Barbero, Jesús; Cañada, Javier; Miranda, José Ignacio
2008-06-05
Hybrid glycopeptide beta-lactam mimetics designed to bind lectins or carbohydrate recognition domains in selectins have been prepared according to a "shape-modulating linker" design. This approach was implemented using the azide-alkyne "click" cycloaddition reaction, and as shown by NMR/MD experiments, binding of the resulting mimetics to Ulex Europaeus Lectin-1 (UEL-1) occurred after a "bent-to-extended" conformational change around a partially rotatable triazolylmethylene moiety.
Probing lectin-mucin interactions by isothermal titration microcalorimetry.
Dam, Tarun K; Brewer, C Fred
2015-01-01
Isothermal titration microcalorimetry (ITC) can directly determine the thermodynamic binding parameters of biological molecules including affinity constant, binding stoichiometry, and heat of binding (enthalpy) and indirectly the entropy and free energy of binding. ITC has been extensively used to study the binding of lectins to mono- and oligosaccharides, but limited applications to lectin-glycoprotein interactions. Inherent experimental challenges to ITC include sample precipitation during the experiment and relative high amount of sample required, but careful design of experiments can minimize these problems and allow valuable information to be obtained. For example, the thermodynamics of binding of lectins to multivalent globular and linear glycoproteins (mucins) have been described. The results are consistent with a dynamic binding mechanism in which lectins bind and jump from carbohydrate to carbohydrate epitope in these molecules leading to increased affinity. Importantly, the mechanism of binding of lectins to mucins appears similar to that for a variety of protein ligands binding to DNA. Recent results also show that high affinity lectin-mucin cross-linking interactions are driven by favorable entropy of binding that is associated with the bind and jump mechanism. The results suggest that the binding of ligands to biopolymers, in general, may involve a common mechanism that involves enhanced entropic effects that facilitate binding interactions.
Structural analysis of Centrolobium tomentosum seed lectin with inflammatory activity.
Almeida, Alysson Chaves; Osterne, Vinicius Jose da Silva; Santiago, Mayara Queiroz; Pinto-Junior, Vanir Reis; Silva-Filho, Jose Caetano; Lossio, Claudia Figueiredo; Nascimento, Francisco Lucas Faustino; Almeida, Ricardo Patricio Honorato; Teixeira, Claudener Souza; Leal, Rodrigo Bainy; Delatorre, Plinio; Rocha, Bruno Anderson Matias; Assreuy, Ana Maria Sampaio; Nascimento, Kyria Santiago; Cavada, Benildo Sousa
2016-04-15
A glycosylated lectin (CTL) with specificity for mannose and glucose has been detected and purified from seeds of Centrolobium tomentosum, a legume plant from Dalbergieae tribe. It was isolated by mannose-sepharose affinity chromatography. The primary structure was determined by tandem mass spectrometry and consists of 245 amino acids, similar to other Dalbergieae lectins. CTL structures were solved from two crystal forms, a monoclinic and a tetragonal, diffracted at 2.25 and 1.9 Å, respectively. The carbohydrate recognition domain (CRD), metal-binding site and glycosylation site were characterized, and the structural basis for mannose/glucose-binding was elucidated. The lectin adopts the canonical dimeric organization of legume lectins. CTL showed acute inflammatory effect in paw edema model. The protein was subjected to ligand screening (dimannosides and trimannoside) by molecular docking, and interactions were compared with similar lectins possessing the same ligand specificity. This is the first crystal structure of mannose/glucose native seed lectin with proinflammatory activity isolated from the Centrolobium genus. Copyright © 2016 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Ma, Ying Jie; Skjoedt, Mikkel-Ole; Garred, Peter
2013-01-01
Collectins and ficolins are important in the clearance of endogenous and exogenous danger materials. A new human collectin-11 was recently identified in low concentration in serum in complex with mannose-binding lectin (MBL)/ficolin-associated serine proteases. Collectin-11 binds to carbohydrate...... residues present on various microorganisms. Thus, we hypothesized that collectin-11 could be a novel initiation molecule in the lectin pathway of complement. We can show that collectin-11 associates with all the known MBL-associated serine proteases (MASP-1, MASP-2 and MASP-3) as well as the lectin...... complement complex on C. albicans. Moreover, spiking collectin-11-depleted serum, which did not mediate complement activation, with recombinant collectin-11 restored the complement activation capability. These results define collectin-11 as the fifth recognition molecule in the lectin complement pathway...
Kruhova, O D; Mandrovs'ka, N M; Kyrychenko, O V
2006-01-01
The presawing treatment of wheat seeds by lectin specific to the plant and its compositions with gapten and nitrogen fixation bacteria on the change in enzyme activity of antioxidant system of plant protection (peroxydase and katalase), endogenous lectin activity and flavonoid content in wheat leaves was studied in vegetation experiments. It is shown, that different biochemical links of protection plant system are activated, i.e. lectin activity in leaves increases 1.3 to 1.5 times, peroxydase activity and katalase activity rises 1.5 times and 5.0 to 8.0 times respectively and flavonoide content in leaves of vegetating plants increases under normal conditions of plant growth at the influence of factors of lectin nature.
Changes Germination, Growth and Anatomy Vicia ervilia in Response to Light Crude Oil Stress
Directory of Open Access Journals (Sweden)
Bahareh Lorestani
2014-05-01
Full Text Available Thepetroleum concentrations are contaminant important sources in the environment. Hydrocarbon’s contaminants depend on their type and concentration can cause variable toxicity in soils, on the other hand, different kinds of plants also response concentration of contaminant differently, because of the diversity of physiological and morphological characteristics. In this study the effect of different concentrations of light crude oil was investigated on stem length, germination and anatomical of Vicia ervilia. A factorial experiment was used with a randomized complete block design (RCBD with three replications. The results showed that the germination and stem lengths decreased significantly (p≤ 0.05 with increasing concentrations of petroleum. Anatomical studies the changes of parenchyma, vascular bundles, epidermal and increase crack showed.
Vicia faba Hypersensitivity and ASA Intolerance in a Farmer: A Case Report
Directory of Open Access Journals (Sweden)
Elisabetta Damiani
2011-01-01
Full Text Available The IgE-mediated allergic reactions to food are caused, generally, by ingestion. However, they can be rarely induced by exposure to airborne food particles through the handling or the cooking. Vicia faba is a vegetable which belongs to Legumes or Fabaceae family, Fabales order. Allergic reactions after ingestion of legumes and cases of asthma after exposure to the cooking vapors have been reported in the literature. A paper assessed the volatile substances (insect repellents released by V. faba. The authors demonstrated that this plant produces several chemical substances, such as small quantities of methyl salicylate. We describe a case of occupational allergy, induced by handling during picking up of fresh broad beans, in a farmer with history of adverse reaction after eating the cooked and raw vegetable.
African Journals Online (AJOL)
evaluate symbiotic characteristics between the crop and the rhizobia in major faba bean producing areas in Tigray ... Nodulation status of the field crops was poor except Ofla, D/Temben and Alaje districts. Though the ..... acknowledge Solomon Hishe and Biadglegn Desmisse for GIS data processing. 6. REFERENCE.
African Journals Online (AJOL)
ABSTRACT: The failure of faba bean production in some regions of Semien. Shewa necessitated a research for a ... ppm) and potassium, a high concentration of calcium and magnesium, and a lower population density of .... Magnesium sulphate, 0.5g; Sodium chloride, 0.2g; Yeast extract, 0.1g;. Mannitol, 10g; Agar, 15.
African Journals Online (AJOL)
the color of nodules (pink which is effective, white which is ineffective in nitrogen fixation). The variation in nodule number and color in turn induce variation in growth and yield of the host due to variation in fixed N (Lupwayi and Mkandawire, 1996; Amijee and Giller, 1998). Faba bean in association with rhizobia can fix up to ...
Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli
2015-04-01
Plant-growth-promoting bacteria (PGPR) may help reduce the toxicity of heavy metals in plants in polluted environments. In this work, the effects of dual inoculation with Rhizobium and PGPR strains on the growth of Vicia faba grown under copper stress were assessed during hydroponic culture. Growth parameters, copper (Cu) accumulation and antioxidant enzyme activities were studied. Copper concentrations above 1mM damaged plant growth, but co-inoculation reduced its harmful effect. Co-inoculation of plants treated with 1mM Cu and 2mM Cu increased the dry weights as compared with Cu-treated and uninoculated plants. However, it decreased copper uptake up to 80% in the roots of 1-mM-Cu-treated plants as compared to non-inoculated control. Copper tolerance in Vicia faba is linked to the activity of antioxidant systems that are modulated by metal concentrations: both superoxide dismutase (SOD) and catalase (CAT) were higher in the presence of Cu; a lower Cu dose of 0.5mM stimulated ascorbate peroxidase (APX) and/or peroxidase (POX) activities in shoots and roots; however in nodules CAT appeared to be the main peroxidase in H2O2 scavenging. The 1mM Cu treatment enhanced SOD, CAT and APX activities in roots and only SOD and POX were activated in shoots. All enzyme activities were inhibited by inoculation of 2mM Cu. The effect of inoculation with copper-accumulating PGPRs and the status of the antioxidant enzyme system were linked to changes in the copper tolerance status of Vicia faba. Our results suggested that Vicia faba inoculation with Rhizobium and PGPR Enterobacter clocae and Pseudomonas sp. could help to alleviate copper stress under hydroponic conditions. This result should be tested under field conditions for soil fertilization and phytostabilisation purposes. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.
Effect of fulvic acids on lead-induced oxidative stress to metal sensitive Vicia faba L. plant
Shahid, Muhammad; Dumat, Camille; Silvestre, Jérôme; Pinelli, Eric
2012-01-01
International audience; Lead (Pb) is a ubiquitous environmental pollutant capable to induce various morphological, physiological, and biochemical functions in plants. Only few publications focus on the influence of Pb speciation both on its phytoavailability and phytotoxicity. Therefore, Pb toxicity (in terms of lipid peroxidation, hydrogen peroxide induction, and photosynthetic pigments contents) was studied in Vicia faba plants in relation with Pb uptake and speciation. V. faba seedlings we...
Cotelle, Sylvie; Dhyèvre, Adrien; Muller, Serge; Chenon, Pascale; Manier, Nicolas; Pandard, Pascal; Echairi, Abdelwahad; Silvestre, Jérôme; Guiresse, Maritxu; Pinelli, Eric; Giorgetti, Lucia; Barbafieri, Meri; Silva, Valéria C; Engel, Fernanda; Radetski, Claudemir M
2015-01-01
The Vicia micronucleus assay was standardized in an international protocol, ISO 29200, "Assessment of genotoxic effects on higher plants-Vicia faba micronucleus test," for soil or soil materials (e.g., compost, sludge, sediment, waste, and fertilizing materials). The aim of this interlaboratory study on the Vicia micronucleus assay was to investigate the robustness of this in vivo assay in terms of its applicability in different countries where each participant were asked to use their own seeds and reference soil, in agreement with the ISO 29200 standard. The ISO 29200 standard protocol was adopted for this study, and seven laboratories from three countries (France, Italy, and Brazil) participated in the study. Negative and positive controls were correctly evaluated by 100 % of the participants. In the solid-phase test, the micronucleus frequency (number of micronuclei/1,000 cells) varied from 0.0 to 1.8 for the negative control (i.e., Hoagland's solution) and from 5.8 to 85.7 for the positive control (i.e., maleic hydrazide), while these values varied from 0.0 to 1.7 for the negative control and from 14.3 to 97.7 for the positive control in the case of liquid-phase test. The variability in the data obtained does not adversely affect the robustness of the protocol assessed, on the condition that the methodology described in the standard ISO 29200 is strictly respected. Thus, the Vicia micronucleus test (ISO 29200) is appropriate for complementing prokaryotic or in vitro tests cited in legislation related to risk assessment of genotoxicity potential.
Genome-wide identification and domain organization of lectin domains in cucumber.
Dang, Liuyi; Van Damme, Els J M
2016-11-01
Lectins are ubiquitous proteins in plants and play important roles in a diverse set of biological processes, such as plant defense and cell signaling. Despite the availability of the Cucumis sativus L. genome sequence since 2009, little is known with respect to the occurrence of lectins in cucumber. In this study, a total of 146 putative lectin genes belonging to 10 different lectin families were identified and localized in the cucumber genome. Domain architecture analysis revealed that most of these lectin gene sequences contain multiple domains, where lectin domains are linked with other domains, as such creating chimeric lectin sequences encoding proteins with dual activities. This study provides an overview of lectin motifs in cucumber and will help to understand their potential biological role(s). Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Lectin switching during dengue virus infection.
Dejnirattisai, Wanwisa; Webb, Andrew I; Chan, Vera; Jumnainsong, Amonrat; Davidson, Andrew; Mongkolsapaya, Juthathip; Screaton, Gavin
2011-06-15
Dengue virus receptors are relatively poorly characterized, but there has been recent interest in 2 C-type lectin molecules, dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN) and its close homologue liver/lymph node-specific ICAM-3-grabbing integrin (L-SIGN), which can both bind dengue and promote infection. In this report we have studied the interaction of dengue viruses produced in insect cells, tumor cell lines, and primary human dendritic cells (DCs) with DC-SIGN and L-SIGN. Virus produced in primary DCs is unable to interact with DC-SIGN but remains infectious for L-SIGN-expressing cells. Skin-resident DCs may thus be a site of initial infection by insect-produced virus, but DCs will likely not participate in large-scale virus replication during dengue infection. These results reveal that differential glycosylation of dengue virus envelope protein is highly dependent on cell state and suggest that studies of virus tropism using virus prepared in insect cells or tumor cell lines should be interpreted with caution.
Energy Technology Data Exchange (ETDEWEB)
Foltete, Anne-Sophie, E-mail: as.foltete@yahoo.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Masfaraud, Jean-Francois, E-mail: masfa@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Bigorgne, Emilie, E-mail: emilie.bigorgne@umail.univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Nahmani, Johanne, E-mail: Johanne.nahmani@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Chaurand, Perrine, E-mail: chaurand@cerege.fr [Centre Europeen de Recherches et d' Enseignement des Geosciences de l' Environnement (CEREGE), UMR 6635 CNRS/Aix-Marseille Universite, Europole de l' Arbois, 13545 Aix-en-Provence (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France)
2011-10-15
Mineral sunscreen nanocomposites, based on a nano-TiO{sub 2} core, coated with aluminium hydroxide and dimethicone films, were submitted to an artificial ageing process. The resulting Altered TiO{sub 2} Nanocomposites (ATN) were then tested in the liquid phase on the plant model Vicia faba, which was exposed 48 h to three nominal concentrations: 5, 25 and 50 mg ATN/L. Plant growth, photosystem II maximum quantum yield, genotoxicity (micronucleus test) and phytochelatins levels showed no change compared to controls. Oxidative stress biomarkers remained unchanged in shoots while in roots, glutathione reductase activity decreased at 50 mg ATN/L and ascorbate peroxidase activity decreased for 5 and 25 mg ATN/L. Nevertheless, despite the weak response of biological endpoints, ICP-MS measurements revealed high Ti and Al concentrations in roots, and X-ray fluorescence micro-spectroscopy revealed titanium internalization in superficial root tissues. Eventual long-term effects on plants may occur. - Highlights: > TiO{sub 2}-containing sunscreen nanocomposites were artificially aged. > Vicia faba was exposed 48 h to the alteration byproducts in liquid phase. > Few endpoints were modified significantly from control. > A clogging on the roots and titanium penetration in tissues were suspected. > Eventual long-term effects of the particles may occur. - Artificially aged TiO{sub 2}-containing sunscreen nanocomposites caused few damages to Vicia faba in 48 h exposure, but particles clogged on roots and Ti entered the root tissues.
Directory of Open Access Journals (Sweden)
Josef Houser
Full Text Available Protein-carbohydrate interactions are very often mediated by the stacking CH-π interactions involving the side chains of aromatic amino acids such as tryptophan (Trp, tyrosine (Tyr or phenylalanine (Phe. Especially suitable for stacking is the Trp residue. Analysis of the PDB database shows Trp stacking for 265 carbohydrate or carbohydrate like ligands in 5 208 Trp containing motives. An appropriate model system to study such an interaction is the AAL lectin family where the stacking interactions play a crucial role and are thought to be a driving force for carbohydrate binding. In this study we present data showing a novel finding in the stacking interaction of the AAL Trp side chain with the carbohydrate. High resolution X-ray structure of the AAL lectin from Aleuria aurantia with α-methyl-l-fucoside ligand shows two possible Trp side chain conformations with the same occupation in electron density. The in silico data shows that the conformation of the Trp side chain does not influence the interaction energy despite the fact that each conformation creates interactions with different carbohydrate CH groups. Moreover, the PDB data search shows that the conformations are almost equally distributed across all Trp-carbohydrate complexes, which would suggest no substantial preference for one conformation over another.
Lectin Activity in Gut Extract of Culex pipiens.
Directory of Open Access Journals (Sweden)
Mona Koosha
2013-06-01
Full Text Available The role of lectins is important in interaction between pathogens and mosquito vectors. This study was performed to identify agglutinin activities of protein molecules on the midgut of Culex pipiens.Culex pipiens was reared in insectray condition and the midguts of males and females (blood fed and unfed were dissected separately in Tris-HCl buffer. The extracts of midguts were applied for hemagglutinin assay against red blood cells of rabbit, mouse, rat, dog, horse, sheep, guinea pig, cow, human (A, B, AB, O groups. Then, the RBCs with relatively high agglutinin activity were chosen for carbohydrate inhibition assay. D (+ glucose, D (+ galactose, D (+ mannose, D (- fructose, D (- arabinose, L (- fucose, lactose, N-acetyl-D-glucosamine, N-acetyl-D-galactosamine, sialic acid were used to specify carbohydrate binding lectin.The highest agglutinin activities were found against sheep and rabbits RBCs. Sexual diversity of agglutinin activities was observed among midgut extraction of males and females. In addition, variation in agglutinin activity of blood fed and unfed female mosquitoes were detected. The lectin activity was inhibited highly with glucose, galactose, fucose and fructose but less inhibitor activities was observed by arabinose, N-acetyl-D-galactosamine, n-acetyl-d-glucosamine, lactose and mannose.The secretion of hemagglutinins (lectins or lectin-like molecules in the digestive system depends on the type of food in the gut. This suggests that emptying of the gut in preparation for protein rich food probably starts the secretion of hemagglutinins.
Singh, Ram Sarup; Bhari, Ranjeeta; Rai, Jyoti
2010-02-01
Fifteen species of Aspergillus were screened for occurrence of lectins. Nine of them (A. sydowii, A. candidus, A. allahabadi, A. terricola, A. ficuum, A. sparsus, A. carneus, A. pulvinus and A. aculeatus) were found to possess lectin activity. None of the species elaborated lectin in culture supernatant. All the lectins agglutinated rat, pig and rabbit erythrocytes. A. sydowii, A. candidus, A. allahabadi, A. terricola, A. ficuum, A. sparsus, A. carneus and A. aculeatus lectins agglutinated all human type erythrocytes equally, while A. pulvinus lectin specifically agglutinated human type A and O erythrocytes. Neuraminidase and protease treatment to erythrocytes substantially augmented lectin titres manyfold. Lectins showed specificity to mucin and asialofetuin and all of them were specific to L-arabinose except that of A. carneus. Lectins from A. sydowii, A. ficuum, A. sparsus and A. carneus displayed remarkable specificities to D-xylose. Maximum lectin activity was expressed by 11 day old cultures of A. sydowii (titre 32), A. ficuum (titre 64) and A. sparsus (titre 1024). Lectins from A. aculeatus, A. candidus and A. terricola were expressed by 7-10 days, 6-9 days and 5-11 days old cultures, respectively. A. allahabadi cultures exhibited maximum lectin activity (titre 32) after 8-10 days of cultivation. A. carneus and A. pulvinus expressed optimal titres of 32 and 8, respectively on the 9th day.
Differential regulation of C-type lectin expression on tolerogenic dendritic cell subsets
van Vliet, Sandra J.; van Liempt, Ellis; Geijtenbeek, Teunis B. H.; van Kooyk, Yvette
2006-01-01
Antigen presenting cells (APC) express high levels of C-type lectins, which play a major role in cellular interactions as well as pathogen recognition and antigen presentation. The C-type lectin macrophage galactose-type lectin (MGL), expressed by dendritic cells (DC) and macrophages, mediates
Lectins binding during alloxan-induced diabetes in rat soleus muscle
African Journals Online (AJOL)
Membrane structural changes of soleus muscle of alloxan-diabetic rats were detected with a panel of six biotinylated lectins. Samples of muscles were obtained from normal and diabetic rats. The biotinylated lectins in staining were detected by avidin-peroxidase complex. Lectin stainning of soleus muscle cryostat sections ...
Marine Sponge Lectins: Actual Status on Properties and Biological Activities
Directory of Open Access Journals (Sweden)
Sandro Mascena Gomes Filho
2014-12-01
Full Text Available Marine sponges are primitive metazoans that produce a wide variety of molecules that protect them against predators. In studies that search for bioactive molecules, these marine invertebrates stand out as promising sources of new biologically-active molecules, many of which are still unknown or little studied; thus being an unexplored biotechnological resource of high added value. Among these molecules, lectins are proteins that reversibly bind to carbohydrates without modifying them. In this review, various structural features and biological activities of lectins derived from marine sponges so far described in the scientific literature are discussed. From the results found in the literature, it could be concluded that lectins derived from marine sponges are structurally diverse proteins with great potential for application in the production of biopharmaceuticals, especially as antibacterial and antitumor agents.
Isolation and Biochemical Characterization of Apios Tuber Lectin
Directory of Open Access Journals (Sweden)
Eri Kenmochi
2015-01-01
Full Text Available Apios tuber lectin, named ATL, was isolated from Apios americana Medikus by two chromatography steps, hydrophobic chromatography and anion-exchange chromatography. The minimum concentration required for the hemagglutination activity toward rabbit erythrocytes of ATL was 4 μg/mL. ATL was composed of a homodimer of 28.4 kDa subunits. The amino acid sequence of ATL was similar to those of other legume lectins. The lectin showed moderate stability toward heating and acidic pH, and the binding affinity against several monosaccharides, such as D-glucosamine and D-galactosamine. ATL also bound to desialylated or agalactosylated glycoproteins such as asialo and agalacto transferrin. ATL decreased the transepithelial electrical resistance across human intestinal Caco-2 cell monolayers, suggesting the effect on the tight junction-mediated paracellular transport.
Ferromagnetic Levan Composite: An Affinity Matrix to Purify Lectin
Directory of Open Access Journals (Sweden)
Renata Angeli
2009-01-01
Full Text Available A simple and inexpensive procedure used magnetite and levan to synthesize a composite recovered by a magnetic field. Lectins from Canavalia ensiformis (Con A and Cratylia mollis (Cramoll 1 and Cramoll 1,4 did bind specifically to composite. The magnetic property of derivative favored washing out contaminating proteins and recovery of pure lectins with glucose elution. Cramoll 1 was purified by this affinity binding procedure in two steps instead of a previous three-step protocol with ammonium sulfate fractionation, affinity chromatography on Sephadex G-75, and ion exchange chromatography through a CM-cellulose column.
Carbohydrate Analogue Microarrays for Identification of Lectin-Selective Ligands.
Hyun, Ji Young; Park, Cheol Wan; Liu, Yanna; Kwon, Daeun; Park, Seong-Hyun; Park, Sungjin; Pai, Jaeyoung; Shin, Injae
2017-06-19
Fifty-five mono- and disaccharide analogues were prepared and used for the construction of microarrays to uncover lectin-selective ligands. The microarray study showed that two disaccharide analogues, 28' and 44', selectively bind to Solanum tuberosum lectin (STL) and wheat germ agglutinin (WGA), respectively. Cell studies indicated that 28' and 44' selectively block the binding of STL and WGA to mammalian cells, unlike the natural ligand LacNAc, which suppresses binding of both STL and WGA to cells. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Tetranectin, a trimeric plasminogen-binding C-type lectin
DEFF Research Database (Denmark)
Holtet, T L; Graversen, Jonas Heilskov; Clemmensen, I
1997-01-01
Tetranectin, a plasminogen-binding protein belonging to the family of C-type lectins, was expressed in E. coli and converted to its native form by in vitro refolding and proteolytic processing. Recombinant tetranectin-as well as natural tetranectin from human plasma-was shown by chemical cross......-linking analysis and SDS-PAGE to be a homo-trimer in solution as are other known members of the collectin family of C-type lectins. Biochemical evidence is presented showing that an N-terminal domain encoded within exons 1 and 2 of the tetranectin gene is necessary and sufficient to govern subunit trimerization....
Soluble Host Defense Lectins in Innate Immunity to Influenza Virus
Ng, Wy Ching; Tate, Michelle D.; Brooks, Andrew G.; Reading, Patrick C.
2012-01-01
Host defenses against viral infections depend on a complex interplay of innate (nonspecific) and adaptive (specific) components. In the early stages of infection, innate mechanisms represent the main line of host defense, acting to limit the spread of virus in host tissues prior to the induction of the adaptive immune response. Serum and lung fluids contain a range of lectins capable of recognizing and destroying influenza A viruses (IAV). Herein, we review the mechanisms by which soluble endogenous lectins mediate anti-IAV activity, including their role in modulating IAV-induced inflammation and disease and their potential as prophylactic and/or therapeutic treatments during severe IAV-induced disease. PMID:22665991
DEFF Research Database (Denmark)
Kirkeby, Svend; Hansen, Axel K; d'Apice, Anthony
2006-01-01
. It is concluded that the carbohydrate recognizing site of the lectin can have a binding requirement of only one saccharide. Lectin histochemistry was performed on sections from wild type mice and from knock-out mice, which lack function of the alpha.1,3-galactosyltransferase gene. All assays with the P....... aeruginosa lectin were compared with the results obtained using an isolectin from the legume shrub Griffonia simplicifolia: the GSI-134 isolectin, which is highly specific for glycans terminating in Ga1 alpha 1-R. In the wild-type mice, lectin histochemistry showed a strong capillary reaction in heart...... was observed, it seems that, in the mouse, the Pseudomonas lectin adheres to the Gal alpha l-3Ga4 beta 1-G1cNAc carbohydrate on endothelial cells in most organs and tissues. Finally, lectin staining of the basement membrane of the acini in the exocrine pancreas suggests the presence of Ga1 alpha 1-3Gal...
DEFF Research Database (Denmark)
Maaløe, Nanna; Bonde, C; Laursen, I
2011-01-01
Mannan-binding lectin is an important component of innate immunity, and insufficiency is associated with several clinical disorders. Recently, experimental replacement therapy with plasma-derived mannan-binding lectin has become an option. The current article presents the case of a patient...... with an insufficient level of mannan-binding lectin and a chronic radiation-induced ulcer following the treatment of breast cancer. After 15 months of initially conservative treatment and thereafter plastic surgery, the healing was still impaired with necrosis in the periphery of the ulcer. Immunological work......-up of the patient revealed pronounced insufficiency of mannan-binding lectin. Following a 6-week experimental intravenous treatment with mannan-binding lectin purified from human plasma, that is, 0.2-0.3 mg mannan-binding lectin per kg body weight twice a week, the defect was completely healed. We suggest...
Directory of Open Access Journals (Sweden)
Kadry Nabeh Abdel Khalik
2013-07-01
Full Text Available The seed morphology and seed proteins of 11 Vicia taxa from Egypt were studied. Macro- and micro-morphological characters, including seed shape, color, size, hilum shape and seed sculpture were described and analyzed. The secondary sculpture of the cell wall varies from papillose in nearly all Vicia species to lophate in V. hirsuta. Further, the seed proteins of studied taxa were investigated by SDS-PAGE and 39 different bands were scored. The similarity analysis based on the SDS-PAGE profile and seed morphology was found to be a useful characteristic for the discrimination of Vicia species both on the subgeneric and the sectional levels. The present study did not acknowledge V. tetrasperma and V. hirsuta as subgenus Ervum. As a result, division of Vicia into two subgenera i.e. Vicia and Cracca, is supported.
DEFF Research Database (Denmark)
Sørensen, Grith Lykke; Petersen, Inge; Thiel, Steffen
2007-01-01
The lectin pathway of the complement system is activated when Mannan-binding lectin (MBL) in complex with MASP-2 binds microorganisms. Polymorphisms in both genes are responsible for low serum levels, which associate with increased risk of infection and autoimmune disease. The present study...... includes 1215 MBL measurements and 1214 MASP-2 activity measurements in healthy Danish adult twins. Total MASP-2 activity was estimated by C4 cleaving activity of samples diluted in an excess of MBL. Twin-twin correlations were higher in monozygotic (MZ) than in dizygotic (DZ) twins for both traits...
Rouf, Razina; Tiralongo, Evelin; Krahl, Anja; Maes, Karen; Spaan, Lina; Wolf, Stefan; May, Tom W; Tiralongo, Joe
2011-01-01
Fifteen Australian mushroom species (higher Basidiomycetes) were assessed for hemagglutination and lectin activity. Hemagglutination activity was evaluated using both neuraminidase treated and untreated rabbit and human A, B, and O erythrocytes. Lectin activity was determined by the ability of various mono- and oligosaccharides to inhibit hemagglutination activity. Of the mushrooms evaluated, seven contained lectin activity. However, five (Agaricus bitorquis, Chlorophyllum brunneum, Coprinus comatus, Cortinarius sp. TWM 1710, and Omphalotus nidiformis) expressed lectin activity in only one of two collections tested. The two remaining lectin active mushroom species (Phlebopus marginatus and Psathyrella asperospora) possessed lectin activity with the same sugar specificity in both collections. Although lectins were identified with diverse specificity, lactose-specific lectin activity was most frequently identified, being present in Agaricus bitorquis, Copronus comatus, Omphalotus nidiformis, and Phlebopus marginatus. In contrast, Psathyrella asperospora, Cortinarius sp. TWM 1710, and Chlorophyllum brunneum were found to possess lectin activity specific for N-acetyl-D-glucosamine, galactose, and N-acetyl-neurammic acid, respectively. Significantly, the galactose-specific lectin activity identified in Cortinarius sp. TWM 1710 and the lactose-specific lectin activity in Phlebopus marginatus have not been previously reported.
Lectin coated MgO nanoparticle: its toxicity, antileishmanial activity, and macrophage activation.
Jebali, Ali; Hekmatimoghaddam, Seyedhossein; Kazemi, Bahram; Allaveisie, Azra; Masoudi, Alireza; Daliri, Karim; Sedighi, Najme; Ranjbari, Javad
2014-10-01
The purpose of this research was to evaluate toxicity of uncoated magnesium oxide nanoparticles (MgO NPs), MgO NPs coated with Peanut agglutinin (PNA) lectin, and PNA alone on the promastigotes of Leishmania major (L. major) and macrophages of BALB/c mice. On the other hand, antileishmanial property of uncoated MgO NPs, lectin coated MgO NPs, and PNA lectin alone was evaluated, and also macrophage activation was investigated after treatment with these materials by measurement of nitrite, H2O2, and some interleukins. This study showed that PNA lectin and lectin coated MgO NPs had approximately no toxicity on L. major and macrophages, but some toxic effects were observed for uncoated MgO NPs, especially at concentration of 500 µg/mL. Interestingly, lectin coated MgO NPs had the highest antileishmanial activity and macrophage activation, compared with uncoated MgO NPs and PNA lectin.
Konami, Y; Yamamoto, K; Osawa, T
1991-02-01
A new type lactose-binding lectin was purified from extracts of Ulex europaeus seeds by affinity chromatography on a column of galactose-Sepharose 4B, followed by gel filtration on Sephacryl S-300. This lectin, designated as Ulex europaeus lectin III (UEA-III), was found to be inhibited by lactose. The dimeric lectin is a glycoprotein with a molecular mass of 70,000 Da; it consists of two apparently identical subunits of a molecular mass of 34,000 Da. Compositional analysis showed that this lectin contains 30% carbohydrate and a large amount of aspartic acid, serine and valine, but no sulfur-containing amino acids. The N-terminal amino-acid sequences of L-fucose-binding Ulex europaeus lectin I (UEA-I) and di-N-acetylchitobiose-binding Ulex europaeus lectin II (UEA-II), both of which we have already purified and characterized, and that of UEA-III were determined and compared.
The Effect of Humic Acid on Nutrient Composition in Broad Bean (Vicia faba L. Roots
Directory of Open Access Journals (Sweden)
Sener AKINCI
2009-12-01
Full Text Available Humic acids promote the conversion of mineral nutrients into forms available to plants. It also stimulates seed germination and viability, and its main effect usually being more prominent in the roots. The objective of this study was to determine of the influence of humic acid on broad bean (Vicia faba L. cultivar �Eresen 87� on root growth and development as well as nutrient uptake, during investigation in a pot experiment. Treatment with leonardite, as humic acid source positively affected both germination and harvesting, enhancing root length and biomass. Humic acid (HA caused significant increase of fresh (RFW and dry (RDW weights by 30.1% and 56.6% of broad bean roots, respectively. Flame photometer and atomic absorption spectrophotometry analyses revealed that K content was major nutrient among the tested elements. Humic acid increased the contents of Na and K significantly. The content of Ca and Fe was not significantly increased whereas Cu, Mn and Zn content decreased under HA treatment.
Directory of Open Access Journals (Sweden)
Jiaojiao Wang
2014-02-01
Full Text Available To analyze the nutritional composition of faba bean (Vicia faba L. seed, estimation models were developed for protein, starch, oil, and total polyphenol using near infrared spectroscopy (NIRS. Two hundred and forty-four samples from twelve producing regions were measured in both milled powder and intact seed forms. Partial least squares (PLS regression was applied for model development. The model based on ground seed powder was generally superior to that based on the intact seed. The optimal seed powder-based models for protein, starch, and total polyphenol had coefficients of correlation (r2 of 0.97, 0.93 and 0.89, respectively. The relationship between nutrient contents and twelve producing areas was determined by two-step cluster analysis. Three distinct groupings were obtained with region-constituent features, i.e., Group 1 of high oil, Group 2 of high protein, and Group 3 of high starch as well as total polyphenol. The clustering accuracy was 79.5%. Moreover, the nutrition contents were affected by seeding date, longitude, latitude, and altitude of plant location. Cluster analysis revealed that the differences in the seed were strongly influenced by geographical factors.
Directory of Open Access Journals (Sweden)
Salem S. Alghamdi
2012-12-01
Full Text Available Sequence-related amplified polymorphism (SRAP markers were used to assess the genetic diversity and relationship among 58 faba bean (Vicia faba L. genotypes. Fourteen SRAP primer combinations amplified a total of 1036 differently sized well-resolved peaks (fragments, of which all were polymorphic with a 0.96 PIC value and discriminated all of the 58 faba bean genotypes. An average pairwise similarity of 21% was revealed among the genotypes ranging from 2% to 65%. At a similarity of 28%, UPGMA clustered the genotypes into three main groups comprising 78% of the genotypes. The local landraces and most of the Egyptian genotypes in addition to the Sudan genotypes were grouped in the first main cluster. The advanced breeding lines were scattered in the second and third main clusters with breeding lines from the ICARDA and genotypes introduced from Egypt. At a similarity of 47%, all the genotypes formed separated clusters with the exceptions of Hassawi 1 and Hassawi 2. Group analysis of the genotypes according to their geographic origin and type showed that the landraces were grouped according to their origin, while others were grouped according to their seed type. To our knowledge, this is the first application of SRAP markers for the assessment of genetic diversity in faba bean. Such information will be useful to determine optimal breeding strategies to allow continued progress in faba bean breeding.
DNA Damage in Vicia faba by Exposure to Agricultural Soils from Tlaxcala, Mexico.
Juárez-Santacruz, L; García-Nieto, E; García-Gallegos, E; Romo-Gómez, C; Ortiz-Ortiz, E; Costilla-Salazar, R; Luna-Zendejas, H S
2015-12-01
The aim of this research was to quantify some POPs, such as p,p' DDT, p,p' DDE, and PCBs in agricultural soils of Tlaxcala, Mexico and evaluate their capacity for eliciting DNA damage, using Vicia faba as bioindicator. The values of ΣDDTs and ΣPCBs ranged from 8-24 to 118-26,983 µg/kg, respectively. The samples T1 (HQ = 9.3) and T2 (HQ = 53.9) showed concentrations of ΣPCBs higher than Canadian guidelines (SQGE = 500 µg/kg). The genotoxicity testing produced percentages of DNA fragmentation higher than negative control and statistically significant (p < 0.05), both in agricultural soils and organic extracts. The soils T2, T3, N4, and N5 showed a DICA from 2.6 to 3.1 times, statistically higher (p < 0.05) than negative control. In general, the agricultural soils have greater genotoxic capacity than the organic extracts, suggesting a potential risk to biota that depends upon this ecosystem.
García-Garijo, A; Tejera, N A; Lluch, C; Palma, F
2014-05-01
Alterations on growth, amino acids metabolism and some antioxidant enzyme activities as result of imazamox treatment were examined in determinate and indeterminate nodules, formed by Phaseolus vulgaris and Vicia sativa, respectively. Young seedlings of both legumes were inoculated with their respective microsymbionts and grown under controlled conditions. At vegetative growth, plants were treated with imazamox (250μM) in the nutrient solution and harvested 7days after. Imazamox was mainly accumulated in V. sativa where concentrations were more than six fold higher than those detected in P. vulgaris. Nodule dry weight and total nitrogen content were reduced by the herbicide treatment: the highest decrease of nodule biomass (50%) and nitrogen content (40%) were registered in V. sativa and P. vulgaris, respectively. The concentration of branched-chain amino acids (BCAA) did not change in neither determinate nor indeterminate nodules even though the acetohydroxyacid synthase activity decreased in root and nodules of both symbioses with the herbicide application. Based on this last result and taking into account that total free amino acids increased in roots but not in nodules of common vetch, a possible BCAA translocation from root to nodule could occur. Our results suggest that the maintenance of BCAA balance in nodule become a priority for the plant in such conditions. The involvement of activities glutathione-S-transferase, guaiacol peroxidase and superoxide dismutase in the response of the symbioses to imazamox are also discussed. Copyright © 2014 Elsevier Inc. All rights reserved.
N-(jasmonoyl)tyrosine-derived compounds from flowers of broad beans (Vicia faba).
Kramell, Robert; Schmidt, Jürgen; Herrmann, Gabriele; Schliemann, Willibald
2005-09-01
Two new amide-linked conjugates of jasmonic acid, N-[(3R,7R)-(-)-jasmonoyl]-(S)-dopa (3) and N-[(3R,7R)-(-)-jasmonoyl]-dopamine (5), were isolated in addition to the known compound N-[(3R,7R)-(-)-jasmonoyl]-(S)-tyrosine (2) from the methanolic extract of flowers of broad bean (Vicia faba). Their structures were proposed on the basis of spectroscopic data (LC-MS/MS) and chromatographic properties on reversed and chiral phases and confirmed by partial syntheses. Furthermore, tyrosine conjugates of two cucurbic acid isomers (7, 8) were detected and characterized by LC-MS. Crude enzyme preparations from flowers of V. faba hydroxylated both (+/-)-2 and N-[(3R,7R/3S,7S)-(-)-jasmonoyl]tyramine [(+/-)-4] to (+/-)-3 and (+/-)-5, respectively, suggesting a possible biosynthetic relationship. In addition, a commercial tyrosinase (mushroom) and a tyrosinase-containing extract from hairy roots of red beet exhibited the same catalytic properties, but with different substrate specificities. The conjugates (+/-)-2, (+/-)-3, (+/-)-4, and (+/-)-5 exhibited in a bioassay low activity to elicit alkaloid formation in comparison to free (+/-)-jasmonic acid [(+/-)-1].
Directory of Open Access Journals (Sweden)
Stefan Martyniuk
2015-09-01
Full Text Available The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv in the solid-carrier inoculant. In a pot experiment the highest number of nodules was detected on roots of pea plants inoculated with the dual-culture inoculant containing Rlv and A. chroococcum, slightly lower numbers on pea roots inoculated with the mono-culture inoculum of Rlv and almost no nodules were found on the roots of pea un-inoculated (control treatment with the bacteria. In the micro-plot experiment conducted in the years 2011–2012 pre-sowing inoculation of pea seeds with the mono-culture inoculant of Rlv or with the mixed inoculant of Rlv and A. chroococcum slightly increased nodule numbers/plant, pod numbers/plant and seed numbers/pod, as compared to the un-inoculated control, but these differences were not reflected in pea seed yields/m2, which were similar in all treatments.
Genetic Diversity Assessment of Portuguese Cultivated Vicia faba L. through IRAP Markers
Directory of Open Access Journals (Sweden)
Diana Tomás
2016-03-01
Full Text Available Faba bean have been grown in Portugal for a long time and locally adapted populations are still maintained on farm. The genetic diversity of four Portuguese faba bean populations that are still cultivated in some regions of the country was evaluated using the Inter Retrotransposons Amplified Polymorphism (IRAP technique. It was shown that molecular markers based on retrotransposons previously identified in other species can be efficiently used in the genetic variability assessment of Vicia faba. The IRAP experiment targeting Athila yielded the most informative banding patterns. Cluster analysis using the neighbor-joining algorithm generated a dendrogram that clearly shows the distribution pattern of V. faba samples. The four equina accessions are separated from each other and form two distinct clades while the two major faba bean accessions are not unequivocally separated by the IRAP. Fluorescent In Situ Hybridization (FISH analysis of sequences amplified by IRAP Athila revealed a wide distribution throughout V. faba chromosomes, confirming the whole-genome coverage of this molecular marker. Morphological characteristics were also assessed through cluster analysis of seed characters using the unweighted pair group method arithmetic average (UPGMA and principal component analysis (PCA, showing a clear discrimination between faba bean major and equina groups. It was also found that the seed character most relevant to distinguish accessions was 100 seed weight. Seed morphological traits and IRAP evaluation give similar results supporting the potential of IRAP analysis for genetic diversity studies.
Molecular tools for utilization of mitochondrial diversity in faba bean (Vicia faba
Directory of Open Access Journals (Sweden)
Aleksić Jelena M.
2014-01-01
Full Text Available We performed in silico PCR analyses utilizing complete mitochondrial (mtDNA genome sequences of faba bean (Vicia faba and two related species, Vigna angularis and Vigna radiata, currently available in GenBank, to infer whether 15 published universal primer pairs for amplification of all 14 cis-spliced introns in genes of NADH subunits (nad genes are suitable for V. faba and related species. Then, we tested via PCR reactions whether seven out of 15 primer pairs would generate PCR products suitable for further manipulation in 16 genotypes of V. faba representing all botanical varieties of this species (major, minor, equina and subsp. paucijuga of various levels of improvement (traditional and improved cultivars originating from Europe, Africa, Asia and south America. We provide new PCR primers for amplification of nad1 intron 2/3 in V. faba, and demonstrate intraspecific variability in primary nucleotide sequences at this locus. Based on outcomes of both in silico predictions and PCR amplification, we report a set of PCR primers for amplification of five introns in nad genes that are promising molecular tools for future phylogeographic and other studies in this species for which unambiguous data on wild ancestors, centre of origin and domestication are lacking. [Projekat Ministarstva nauke Republike Srbije, br. 173005
Use of lectin microarray to differentiate gastric cancer from gastric ulcer
Huang, Wei-Li; Li, Yang-Guang; Lv, Yong-Chen; Guan, Xiao-Hui; Ji, Hui-Fan; Chi, Bao-Rong
2014-01-01
AIM: To investigate the feasibility of lectin microarray for differentiating gastric cancer from gastric ulcer. METHODS: Twenty cases of human gastric cancer tissue and 20 cases of human gastric ulcer tissue were collected and processed. Protein was extracted from the frozen tissues and stored. The lectins were dissolved in buffer, and the sugar-binding specificities of lectins and the layout of the lectin microarray were summarized. The median of the effective data points for each lectin was globally normalized to the sum of medians of all effective data points for each lectin in one block. Formalin-fixed paraffin-embedded gastric cancer tissues and their corresponding gastric ulcer tissues were subjected to Ag retrieval. Biotinylated lectin was used as the primary antibody and HRP-streptavidin as the secondary antibody. The glycopatterns of glycoprotein in gastric cancer and gastric ulcer specimens were determined by lectin microarray, and then validated by lectin histochemistry. Data are presented as mean ± SD for the indicated number of independent experiments. RESULTS: The glycosylation level of gastric cancer was significantly higher than that in ulcer. In gastric cancer, most of the lectin binders showed positive signals and the intensity of the signals was stronger, whereas the opposite was the case for ulcers. Significant differences in the pathological score of the two lectins were apparent between ulcer and gastric cancer tissues using the same lectin. For MPL and VVA, all types of gastric cancer detected showed stronger staining and a higher positive rate in comparison with ulcer, especially in the case of signet ring cell carcinoma and intra-mucosal carcinoma. GalNAc bound to MPL showed a significant increase. A statistically significant association between MPL and gastric cancer was observed. As with MPL, there were significant differences in VVA staining between gastric cancer and ulcer. CONCLUSION: Lectin microarray can differentiate the different
Lectin from sainfoin (Onobrychis viciifolia scop.). Complete amino acid sequence.
Kouchalakos, R N; Bates, O J; Bradshaw, R A; Hapner, K D
1984-04-10
The complete amino acid sequence of a lectin from sainfoin ( Onobrychis viciifolia Scop . var. Eski ) has been determined by sequential Edman analyses of the intact protein and peptides derived from digests with trypsin and thermolysin. Peptides were purified by pH fractionation, by gel filtration, and by cation-exchange and reverse-phase high-performance liquid chromatography. Seven segments of continuous sequence, accounting for the entire protein, were aligned through sequence comparison with several homologous leguminous lectins to give the final structure. Sainfoin lectin monomer, a glycoprotein which contains a single polypeptide chain of 236 amino acid residues with a molecular weight of 26 509, has amino- and carboxyl-terminal residues of alanine and threonine, respectively. A single residue of cysteine, located at position 33, is the only sulfur-containing amino acid present. Asparagine-118 is the single oligosaccharide attachment site. At least two apparent allelomorphic forms of the protein, having valine or isoleucine at position 49 in equal amounts, were detected. The amino acid sequence of sainfoin lectin exhibits circular permutation relative to that of the homologous protein concanavalin A.
Signalling through C-type lectin receptors: shaping immune responses
Geijtenbeek, Teunis B. H.; Gringhuis, Sonja I.
2009-01-01
C-type lectin receptors (CLRs) expressed by dendritic cells are crucial for tailoring immune responses to pathogens. Following pathogen binding, CLRs trigger distinct signalling pathways that induce the expression of specific cytokines which determine T cell polarization fates. Some CLRs can induce
Lectins, Mitogenicity and Seed Germination: A Comparative Study ...
African Journals Online (AJOL)
The fate of lectins contained in the seeds of T. occidentalis, C. papaya and A. communis have been followed during the germinative process. Under the same culture conditions, the emergence of both the radicle and the plumule (the 3rd and 5th day; 18th and 20th and 12th and the 15th day respectively for T. occidentalis, C.
Narcissus tazetta lectin shows strong inhibitory effects against ...
Indian Academy of Sciences (India)
Prakash
early stem and progenitor cells, and expansion of lineage- committed cells in prolonged culture could be developed for clinical expansion of CD34+ cells for transplantation and use of these cells for other cell therapy strategies. In this study, we investigated the inhibitory effect of a novel mannose- binding lectin isolated ...
21 CFR 864.9550 - Lectins and protectins.
2010-04-01
... proteins derived from plants and lower animals that cause cell agglutination in the presence of certain... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Lectins and protectins. 864.9550 Section 864.9550 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...
Lectins as possible candidates towards anti-microbial defense in ...
African Journals Online (AJOL)
In this regard, lectins have been implicated as pattern recognition molecules serving as biosensors for detecting carbohydrate components on the microbial cells, thus triggering signaling cascade for immune activation. Understanding of such silkworm agglutinins, most specifically their binding specificities and pattern of ...
Cereal n-glycoproteins enrichment by lectin affinity monolithic chromatography
Czech Academy of Sciences Publication Activity Database
Flodrová, Dana; Bobálová, Janette; Laštovičková, Markéta
2016-01-01
Roč. 44, č. 2 (2016), s. 286-297 ISSN 0133-3720 R&D Projects: GA ČR(CZ) GPP503/12/P395 Institutional support: RVO:68081715 Keywords : barley * wheat * glycoprotein * mass spectrometry * lectin chromatography Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.496, year: 2016
Clinical manifestations of mannan-binding lectin deficiency
DEFF Research Database (Denmark)
Thiel, Steffen; Frederiksen, Pernille Dorthea; Jensenius, Jens Christian
2006-01-01
Mannan-binding lectin (MBL) is a plasma protein of the innate immune system with the ability to initiate antimicrobial and inflammatory actions. MBL deficiency is common. More than 10% of the general population may, depending on definition, be classified as MBL deficient, underlining the redundancy...
Mannan-binding lectin in astma and allergy
DEFF Research Database (Denmark)
Kaur, S.; Thiel, Steffen; Sarma, P.U.
2006-01-01
Mannan-binding lectin (MBL) is a vital and versatile component of innate immunity. It is present in serum and may bind to a plethora of microbial pathogens and mediate opsonization of these by complement-dependent and/or independent mechanisms. Low-MBL levels in serum, attributed to certain genetic...
C-type lectin receptors orchestrate antifungal immunity
Wevers, Brigitte A.; Geijtenbeek, Teunis B. H.; Gringhuis, Sonja I.
2013-01-01
Fungal infections are an emerging threat for human health. A coordinated host immune response is fundamental for successful elimination of an invading fungal microbe. A panel of C-type lectin receptors expressed on antigen-presenting dendritic cells enable innate recognition of fungal cell wall
Cancer Biomarker Discovery: Lectin-Based Strategies Targeting Glycoproteins
Directory of Open Access Journals (Sweden)
David Clark
2012-01-01
Full Text Available Biomarker discovery can identify molecular markers in various cancers that can be used for detection, screening, diagnosis, and monitoring of disease progression. Lectin-affinity is a technique that can be used for the enrichment of glycoproteins from a complex sample, facilitating the discovery of novel cancer biomarkers associated with a disease state.
Mitogenic Properties Of Lectin From Mucuna Sloanei Seed Extracts ...
African Journals Online (AJOL)
Mitogenic properties of lectin from mucuna sloanei seed extracts were studied. The seeds of mucuna sloanie were shelled and ground using an electric grinder. The powder meal was then defatted with petroleum ether, and adjusted to 10 %( w/v) in potassium inorganic phosphates k-pi (A) buffer (pH 7.5). The suspension ...
Presenting Precision Glycomacromolecules on Gold Nanoparticles for Increased Lectin Binding
Directory of Open Access Journals (Sweden)
Sophia Boden
2017-12-01
Full Text Available Glyco-functionalized gold nanoparticles have great potential as biosensors and as inhibitors due to their increased binding to carbohydrate-recognizing receptors such as the lectins. Here we apply previously developed solid phase polymer synthesis to obtain a series of precision glycomacromolecules that allows for straightforward variation of their chemical structure as well as functionalization of gold nanoparticles by ligand exchange. A novel building block is introduced allowing for the change of spacer building blocks within the macromolecular scaffold going from an ethylene glycol unit to an aliphatic spacer. Furthermore, the valency and overall length of the glycomacromolecule is varied. All glyco-functionalized gold nanoparticles show high degree of functionalization along with high stability in buffer solution. Therefore, a series of measurements applying UV-Vis spectroscopy, dynamic light scattering (DLS and surface plasmon resonance (SPR were performed studying the aggregation behavior of the glyco-functionalized gold nanoparticles in presence of model lectin Concanavalin A. While the multivalent presentation of glycomacromolecules on gold nanoparticles (AuNPs showed a strong increase in binding compared to the free ligands, we also observed an influence of the chemical structure of the ligand such as its valency or hydrophobicity on the resulting lectin interactions. The straightforward variation of the chemical structure of the precision glycomacromolecule thus gives access to tailor-made glyco-gold nanoparticles (glyco-AuNPs and fine-tuning of their lectin binding properties.
Mannose-Binding Lectin Deficiency Is Associated with Myocardial Infarction
DEFF Research Database (Denmark)
Vengen, Inga Thorsen; Madsen, Hans O; Garred, Peter
2012-01-01
Mannose-binding lectin (MBL) and ficolins activate the complement cascade, which is involved in atherogenesis. Based on a pilot study, we hypothesized that functional polymorphisms in the MBL gene (MBL2) leading to dysfunctional protein are related to development of myocardial infarction (MI...
Multivalent carbohydrate inhibitors of bacterial lectins and toxins
Fu, O.
2015-01-01
Bacteria and their toxins often carry proteins on their surface binding to specific components of tissue cells or the extracellular matrix. In many cases the components are carbohydrate structures. The adhesion of these carbohydrate-binding proteins, named lectins, to human glycoconjugates is a
Lectin Activity in Gut Extract of Culex Pipiens
Directory of Open Access Journals (Sweden)
Mona Koosha
2013-03-01
Full Text Available Background: The role of lectins is important in interaction between pathogens and mosquito vectors. This study was performed to identify agglutinin activities of protein molecules on the midgut of Culex pipiens. Methods: Culex pipiens was reared in insectray condition and the midguts of males and females (blood fed and unfed were dissected separately in Tris-HCl buffer. The extracts of midguts were applied for hemagglutinin assay against red blood cells of rabbit, mouse, rat, dog, horse, sheep, guinea pig, cow, human (A, B, AB, O groups. Then, the RBCs with relatively high agglutinin activity were chosen for carbohydrate inhibition assay. D (+ glucose, D (+ galactose, D (+ mannose, D (- fructose, D (- arabinose, L (- fucose, lactose, N-acetyl-D-glucosamine, N-acetyl-D-galactosamine, sialic acid were used to specify carbohydrate binding lectin.Results: The highest agglutinin activities were found against sheep and rabbits RBCs. Sexual diversity of agglutinin activities was observed among midgut extraction of males and females. In addition, variation in agglutinin activity of blood fed and unfed female mosquitoes were detected. The lectin activity was inhibited highly with glucose, galactose, fucose and fructose but less inhibitor activities was observed by arabinose, N-acetyl-D-galactosamine, n-acetyl-d-glucosamine, lactose and mannose.Conclusion: The secretion of hemagglutinins (lectins or lectin-like molecules in the digestive system depends on the type of food in the gut. This suggests that emptying of the gut in preparation for protein rich food probably starts the secretion of hemagglutinins.
Microvessel changes in hypertension measured by Griffonia simplicifolia I lectin.
Greene, A S; Lombard, J H; Cowley, A W; Hansen-Smith, F M
1990-06-01
Commonly used methods for assessing reductions in microvascular density (rarefaction) in hypertension detect only perfused microvessels. In the present study, samples of cremaster and spinotrapezius muscles were taken from rats with chronic (4-week) reduced renal mass hypertension and normotensive sham-operated control rats, as well as from 12-week-old spontaneously hypertensive rats and their normotensive Wistar-Kyoto control strain. Mean arterial pressure was 149 +/- 8 mm Hg in the rats with reduced renal mass hypertension, 114 +/- 7 mm Hg in sham-operated rats, 177 +/- 9 mm Hg in spontaneously hypertensive rats, and 95 +/- 4 mm Hg in Wistar-Kyoto rats. Muscle samples were incubated with rhodamine-labeled Griffonia simplicifolia I lectin, which identifies both perfused and nonperfused microvessels. Microvascular density was assessed by counting intersections with a 20-microns grid. Microvessel density was significantly reduced in cremaster muscles of both spontaneously hypertensive and reduced renal mass hypertensive rats, and in the spinotrapezius muscle of spontaneously hypertensive rats, compared with their respective normotensive controls. Further studies in the reduced renal mass rats on low salt diets indicated that lectin binding was also decreased as salt intake was increased, independent of blood pressure. This change was not due to an alteration in lectin-binding affinity. These studies indicate that lectin binding can be a useful tool for assessing microvessel density that does not depend on the perfusion state of the vessels and that rarefaction due to hypertension is not evenly distributed in all vascular beds. These results also provide evidence that dietary salt intake alone can influence microvessel density, as measured by the lectin technique.
Prevalence of the F-type lectin domain.
Bishnoi, Ritika; Khatri, Indu; Subramanian, Srikrishna; Ramya, T N C
2015-08-01
F-type lectins are fucolectins with characteristic fucose and calcium-binding sequence motifs and a unique lectin fold (the "F-type" fold). F-type lectins are phylogenetically widespread with selective distribution. Several eukaryotic F-type lectins have been biochemically and structurally characterized, and the F-type lectin domain (FLD) has also been studied in the bacterial proteins, Streptococcus mitis lectinolysin and Streptococcus pneumoniae SP2159. However, there is little knowledge about the extent of occurrence of FLDs and their domain organization, especially, in bacteria. We have now mined the extensive genomic sequence information available in the public databases with sensitive sequence search techniques in order to exhaustively survey prokaryotic and eukaryotic FLDs. We report 437 FLD sequence clusters (clustered at 80% sequence identity) from eukaryotic, eubacterial and viral proteins. Domain architectures are diverse but mostly conserved in closely related organisms, and domain organizations of bacterial FLD-containing proteins are very different from their eukaryotic counterparts, suggesting unique specialization of FLDs to suit different requirements. Several atypical phylogenetic associations hint at lateral transfer. Among eukaryotes, we observe an expansion of FLDs in terms of occurrence and domain organization diversity in the taxa Mollusca, Hemichordata and Branchiostomi, perhaps coinciding with greater emphasis on innate immune strategies in these organisms. The naturally occurring FLDs with diverse domain organizations that we have identified here will be useful for future studies aimed at creating designer molecular platforms for directing desired biological activities to fucosylated glycoconjugates in target niches. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Hogenkamp, A.|info:eu-repo/dai/nl/243274319; Isohadouten, N.; Reemers, S.S.N.|info:eu-repo/dai/nl/304836508; Romijn, R.A.|info:eu-repo/dai/nl/26228359X; Hemrika, W.|info:eu-repo/dai/nl/121631362; White, M.R.; Tefsen, B.; Vervelde, L.|info:eu-repo/dai/nl/134923391; van Eijk, M.|info:eu-repo/dai/nl/255160216; Veldhuizen, E.J.A.|info:eu-repo/dai/nl/19545264X; Haagsman, H.P.|info:eu-repo/dai/nl/069273278
2008-01-01
Many proteins of the calcium-dependent (C-type) lectin family have been shown to play an important role in innate immunity. They can bind to a broad range of carbohydrates, which enables them to interact with ligands present on the surface of micro-organisms.We previously reported the finding of a
Energy Technology Data Exchange (ETDEWEB)
Dharkar, Poorva D.; Anuradha, P.; Gaikwad, Sushama M.; Suresh, C. G., E-mail: cg.suresh@ncl.res.in [Division of Biochemical Sciences, National Chemical Laboratory, Pune 411008 (India)
2006-03-01
A lectin from Trichosanthes dioica seeds has been purified and crystallized using 25%(w/v) PEG 2K MME, 0.2 M ammonium acetate, 0.1 M Tris–HCl pH 8.5 and 50 µl 0.5%(w/v) n-octyl β-d-glucopyranoside as thick needles belonging to hexagonal space group P6{sub 4}. A lectin from Trichosanthes dioica seeds has been purified and crystallized using 25%(w/v) PEG 2K MME, 0.2 M ammonium acetate, 0.1 M Tris–HCl pH 8.5 and 50 µl 0.5%(w/v) n-octyl β-d-glucopyranoside as thick needles belonging to hexagonal space group P6{sub 4}. Unit-cell parameters were a = b = 167.54, c = 77.42 Å. The crystals diffracted to a Bragg spacing of 2.8 Å. Both the structures of abrin-a and T. kirilowii lectin could be used as a model in structure determination using the molecular-replacement method; however, T. kirilowii lectin coordinates gave better values of reliability and correlation parameters. The thermal, chemical and pH stability of this lectin have also been studied. When heated, its haemagglutination activity remained unaffected up to 363 K. Other stability studies show that 4 M guanidinium hydrochloride (Gdn–HCl) initiates unfolding and that the protein is completely unfolded at 6 M Gdn–HCl. Treatment with urea resulted in a total loss of activity at higher concentrations of denaturant with no major structural changes. The protein remained stable over a wide pH range, from pH 6 to pH 12, except for partial unfolding at extremely alkaline pH. The role of disulfide bonds in the protein stability was found to be insignificant. Rayleigh light-scattering studies showed no molecular aggregation in any of the extreme treated conditions. The unusual stability of this lectin resembles that of type II ribosome-inactivating proteins (type II RIPs), which is also supported by structure determination. The structural features observed in a preliminary electron-density map were compared with the other two available Trichosanthes lectin structures.
Jordan Aguilar, Bladimir
2011-01-01
En México el haba (Vicia faba L.) es importante para la alimentación de los habitantes del medio rural y urbano, contiene un alto contenido nutritivo, es un alimento balanceado, asimismo en la actualidad los productores demandan variedades con mayor calidad de semilla. El rango en cuanto al contenido de taninos en las semillas de haba cultivadas por los agricultores fue determinado, se estimaron las relaciones entre las variedades de haba mediante la utilización de marcadores moleculares tipo...
Ca2+-mediated remote control of reversible sieve tube occlusion in Vicia faba
DEFF Research Database (Denmark)
Furch, Alexandra C.U.; Hafke, Jens B.; Schulz, Alexander
2007-01-01
(EPWs), and is reversible in intact plants. The time-course of the wound response was studied in sieve elements of main veins of intact Vicia faba plants using confocal and multiphoton microscopy. Only 15-45 s after burning a leaf tip, forisomes (giant protein bodies specific for legume sieve tubes...... reversible; callose degraded over the subsequent 1-2 h. The heat induction of both modes of occlusion coincided with the passage of an EPW visualized by electrophysiology or the potential-sensitive dye RH-414. In contrast to burning, cutting of the leaf tip induced neither an EPW nor callose deposition...
Barros, Claudio S.L.; Rafael A. Fighera; Daniela B. Rozza; Raquel R. Rech; Simone V. Sallis; Langohr, Ingeborg M.
2001-01-01
Dois surtos de uma doença associada ao pastoreio de duas espécies de ervilhaca (predominantemente Vicia villosa e, em menor grau, V. sativa) foram observados em agosto-setembro de 2001, em vacas Holandesas adultas de duas propriedades rurais do Rio Grande do Sul. Foram afetadas, em uma das propriedades, quatro de 42 vacas (9,5%) e, na outra, uma de oito vacas (12,5%). Os sinais clínicos incluíam, embora não em todos os casos, febre, prurido, espessamento e enrugamento da pele com placas multi...
DEFF Research Database (Denmark)
Engvild, Kjeld Christensen; Egsgaard, Helge; Larsen, Elfinn
1980-01-01
4-Chloroindole-3-acetic acid methyl ester was identified unequivocally in Lathyrus latifolius L., Vicia faba L. and Pisum sativum L. by thin layer chromatography, gas chromatography and mass spectrometry. The gas chromatographic system was able to separate underivatized chloroindole-3-acetic acid...... methyl ester isomers. The quantitative determination of 4-chloroindole-3-acetic acid methyl ester in immature seeds of these three species was performed by gas chromatography – mass spectrometry using deuterium labelled 4-chloro-indole-3-acetic acid methyl ester as an internal standard. P. sativum...
Molecular recognition of surface-immobilized carbohydrates by a synthetic lectin.
Rauschenberg, Melanie; Fritz, Eva-Corrina; Schulz, Christian; Kaufmann, Tobias; Ravoo, Bart Jan
2014-01-01
The molecular recognition of carbohydrates and proteins mediates a wide range of physiological processes and the development of synthetic carbohydrate receptors ("synthetic lectins") constitutes a key advance in biomedical technology. In this article we report a synthetic lectin that selectively binds to carbohydrates immobilized in a molecular monolayer. Inspired by our previous work, we prepared a fluorescently labeled synthetic lectin consisting of a cyclic dimer of the tripeptide Cys-His-Cys, which forms spontaneously by air oxidation of the monomer. Amine-tethered derivatives of N-acetylneuraminic acid (NANA), β-D-galactose, β-D-glucose and α-D-mannose were microcontact printed on epoxide-terminated self-assembled monolayers. Successive prints resulted in simple microarrays of two carbohydrates. The selectivity of the synthetic lectin was investigated by incubation on the immobilized carbohydrates. Selective binding of the synthetic lectin to immobilized NANA and β-D-galactose was observed by fluorescence microscopy. The selectivity and affinity of the synthetic lectin was screened in competition experiments. In addition, the carbohydrate binding of the synthetic lectin was compared with the carbohydrate binding of the lectins concanavalin A and peanut agglutinin. It was found that the printed carbohydrates retain their characteristic selectivity towards the synthetic and natural lectins and that the recognition of synthetic and natural lectins is strictly orthogonal.
Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis.
Tawakoli, Pune N; Neu, Thomas R; Busck, Mette M; Kuhlicke, Ute; Schramm, Andreas; Attin, Thomas; Wiedemeier, Daniel B; Schlafer, Sebastian
2017-01-01
The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled lectins to visualize and quantify extracellular glycoconjugates in dental biofilms. Lectin binding was screened on pooled supragingival biofilm samples collected from 76 subjects using confocal microscopy. FLBA was then performed with 10 selected lectins on biofilms grown in situ for 48 h in the absence of sucrose. For five lectins that proved particularly suitable, stained biovolumes were quantified and correlated to the bacterial composition of the biofilms. Additionally, combinations of up to three differently labeled lectins were tested. Of the 10 lectins, five bound particularly well in 48-h-biofilms: Aleuria aurantia (AAL), Calystega sepiem (Calsepa), Lycopersicon esculentum (LEA), Morniga-G (MNA-G) and Helix pomatia (HPA). No significant correlation between the binding of specific lectins and bacterial composition was found. Fluorescently labeled lectins enable the visualization of glycoconjugates in the dental biofilm matrix. The characterization and quantification of glycoconjugates in dental biofilms require a combination of several lectins. For 48-h-biofilms grown in absence of sucrose, AAL, Calsepa, HPA, LEA, and MNA-G are recommendable.
Microbial F-type lectin domains with affinity for blood group antigens.
Mahajan, Sonal; Khairnar, Aasawari; Bishnoi, Ritika; Ramya, T N C
2017-09-23
F-type lectins are fucose binding lectins with characteristic fucose binding and calcium binding motifs. Although they occur with a selective distribution in viruses, prokaryotes and eukaryotes, most biochemical studies have focused on vertebrate F-type lectins. Recently, using sensitive bioinformatics search techniques on the non-redundant database, we had identified many microbial F-type lectin domains with diverse domain organizations. We report here the biochemical characterization of F-type lectin domains from Cyanobium sp. PCC 7001, Myxococcus hansupus and Leucothrix mucor. We demonstrate that while all these three microbial F-type lectin domains bind to the blood group H antigen epitope on fucosylated glycans, there are fine differences in their glycan binding specificity. Cyanobium sp. PCC 7001 F-type lectin domain binds exclusively to extended H type-2 motif, Myxococcus hansupus F-type lectin domain binds to B, H type-1 and Lewis(b) motifs, and Leucothrix mucor F-type lectin domain binds to a wide range of fucosylated glycans, including A, B, H and Lewis antigens. We believe that these microbial lectins will be useful additions to the glycobiologist's toolbox for labeling, isolating and visualizing glycans. Copyright © 2017 Elsevier Inc. All rights reserved.
Genetic diversity of Palestine landraces of faba bean (Vicia faba) based on RAPD markers.
Basheer-Salimia, R; Shtaya, M; Awad, M; Abdallah, J; Hamdan, Y
2013-09-03
Until now, neither phenotypic nor molecular approaches have been used to characterize the landraces of Palestine faba beans (Vicia faba). We used PCR-based RAPD markers to determine the genetic diversity and relatedness among 26 Palestinian faba bean landraces (traditional farmers' varieties) from 8 localities in the West Bank, Palestine. In tests with 37 primers, 14 generated no polymorphic bands, 12 exhibited weak and unclear products, and 11 primers produced good amplification products with high intensity and pattern stability. Ninety-four DNA fragments (loci) were detected, with an average of 8.54 loci per primer and size ranging from 160 to 1370 bp. A minimum of 4 and a maximum of 14 DNA fragments were obtained using (OPA-05 and OPA-09) and (BC-261) primers, respectively. The maximum percentage of polymorphic markers was 71.4 (BC-298) and the minimum was 50.0 (OPA-05, -09, -16). The 11 primers exhibited relatively high collective resolving power (Rp) values of 26.316, and varied from 0.154 for the OPA-09 primer to 5.236 for the BC-261, with an overall mean of 2.392. The primers BC-261, -322, and -298 were found to be the most useful RAPD primers to assess the genetic diversity of Palestinian faba beans, as they revealed relatively high Rp rates (5.236, 3.618, and 3.150, respectively). Based on the Jaccard coefficient, the genetic distance ranged from 0.358 to 0.069, with a mean of 0.213. We conclude that the RAPD technique is useful for determining genetic diversity and for developing suitable fingerprints for faba bean landraces grown in Palestine.
Oxidative stress and DNA damage in broad bean (Vicia faba L.) seedlings induced by thallium.
Radić, Sandra; Cvjetko, Petra; Glavas, Katarina; Roje, Vibor; Pevalek-Kozlina, Branka; Pavlica, Mirjana
2009-01-01
Thallium (Tl) is a metal of great toxicological concern because it is highly toxic to all living organisms through mechanisms that are yet poorly understood. Since Tl is accumulated by important crops, the present study aimed to analyze the biological effects induced by bioaccumulation of Tl in broad bean (Vicia faba L.) as well as the plant's antioxidative defense mechanisms usually activated by heavy metals. Thallium toxicity was related to production of reactive oxygen species in leaves and roots of broad bean seedlings following short-term (72 h) exposure to thallium (I) acetate (0, 0.5, 1, 5, and 10 mg/L) by evaluating DNA damage and oxidative stress parameters as well as antioxidative response. The possible antagonistic effect of potassium (K) was tested by combined treatment with 5 mg/L of Tl (Tl+) and 10 mg/L of potassium (K+) acetate. Accumulation of Tl+ in roots was 50 to 250 times higher than in broad bean shoots and was accompanied by increase in dry weight and proline. Despite responsive antioxidative defense (increased activities of superoxide dismutase, ascorbate peroxidase, and pyrogallol peroxidase), Tl+ caused oxidative damage to lipids and proteins as evaluated by malondialdehyde and carbonyl group levels, and induced DNA strand breaks. Combined treatment caused no oxidative alternations to lipids and proteins though it induced DNA damage. The difference in Tl-induced genotoxicity following both acellular and cellular exposure implies indirect DNA damage. Results obtained indicate that oxidative stress is involved in the mechanism of Tl toxicity and that the tolerance of broad bean to Tl is achieved, at least in part, through the increased activity of antioxidant enzymes.
Lead-induced DNA damage in Vicia faba root cells: potential involvement of oxidative stress.
Pourrut, Bertrand; Jean, Séverine; Silvestre, Jérôme; Pinelli, Eric
2011-12-24
Genotoxic effects of lead (0-20μM) were investigated in whole-plant roots of Vicia faba L., grown hydroponically under controlled conditions. Lead-induced DNA damage in V. faba roots was evaluated by use of the comet assay, which allowed the detection of DNA strand-breakage and with the V. faba micronucleus test, which revealed chromosome aberrations. The results clearly indicate that lead induced DNA fragmentation in a dose-dependant manner with a maximum effect at 10μM. In addition, at this concentration, DNA damage time-dependently increased until 12h. Then, a decrease in DNA damages was recorded. The significant induction of micronucleus formation also reinforced the genotoxic character of this metal. Direct interaction of lead with DNA was also evaluated with the a-cellular comet assay. The data showed that DNA breakages were not associated with a direct effect of lead on DNA. In order to investigate the relationship between lead genotoxicity and oxidative stress, V. faba were exposed to lead in the presence or absence of the antioxidant Vitamin E, or the NADPH-oxidase inhibitor dephenylene iodonium (DPI). The total inhibition of the genotoxic effects of lead (DNA breakage and micronucleus formation) by these compounds reveals the major role of reactive oxygen species (ROS) in the genotoxicity of lead. These results highlight, for the first time in vivo and in whole-plant roots, the relationship between ROS, DNA strand-breaks and chromosome aberrations induced by lead. Copyright © 2011 Elsevier B.V. All rights reserved.
Swamy, Bale M; Bhat, Anuradha G; Hegde, Ganapati V; Naik, Ramachandra S; Kulkarni, Srikanth; Inamdar, Shashikala R
2004-11-01
Many fungi are known to secrete lectins, but their functional roles are not clearly understood. Sclerotium rolfsii, a soilborne plant pathogenic fungus capable of forming fruiting bodies called sclerotial bodies, secrete a cell wall-associated Thomsen-Friedenreich antigen-specific lectin. To understand the functional role of this lectin, we examined its occurrence and expression during development of the fungus. Furthermore, putative endogenous receptors of the lectin were examined to substantiate the functional role of the lectin. Immunolocalization studies using FITC-labeled lectin antibodies revealed discrete distribution of lectin sites at the branching points of the developing mycelia and uniformly occurring lectin sites on the mature sclerotial bodies. During development of the fungus the lectin is expressed in small amounts on the vegetative mycelia and reaching very high levels in mature sclerotial bodies with a sudden spurt in secretion at the maturation stage. Capping of the lectin sites on the sclerotial bodies by lectin antibodies or haptens inhibit strongly the germination of these bodies, indicating functional significance of the lectin. At the maturation stage the lectin interacts with the cell wall-associated putative endogenous receptor leading to the aggregation of mycelium to form sclerotial bodies. The lectin-receptor complex probably acts as signaling molecule in the germination process of sclerotial bodies. Using biotinylated lectin, the receptors were identified by determining the specific lectin binding to lipid components, extracted from sclerotial bodies, and separated on thin-layer chromatograms. Preliminary characterization studies indicated that the receptors are glycosphingolipids and resemble inositolphosphoceramides. These findings together demonstrate the importance of lectin-receptor interactions to explain hitherto speculated functional role of the lectins and also the glycosphingolipids of fungi.
PO-20 - Crosstalk between the lectin pathway and haemostasis in patients with pulmonary cancer
DEFF Research Database (Denmark)
Larsen, J B; Christensen, T D; Hvas, C L
2016-01-01
types of cancer. The exact role of the complement system in cancer is currently discussed. However, one possible consequence of the increased complement activation could be contribution to the increased thrombosis risk which cancer patients experience. Proteins of the lectin pathway can activate......INTRODUCTION: Recent research has focused on the complement system in cancer, including the lectin pathway of complement activation. Mannose-binding lectin (MBL), a key activator of the lectin pathway, can bind to tumor cell surfaces in vitro, and lectin pathway activation is increased in several...... coagulation and impair fibrinolysis in vitro, but the significance of this in a clinical setting is not well understood. AIM: We aim to investigate associations between lectin pathway and haemostatic activation in patients with lung cancer undergoing thoracoscopic surgery. MATERIALS AND METHODS: Patients...
Gartner, T K; Ogilvie, M L
1984-01-01
Three lactose-inhibited lectins from the venoms of the snakes Agkistrodon contortrix contortrix (southern copperhead), Ancistrodon piscivorous leukostoma (western cottonmouth moccasin) and Crotalus atrox (western diamondback rattlesnake) have been isolated and newly characterized. The three lectins are similar to thrombolectin, a lectin isolated from the venom of Bothrops atrox (fer-de-lance) (Gartner, Stocker & Williams, 1980), with regard to sugar specificity, Mr, Ca2+ requirements and sensitivity to reducing agents. Each lectin is a dimer (Mr 28 000) consisting of monomers (Mr 14 000) indistinguishable on sodium dodecyl sulphate/polyacrylamide-gel electrophoresis. Haemagglutination activity is dependent on the presence of Ca2+ and is inhibited by reducing agents. The lectins are not identical and can be distinguished on the basis of relative affinities for inhibiting sugars, isoelectric points and immunoprecipitation assays using anti-(cottonmouth lectin) serum. Images Fig. 1. Fig. 2. Fig. 4. Fig. 5. PMID:6391472
Lectin Activation in Giardia lamblia by Host Protease: A Novel Host-Parasite Interaction
Lev, Boaz; Ward, Honorine; Keusch, Gerald T.; Pereira, Miercio E. A.
1986-04-01
A lectin in Giardia lamblia was activated by secretions from the human duodenum, the environment where the parasite lives. Incubation of the secretions with trypsin inhibitors prevented the appearance of lectin activity, implicating proteases as the activating agent. Accordingly, lectin activation was also produced by crystalline trypsin and Pronase; other proteases tested were ineffective. When activated, the lectin agglutinated intestinal cells to which the parasite adheres in vivo. The lectin was most specific to mannose-6-phosphate and apparently was bound to the plasma membrane. Activation of a parasite lectin by a host protease represents a novel mechanism of hostparasite interaction and may contribute to the affinity of Giardia lamblia to the infection site.
Chen, Yanan; Vedala, Harindra; Kotchey, Gregg P.; Audfray, Aymeric; Cecioni, Samy; Imberty, Anne; Vidal, Sébastien; Star, Alexander
2012-01-01
Here we investigated the interactions between lectins and carbohydrates using field-effect transistor (FET) devices comprised of chemically converted graphene (CCG) and single-walled carbon nanotubes (SWNTs). Pyrene- and porphyrin-based glycoconjugates were functionalized noncovalently on the surface of CCG-FET and SWNT-FET devices, which were then treated with 2 µM of nonspecific and specific lectins. In particular, three different lectins (PA-IL, PA-IIL and ConA) and three carbohydrate epitopes (galactose, fucose and mannose) were tested. The responses of 36 different devices were compared and rationalized using computer-aided models of carbon nanostructure/glycoconjugate interactions. Glycoconjugates surface coverage in addition to one-dimensional structures of SWNTs resulted in optimal lectin detection. Additionally, lectin titration data of SWNT- and CCG-based biosensors were used to calculate lectin dissociation constants (Kd) and compare them to the values obtained from the isothermal titration microcalorimetry (ITC) technique. PMID:22136380
Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli
2015-03-01
There is a need to conduct research on the selection of microbial isolates from rhizosphere of plants growing on heavy metal contaminated soils for specific restoration programs. This article suggest a consortium of bacteria combining Rhizobium sp. CCNWSX0481, Rhizobium leguminosarum bv. viciae, Enterobacter cloacae and Pseudomonas sp. 2(2010) that was examined for the ability to promote Vicia faba.L. growth when cultivated on the vineyard of soil moderately contaminated with copper. Data showed that inoculation was significant in nodulation; it increases the number and the weight of nodules of 50%. Co-inoculation was also found to positively influence growth and seed yield, through increasing fresh shoot and fresh root weights by 33 and 26%, respectively, and through rising numbers of seed per pod and pods per plant. In contrast, co-inoculation produced a significant reduction of accumulated copper in roots attending 35%, however, the treatment revealed no significant effects on the copper contents in pods and seeds. The tested inoculum could be an option to promote V. faba growth and to enhance soil fertilization in moderate copper contaminated soils. Further studies on the influence of co-inoculation practices on copper migration in soil-plant systems are recommended to acquire more information for evaluation of this legume safety. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Hogg, B.; Davies, A.E.; Wilson, K.E.; Bisseling, T.; Downie, J.A.
2002-01-01
Cultivar Afghanistan peas are resistant to nodulation by many strains of Rhizobium leguminosarum bv. viciae but are nodulated by strain TOM, which carries the host specificity gene nodX. Some strains that lack nodX can inhibit nodulation of cv. Afghanistan by strain TOM. We present evidence that
Helsper, J.P.F.G.; Loon, van Y.P.J.; Kwakkel, R.P.; Norel, van A.; Poel, van der A.F.B.
1996-01-01
Seeds from six pairs of near-isogenic lines of Vicia faba L., each pair consisting of a tannin-free (TF) and a tannin-containing (TC) partner line, were used to study the effect of breeding for the absence of condensed tannins on the seed content of dry matter (DM), crude protein (CP), and starch
Leeuwen, P. van; Jansman, A.J.M.; Wiebenga, J.; Koninkx, J.F.J.G.; Mouwen, J.M.V.M.
1995-01-01
The objective of the present study was to evaluate effects of condensed tannins in faba beans (Vicia faba L.) on morphological and functional variables of the small-intestinal mucosa of piglets. In an experiment with young piglets (8-17 kg body weight), fed on either a control diet or a diet
The glycosyl moiety of lectin from sainfoin (Onobrychis viciifolia, Scop.).
Namen, A E; Hapner, K D
1979-09-29
A lectin isolated from the seeds of sainfoin (Onobrychis viciifolia, Scop. var Eski) has been shown to be a glycoprotein containing 2.6% (w/w) neutral carbohydrate and 1.6% (w/w) glucosamine (Hapner, K.D. and Robbins, J.E. (1979) Biochim. Biophys. Acta 580, 186--197) A homogeneous glycopeptide accounting for 70% of the original glycoprotein carbohydrate was isolated from pronase digests of the lectin by gel filtration chromatography. Gas-liquid chromatographic and amino acid analyses showed the glycosyl portion to contain glucosamine, mannose, xylose and fucose in molar ratio to glycopeptide of 1.8 : 1.8 : 0.7 : 0.9. The amino acid sequence was determined as H2N-Ser-Asn(glycosyl)-glu-Thr-COOH. The glycosyl moiety was attached to the peptide through N-glycosidic linkage between asparagine and glucosamine.
Plant Lectins as Medical Tools against Digestive System Cancers.
Estrada-Martínez, Laura Elena; Moreno-Celis, Ulisses; Cervantes-Jiménez, Ricardo; Ferriz-Martínez, Roberto Augusto; Blanco-Labra, Alejandro; García-Gasca, Teresa
2017-07-03
Digestive system cancers-those of the esophagus, stomach, small intestine, colon-rectum, liver, and pancreas-are highly related to genetics and lifestyle. Most are considered highly mortal due to the frequency of late diagnosis, usually in advanced stages, caused by the absence of symptoms or masked by other pathologies. Different tools are being investigated in the search of a more precise diagnosis and treatment. Plant lectins have been studied because of their ability to recognize and bind to carbohydrates, exerting a variety of biological activities on animal cells, including anticancer activities. The present report integrates existing information on the activity of plant lectins on various types of digestive system cancers, and surveys the current state of research into their properties for diagnosis and selective treatment.
Griffithsin: An Antiviral Lectin with Outstanding Therapeutic Potential
Directory of Open Access Journals (Sweden)
Sabrina Lusvarghi
2016-10-01
Full Text Available Griffithsin (GRFT, an algae-derived lectin, is one of the most potent viral entry inhibitors discovered to date. It is currently being developed as a microbicide with broad-spectrum activity against several enveloped viruses. GRFT can inhibit human immunodeficiency virus (HIV infection at picomolar concentrations, surpassing the ability of most anti-HIV agents. The potential to inhibit other viruses as well as parasites has also been demonstrated. Griffithsin’s antiviral activity stems from its ability to bind terminal mannoses present in high-mannose oligosaccharides and crosslink these glycans on the surface of the viral envelope glycoproteins. Here, we review structural and biochemical studies that established mode of action and facilitated construction of GRFT analogs, mechanisms that may lead to resistance, and in vitro and pre-clinical results that support the therapeutic potential of this lectin.
Antibacterial activity of a lectin-like Burkholderia cenocepacia protein.
Ghequire, Maarten G K; De Canck, Evelien; Wattiau, Pierre; Van Winge, Iris; Loris, Remy; Coenye, Tom; De Mot, René
2013-08-01
Bacteriocins of the LlpA family have previously been characterized in the γ-proteobacteria Pseudomonas and Xanthomonas. These proteins are composed of two MMBL (monocot mannose-binding lectin) domains, a module predominantly and abundantly found in lectins from monocot plants. Genes encoding four different types of LlpA-like proteins were identified in genomes from strains belonging to the Burkholderia cepacia complex (Bcc) and the Burkholderia pseudomallei group. A selected recombinant LlpA-like protein from the human isolate Burkholderia cenocepacia AU1054 displayed narrow-spectrum genus-specific antibacterial activity, thus representing the first functionally characterized bacteriocin within this β-proteobacterial genus. Strain-specific killing was confined to other members of the Bcc, with mostly Burkholderia ambifaria strains being susceptible. In addition to killing planktonic cells, this bacteriocin also acted as an antibiofilm agent. © 2013 The Authors. Microbiology Open published by John Wiley & Sons Ltd.
Soluble Host Defense Lectins in Innate Immunity to Influenza Virus
Directory of Open Access Journals (Sweden)
Wy Ching Ng
2012-01-01
Full Text Available Host defenses against viral infections depend on a complex interplay of innate (nonspecific and adaptive (specific components. In the early stages of infection, innate mechanisms represent the main line of host defense, acting to limit the spread of virus in host tissues prior to the induction of the adaptive immune response. Serum and lung fluids contain a range of lectins capable of recognizing and destroying influenza A viruses (IAV. Herein, we review the mechanisms by which soluble endogenous lectins mediate anti-IAV activity, including their role in modulating IAV-induced inflammation and disease and their potential as prophylactic and/or therapeutic treatments during severe IAV-induced disease.
A comparison of tomato (Lycopersicon esculentum) lectin with its deglycosylated derivative.
Kilpatrick, D C; GRAHAM, C.; Urbaniak, S J; Jeffree, C. E.; Allen, A. K.
1984-01-01
A deglycosylated derivative of tomato (Lycopersicon esculentum) lectin was prepared with the use of trifluoromethanesulphonic acid. Its properties were generally similar to those of the native lectin, but differences were evident in terms of relative agglutinating activity towards sheep, (untreated) human and trypsin-treated human erythrocytes. The two forms of tomato lectin were used in conjunction with a battery of specific antisera to investigate structural relatedness among solanaceous le...
Kentaro Kato; Takashi Makiuchi; Xunjia Cheng; Hiroshi Tachibana
2017-01-01
Galactose and N-acetyl-D-galactosamine-inhibitable lectin of Entamoeba histolytica has roles in pathogenicity and induction of protective immunity in rodent models of amoebiasis. Recently, the intermediate subunit of the lectin, Igl1, of E. histolytica has been shown to have hemolytic activity. However, the corresponding lectin is also expressed in a non-virulent species, Entamoeba dispar, and another subunit, Igl2, is expressed in the protozoa. Therefore, in this study, we compared the activ...
Glycoproteins of axonal transport: affinity chromatography on fucose-specific lectins
Energy Technology Data Exchange (ETDEWEB)
Gustavsson, S.; Ohlson, C.; Karlsson, J.O.
1982-03-01
Rapidly transported fucose-labeled glycoproteins from axons of rabbit retinal ganglion cells were solubilized with nonionic detergents. The solubilized components were subjected to affinity chromatography on three different fucose-specific lectins. A recently characterized fucose-specific lectin from Aleuria aurantia bound reversibly approximately 60% of the applied protein-bound radioactivity. The lectins from Lotus tetragonolobus and Ulex europaeus bound are very small proportions of the labeled rapidly transported glycoproteins.
Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis
Tawakoli, Pune N.; Neu, Thomas R.; Busck, Mette M.; Kuhlicke, Ute; Schramm, Andreas; Attin, Thomas; Wiedemeier, Daniel B.; Schlafer, Sebastian
2017-01-01
ABSTRACT The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled lectins to visualize and quantify extracellular glycoconjugates in dental biofilms. Lectin binding was screened on pooled supragingival biofilm samples collected from 76 subjects using confocal...
-Glucosidase inhibitory activity of thermostability lectin protein from ...
African Journals Online (AJOL)
Personal
2012-05-24
May 24, 2012 ... sulfate precipitation and Con A-Sepharose affinity column chromatography. This lectin had an IC50 value for GI activity of 0.031 ± 0.02 mg/ml, an estimated molecular mass of 35.7 kDa, of which 15.8% was carbohydrate, was thermostable up to 80°C for 70 min, showed an optimum activity within the pH ...
Identification and characterisation of lectins in several tick species
Czech Academy of Sciences Publication Activity Database
Štěrba, J.; Dupejová, J.; Fišer, M.; Golovchenko, Maryna; Rudenko, Natalia; Grubhoffer, L.
2009-01-01
Roč. 276, S1 (2009), s. 88-88 ISSN 1742-464X. [34th FEBS Congress: Life's Molecular Interactions. 04.07.2009-09.07.2009, Prague] R&D Projects: GA AV ČR KJB600960906; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : lectin s * hemagglutination acitvity * fibrinogen- related domain Subject RIV: CE - Biochemistry
Nkrp1 Family, from Lectins to Protein Interacting Molecules
Czech Academy of Sciences Publication Activity Database
Rozbeský, Daniel; Ivanova, Ljubina; Hernychová, Lucie; Grobárová, Valeria; Novák, Petr; Černý, J.
2015-01-01
Roč. 20, č. 2 (2015), s. 3463-3478 ISSN 1420-3049 R&D Projects: GA MŠk(CZ) EE2.3.20.0055; GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : NATURAL-KILLER-CELL * C-TYPE LECTIN * CARBOHYDRATE-RECOGNITION DOMAIN Subject RIV: CC - Organic Chemistry Impact factor: 2.465, year: 2015
Bovine viral diarrhea virus: affinity chromatography on Crotalaria juncea lectin.
Moreno-Lopez, J; Kristiansen, T; Kårsnas, P
1981-04-01
Attempts were made to purify bovine viral diarrhea virus by chromatography on Crotalaria juncea lectin coupled to Sepharose 2B. A recovery of abut 65% of viral infectivity after desorption was obtained. Electron microscopy revealed mostly de-enveloped particles, rather uniform in appearance but differing in size. Immunodiffusion tests with immune calf sera showed precipitation lines of identity between the desorbed virus and extracts from infected cell cultures.
A glycobiology review: carbohydrates, lectins, and implications in cancer therapeutics
Ghazarian, Haike; Idoni, Brian; Oppenheimer, Steven B.
2010-01-01
This review is intended for general readers who would like a basic foundation in carbohydrate structure and function, lectin biology and the implications of glycobiology in human health and disease, particularly in cancer therapeutics. These topics are among the hundreds included in the field of glycobiology and are treated here because they form the cornerstone of glycobiology or the focus of many advances in this rapidly expanding field. PMID:20199800
Characterization of a new lectin involved in the protoplast regeneration of Bryopsis hypnoides
Niu, Jianfeng; Wang, Guangce; Lü, Fang; Zhou, Baicheng; Peng, Guang
2009-09-01
A group of coenocytic marine algae differs from higher plants, whose totipotency depends on an intact cell (or protoplast). Instead, this alga is able to aggregate its extruded protoplasm in sea water and generate new mature individuals. It is thought that lectins play a key role in the aggregation process. We purified a lectin associated with the aggregation of cell organelles in Bryopsis hypnoides. The lectin was ca. 27 kDa with a pI between pH 5 and pH 6. The absence of carbohydrate suggested that the lectin was not a glycoprotein. The hemagglutinating activity (HA) of the lectin was not dependent on the presence of divalent cations and was inhibited by N-Acetylgalactosamine, N-Acetylglucosamine, and the glycoprotein bovine submaxillary mucin. The lectin preferentially agglutinated Gram-negative bacterium. The HA of this lectin was stable between pH 4 to pH 10. Cell organelles outside the cytoplasm were agglutinated by the addition of lectin solution (0.5 mg ml-1). Our results suggest that the regeneration of B. hypnoides is mediated by this lectin. We also demonstrated that the formation of cell organelle aggregates was inhibited by nigericin in natural seawater (pH 8.0). Given that nigericin dissipates proton gradients across the membrane, we hypothesize that the aggregation of cell organelles was proton-gradient dependent.
Molecular recognition of surface-immobilized carbohydrates by a synthetic lectin
Directory of Open Access Journals (Sweden)
Melanie Rauschenberg
2014-06-01
Full Text Available The molecular recognition of carbohydrates and proteins mediates a wide range of physiological processes and the development of synthetic carbohydrate receptors (“synthetic lectins” constitutes a key advance in biomedical technology. In this article we report a synthetic lectin that selectively binds to carbohydrates immobilized in a molecular monolayer. Inspired by our previous work, we prepared a fluorescently labeled synthetic lectin consisting of a cyclic dimer of the tripeptide Cys-His-Cys, which forms spontaneously by air oxidation of the monomer. Amine-tethered derivatives of N-acetylneuraminic acid (NANA, β-D-galactose, β-D-glucose and α-D-mannose were microcontact printed on epoxide-terminated self-assembled monolayers. Successive prints resulted in simple microarrays of two carbohydrates. The selectivity of the synthetic lectin was investigated by incubation on the immobilized carbohydrates. Selective binding of the synthetic lectin to immobilized NANA and β-D-galactose was observed by fluorescence microscopy. The selectivity and affinity of the synthetic lectin was screened in competition experiments. In addition, the carbohydrate binding of the synthetic lectin was compared with the carbohydrate binding of the lectins concanavalin A and peanut agglutinin. It was found that the printed carbohydrates retain their characteristic selectivity towards the synthetic and natural lectins and that the recognition of synthetic and natural lectins is strictly orthogonal.
Detection, purification and characterization of a lectin from freshwater green algae Spirogyra spp.
Directory of Open Access Journals (Sweden)
ANTÔNIA S. DE OLIVEIRA
2017-08-01
Full Text Available ABSTRACT Freshwater algae are rich sources of structurally biologically active metabolites, such as fatty acids, steroids, carotenoids and polysaccharides. Among these metabolites, lectins stand out. Lectins are proteins or glycoproteins of non-immune origin which bind to carbohydrates or glycoconjugates, without changing ligand structure. Many studies have reported on the use of Spirogyra spp. as effective bioindicators of heavy metals; however, reports on Spirogyra molecular bioprospecting are quite limited. Therefore, this study aimed to detect, isolate, purify and characterize a lectin present in the freshwater green algae Spirogyra. Presence of the lectin protein in the extract was detected by hemagglutination assays. Subsequently, the protein extract was subjected to a sugar inhibition assay to identify the lectin-specific carbohydrate. Following this, the extract was applied to a guar gum column to afford the pure lectin. The lectin was inhibited by N-acetyl-glucosamine and N-acetyl-beta-D-mannose, but more strongly by D-galactose. The apparent molecular mass of the purified lectin was evaluated by Polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulfate (SDS-PAGE. Electrophoretic analysis revealed a single protein band with an apparent molecular mass of 56 kDa. Thus, it could be concluded that a lectin was purified from Spirogyra spp.
Toxicity and Binding Profile of Lectins from the Genus Canavalia on Brine Shrimp
Directory of Open Access Journals (Sweden)
Francisco Vassiliepe Sousa Arruda
2013-01-01
Full Text Available Lectins are sugar-binding proteins widely distributed in nature with many biological functions. Although many lectins have a remarkable biotechnological potential, some of them can be cytotoxic. Thus, the aim of this study was to assess the toxicity of five lectins, purified from seeds of different species of Canavalia genus. In order to determine the toxicity, assays with Artemia nauplii were performed. In addition, a fluorescence assay was carried out to evaluate the binding of lectins to Artemia nauplii. In order to verify the relationship between the structure of lectins and their cytotoxic effect, structural analysis was carried out to evaluate the volume of the carbohydrate recognition domain (CRD of each lectin. The results showed that all lectins exhibited different toxicities and bound to a similar area in the digestive tract of Artemia nauplii. Concerning the structural analysis, differences in spatial arrangement and volume of CRD may explain the variation of the toxicity exhibited by each lectin. To this date, this is the first study that establishes a link between toxicity and structure of CRD from Diocleinae lectins.
A simple fibril and lectin model for cyst walls of Entamoeba and perhaps Giardia
Samuelson, John; Robbins, Phillips
2010-01-01
Cyst walls of Entamoeba and Giardia protect them from environmental insults, stomach acids, and intestinal proteases. Each cyst wall contains a sugar homopolymer: chitin in Entamoeba and a unique N-acetylgalactosamine (GalNAc) homopolymer in Giardia. Entamoeba cyst wall proteins include Jacob lectins (carbohydrate-binding proteins) that cross-link chitin, chitinases that degrade chitin, and Jessie lectins that make walls impermeable. Giardia cyst wall proteins are also lectins that bind fibrils of the GalNAc homopolymer. While many of the details remain to be determined for the Giardia cyst wall, current data suggests a relatively simple fibril and lectin model for the Entamoeba cyst wall. PMID:20934911
Cell surface lectin array: parameters affecting cell glycan signature.
Landemarre, Ludovic; Cancellieri, Perrine; Duverger, Eric
2013-04-01
Among the "omics", glycomics is one of the most complex fields and needs complementary strategies of analysis to decipher the "glycan dictionary". As an alternative method, which has developed since the beginning of the 21st century, lectin array technology could generate relevant information related to glycan motifs, accessibility and a number of other valuable insights from molecules (purified and non-purified) or cells. Based on a cell line model, this study deals with the key parameters that influence the whole cell surface glycan interaction with lectin arrays and the consequences on the interpretation and reliability of the results. The comparison between the adherent and suspension forms of Chinese Hamster Ovary (CHO) cells, showed respective glycan signatures, which could be inhibited specifically by neoglycoproteins. The modifications of the respective glycan signatures were also revealed according to the detachment modes and cell growth conditions. Finally the power of lectin array technology was highlighted by the possibility of selecting and characterizing a specific clone from the mother cell line, based on the slight difference determination in the respective glycan signatures.
Development of gastrointestinal surface. VIII. Lectin identification of carbohydrate differences
Energy Technology Data Exchange (ETDEWEB)
Pang, K.Y.; Bresson, J.L.; Walker, W.A.
1987-05-01
Binding of microvillus membranes (MVM) from newborn and adult rats by concanavalin A (Con A), Ulex europaeus (UEA I), Dolichos bifluorus (DBA), and Triticum vulgaris (WGA) was examined to determine the availability of carbohydrate-containing sites for these lectins on the intestinal surface during development. Consistent patterns of differences in the reaction of MVM with these lectins were found. Con A and UEA had much higher reactivities to MVM of adult than newborn rats. /sup 125/I-labeled-UEA gel overlay experiments revealed the abundance of UEA-binding sites in MVM of adult rat in contrast to the two binding sites in MVM of a newborn rat. DBA bound only to MVM of the adults, and very few binding sites were found in immature MVM. In contrast to these lectins, WGA binding was much higher in MVM of the newborns and decreased with maturation. Additional experiments on the age dependence of UEA and DBA reactivities revealed that the most striking changes occur in animals from 2 to 2 wk of age. In MVM from 2-wk-old rats, there were only 13.9% and < 0.2% of the adult binding capacities for UEA and DBA, respectively. By the time the animals were 4 wk old, the binding capacity for UEA had attained close to the level of the adults, whereas for DBA it reached 71.3% of the adult value. These results provide definite evidence of changes in the intestinal surface during perinatal development.
Labeling of lectin receptors during the cell cycle.
Garrido, J
1976-12-01
Labeling of lectin receptors during the cell cycle. (Localizabión de receptores para lectinas durante el ciclo celular). Arch. Biol. Med. Exper. 10: 100-104, 1976. The topographic distribution of specific cell surface receptors for concanavalin A and wheat germ agglutinin was studied by ultrastructural labeling in the course of the cell cycle. C12TSV5 cells were synchronized by double thymidine block or mechanical selection (shakeoff). They were labeled by means of lectin-peroxidase techniques while in G1 S, G2 and M phases of the cycle. The results obtained were similar for both lectins employed. Interphase cells (G1 S, G2) present a stlihtly discontinous labeling pattern that is similar to the one observed on unsynchronized cells of the same line. Cells in mitosis, on the contrary, present a highly discontinous distribution of reaction product. This pattern disappears after the cells enters G1 and is not present on mitotic cells fixed in aldehyde prior to labeling.
Engineering a Therapeutic Lectin by Uncoupling Mitogenicity from Antiviral Activity
Swanson, Michael D.; Boudreaux, Daniel M.; Salmon, Loïc; Chugh, Jeetender; Winter, Harry C.; Meagher, Jennifer L.; André, Sabine; Murphy, Paul V.; Oscarson, Stefan; Roy, René; King, Steven; Kaplan, Mark H.; Goldstein, Irwin J.; Tarbet, E. Bart; Hurst, Brett L.; Smee, Donald F.; de la Fuente, Cynthia; Hoffmann, Hans-Heinrich; Xue, Yi; Rice, Charles M.; Schols, Dominique; Garcia, J. Victor; Stuckey, Jeanne A.; Gabius, Hans-Joachim; Al-Hashimi, Hashim M.; Markovitz, David M.
2015-01-01
Summary A key effector route of the Sugar Code involves lectins that exert crucial regulatory controls by targeting distinct cellular glycans. We demonstrate that a single amino acid substitution in a banana lectin, replacing histidine 84 with a threonine, significantly reduces its mitogenicity while preserving its broad-spectrum antiviral potency. X-ray crystallography, NMR spectroscopy, and glycocluster assays reveal that loss of mitogenicity is strongly correlated with loss of pi-pi stacking between aromatic amino acids H84 and Y83, which removes a wall separating two carbohydrate binding sites, thus diminishing multivalent interactions. On the other hand, monovalent interactions and antiviral activity are preserved by retaining other wild-type conformational features and possibly through unique contacts involving the T84 side chain. Through such fine-tuning, target selection and downstream effects of a lectin can be modulated so as to knock down one activity while preserving another, thus providing tools for therapeutics and for understanding the Sugar Code. PMID:26496612
Huang, Xin; Li, Tingting; Jin, Min; Yin, Shaowu; Wang, Wen; Ren, Qian
2017-07-01
C-type lectins (CTLs) are involved in the innate immune defense of vertebrates and invertebrates against invading pathogens. This study cloned and characterized a novel C-type lectin (MnCTL) of the oriental river prawn, Macrobrachium nipponense. The cloned MnCTL cDNA encompasses an open reading frame of 774 nucleotides and encodes polypeptides of 257 residues. The deduced MnCTL protein contains a single carbohydrate recognition domain (CRD) with an EPN (Glu-Pro-Asn) motif in calcium-binding site 2. Phylogenetic analysis indicated that MnCTL has a closer evolutionary relationship with vertebrate lectins than with invertebrate lectins. Tissue expression analysis showed that high levels of MnCTL are ubiquitously distributed in the gills and stomach of M. nipponense. Quantitative real-time RT-PCR (qRT-PCR) analysis showed that MnCTL expression was up-regulated by bacteria or white spot syndrome virus (WSSV) challenge. Knock-down of the MnCTL gene in WSSV-challenged prawns significantly decreased MnALF1 and MnALF2 transcript levels. The recombinant MnCRD (rMnCRD) agglutinated both Gram-positive (Staphylococcus aureus) and Gram-negative bacteria (Vibrio parahaemolyticus) in the presence of calcium. Furthermore, rMnCRD could bind to all the tested bacteria with different activities. The sugar-binding assay showed that rMnCRD was able to bind lipopolysaccharide and peptidoglycan in a concentration-dependent manner. In addition, rMnCRD could accelerate bacterial clearance. On the contrary, MnCTL silencing by dsRNA interference could weaken the bacterial clearance ability. All these findings implicated MnCTL were involved in the antiviral and antibacterial innate immunity of M. nipponense. Copyright © 2017 Elsevier Ltd. All rights reserved.
Isolation of a ß-galactoside-binding lectin from cat liver
Directory of Open Access Journals (Sweden)
L. Franco-Fraguas
2003-04-01
Full Text Available A lectin from cat liver has been identified and purified by affinity chromatography on asialofetuin-Sepharose. One hundred micrograms of lectin was obtained from one cat liver with a purification factor of 1561. The lectin agglutinates trypsin-treated rabbit and cow erythrocytes. Hemagglutination was inhibited only by saccharides containing ß-galactosyl residues, of which the 1-amine-1-deoxy-ß-D-galactose was the most potent one by inhibiting hemagglutination at a concentration of 12.5 mM, followed by melibiose, trehalose and galactose. The lectin has a subunit molecular mass of 14.4 kDa determined by SDS-PAGE under reducing conditions and a pI of 4.85. Compared with the composition of lectins from calf heart and porcine heart, cat liver lectin contains approximately the same amount of cysteine, half the amount of glycine, twice as much arginine and threonine, and three times the amounts of tyrosine and methionine. Cat liver lectin contains four cysteine residues per subunit, all of them in the reduced form. Their lack of reactivity towards thiol-reactive supports suggests they are not exposed on the lectin surface. The protein apparently has a blocked N-terminus. The purified lectin was stable for up to 20 months stored at +4ºC in buffer supplemented with 4 mM ß-mercaptoethanol. Results indicated that this lectin belongs to the family of soluble ß-galactoside-binding lectins, also known as galectins, which are expressed in a wide range of vertebrate tissues.
Influence of ionizing irradiation on the antioxidant enzymes of Vicia faba L.
Directory of Open Access Journals (Sweden)
El-Beltagi, Hossam E. S.
2010-09-01
Full Text Available The seeds of Vicia faba L. Giza 834 were exposed to γ-irradiation at dose levels of 2.5, 5.0, 10.0 and 20.0 kGy and after that exposed to He–Ne (632.8 nm or diode (650.0 nm laser irradiation for 5 min. The activities of POD, APOX, CAT, SOD and GST enzymes were significantly stimulated and this stimulation reached its maximum at a dose level of 5.0 kGy for enzymes POD, APOX, CAT and SOD, but for GST enzyme at a dose level 10.0 kGy. For He- Ne laser, with or without different doses (2.5, 5.0, 10.0 and 20.0 kGy of γ-irradiation, enzyme induction was significantly stimulated and positively correlated with the dose levels of γ-irradiation in combination with the He-Ne treatment. There was a significant increase in the concentration of MDA and this increase was more pronounced at dose level 20.0 kGy (38.2 μmol/g d.w compared to the control (3.9 μmol/g d.w. Laser treatment by He–Ne laser or diode laser only caused a slight increase (P 2O2 content significantly increased in all treatments and this increase reached its maximum at dose level 20.0 kGy (36.3 μmol/g d.w compared to the control (2.3 μmol/g d.w.. On the other hand, He-Ne or diode laser treatments combined with γ-irradiation significantly decreased in comparison with γ-irradiation treatments alone. In the case of glutathione content, there were significant increases by γ-irradiation at dose levels 2.5, 5.0, 10.0 and 20.0 kGy. Furthermore, with a combination of γ-irradiation and He-Ne or diode laser, a marked increase in glutathione content was found and was more pronounced than that of gamma irradiation alone.Semillas de Vicia faba L. Giza 834 fueron expuestas a γ-irradiación a dosis de 2.5, 5.0, 10.0 y 20.0 kGy y después expuesta a una radiación laser de He–Ne (632.8 nm o de diodo (650.0 nm durante 5 minutos. Las actividades de las enzimas POD, APOX, CAT, SOD y GST fueron favorecidas significativamente, y éstas alcanzaron un máximo a una dosis de 5.0 kGy para las enzimas
Directory of Open Access Journals (Sweden)
Luciana Sonne
2010-08-01
Full Text Available An unusual case of spontaneous Vicia villosa poisoning affected a 6-year-old Holstein cow. Although the most striking findings included a generalized hemorrhagic condition associated with granulomatous myelitis, histological lesions typically seen with the vetch-associated systemic granulomatous syndrome were also present. Prominent gross findings were bloody nasal and oral discharges, disseminated hemorrhages, and bloody feces. Generalized hemorrhages associated with infiltration of numerous organs by lymphocytes, plasma cells, macrophages, multinucleated giants cells, and eosinophils were the main microscopic findings. Anti-CD68 immunostaining confirmed the presence of moderate histiocytic infiltrate and multinucleated giant cells in the bone marrow. These changes in the bone marrow probably caused the generalized hemorrhagic changes described here.Um bovino Holandês de seis anos naturalmente intoxicado pela Vicia villosa apresentou lesões não comumente encontradas nessa intoxicação. Embora a lesão mais evidente fosse hemorragia generalizada associada à mielite granulomatosa, as lesões granulomatosas típicas da intoxicação pela ervilhaca também estavam presentes histologicamente. Os principais achados macroscópicos foram hemorragias nasal e oral, hemorragias generalizadas e fezes com sangue. Lesões hemorrágicas generalizadas associadas com infiltrado inflamatório de linfócitos, plasmócitos, macrófagos, células gigantes multinucleadas e eosinófilos foram os principais achados microscópicos encontrados. O teste imuno-histoquímico anti-CD68 confirmou a presença de infiltrado moderado de macrófagos e de células gigantes multinucleadas na medula óssea. As alterações na medula óssea provavelmente constituem a causa da hemorragia generalizada descrita nesse caso.
DEFF Research Database (Denmark)
Brown, P J; Poulsen, Steen Seier; Wells, M
1991-01-01
The distribution of goblet cells containing serine protease and of those binding the lectin Ulex europaeus agglutinin-1 (UEA-1) in the pig small intestine is altered during the period after weaning. Goblet cells exhibiting binding of other lectins were not altered. These alterations and other cha...
Macrophage galactose-type C-type lectin receptor for DC targeting of antitumor glycopeptide vaccines
DEFF Research Database (Denmark)
Nuti, M; Zizzari, I; Napoletano, C
2011-01-01
e13528 Background: Dendritic cells (DCs) are the most potent antigen presenting cells and are employed in cancer vaccination. Several receptors are being studied in order to identif strategies to increase DCs activating capacity. The C-type lectin macrophage galactose type C-type lectin (MGL...
The Roles of Direct Recognition by Animal Lectins in Antiviral Immunity and Viral Pathogenesis
Directory of Open Access Journals (Sweden)
Yang Liu
2015-01-01
Full Text Available Lectins are a group of proteins with carbohydrate recognition activity. Lectins are categorized into many families based on their different cellular locations as well as their specificities for a variety of carbohydrate structures due to the features of their carbohydrate recognition domain (CRD modules. Many studies have indicated that the direct recognition of particular oligosaccharides on viral components by lectins is important for interactions between hosts and viruses. Herein, we aim to globally review the roles of this recognition by animal lectins in antiviral immune responses and viral pathogenesis. The different classes of mammalian lectins can either recognize carbohydrates to activate host immunity for viral elimination or can exploit those carbohydrates as susceptibility factors to facilitate viral entry, replication or assembly. Additionally, some arthropod C-type lectins were recently identified as key susceptibility factors that directly interact with multiple viruses and then facilitate infection. Summarization of the pleiotropic roles of direct viral recognition by animal lectins will benefit our understanding of host-virus interactions and could provide insight into the role of lectins in antiviral drug and vaccine development.
C-type lectins do not act as functional receptors for filovirus entry into cells
Energy Technology Data Exchange (ETDEWEB)
Matsuno, Keita; Nakayama, Eri; Noyori, Osamu [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo (Japan); Marzi, Andrea; Ebihara, Hideki [Laboratory of Virology, Division of Intramural Research, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, MT (United States); Irimura, Tatsuro [Graduate School of Pharmaceutical Science, University of Tokyo, Tokyo (Japan); Feldmann, Heinz [Laboratory of Virology, Division of Intramural Research, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, MT (United States); Takada, Ayato, E-mail: atakada@czc.hokudai.ac.jp [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo (Japan)
2010-12-03
Research highlights: {yields} Filovirus glycoprotein (GP) having a deficient receptor binding region were generated. {yields} Mutant GPs mediated virus entry less efficiently than wild-type GP. {yields} Mutant GPs bound to C-type lectins but not mediated entire steps of cellular entry. {yields} C-type lectins do not independently mediate filovirus entry into cells. {yields} Other molecule(s) are required for C-type lectin-mediated entry of filoviruses. -- Abstract: Cellular C-type lectins have been reported to facilitate filovirus infection by binding to glycans on filovirus glycoprotein (GP). However, it is not clearly known whether interaction between C-type lectins and GP mediates all the steps of virus entry (i.e., attachment, internalization, and membrane fusion). In this study, we generated vesicular stomatitis viruses pseudotyped with mutant GPs that have impaired structures of the putative receptor binding regions and thus reduced ability to infect the monkey kidney cells that are routinely used for virus propagation. We found that infectivities of viruses with the mutant GPs dropped in C-type lectin-expressing cells, parallel with those in the monkey kidney cells, whereas binding activities of these GPs to the C-type lectins were not correlated with the reduced infectivities. These results suggest that C-type lectin-mediated entry of filoviruses requires other cellular molecule(s) that may be involved in virion internalization or membrane fusion.
Macroporous silica particles derivatized for enhanced lectin affinity enrichment of glycoproteins.
Mann, Benjamin F
2015-01-01
This chapter details procedures for (1) functionalizing macroporous silica particles with lectins, a class of proteins that have affinity for the glycan moieties on glycoproteins, and (2) utilizing the lectin-silica material for high-performance affinity chromatography (HPAC) to enrich glycoproteins from small volumes of biological sample materials.
Purification and Characterization of a Lectin from Phaseolus vulgaris cv. (Anasazi Beans
Directory of Open Access Journals (Sweden)
Arishya Sharma
2009-01-01
Full Text Available A lectin has been isolated from seeds of the Phaseolus vulgaris cv. “Anasazi beans” using a procedure that involved affinity chromatography on Affi-gel blue gel, fast protein liquid chromatography (FPLC-ion exchange chromatography on Mono S, and FPLC-gel filtration on Superdex 200. The lectin was comprised of two 30-kDa subunits with substantial N-terminal sequence similarity to other Phaseolus lectins. The hemagglutinating activity of the lectin was stable within the pH range of 1–14 and the temperature range of 0–80∘C. The lectin potently suppressed proliferation of MCF-7 (breast cancer cells with an IC50 of 1.3 μM, and inhibited the activity of HIV-1 reverse transcriptase with an IC50 of 7.6 μM. The lectin evoked a mitogenic response from murine splenocytes as evidenced by an increase in [3H-methyl]-thymidine incorporation. The lectin had no antifungal activity. It did not stimulate nitric oxide production by murine peritoneal macrophages. Chemical modification results indicated that tryptophan was crucial for the hemagglutinating activity of the lectin.
DEFF Research Database (Denmark)
Øhlenschlaeger, Tommy; Garred, Peter; Madsen, Hans O
2004-01-01
Cardiovascular disease is an important complication in patients with systemic lupus erythematosus (SLE). Variant alleles of the mannose-binding lectin gene are associated with SLE as well as with severe atherosclerosis. We determined whether mannose-binding lectin variant alleles were associated...
Mannose-binding lectin polymorphisms and susceptibility to infection in systemic lupus erythematosus
DEFF Research Database (Denmark)
Garred, P; Madsen, H O; Halberg, P
1999-01-01
To determine whether variant alleles in the coding portion of the mannose-binding lectin (MBL) gene are associated with increased susceptibility to systemic lupus erythematosus (SLE) and concomitant infections.......To determine whether variant alleles in the coding portion of the mannose-binding lectin (MBL) gene are associated with increased susceptibility to systemic lupus erythematosus (SLE) and concomitant infections....
Ezpeleta, I; Arangoa, M A; Irache, J M; Stainmesse, S; Chabenat, C; Popineau, Y; Orecchioni, A M
1999-11-25
One approach to improve the bioavailability and efficiency of drugs consists of the association of a ligand (i.e. lectins), showing affinity for biological structures located on the mucosa surfaces, to nanoparticulate drug delivery systems. In this context, Ulex europaeus lectin-gliadin nanoparticle conjugates (UE-GNP) were prepared with the aim of evaluating their in vitro bioadhesive properties. The lectin was fixed by a covalent procedure to gliadin nanoparticles by a two-stage carbodiimide method. Typically, the amount of bound lectin was calculated to be approximately 15 microg lectin/mg nanoparticle, which represented a coupling efficiency of approximately 16% of the initial lectin concentration. In addition, the activity of these conjugates was tested with bovine submaxillary gland mucin (BSM) and the level of binding to this mucin was always much greater with UE-GNP than with controls (gliadin nanoparticles). However, the presence of 50 micromol fucose, which is the reported specific sugar for U. europaeus lectin, specifically inhibited the activity of these conjugates and, therefore, the UE-GNP binding to BSM was attenuated by 70%. These results clearly showed that the activity and specificity of U. europaeus lectin was preserved after covalent coupling to these biodegradable carriers.
Wagemakers, Alex; Coumou, Jeroen; Schuijt, Tim J.; Oei, Anneke; Nijhof, Ard M.; van 't Veer, Cornelis; van der Poll, Tom; Bins, Adriaan D.; Hovius, Joppe W. R.
2016-01-01
We previously identified tick salivary lectin pathway inhibitor (TSLPI) in Ixodes scapularis, a vector for Borrelia burgdorferi sensu stricto (s.s.) in North America. TSLPI is a salivary protein facilitating B. burgdorferi s.s. transmission and acquisition by inhibiting the host lectin complement
Rapid bead-based immunoassay for measurement of mannose-binding lectin
DEFF Research Database (Denmark)
Bay, J T; Garred, P
2009-01-01
Mannose-binding lectin (MBL) is a serum protein, which functions as an opsonin and initiator of the lectin pathway of complement. The serum concentration of MBL shows great interindividual variation because of common polymorphisms in the MBL2 gene. Although several quantitative MBL immunoassays...
Serum levels, ontogeny and heritability of chicken mannan-binding lectin (MBL)
DEFF Research Database (Denmark)
Laursen, S.B.; Hedemand, J.E.; Nielsen, O.L.
1998-01-01
Mannan-binding lectin (MBL) is a serum lectin found in mammals and recently also in birds. It is thought to play an important role in the innate immune defence through binding to surface carbohydrates on micro-organisms followed by complement activation via the MBL pathway. This results...
Dual function of C-type lectin-like receptors in the immune system.
Cambi, A.; Figdor, C.G.
2003-01-01
Carbohydrate-binding C-type lectin and lectin-like receptors play an important role in the immune system. The large family can be subdivided into subtypes according to their structural similarities and functional differences. The selectins are of major importance in mediating cell adhesion and
An assay for the mannan-binding lectin pathway of complement activation
DEFF Research Database (Denmark)
Petersen, Steen Vang; Thiel, S; Jensen, L
2001-01-01
The mannan-binding lectin (MBL) pathway of complement activation has been established as the third pathway of complement activation. MBL is a carbohydrate-binding serum protein, which circulates in complex with serine proteases known as mannan-binding lectin associated serine proteases (MASPs...
The Lectin Frontier Database (LfDB), and data generation based on frontal affinity chromatography.
Hirabayashi, Jun; Tateno, Hiroaki; Shikanai, Toshihide; Aoki-Kinoshita, Kiyoko F; Narimatsu, Hisashi
2015-01-08
Lectins are a large group of carbohydrate-binding proteins, having been shown to comprise at least 48 protein scaffolds or protein family entries. They occur ubiquitously in living organisms-from humans to microorganisms, including viruses-and while their functions are yet to be fully elucidated, their main underlying actions are thought to mediate cell-cell and cell-glycoconjugate interactions, which play important roles in an extensive range of biological processes. The basic feature of each lectin's function resides in its specific sugar-binding properties. In this regard, it is beneficial for researchers to have access to fundamental information about the detailed oligosaccharide specificities of diverse lectins. In this review, the authors describe a publicly available lectin database named "Lectin frontier DataBase (LfDB)", which undertakes the continuous publication and updating of comprehensive data for lectin-standard oligosaccharide interactions in terms of dissociation constants (Kd's). For Kd determination, an advanced system of frontal affinity chromatography (FAC) is used, with which quantitative datasets of interactions between immobilized lectins and >100 fluorescently labeled standard glycans have been generated. The FAC system is unique in its clear principle, simple procedure and high sensitivity, with an increasing number (>67) of associated publications that attest to its reliability. Thus, LfDB, is expected to play an essential role in lectin research, not only in basic but also in applied fields of glycoscience.
Vliegenthart, J.F.G.; Haseley, S.R.; Talaga, P.; Kamerling, J.P.
1999-01-01
An accurate, rapid, and sensitive method for characterizing the carbohydrate binding properties of lectins using a BIAcore apparatus and the detection method of surface plasmon resonance is described. As a model study, the sialic acid binding lectins from Sambucus nigra and Maackia amurensis, which
Isolation and characterization of a new mannose-binding lectin gene ...
Indian Academy of Sciences (India)
Abstract. In this paper, we report the cloning and characterization of the first mannose-binding lectin gene from a gymnosperm plant species, Taxus media. ... Phylogenetic tree analyses showed that TMA belonged to the structurally and evolutionarily closely related monocot mannose-binding lectin superfamily. This study ...
Singh, D D; Saikrishnan, K; Kumar, Prashant; Dauter, Z; Sekar, K; Surolia, A; Vijayan, M
2004-11-01
The banana lectin from Musa paradisiaca, MW 29.4 kDa, has been isolated, purified and crystallized. The trigonal crystals contain one dimeric molecule in the asymmetric unit. The structure has been solved using molecular replacement to a resolution of 3 A. The structure of the subunit is similar to that of jacalin-like lectins.
The Distribution of Lectins across the Phylum Nematoda: A Genome-Wide Search
Directory of Open Access Journals (Sweden)
Lander Bauters
2017-01-01
Full Text Available Nematodes are a very diverse phylum that has adapted to nearly every ecosystem. They have developed specialized lifestyles, dividing the phylum into free-living, animal, and plant parasitic species. Their sheer abundance in numbers and presence in nearly every ecosystem make them the most prevalent animals on earth. In this research nematode-specific profiles were designed to retrieve predicted lectin-like domains from the sequence data of nematode genomes and transcriptomes. Lectins are carbohydrate-binding proteins that play numerous roles inside and outside the cell depending on their sugar specificity and associated protein domains. The sugar-binding properties of the retrieved lectin-like proteins were predicted in silico. Although most research has focused on C-type lectin-like, galectin-like, and calreticulin-like proteins in nematodes, we show that the lectin-like repertoire in nematodes is far more diverse. We focused on C-type lectins, which are abundantly present in all investigated nematode species, but seem to be far more abundant in free-living species. Although C-type lectin-like proteins are omnipresent in nematodes, we have shown that only a small part possesses the residues that are thought to be essential for carbohydrate binding. Curiously, hevein, a typical plant lectin domain not reported in animals before, was found in some nematode species.
Quaternary association in β-prism I fold plant lectins: Insights from X ...
Indian Academy of Sciences (India)
Dimeric banana lectin and calsepa, tetrameric artocarpin and octameric heltuba are mannose-specific -prism I fold lectins of nearly the same tertiary structure. MD simulations on individual subunits and the oligomers provide insights into the changes in the structure brought about in the protomers on oligomerization, ...
Gómez-Arroyo, S; Armienta, M A; Cortés-Eslava, J; Villalobos-Pietrini, R
1997-11-27
Sister chromatid exchanges (SCE) in Vicia faba root tips were used to examine well water containing high levels of arsenic. The increased amount of arsenic was contained in well water from different towns of Zimapan, Hidalgo, Mexico. Treatments of 3 h were applied followed by the differential staining technique of Tempelaar et al. (Mutation Res. 103 (1982) 321-326). Concentrations of arsenic from 0.267 up to 1.070 mg/l were determined by colorimetry in the polluted samples used for this study. These values were above the permissible limit of 0.05 mg/l in drinking water. In all cases, except one in which the As concentration was 0.021, the arsenic-contaminated water produced significant increases of SCE compared with the control (p Comarca Lagunera and the results observed in Zimapan.
Bechkri, Sakina; Medoukali, Imane; Khelifi, Douadi
2017-12-01
Genetic variability was studied in 78 populations of locally collected Vicia L. taxa for seed albumins, globulins and prolamins patterns by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) along with an ecogeographic characterization of sites investigated. 131, 119 and 98 bands were respectively used for albumin, globulin and prolamin cluster analysis. Dendrograms based on the Jaccard index and the UPGMA method were generated and the degree of genetic diversity between and within taxa was evaluated. Five clusters were generated from albumins, six from globulins and four from prolamins patterns. The results reflect the great diversity of storage proteins and a high correlation was obtained between the three studied fractions. Several accessions present specific bands which could be used as a discriminatory marker both on intra and interspecific levels. No clear relationships were seen between the groups according to their geographical origin. Data obtained from ecogeographic investigation can be used for future collecting missions.
Mitogenic activity of new lectins from seeds of wild Artocarpus species from Vietnam.
Blasco, E; Ngoc, L D; Aucouturier, P; Preud'Homme, J L; Barra, A
1996-05-01
Proliferative response of human peripheral blood mononuclear cells (PBMC) stimulated by new lectins purified from seeds of differents Artocarpus species from Vietnam (A. asperulus, A. heterophyllus, A. masticata, A. melinoxylus, A. parva and A. petelotii) was studied and compared to those of the lectin jacalin purified from jackfruit (A. heterophyllus) seeds collected in the island La Réunion. All lectins stimulated human PBMC to proliferate, with a variable efficiency of the mitogenic activity. Phenotypic analysis of cells recovered after 7 day-cultures showed that these lectins mostly stimulated CD4+ T lymphocytes. These results suggest that these lectins from different Artocarpus species are similar in terms of their mitogenic activity although their structural features are not identical.
LECTIN PROSPECTING IN COLOMBIAN LABIATAE. A SYSTEMATIC-ECOLOGICAL APPROACH - II.
Directory of Open Access Journals (Sweden)
PÉREZ GERARDO
2006-12-01
Full Text Available This is the second study of lectin and mucilage detection in Labiatae nutlets fromColombia. It was carried out on 31 taxa belonging to 7 genera in which no previousstudies have been carried out in this field. A differential response was observedin the group of genera and species studied in terms of mucilage presence as wellas lectin activity which consistently increased following extract treatment withPectinex. Lectin activity was detected in 28 species, being important (greater than60% activity in at least 75% of them. Genera such as Hyptis, Scutellaria, Aegiphilaand Lepechinia, whilst not presenting mucilage, did present lectin activity, havinghigh activity in most cases. By contrast, Salvia (in all sections studied presentedmucilage and important lectin activity.
Visualizing the dental biofilm matrix by means of fluorescence lectin-binding analysis
DEFF Research Database (Denmark)
Tawakoli, Pune Nina; Neu, Thomas R; Busck, Mette Marie
2017-01-01
The extracellular matrix is a poorly studied, yet important component of dental biofilms. Fluorescence lectin-binding analysis (FLBA) is a powerful tool to characterize glycoconjugates in the biofilm matrix. This study aimed to systematically investigate the ability of 75 fluorescently labeled...... lectins to visualize and quantify extracellular glycoconjugates in dental biofilms. Lectin binding was screened on pooled supragingival biofilm samples collected from 76 subjects using confocal microscopy. FLBA was then performed with 10 selected lectins on biofilms grown in situ for 48 h in the absence...... in the dental biofilm matrix. The characterization and quantification of glycoconjugates in dental biofilms require a combination of several lectins. For 48-h-biofilms grown in absence of sucrose, AAL, Calsepa, HPA, LEA, and MNA-G are recommendable....
Small unilamellar vesicles as reagents: a chemically defined, quantitative assay for lectins
Energy Technology Data Exchange (ETDEWEB)
Rando, R.R.
1981-01-01
Samll unilamellar vesicles containing synthetic glycolipids can be prepared. These vesicles are aggregated by the appropriate lectin (Orr et al., 1979; Rando and Bangerter, 1979; Slama and Rando, 1980). It is shown here that extent of aggregation of these vesicles as measured by light scattering at 360 nm, is, under certain conditions, linear with amount of lectin added. This forms the basis of a rapid and simple quantitative assay for lectins using the modified vesicles as a defined chemical substrate. The assay is sensitive to lectin concentrations in the low ..mu..g range. The assay is applied here to studies on concanavalin A, Ricinus communis agglutinin and the ..cap alpha..-fucosyl binding lectin from Ulex europaeus (Type I).
Complement-mediated neutralization of dengue virus requires mannose-binding lectin
DEFF Research Database (Denmark)
Avirutnan, Panisadee; Hauhart, Richard E; Marovich, Mary A
2011-01-01
ABSTRACT Mannose-binding lectin (MBL) is a key soluble pathogen recognition protein of the innate immune system that binds specific mannose-containing glycans on the surfaces of microbial agents and initiates complement activation via the lectin pathway. Prior studies showed that MBL...... deficient in different complement components, we showed that inhibition of infection by insect cell- and mammalian cell-derived DENV was primarily dependent on the lectin pathway. Human MBL also bound to DENV and neutralized infection of all four DENV serotypes through complement activation...... hemorrhagic fever and dengue shock syndrome. Four serotypes of DENV exist, and severe illness is usually associated with secondary infection by a different serotype. Here, we show that mannose-binding lectin (MBL), a pattern recognition molecule that initiates the lectin pathway of complement activation...
Evolutionary conservation of mannan-binding lectin (MBL) in bony fish
DEFF Research Database (Denmark)
Kania, Per Walter; Sørensen, Rasmus Reng; Koch, Claus
2010-01-01
characterized in the rainbow trout but so far no molecules of the lectin pathway have been identified. Based on the generally accepted idea of complement evolution, which predicts that the alternative pathway predates the two other pathways, and that the lectin pathway developed before the classical, we set out...... to characterize members of the lectin pathway in fish. We identified and characterized three homologues of mannan-binding lectin (MBL) with a bona fide collectin structure. By means of RT-PCR and immunohistochemistry using monoclonal antibodies we found that they were synthesized in the spleen, the anterior...... intestine and the liver. In the liver, we saw co-expression with mannan-binding lectin associated serine protease (MASP). The MBL homologues 2 and 3 (MBL-H2,3) were also found in the vascular system of the rainbow trout. By means of gel size exclusion chromatography of serum we found that MBL-H2...
Developmental changes in the distribution of cecal lectin-binding sites of Balb-c mice.
Doehrn, S; Breipohl, W; Lierse, W; Romaniuk, K; Young, W
1992-01-01
The existence of lectin-binding sites was investigated in the cecum of Balb-c mice at seven developmental stages ranging from 18 days post conception (p.c.) to 8 weeks after birth. Nine horseradish-peroxidase-conjugated lectins (concanavalin A, Triticum vulgaris, Dolichus biflorus, Helix pomatia, Arachis hypogaea, Glycine maximus, Lotus tetragonolobus, Ulex europaeus, Limulus polyphemus) were applied to 5- to 7-microns thin paraffin sections of Bouin-fixed tissue. After DAB staining the sections were evaluated by light microscopy. It was shown that each lectin exhibits a unique developmental pattern. The adult binding patterns were established at the age of 3-4 weeks with only minor changes occurring thereafter. Considerable differences in binding patterns occurred not only between lectins of different groups but also between lectins with the same nominal monosaccharide specificity.
Petryniak, J; Huard, T K; Nordblom, G D; Goldstein, I J
1986-01-01
Purified 125I-labeled lectins from Datura stramonium, Evonymus europaea, and Griffonia simplicifolia (I-B4 isolectin) were used to analyze changes in the expression of carbohydrates on the surface of resident (PC) and thioglycollate-stimulated murine (C57B/6J) peritoneal exudate cells (PEC). The lectins from D. stramonium, E. europaea, and G. simplicifolia I-B4 bind specifically to PEC with relatively high affinity (Kd = 5.65 +/- 1.08 X 10(-7) M, 1.08 +/- 0.12 X 10(-8) M, and 1.33 +/- 0.15 X 10(-7) M, respectively). Assuming a single lectin molecule binds to each cell surface saccharide, the number of receptor sites per cell ranged for different cell samples from 22.3 to 50.0 X 10(6), from 3.8 to 4.8 X 10(6), and from 2.0 to 16.8 X 10(6) for D. stramonium, E. europaea, and G. simplicifolia I-B4 lectins, respectively. There were approximately 3- to 7-fold, 16- to 20-fold, and 2- to 20-fold increases in binding capacity for D. stramonium, E. europaea and G. simplicifolia I-B4, respectively, compared to the binding to resident, peritoneal cells. Scatchard plots of the binding of all three lectins to PEC were linear, suggesting that the receptor sites for these lectins are homogeneous and noninteracting. The binding capacity of these lectins to PEC was unchanged after trypsin digestion of cells. The expression of carbohydrates on the surface of PEC was also monitored by an agglutination assay. PEC were agglutinated by all three lectins whereas PC either were not agglutinated or were agglutinated only at high lectin concentrations. On the basis of our knowledge of the carbohydrate binding specificity of the D. stramonium and G. simplicifolia I-B4 lectins, we postulate that, parallel with thioglycolate stimulation, there is an increase in the number of N-acetyllactosamine residues and terminal alpha-D-galactosyl end groups. The blood group B, and H type 1 determinants--DGa1 alpha 1,3[LFuc alpha 1,2]DGa1 beta 1,3(or 4)DGlcNAc and LFuc alpha 1,2DGa1 beta 1,3DG1c
CAPs markers to assist selection for low vicine and convicine contents in faba bean (Vicia faba L.).
Gutierrez, N; Avila, C M; Duc, G; Marget, P; Suso, M J; Moreno, M T; Torres, A M
2006-12-01
The antinutritional factors (ANFs) present in Vicia spp. seeds are a major constraint to the wider utilization of these crops as grain legumes. In the case of faba bean (Vicia faba L.), a breeding priority is the absence vicine and convicine (v-c); responsible for favism in humans and for the reduced animal performance or low egg production in laying hens. The discovery of a spontaneous mutant allele named vc-, which induces a 10-20 fold reduction of v-c contents, may facilitate the process. However, the high cost and difficulty of the chemical detection of v-c seriously restricts the advances in breeding-selection. To identify random amplified polymorphic DNA (RAPD) markers linked to this gene, we have analysed an F(2 )population derived from a cross between a line with high v-c content (Vf6) and the vc- genotype (line 1268). Quantification of v-c was done by spectrophotometry on the parents and the F(2 )population (n = 136). By using bulked segregant analysis (BSA), two RAPD markers linked in coupling and repulsion phase to the allele vc- were identified and further converted into sequence characterized amplified regions (SCARs). Amplification of SCARS was more consistent, although the initial polymorphism between pools was lost. To recover the polymorphisms several approaches were explored. Restriction digestion with HhaI (for SCAR SCH01(620)) and RsaI (for SCAR SCAB12(850)) revealed clear differences between the parental lines. The simultaneous use of the two cleavage amplified polymorphism (CAP) markers will allow the correct fingerprinting of faba bean plants and can be efficiently used in breeding selection to track the introgression of the vc- allele to develop cultivars with low v-c content and improved nutritional value.
Directory of Open Access Journals (Sweden)
Shahera Zaitoun
2010-01-01
Full Text Available A field experiment was conducted during 2005/2006 at Jordan University of Science and Technology campus (32°30” N, 35°59” E, Irbid, Jordan, to study the role of bee visitors on seed set and production of Vicia villosa spp. dasycarpa grown under semiarid conditions. Two treatments were imposed on Vicia villosa plants before flowering: 1 Plants were covered in cages (control or 2 Plants were left uncovered to permit bee visiting. The results of this experiment showed that V. villosa flowers were very attractive to worker honeybees as well as to few numbers of wild bees. The most frequent visitor species were A. mellifera and Anthophora albigena of family Apidae. V. villosa flowers attracted most of the bee visitors in the early hours of the day. The duration of their visit on the flowers also peaked early in the day and decreased toward the end of the day. The percentage of pod set of the un-covered plants averaged 14% out of the total florets on the plants, which was significantly higher than the covered plants (2%. These results indicated that the percentage of flower abscission was high and averaged more than 86%. Plant covering significantly reduced seed yield by reducing seed and pod number per plant and seed number per pod, but had no effect on individual seed weight. In conclusion, preventing bees from visiting during flowering of V. villosa spp. dasycarpa decreased seed set, seed yield and yield components. Further studies are needed to understand the high flower abscission and failure of seed set in this species.
Re-examining the proposed lectin properties of IL-2.
Papalia, Giuseppe A; Rini, James M
2008-03-01
Early work examining the interactions of IL-2 and the urinary glycoprotein uromodulin led to the suggestion that IL-2 was a lectin with specificity for high-mannose and mannan ligands. Subsequent studies have attributed various roles to these properties, some critical to the cell proliferative activity of IL-2. In an attempt to verify the reported interaction between IL-2 and mannose containing carbohydrate ligands we studied two biologically active forms of IL-2 using various techniques including affinity chromatography, equilibrium dialysis, and NMR methods. Despite previous reports we have not been able to demonstrate that IL-2 possesses the ability to bind carbohydrate.
Directory of Open Access Journals (Sweden)
Irena Lorenc-Kubis
2014-01-01
Full Text Available Hemagglutinating activity has been found in acetate extracts from roots and stems of squash seedlings (Cucurbita ficifolia. The hemaglutinating activity changes during seeds germination and seedling development. Dot blot and Western blot techniques have shown that proteins from these vegetative tissues cross-reacted with antibodies raised against endogenous cotyledons lectin CLBa and Con A.Lectins were isolated from stems and roots of 6-day old seedlings by precipitation with ethanol, affinity chromatography on Con A-Sepharose, gel filtration on Bio-gel P100 and separated by electrophoresis on polyacrylamide gel. Three purified lectins (RLA1, RLA2, RLA3 were obtained from roots and four from stems (SLA1, SLA2, SLA3, SLA4. The purified lectins from roots and stems agglutinated all human red blood cells, but sheep erythrocytes were most sensitive to agglutination. The hemagglutination of the root lectins RLA2 and RLA3 was inhibited by a very low concentration of arabinose, while RLA1, of xylose and Ga1NAc. Arabinose and Xylose were also found to be the most effective inhibitors of all stem lectins.
Directory of Open Access Journals (Sweden)
Yufang Hou
2010-01-01
Full Text Available Reversed micelles were used to extract lectin from red kidney beans and factors affecting reverse micellar systems (pH value, ionic strength and extraction time were studied. The optimal conditions were extraction at pH 4–6, back extraction at pH 9–11, ion strength at 0.15 M NaCl, extraction for 4–6 minutes and back extraction for 8 minutes. The reverse micellar system was compared with traditional extraction methods and demonstrated to be a time-saving method for the extraction of red kidney bean lectin. Mitogenic activity of the lectin was reasonably good compared with commercial phytohemagglutinin (extracted from Phaseolus vulgaris Mitogenic properties of the lectin were enhanced when four Chinese herbal polysaccharides were applied concurrently, among which 50 μg/mL Astragalus mongholicus polysaccharides (APS with 12.5 μg/mL red kidney bean lectin yielded the highest mitogenic activity and 100 mg/kg/bw APS with 12.5 mg/kg/bw red kidney bean lectin elevated mouse nonspecific immunity.
Yagi, Fumio; Iwaya, Toshinobu; Haraguchi, Tomokazu; Goldstein, Irwin J
2002-09-01
A novel lectin was isolated from leaves of the Japanese cycad, Cycas revoluta Thunb. (gymnosperm), and its characteristics including amino acid composition, molecular mass, carbohydrate binding specificity and partial amino acid sequences were examined. The inhibition analysis of hemagglutinating activity with various sugars showed that the lectin has a carbohydrate-binding specificity similar to those of mannose recognizing, jacalin-related lectins. Partial amino acid sequences of the lysylendopeptic peptides shows that the lectin might have a repeating structure and belong to the jacalin-related lectin family.
DEFF Research Database (Denmark)
Vijn, I; Yang, W C; Pallisgård, N
1995-01-01
We isolated ENOD5, ENOD12 and ENOD40 homologues from Vicia sativa and studied their expression pattern during Rhizobium-induced nodule formation. Comparison of the VsENOD40 nucleotide sequence with the pea, soybean and alfalfa ENOD40 sequences showed that the sequences contain two conserved regions...... the expression pattern of VsENOD5, VsENOD12 and VsENOD40 during Rhizobium-induced nodule formation. Although the expression of these genes is largely similar to that of the pea counterparts, differences where found for the expression of VsENOD12 and VsENOD40 in Vicia. VsENOD12 is expressed in the whole...
Mazur, Andrzej; De Meyer, Sofie E; Tian, Rui; Wielbo, Jerzy; Zebracki, Kamil; Seshadri, Rekha; Reddy, Tbk; Markowitz, Victor; Ivanova, Natalia N; Pati, Amrita; Woyke, Tanja; Kyrpides, Nikos C; Reeve, Wayne
2015-01-01
Rhizobium leguminosarum bv. viciae GB30 is an aerobic, motile, Gram-negative, non-spore-forming rod that can exist as a soil saprophyte or as a legume microsymbiont of Pisum sativum. GB30 was isolated in Poland from a nodule recovered from the roots of Pisum sativum growing at Janow. GB30 is also an effective microsymbiont of the annual forage legumes vetch and pea. Here we describe the features of R. leguminosarum bv. viciae strain GB30, together with sequence and annotation. The 7,468,464 bp high-quality permanent draft genome is arranged in 78 scaffolds of 78 contigs containing 7,227 protein-coding genes and 75 RNA-only encoding genes, and is part of the GEBA-RNB project proposal.
Directory of Open Access Journals (Sweden)
Ambarova N. O.
2009-12-01
Full Text Available Aim. The purpose of this investigation was to research carbohydrate specificity of a new lectin from fruiting body of Mycena pura and possibilities of its application in histochemical studies. Methods. The lectin has been purified by affinity chromatography on «îvomucine». The lectin carbohydrate specificity has been determined by a reaction of inhibiting haemagglutination by haptens. Histological materials were fixed in 4 % neutral formalin solution. Alkaline phosphatase was revealed in the cryostat unfixed microscopical sections. Results. The lectin yield from fresh fruit bodies of raw material was 9 mg/kg. Mol. mass of the lectin is 40 kDa. The lectin poorly interacted with D-glucose and D-mannose in contrast to lectins from Pisum sativum and Leucojum vernum. The peculiarity of this lectin is its strong interaction with alkaline phosphatase, the highest among twenty tested lectins. However, the receptors for Mycena lectin binding in mammalian tissues are not limited by this enzyme being presented also by glycoconjugates of another structure, as it was shown for fetus calf small intestine and kidney of rat. Conclusions. An important role in the lectin interaction with glycoproteins probably belongs to the disaccharide links of GlcNAcb(1-2Mana(1-6 or GlcNAcb(1- 2Mana(1-2, which not necessarily are terminal
Isolation and characterization of two Korean mistletoe lectins.
Kang, Tae Bong; Song, Seong Kyu; Yoon, Taek Joon; Yoo, Yung Choon; Lee, Kwan Hee; Her, Erk; Kim, Jong Bae
2007-11-30
Two isolectins (KML-IIU and the KML-IIL) were individually isolated from the previously reported Korean mistletoe lectin, KML-C, by using an immunoaffinity column. Molecular weights of the KML-IIU and the KML-IIL were 64 kDa and 60 kDa respectively. Both of the lectins were composed of heterogeneous A and B subunits linked with a disulfide bond, and showed the same carbohydrate-binding specificities for Gal and GalNAc. However, they are different not only in biophysical properties (glycosylation and amino acid compositions) but also bioactivities (cell killing and cytokine induction). The KML-IIL showed 17-145 times stronger in cytotoxicities to various human and mouse cancer cell lines than the KML-IIU. The KML-IIL also induced TNF-alpha secretion from mouse peritoneal macrophages 4.5 times better than the KML-IIU. The results demonstrated isolectins in Korean mistletoe were varied in bioactivities and the KML-IIL may be developed as an anti-cancer agent.
Nkrp1 Family, from Lectins to Protein Interacting Molecules
Directory of Open Access Journals (Sweden)
Daniel Rozbeský
2015-02-01
Full Text Available The C-type lectin-like receptors include the Nkrp1 protein family that regulates the activity of natural killer (NK cells. Rat Nkrp1a was reported to bind monosaccharide moieties in a Ca2+-dependent manner in preference order of GalNac > GlcNAc >> Fuc >> Gal > Man. These findings established for rat Nkrp1a have been extrapolated to all additional Nkrp1 receptors and have been supported by numerous studies over the past two decades. However, since 1996 there has been controversy and another article showed lack of interactions with saccharides in 1999. Nevertheless, several high affinity saccharide ligands were synthesized in order to utilize their potential in antitumor therapy. Subsequently, protein ligands were introduced as specific binders for Nkrp1 proteins and three dimensional models of receptor/protein ligand interaction were derived from crystallographic data. Finally, for at least some members of the NK cell C-type lectin-like proteins, the “sweet story” was impaired by two reports in recent years. It has been shown that the rat Nkrp1a and CD69 do not bind saccharide ligands such as GlcNAc, GalNAc, chitotetraose and saccharide derivatives (GlcNAc-PAMAM do not directly and specifically influence cytotoxic activity of NK cells as it was previously described.
Kamo, Tsunashi; Takemura, Tomoko; Wasano, Naoya; Fujii, Yoshiharu; Hiradate, Syuntaro
2012-01-01
We quantified the cyanamide content of young leaves of nine Vicia species, Lens culinaris, and Robinia pseudo-acacia using a modified analytical procedure that made it possible to measure the cyanamide content of a single leaf. Recent molecular phylogenetic analysis suggests that cyanamide is present in V. benghalensis, which is placed in a monophyletic group with cyanamide-biosynthesizing plants, V. villosa and V. cracca; this suggestion was verified.
BAĞCI, Muhittin; Mutlu, Hüseyin
2014-01-01
This study covers M2 generation of the mutation breeding Project with practice of gamma irradiation on Hungarian vetch (Vicia pannonica Crantz.). The study was counducted, with the purpose of determine and contrast control dose have effects on some properties of vegetational. In the study, M1 plant seeds of three Hungarian vetch cultivars (Tarmbeyazı-98, Anadolupembesi-2002 and Oğuz-2002) were planted. It was examined that morphological, biological and agricultural characteristics obtained M2...
Witten, Stephanie; Aulrich, Karen
2015-01-01
In Organic Farming, grain legumes are important protein feedstuffs. There are hints indicating that the amino acid (AA) profile is affected by factors associated with varying crude protein (CP) contents of crops. The knowledge on this relationship between CP and AA profile needs to be extended to optimize feeding strategies for monogastrics as well as the selection of cultivars and varieties in fodder crop cultivation. Therefore, samples of 67 field beans (Vicia faba L.) and 86 field peas (Pi...
Lectin typing of Campylobacter jejuni using a novel quartz crystal microbalance technique
Energy Technology Data Exchange (ETDEWEB)
Yakovleva, Maria E., E-mail: maria.yakovleva@gmail.com [Department of Infectious Diseases and Medical Microbiology, Lund University, 223 62 Lund (Sweden); Moran, Anthony P. [Department of Microbiology, School of Natural Sciences, National University of Ireland, Galway (Ireland); Safina, Gulnara R. [Department of Analytical and Marine Chemistry, University of Gothenburg, 412 96 Gothenburg (Sweden); Wadstroem, Torkel [Department of Infectious Diseases and Medical Microbiology, Lund University, 223 62 Lund (Sweden); Danielsson, Bengt [Acromed Invest AB, Magistratsvaegen 10, 226 43 Lund (Sweden)
2011-05-23
Seven Campylobacter jejuni strains were characterised by a lectin typing assay. The typing system was based on a quartz crystal microbalance technique (QCM) with four commercially available lectins (wheat germ agglutinin, Maackia amurensis lectin, Lens culinaris agglutinin, and Concanavalin A), which were chosen for their differing carbohydrate specificities. Initially, the gold surfaces of the quartz crystals were modified with 11-mercaptoundecanoic acid followed by lectin immobilisation using a conventional amine-coupling technique. Bacterial cells were applied for lectin typing without preliminary treatment, and resonant frequency and dissipation responses were recorded. The adhesion of microorganisms on lectin surfaces was confirmed by atomic force microscopy. Scanning was performed in the tapping mode and the presence of bacteria on lectin-coated surfaces was successfully demonstrated. A significant difference in the dissipation response was observed for different C. jejuni strains which made it possible to use this parameter for discriminating between bacterial strains. In summary, the QCM technique proved a powerful tool for the recognition and discrimination of C. jejuni strains. The approach may also prove applicable to strain discrimination of other bacterial species, particularly pathogens.
Energy Technology Data Exchange (ETDEWEB)
Delatorre, P.; Gadelha, C.A.A.; Santi-Gadelha, T. [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil); Nobrega, R.B.; Rocha, B.A.M.; Nascimento, K.S.; Naganao, C.S.; Sampaio, A.H.; Cavada, B.S. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil); Pires, A.F.; Assreuy, A.M.S. [Universidade Estadual do Ceara (UECE), Fortaleza, CE (Brazil)
2012-07-01
Full text: Lectins are proteins/glycoproteins with at least one noncatalytic domain binding reversibly to specific monosaccharides or oligosaccharides. By binding to carbohydrate moieties on the cell surface, lectins participate in a range of cellular processes without changing the properties of the carbohydrates involved. The lectin of Dioclea virgata (DvirL), both native and complexed with X-man, was submitted to X-ray diffraction analysis and the crystal structure was compared to that of other Diocleinae lectins in order to better understand differences in biological proper- ties, especially with regard to the ability of lectins to induce nitric oxide (NO) production. The DvirL diffraction analysis revealed that both the native crystal and the X-Man-complexed form are orthorhombic and belong to space group I222. The cell parameters were: a=65.4 , b=86.6 and c=90.2 (native structure), and a=61.89 , b=87.67 and c=88.78 (X-Man-complexed structure). An association was observed between the volume of the carbohydrate recognition domain (CRD), the ability to induce NO production and the relative positions of Tyr12, Arg228 and Leu99. Thus, differences in biological activity induced by Diocleinae lectins are related to the configuration of amino acid residues in the carbohydrate binding site and to the structural conformation of subsequent regions capable of influencing site-ligand interactions. In conclusion, the ability of Diocleinae lectins to induce NO production depends on CRD configuration. (author)
Petrova, Mariya I; Imholz, Nicole C E; Verhoeven, Tine L A; Balzarini, Jan; Van Damme, Els J M; Schols, Dominique; Vanderleyden, Jos; Lebeer, Sarah
2016-01-01
Increased antibiotic resistance has catalyzed the research on new antibacterial molecules and alternative strategies, such as the application of beneficial bacteria. Since lectin molecules have unique sugar-recognizing capacities, and pathogens are often decorated with sugars that affect their survival and infectivity, we explored whether lectins from the probiotic strain Lactobacillus rhamnosus GG have antipathogenic properties. The genome sequence of L. rhamnosus GG was screened for the presence of lectin-like proteins. Two genes, LGG_RS02780 and LGG_RS02750, encoding for polypeptides with an N-terminal conserved L-type lectin domain were detected and designated Llp1 (lectin-like protein 1) and Llp2. The capacity of Llp1 and Llp2 to inhibit biofilm formation of various pathogens was investigated. Sugar specificity was determined by Sepharose beads assays and glycan array screening. The isolated lectin domains of Llp1 and Llp2 possess pronounced inhibitory activity against biofilm formation by various pathogens, including clinical Salmonella species and uropathogenic E. coli, with Llp2 being more active than Llp1. In addition, sugar binding assays with Llp1 and Llp2 indicate specificity for complex glycans. Both proteins are also involved in the adhesion capacity of L. rhamnosus GG to gastrointestinal and vaginal epithelial cells. Lectins isolated from or expressed by beneficial lactobacilli could be considered promising bio-active ingredients for improved prophylaxis of urogenital and gastrointestinal infections.
Greatens, Amanda; Hakozaki, Tomohiro; Koshoffer, Amy; Epstein, Howard; Schwemberger, Sandy; Babcock, George; Bissett, Donald; Takiwaki, Hirotsugu; Arase, Seiji; Wickett, R Randall; Boissy, Raymond E
2005-07-01
Skin pigmentation results in part from the transfer of melanized melanosomes synthesized by melanocytes to neighboring keratinocytes. Plasma membrane lectins and their glycoconjugates expressed by these epidermal cells are critical molecules involved in this transfer process. In addition, the derivative of vitamin B(3), niacinamide, can inhibit melanosome transfer and induce skin lightening. We investigated the effects of these molecules on the viability of melanocytes and keratinocytes and on the reversibility of melanosome-transfer inhibition induced by these agents using an in vitro melanocyte-keratinocyte coculture model system. While lectins and neoglycoproteins could induce apoptosis in a dose-dependent manner to melanocytes or keratinocytes in monoculture, similar dosages of the lectins, as opposed to neoglycoproteins, did not induce apoptosis to either cell type when treated in coculture. The dosages of lectins and niacinamide not affecting cell viability produced an inhibitory effect on melanosome transfer, when used either alone or together in cocultures of melanocytes-keratinocytes. Cocultures treated with lectins or niacinamide resumed normal melanosome transfer in 3 days after removal of the inhibitor, while cocultures treated with a combination of lectins and niacinamide demonstrated a lag in this recovery. Subsequently, we assessed the effect of niacinamide on facial hyperpigmented spots using a vehicle-controlled, split-faced design human clinical trial. Topical application of niacinamide resulted in a dose-dependent and reversible reduction in hyperpigmented lesions. These results suggest that lectins and niacinamide at concentrations that do not affect cell viability are reversible inhibitors of melanosome transfer.
Synthesis of a selective inhibitor of a fucose binding bacterial lectin from Burkholderia ambifaria.
Richichi, Barbara; Imberty, Anne; Gillon, Emilie; Bosco, Rosa; Sutkeviciute, Ieva; Fieschi, Franck; Nativi, Cristina
2013-06-28
Burkholderia ambifaria is a bacterium member of the Burkholderia cepacia complex (BCC), a closely related group of Gram-negative bacteria responsible for "cepacia syndrome" in immunocompromised patients. B. ambifaria produces BambL, a fucose-binding lectin that displays fine specificity to human fucosylated epitopes. Here, we report the first example of a synthetic ligand able to selectively bind, in the micromolar range, the pathogen-lectin BambL. The synthetic routes for the preparation of the α conformationally constrained fucoside are described, focusing on a totally diastereoselective inverse electron demand [4 + 2] Diels-Alder reaction. Isothermal titration calorimetry (ITC) demonstrated that this compound binds to the pathogen-associated lectin BambL with an affinity comparable to that of natural fucose-containing oligosaccharides. No binding was observed by LecB, a fucose-binding lectin from Pseudomonas aeruginosa, and the differences in affinity between the two lectins could be rationalized by modeling. Furthermore, SPR analyses showed that this fucomimetic does not bind to the human fucose-binding lectin DC-SIGN, thus supporting the selective binding profile towards B. ambifaria lectin.
Chatterjee, Biji; Ghosh, Krishna; Yadav, Nitin; Kanade, Santosh R
2017-01-01
Lectins are omnipresent in almost all life forms, being the proteins which specifically bind to carbohydrate moieties on the cell surface; they have been explored for their anti-tumour activities. In this study, we purified a fucose specific-lectin (IFL) from Fenneropenaeus indicus haemolymph using fucose-affinity column and characterized for its haemagglutination activity, carbohydrate specificity, dependency on cations and cytotoxicity against cancer cells. The lectin showed non-specificity against human erythrocytes. It was a Ca2+-dependent lectin which remained stable over wide pH and temperature ranges. The lectin showed effective dose dependent cytotoxicity against different human cancer cell lines and induced apoptosis in MCF-7 cells as evidenced by DNA ladder assay and PARP cleavage in a dose dependent manner. Moreover, an increased p21 level corresponding to cyclin D downregulation in response to IFL treatment was observed which might work as probable factors to inhibit cell growth and induce apoptosis of MCF-7 cells. Therefore, we report a novel lectin from the prawn haemolymph with high specificity for L-fucose and antiproliferative towards human cancer cells. However, further establishment of the modus operandi of this lectin is required to enable its biotechnological applications. © The Authors 2016. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.
N-acetyl-D-galactosamine-specific lectin isolated from the seeds of Carica papaya.
Wang, Teng-Hsu; Kung, Yen-Lun; Lee, Min-Hsiung; Su, Nan-Wei
2011-04-27
N-Acetyl-D-galactosamine (GalNAc)-specific lectins are of great interest because they have been reported to detect tumor-associated antigens of malignant cells. We isolated a novel lectin from Carica papaya seeds, named C. papaya lectin (CPL). Purification of the lectin involved ammonium sulfate fractionation and DEAE anion exchange and repeated gel filtration chromatography. Inhibition of CPL causing hemagglutination on human erythrocytes showed that the lectin shows specificity to GalNAc and lactose. Surface plasmon resonance further revealed that the lectin possesses high specificity toward GalNAc with a dissociation constant of 5.5 × 10(-9) M. The lectin is composed of 38- and 40-kDa subunits with a molecular mass of ∼804 kDa estimated by size-exclusion high-performance liquid chromatography. Incubation of CPL with Jurkat T cells showed significant induction of IL-2 cytokine, which suggests that CPL has potent immunomodulatory effects on immune cells.
Comparative Study of Lectin Domains in Model Species: New Insights into Evolutionary Dynamics
Directory of Open Access Journals (Sweden)
Sofie Van Holle
2017-05-01
Full Text Available Lectins are present throughout the plant kingdom and are reported to be involved in diverse biological processes. In this study, we provide a comparative analysis of the lectin families from model species in a phylogenetic framework. The analysis focuses on the different plant lectin domains identified in five representative core angiosperm genomes (Arabidopsis thaliana, Glycine max, Cucumis sativus, Oryza sativa ssp. japonica and Oryza sativa ssp. indica. The genomes were screened for genes encoding lectin domains using a combination of Basic Local Alignment Search Tool (BLAST, hidden Markov models, and InterProScan analysis. Additionally, phylogenetic relationships were investigated by constructing maximum likelihood phylogenetic trees. The results demonstrate that the majority of the lectin families are present in each of the species under study. Domain organization analysis showed that most identified proteins are multi-domain proteins, owing to the modular rearrangement of protein domains during evolution. Most of these multi-domain proteins are widespread, while others display a lineage-specific distribution. Furthermore, the phylogenetic analyses reveal that some lectin families evolved to be similar to the phylogeny of the plant species, while others share a closer evolutionary history based on the corresponding protein domain architecture. Our results yield insights into the evolutionary relationships and functional divergence of plant lectins.
The Lectin Frontier Database (LfDB, and Data Generation Based on Frontal Affinity Chromatography
Directory of Open Access Journals (Sweden)
Jun Hirabayashi
2015-01-01
Full Text Available Lectins are a large group of carbohydrate-binding proteins, having been shown to comprise at least 48 protein scaffolds or protein family entries. They occur ubiquitously in living organisms—from humans to microorganisms, including viruses—and while their functions are yet to be fully elucidated, their main underlying actions are thought to mediate cell-cell and cell-glycoconjugate interactions, which play important roles in an extensive range of biological processes. The basic feature of each lectin’s function resides in its specific sugar-binding properties. In this regard, it is beneficial for researchers to have access to fundamental information about the detailed oligosaccharide specificities of diverse lectins. In this review, the authors describe a publicly available lectin database named “Lectin frontier DataBase (LfDB”, which undertakes the continuous publication and updating of comprehensive data for lectin-standard oligosaccharide interactions in terms of dissociation constants (Kd’s. For Kd determination, an advanced system of frontal affinity chromatography (FAC is used, with which quantitative datasets of interactions between immobilized lectins and >100 fluorescently labeled standard glycans have been generated. The FAC system is unique in its clear principle, simple procedure and high sensitivity, with an increasing number (>67 of associated publications that attest to its reliability. Thus, LfDB, is expected to play an essential role in lectin research, not only in basic but also in applied fields of glycoscience.
Tissue and subcellular distribution of the lectin from Datura stramonium (thorn apple).
Kilpatrick, D C; Yeoman, M M; Gould, A R
1979-01-01
Plants of Datura stramonium (thorn-apple) were dissected into their component tissues and examined for the presence of the Datura lectin. This lectin was easily detected in seeds and in various parts of the flowers of adult plants. Traces were also found in green (emerged) cotyledons and roots of seedlings. The specific lectin activity in seeds contained within the fruits increased as the seeds matured. Mature seeds were homogenized in sucrose and separated by differential centrifugation into four fractions, three of which were clearly of distinct composition. Most of the lectin activity sedimented with the low-speed (cell-wall/protein-body) pellet, but a similar specific activity was recovered from the other fractions. However, if EDTA was included in the homogenization medium, three or four times more lectin activity was recovered in the soluble fraction. Immunofluorescent staining of formaldehyde-fixed sections showed that the lectin was localized in the cytoplasm, with little associated with cell walls. The possible relevance of these results to the function of the lectin in plant cells is discussed. Images PLATE 1 PLATE 2 PMID:393254
Lectin-based food poisoning: a new mechanism of protein toxicity.
Directory of Open Access Journals (Sweden)
Katsuya Miyake
Full Text Available BACKGROUND: Ingestion of the lectins present in certain improperly cooked vegetables can result in acute GI tract distress, but the mechanism of toxicity is unknown. In vivo, gut epithelial cells are constantly exposed to mechanical and other stresses and consequently individual cells frequently experience plasma membrane disruptions. Repair of these cell surface disruptions allows the wounded cell to survive: failure results in necrotic cell death. Plasma membrane repair is mediated, in part, by an exocytotic event that adds a patch of internal membrane to the defect site. Lectins are known to inhibit exocytosis. We therefore tested the novel hypothesis that lectin toxicity is due to an inhibitory effect on plasma membrane repair. METHODS AND FINDINGS: Repair of plasma membrane disruptions and exocytosis of mucus was assessed after treatment of cultured cell models and excised segments of the GI tract with lectins. Plasma membrane disruptions were produced by focal irradiation of individual cells, using a microscope-based laser, or by mechanical abrasion of multiple cells, using a syringe needle. Repair was then assessed by monitoring the cytosolic penetration of dyes incapable of crossing the intact plasma membrane. We found that cell surface-bound lectins potently inhibited plasma membrane repair, and the exocytosis of mucus that normally accompanies the repair response. CONCLUSIONS: Lectins potently inhibit plasma membrane repair, and hence are toxic to wounded cells. This represents a novel form of protein-based toxicity, one that, we propose, is the basis of plant lectin food poisoning.
Directory of Open Access Journals (Sweden)
Mohammad Reza Arab
2010-07-01
Full Text Available "nAltered glycosylation of proteins in cancer cells is one of the main processes responsible for anaplasia, invasion and metastatic potential of neoplastic cells. Lectins are nonimmunogenetic compounds which specifically detect certain terminal sugars of glycoconjugates. The aim of the present study was to identify the N-acetylgalactosamine (GalNac containing glycoconjugates in cancer cells in all grades of gastric carcinoma. Paraffin blocks belong to 30 patients of gastric carcinoma (10 cases from each grade was collected from pathology file of Ali-Ebn-Abitaleb Hospital in Zahedan during 2005-2007. Prepared sections (5-7μm in thickness were stained by Alcian Blue, hematoxylin and eosin (H&E and helix pomatia agglutinin (HPA conjugated lectin. Lectin diluted up to 10μg/ml in PBS (0.1M, pH=6.8. Lectin reactivity was visualized by 0.03% diaminobenzidine (DAB solution. Sections were graded according to staining intensity to lectin (0-4+. Although there was some difference for lectin staining intensity between cancer cells in different grades of gastric carcinoma, statistical analysis showed that there was only a significant difference for cancer cells reactivity between histopathological grades of II and III. The pattern of reactivity to HPA lectin were also different from all histopathological grades. It seems that in cancer cells, the amount and distribution of GalNac containing glycoconjugate differ from neoplastic cells of different histopathological grades in gastric carcinoma.
Directory of Open Access Journals (Sweden)
Danileuchenko V. V.
2010-02-01
Full Text Available Aim. To study hemolytical and antimicrobical action of two new lectins, obtained from fruit bodies of poisonous basidial mushrooms of A. virosa Secr. and M. pura /Fr./ Kumm. Methods. Research on hemolytical action of lectins was conducted on the erythrocytes of human and animals. The experiments on osmotic protection of erythrocytes were performed in the presence of polyethylenglycols of different molecular mass (in a range from 400 to 4000 Da. Antimicrobical activity of lectins was studied by determination of area delay of growth of culture of different types of microorganisms on the Petri dish in an agaric media. Results. Both lectins hemolyse the erythrocytes of rabbit, human, rat and dog and do not hemolyse the erythrocytes of cow and ship in concentration of 1 mg/ml. The rabbit erythrocytes are most sensitive to hemolytical action of lectins, while hemolytic ability of A. virosa lectin is higher. Hemolysis was not observed in the presence of PEG of molecular mass over 1,350 Da. Action of lectins on 10 types of microorganisms was investigated. Lectins inhibited mainly growth of grammpositive microorganisms and protey. For most tested microorganisms antimicrobial action of Mycena lectin is stronger comparing with A. virosa lectin. Conclusions. Two new hemolytical lectins are found in the fruit bodies of mushrooms-basidiomycetes. The lectin formed ion-permeable pores in membrane of erythrocytes with the hydrodynamic diameter smaller than 2.3 nm and larger than 1.6 nm. These lectins displays also antimicrobial activity and by the sum of these features are similar to the cytolytic lectins of lower invertebrates.
Evolutionary history and stress regulation of the lectin superfamily in higher plants
Directory of Open Access Journals (Sweden)
Ramachandran Srinivasan
2010-03-01
Full Text Available Abstract Background Lectins are a class of carbohydrate-binding proteins. They play roles in various biological processes. However, little is known about their evolutionary history and their functions in plant stress regulation. The availability of full genome sequences from various plant species makes it possible to perform a whole-genome exploration for further understanding their biological functions. Results Higher plant genomes encode large numbers of lectin proteins. Based on their domain structures and phylogenetic analyses, a new classification system has been proposed. In this system, 12 different families have been classified and four of them consist of recently identified plant lectin members. Further analyses show that some of lectin families exhibit species-specific expansion and rapid birth-and-death evolution. Tandem and segmental duplications have been regarded as the major mechanisms to drive lectin expansion although retrogenes also significantly contributed to the birth of new lectin genes in soybean and rice. Evidence shows that lectin genes have been involved in biotic/abiotic stress regulations and tandem/segmental duplications may be regarded as drivers for plants to adapt various environmental stresses through duplication followed by expression divergence. Each member of this gene superfamily may play specialized roles in a specific stress condition and function as a regulator of various environmental factors such as cold, drought and high salinity as well as biotic stresses. Conclusions Our studies provide a new outline of the plant lectin gene superfamily and advance the understanding of plant lectin genes in lineage-specific expansion and their functions in biotic/abiotic stress-related developmental processes.
Shi, Zhaomei; Fan, Chao; Huang, Junjie; Bai, Haihong; Qin, Weijie; Cai, Yun; Qian, Xiaohong
2015-02-01
Protein glycosylation in eukaryotic cells regulates a variety of physiological processes including cell recognition, cell adhesion, migration, and immune response. It is also closely related with the occurrence and development of many critical diseases. Therefore, large scale identification of protein glycosylation not only provides important information for the study of basic biological mechanisms, but also is crucial for the discovery of new diagnostic biomarkers and therapeutic targets. Due to the low abundance of glycoprotein/glycopeptide in real biological samples, enrichment before mass spectrometry (MS) analysis is an essential step for achieving deep glycosylation site coverage. Lectin enrichment, as an effective method for glycoproteins/glycopeptides enrichment, has been utilized widely in glycoproteomics research. To solve the problems of low lectin loading and limited enrichment efficiency of existing lectin functional materials, we prepared two kinds of new graphene oxide ( GO) immobilized lectin. Besides good dispersion in aqueous solution as well as good chemical stability, GO has extremely large specific surface area and also carries high density of functional groups on its surface, which is especially benelicial for achieving high lectin loading amount. As a result, lectin loading as high as 1. 90 mg/mg was achieved for GO-lectin (GO-ConA 2. 073 mg/mg, RSD = 1. 0%; GO-WGA 1. 908 mg/mg, RSD = 0.14%). One milligram GO-lectin can adsorb more than 200 µg glycoprotein each experiment in two weeks. The GO-lectin was successfully applied in glycoproteins/glycopeptides enrichment with high efficiency and selectivity, indicating its good application potential in glycoproteomics research.
Rizvi, Sabika; Banu, Naheed
2008-03-01
Lectins are carbohydrate-binding proteins present in a wide variety of plants and animals, which serve various important physiological functions. A soluble beta-galactoside binding lectin has been isolated and purified to homogeneity from buffalo brain using ammonium sulphate precipitation (40-70%) and gel permeation chromatography on Sephadex G50-80 column. The molecular weight of buffalo brain lectin (BBL) as determined by SDS-PAGE under reducing and non-reducing conditions was 14.2 kDa, however, with gel filtration it was 28.5 kDa, revealing the dimeric form of protein. The neutral sugar content of the soluble lectin was estimated to be 3.3%. The BBL showed highest affinity for lactose and other sugar moieties in glycosidic form, suggesting it to be a beta-galactoside binding lectin. The association constant for lactose binding as evidenced by Scatchard analysis was 6.6 x 10(3) M(-1) showing two carbohydrate binding sites per lectin molecule. A total inhibition of lectin activity was observed by denaturants like guanidine HCl, thiourea and urea at 6 M concentration. The treatment of BBL with oxidizing agent destroyed its agglutination activity, abolished its fluorescence, and shifted its UV absorption maxima from 282 to 250 nm. The effect of H2O2 was greatly prevented by lactose indicating that BBL is more stable in the presence of its specific ligand. The purified lectin was investigated for its brain cell aggregation properties by testing its ability to agglutinate cells isolated from buffalo and goat brains. Rate of aggregation of buffalo brain cells by purified protein was more than the goat brain cells. The data from above study suggests that the isolated lectin may belong to the galectin-1 family but is glycosylated unlike those purified till date.
Differential activity of a lectin from Solieria filiformis against human pathogenic bacteria
Directory of Open Access Journals (Sweden)
M.L. Holanda
2005-12-01
Full Text Available A lectin isolated from the red alga Solieria filiformis was evaluated for its effect on the growth of 8 gram-negative and 3 gram-positive bacteria cultivated in liquid medium (three independent experiments/bacterium. The lectin (500 µg/mL stimulated the growth of the gram-positive species Bacillus cereus and inhibited the growth of the gram-negative species Serratia marcescens, Salmonella typhi, Klebsiella pneumoniae, Enterobacter aerogenes, Proteus sp, and Pseudomonas aeruginosa at 1000 µg/mL but the lectin (10-1000 µg/mL had no effect on the growth of the gram-positive bacteria Staphylococcus aureus and B. subtilis, or on the gram-negative bacteria Escherichia coli and Salmonella typhimurium. The purified lectin significantly reduced the cell density of gram-negative bacteria, although no changes in growth phases (log, exponential and of decline were observed. It is possible that the interaction of S. filiformis lectin with the cell surface receptors of gram-negative bacteria promotes alterations in the flow of nutrients, which would explain the bacteriostatic effect. Growth stimulation of the gram-positive bacterium B. cereus was more marked in the presence of the lectin at a concentration of 1000 µg/mL. The stimulation of the growth of B. cereus was not observed when the lectin was previously incubated with mannan (125 µg/mL, its hapten. Thus, we suggest the involvement of the binding site of the lectin in this effect. The present study reports the first data on the inhibition and stimulation of pathogenic bacterial cells by marine alga lectins.
Zhu-Salzman, Keyan; Hammen, Philip K; Salzman, Ron A; Koiwa, Hisashi; Bressan, Ray A; Murdock, Larry L; Hasegawa, Paul M
2002-06-01
Site-directed mutagenesis previously identified the residues responsible for the biological activity of the plant defense legume lectin, Griffonia simplicifolia lectin II (GSII) [Proc. Natl. Acad. Sci. USA 95, (1998) 15123-15128]. However, these results were inconclusive as to whether these residues function as direct defense determinants through carbohydrate binding, or whether substantial changes of the protein structure had occurred in mutated proteins, with this structural disruption actually causing the loss of biochemical and biological functions. Evidence shown here supports the former explanation: circular dichroism and fluorescence spectra showed that mutations at carbohydrate-binding residues of GSII do not render it dysfunctional because of substantial secondary or tertiary structure modifications; and trypsin treatment confirmed that rGSII structural integrity is retained in these mutants. Reduced biochemical stability was observed through papain digestion and urea denaturation in mutant versions that had lost carbohydrate-binding ability, and this was correlated with lower Ca(2+) content. Accordingly, the re-addition of Ca(2+) to demetalized proteins could recover resistance to papain in the carbohydrate-binding mutant, but not in the non-binding mutant. Thus, both carbohydrate binding (presumably to targets in the insect gut) and biochemical stability to proteolytic degradation in situ indeed contribute to anti-insect activity, and these activities are Ca(2+)-dependent.
A sperm-agglutinating lectin from seeds of Jack fruit (Artocarpus heterophyllus).
Namjuntra, P; Muanwongyathi, P; Chulavatnatol, M
1985-04-30
A lectin specific for N-acetylgalactosamine was isolated from seed extract of Jack fruit (Artocarpus heterophyllus) by ammonium sulfate precipitation, followed by affinity chromatography on a Affigel-galactosamine-agarose column. The lectin possessed agglutinating activities for human and rat sperm as well as human red blood cells. It was found to have Mr = 62,000 consisting of two dissimilar subunits of Mr = 18,000 and 13,000. It also cross-reacted with an antibody against the lectin of Osage Orange (Maclura pomifera).
Purification of a N-acetyl-D-galactosamine specific lectin from the orchid Laelia autumnalis.
Zenteno, R; Chávez, R; Portugal, D; Páez, A; Lascurain, R; Zenteno, E
1995-10-01
From the pseudobulbs of the orchid L. autumnalis a lectin was purified on immobilized porcine mucin with A + H blood group substance. This lectin is a dimeric glycoprotein of M(r) 12,000 with an Sw,20 of 2.2, showing haemagglutinating activity directed mainly to human A1 desialylated erythrocytes. The lectin possesses sugar specificity for N-acetyl-D-galactosamine and also shows high specificity for glycoproteins containing the T (galactose beta 1,3GA1NAc alpha 1,0 Ser/Thr) or the Tn antigen (GalNAc alpha 1,0 Ser/Thr).
Zhong, Hengwen; El Rassi, Ziad
2009-05-01
In this report, monolithic silica-based capillary columns were produced by the sol-gel process and subsequently silanized with gamma-glycidoxypropyltrimethoxysilane to form on the surface of the monolith a reactive gamma-glycidoxypropylsilyl sublayer to which an interactive top layer can be covalently attached. The interactive top layer consisted of either an immobilized lectin or polar cyano functions to perform lectin affinity chromatography (LAC) of glycoproteins or normal phase chromatography (NPC) of glycans, respectively. Two lectins were immobilized, namely Con A and wheat germ agglutinin (WGA) due to their utility in LAC of a wide range of glycoconjugates. On the other hand, 1H-imidazole-4,5-dicarbonitrile was covalently attached to the silica monolith to yield polar silica monolith referred to as 2CN-OH monolith. The two lectin monolithic columns were evaluated in Nano-LC with standard glycoproteins over a wide range of conditions and proved useful in capturing the glycoforms bearing the pertinent saccharidic motifs for interaction with the given lectin. The 2CN-OH monolithic columns were effective in the profiling of glycans derived from glycoproteins in both NP-CEC and NP-Nano-LC with NP-CEC offering enhanced separation when compared to NP-Nano-LC.
Ruiz-May, Eliel; Hucko, Simon; Howe, Kevin J; Zhang, Sheng; Sherwood, Robert W; Thannhauser, Theodore W; Rose, Jocelyn K C
2014-02-01
Lectin affinity chromatography (LAC) can provide a valuable front-end enrichment strategy for the study of N-glycoproteins and has been used to characterize a broad range eukaryotic N-glycoproteomes. Moreover, studies with mammalian systems have suggested that the use of multiple lectins with different affinities can be particularly effective. A multi-lectin approach has also been reported to provide a significant benefit for the analysis of plant N-glycoproteins; however, it has yet to be determined whether certain lectins, or combinations of lectins are optimal for plant N-glycoproteome profiling; or whether specific lectins show preferential association with particular N-glycosylation sites or N-glycan structures. We describe here a comparative study of three mannose-binding lectins, concanavalin A, snowdrop lectin, and lentil lectin, to profile the N-glycoproteome of mature green stage tomato (Solanum lycopersicum) fruit pericarp. Through coupling lectin affinity chromatography with a shotgun proteomics strategy, we identified 448 putative N-glycoproteins, whereas a parallel lectin affinity chromatography plus hydrophilic interaction chromatography analysis revealed 318 putative N-glycosylation sites on 230 N-glycoproteins, of which 100 overlapped with the shotgun analysis, as well as 17 N-glycan structures. The use of multiple lectins substantially increased N-glycoproteome coverage and although there were no discernible differences in the structures of N-glycans, or the charge, isoelectric point (pI) or hydrophobicity of the glycopeptides that differentially bound to each lectin, differences were observed in the amino acid frequency at the -1 and +1 subsites of the N-glycosylation sites. We also demonstrated an alternative and complementary in planta recombinant expression strategy, followed by affinity MS analysis, to identify the putative N-glycan structures of glycoproteins whose abundance is too low to be readily determined by a shotgun approach, and
Biodiversity of mannose-specific lectins within Narcissus species.
Lopez, Susanna; Codina, Carlos; Bastida, Jaume; Viladomat, Francesc; Davidson, Elaine; Stewart, Derek
2002-04-24
Mannose-specific lectins (MSLs) were isolated from the bulbs of 27 species of wild Spanish Narcissi and compared to the commercially available MSL from daffodil (Narcissus pseudonarcissus, NPA). Molecular weight analysis showed the monomers of all the MSLs were at, or around, 12.5 kD. Haemagglutination assays showed that the MSLs exhibited activities at up to four times greater than that displayed by NPA and other MSLs derived from other species such as Galanthus nivalus (snowdrop) and Allium ursinum (ramson). Elution profiles from ion exchange chromatography exhibited similarities for species within the same taxonomic section suggesting that this method could aid in species classification. Further analysis by isoelectric focusing showed many isolectins are present in vivo and that even within a single peak from ion exchange chromatography there are numerous isolectins present. The basis of the isolectin heterogeneity is suggested to reside in the tetraploidy (sometime triploidy) nature of Narcissus genes.
Lectin Histochemical Study of Vasculogenesis During Rat Pituitary Morphogenesis
Directory of Open Access Journals (Sweden)
Ali Reza Ebrahimzadeh Bideskan
2011-01-01
Full Text Available Objective(s The aim of this study was to investigate glycoconjugates distribution patterns as well as their changes during the course of pituitary portal vasculogenesis and angiogenesis.Materials and MethodsFormalin fixed paraffin sections of 10 to 20 days of Sprague Dawly rat fetuses were processed for histochemical studies using four different horseradish peroxidase (HRP conjugated lectins. Orange peel fungus (OFA, Vicica villosa (VVA, Glycine max (SBA and Wistaria floribunda (WFA specific for α-L-Fucose, D-Gal, α, ß-D-GalNAc and D- GalNAc terminal sugars of glycoconjugates respectively.ResultsOur finding indicated that adenohypophysal cells reacted with OFA on gestational day 10 (E10 and increased progressively to E14. Staining intensity did not change from days 14 to17, then after increased following days to E20 significantly (P< 0.05. A few cells around Rathke’s pouch reacted with VVA on E13, increased to E14 and decreased significantly afterward (P< 0.05. Reaction of some cells around Rathke’s pouch reacted with SBA on E14. This visible reaction was the same as E18 and decreased later (P< 0.05. Many cells around Rathke’s pouch reacted with WFA on E13 and increased on E 14 and E15 and decreased thereafter (P< 0.05.ConclusionReactions of OFA and other tested lectins with endothelial cells around Rathke’s pouch and developing pars distalis were different. These results suggest that embryonic origin of hypophiseal pituitary portal (HPP system endothelial cells are not the same and our finding also indicated that glycoconjugates with terminal sugars α-L-Fucose, D-Gal, α, ß-D-GalNAc may play critical role(s in cell interactions and tissue differentiations such as vasculogensis and angiogenesis as well as other developmental precursors in formation of the pituitary gland.
Kato, Kentaro; Yahata, Kazuhide; Gopal Dhoubhadel, Bhim; Fujii, Yoshito; Tachibana, Hiroshi
2015-09-10
Galactose and N-acetyl-D-galactosamine (Gal/GalNAc) inhibitable lectin of Entamoeba histolytica, a common protozoan parasite, has roles in pathogenicity and induction of protective immunity in mouse models of amoebiasis. The lectin consists of heavy (Hgl), light (Lgl), and intermediate (Igl) subunits. Hgl has lectin activity and Lgl does not, but little is known about the activity of Igl. In this study, we assessed various regions of Igl for hemagglutinating activity using recombinant proteins expressed in Escherichia coli. We identified a weak hemagglutinating activity of the protein. Furthermore, we found novel hemolytic and cytotoxic activities of the lectin, which resided in the carboxy-terminal region of the protein. Antibodies against Igl inhibited the hemolytic activity of Entamoeba histolytica trophozoites. This is the first report showing hemagglutinating, hemolytic and cytotoxic activities of an amoebic molecule, Igl.
DEFF Research Database (Denmark)
Rosbjerg, Anne; Genster, Ninette; Pilely, Katrine
2016-01-01
, lectin, and alternative pathways under both immunocompetent and immunocompromised conditions to provide a relevant dual-perspective on the response against A. fumigatus. Conidia (spores) from a clinical isolate of A. fumigatus were combined with various human serum types (including serum deficient...... of various complement components and serum from umbilical cord blood). We also combined this with inhibitors against C1q, mannose-binding lectin (MBL), and ficolin-2 before complement activation products and phagocytosis were detected by flow cytometry. Our results showed that alternative pathway amplified...... complement on A. fumigatus, but required classical and/or lectin pathway for initiation. In normal human serum, this initiation came primarily from the classical pathway. However, with a dysfunctional classical pathway (C1q-deficient serum), lectin pathway activated complement and mediated opsonophagocytosis...
Tetala, K.K.R.; Chen, B.; Visser, G.M.; Beek, van T.A.
2007-01-01
Carbohydrate monolithic beds were synthesized in a single step in capillary columns to study affinity chromatography of lectins. In this method, carbohydrates (-galactose, -glucose, and -mannose) with an easy to synthesize alkene terminated tetraethylene glycol spacer were used as functional
[Carbohydrate-binding proteins--lectins and glycosidases in plants of Anthurium genus].
Tkachenko, V I; Datskiv, M Z; Lutsyk, M D
1993-01-01
The content of lectins and activity of glycosidases have been estimated in seeds and vegetative organs of 5 strains of plants of Anthurium genus. In seeds of all the investigated strains lectins were detected with the selectivity toward the N-acetyl-galactosamine (minimal inhibitory concentration of sugar was 0.1-0.2 mM) and an anti-A blood group specificity. Lectins of Anthuriums selectively bound O-type glycosidic chains and revealed high affinity toward mucins (salivary or ovary cysts origin). Lectins were not detected in vegetative parts of Anthuriums. In seeds of plants the following glycosidases were detected in the diminishing activity order: alpha-galactosidase, alpha-mannosidase, beta-galactosidase, beta-glucosaminidase.
A journey through the lectin pathway of complement-MBL and beyond
DEFF Research Database (Denmark)
Garred, Peter; Genster, Ninette; Pilely, Katrine
2016-01-01
Mannose-binding lectin (MBL), collectin-10, collectin-11, and the ficolins (ficolin-1, ficolin-2, and ficolin-3) are soluble pattern recognition molecules in the lectin complement pathway. These proteins act as mediators of host defense and participate in maintenance of tissue homeostasis...... of these molecules is their ability to interact with a set of serine proteases named MASPs (MASP-1, MASP-2, and MASP-3). MASP-1 and -2 trigger the activation of the lectin pathway and MASP-3 may be involved in the activation of the alternative pathway of complement. Furthermore, MASPs mediate processes related......, and Carnevale) embryonic development syndrome originates from rare mutations affecting either collectin-11 or MASP-3, indicating a broader functionality of the complement system than previously anticipated. This review summarizes the characteristics of the molecules in the lectin pathway....
Genotyping of mannose-binding lectin (MBL2) codon 54 and ...
African Journals Online (AJOL)
binding lectin and are associated with infectious conditions. Acute respiratory tract infections are among the most prevalent infections in childhood with the highest incidence among children younger than 2 years. This study aimed at correlation ...
Mannan binding lectin : a two-faced regulator of renal allograft injury?
Damman, Jeffrey; Seelen, Marc A.
Complement activation plays an important role in the pathogenesis of renal allograft injury after kidney transplantation. There are three known pathways of complement activation, namely, classical, alternative, and lectin pathways. In renal allograft injury, contradictory results were reported about
Opsonic function of sialic acid specific lectin in freshwater crab Paratelphusa jacquemontii
National Research Council Canada - National Science Library
Denis, Maghil; Thayappan, Karthigayani; Ramasamy, Sivakumar Mullivanam; Munusamy, Arumugam
2015-01-01
The sialic acid specific humoral lectin, Pjlec of the freshwater crab Paratelphusa jacquemontii was investigated for its opsonin function with rabbit erythrocyte as target cell for phagocytosis by the crab’s hemocyte...
Lectins binding during alloxan-induced diabetes in rat soleus muscle
African Journals Online (AJOL)
SERVER
2008-04-17
Apr 17, 2008 ... Key words: Diabetes, alloxan, Wistar rat, soleus muscle, lectin staining. ... betes mellitus on skeletal muscle of rats were examined by several authors ..... diagnosis and classification of diabetes mellitus and its complication.
Secretory Expression and Characterization of Chinese Narcissus GNA-Like Lectin in Pichia pastoris.
Li, Xinyu; Zhang, Pengpeng; Zhang, Ning; Liang, Xiao; Wang, Wenya; Yuan, Qipeng; Li, Qiang
2017-08-01
Narcissus tazetta lectin (NTL) is a GNA-like lectin, which has a wide potential application in medicine, agriculture, and glycobiology. In the present paper, the codon-optimized ntl gene was transformed into the yeast Pichia pastoris; SDS-PAGE gel and western blotting analysis revealed that the recombinant lectin was expressed successfully in Pichia yeast. The similarity between the recombinant NTL and the native NTL was confirmed by circular dichroism (CD) and hemagglutination assay further. In the 5-L scale fermentator, the protein yield was as high as 1.2 g/L after fermentation for 96 h. In addition, the effect of metal ions (K+, Mg2+, Ca2+, and Cu2+), acid, and alkaline on hemagglutinating activity of NTL was tested, which provided biochemical characterizations of the mannose-binding lectin from Chinese Narcissus.
Energy Technology Data Exchange (ETDEWEB)
Silva Filho, J.C.; Santi-Gadelha, T.; Gadelha, C.A.A.; Delatorre, P. [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil); Teixeira, C.S.; Rocha, B.A.M.; Nobrega, R.B.; Alencar, K.L.L.; Cavada, B.S. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil)
2012-07-01
Full text: Lectins are a class of proteins of non-immune origin characterized by its capability in interacts specifically and reversibly to mono and oligosaccharides. In plant several possible roles have been suggested including their function in seed maturation, cell wall assembly, defense mechanisms, or rhizobial nodulation of legume roots. Nearly all application and proposed of the plant lectins are based on their specific carbohydrate binding. However, it has been reported that lectins from legumes, might interact with other molecules, such as non proteic amino acids and hydrophobic compounds. This study show the first the crystal structure based on molecular replacement of the Canavalia maritima (CML) complexed with IAA correlated with possible role in plant development. Purified CML was dissolved in 20 mMTrisHCl pH 7.6 containing 5 mM IAA, the suitable co-crystals from CML-IAA complex grew in condition 4 of screen I (0.1 M TrisHCl pH 8.5 and 2.0 M ammonium sulfate). This crystal belong to the orthorhombic space group I222 with unit-cell parameters a = 67.1 ; b = 70.7 , c = 97.7 , The structure was refined at 2.1 of resolution to a final R factor of 20.63 % and an R free of 22.54 %. To check the relative position of the IAA molecule in relation to the biological assemble of the CML, the tetrameric structure was generate by crystallographic symmetry. IAA molecules are positioned in the central cavity. The IAA is stabilized by interacting through hydrogen bounds and Van der Waals forces with the amino acids residues Ser 108 and Asn131, and two water molecules. The hydrophilic interactions occur between IAA and side chains of Ser 108, Asn131 and water molecules 26 and 31 by H-bonds. The OG oxygen from Ser108 display H-bonds with O2 and O3 oxygen atoms from IAA, 3.1 and 2.8 respectively. The tetrameric structure of CML complexed with IAA revels which this protein can act during the seedling in plant development. (author)
Differential effect of plant lectins on mast cells of different origins
Directory of Open Access Journals (Sweden)
F.C. Lopes
2005-06-01
Full Text Available Histamine release induced by plant lectins was studied with emphasis on the carbohydrate specificity, external calcium requirement, metal binding sites, and mast cell heterogeneity and on the importance of antibodies bound to the mast cell membrane to the lectin effect. Peritoneal mast cells were obtained by direct lavage of the rat peritoneal cavity and guinea pig intestine and hamster cheek pouch mast cells were obtained by dispersion with collagenase type IA. Histamine release was induced with concanavalin A (Con A, lectins from Canavalia brasiliensis, mannose-specific Cymbosema roseum, Maackia amurensis, Parkia platycephala, Triticum vulgaris (WGA, and demetallized Con A and C. brasiliensis, using 1-300 µg/ml lectin concentrations applied to Wistar rat peritoneal mast cells, peaking on 26.9, 21.0, 29.1, 24.9, 17.2, 10.7, 19.9, and 41.5%, respectively. This effect was inhibited in the absence of extracellular calcium. The lectins were also active on hamster cheek pouch mast cells (except demetallized Con A and on Rowett nude rat (animal free of immunoglobulins peritoneal mast cells (except for mannose-specific C. roseum, P. platycephala and WGA. No effect was observed in guinea pig intestine mast cells. Glucose-saturated Con A and C. brasiliensis also released histamine from Wistar rat peritoneal mast cells. These results suggest that histamine release induced by lectins is influenced by the heterogeneity of mast cells and depends on extracellular calcium. The results also suggest that this histamine release might occur by alternative mechanisms, because the usual mechanism of lectins is related to their binding properties to metals from which depend the binding to sugars, which would be their sites to bind to immunoglobulins. In the present study, we show that the histamine release by lectins was also induced by demetallized lectins and by sugar-saturated lectins (which would avoid their binding to other sugars. Additionally, the lectins
Quaternary association in β-prism I fold plant lectins: Insights from X ...
Indian Academy of Sciences (India)
are obtained when the free banana lectin subunit and the two subunits in the banana lectin dimer are used in the superposition. The rms deviations in C α positions on superposition of the most probable structure of the free subunit of artocarpin on those of the tetramer are somewhat higher in the range of 1.20 Å to 1.60 Å, ...
Interaction of Campylobacter jejuni and Campylobacter coli with lectins and blood group antibodies.
Wong, K H; Skelton, S K; Feeley, J C
1985-01-01
Lectins and blood group antibodies were used to probe the surface structures of Campylobacter jejuni and Campylobacter coli. Of the 29 strains tested, there were distinct reaction patterns. The lectin-reactive and blood group antibody-reactive sites on the bacterial surface were distinguishable from the heat-stable (lipopolysaccharide) antigenic determinants. The interactions were strain specific. The reactive sites were stable with respect to culture media and passage and may be useful as ad...
A C-Type Lectin from Bothrops jararacussu Venom Disrupts Staphylococcal Biofilms
Klein, Raphael Contelli; Fabres-Klein, Mary Hellen; de Oliveira, Leandro Licursi; Feio, Renato Neves; Malouin, François; Ribon, Andréa de Oliveira Barros
2015-01-01
Bovine mastitis is a major threat to animal health and the dairy industry. Staphylococcus aureus is a contagious pathogen that is usually associated with persistent intramammary infections, and biofilm formation is a relevant aspect of the outcome of these infections. Several biological activities have been described for snake venoms, which led us to screen secretions of Bothrops jararacussu for antibiofilm activity against S. aureus NRS155. Crude venom was fractionated by size-exclusion chromatography, and the fractions were tested against S. aureus. Biofilm growth, but not bacterial growth, was affected by several fractions. Two fractions (15 and 16) showed the best activities and were also assayed against S. epidermidis NRS101. Fraction 15 was identified by TripleTOF mass spectrometry as a galactose-binding C-type lectin with a molecular weight of 15 kDa. The lectin was purified from the crude venom by D-galactose affinity chromatography, and only one peak was observed. This pure lectin was able to inhibit 75% and 80% of S. aureus and S. epidermidis biofilms, respectively, without affecting bacterial cell viability. The lectin also exhibited a dose-dependent inhibitory effect on both bacterial biofilms. The antibiofilm activity was confirmed using scanning electron microscopy. A pre-formed S. epidermidis biofilm was significantly disrupted by the C-type lectin in a time-dependent manner. Additionally, the lectin demonstrated the ability to inhibit biofilm formation by several mastitis pathogens, including different field strains of S. aureus, S. hyicus, S. chromogenes, Streptococcus agalactiae, and Escherichia coli. These findings reveal a new activity for C-type lectins. Studies are underway to evaluate the biological activity of these lectins in a mouse mastitis model. PMID:25811661
Stability of Curcuma longa rhizome lectin: Role of N-linked glycosylation.
Biswas, Himadri; Chattopadhyaya, Rajagopal
2016-04-01
Curcuma longa rhizome lectin, a mannose-binding protein of non-seed portions of turmeric, is known to have antifungal, antibacterial and α-glucosidase inhibitory activities. We studied the role of complex-type glycans attached to asparagine (Asn) 66 and Asn 110 to elucidate the role of carbohydrates in lectin activity and stability. Apart from the native lectin, the characteristics of a deglycosylated Escherichia coli expressed lectin, high-mannose oligosaccharides at both asparagines and its glycosylation mutants N66Q and N110Q expressed in Pichia pastoris, were compared to understand the relationship between glycosylation and activity. Far UV circular dichroism (CD) spectra, fluorescence emission maximum, hemagglutination assay show no change in secondary or tertiary structures or sugar-binding properties between wild-type and aforementioned recombinant lectins under physiological pH. But reduced agglutination activity and loss of tertiary structure are observed in the acidic pH range for the deglycosylated and the N110Q protein. In thermal and guanidine hydrochloride (GdnCl)-induced unfolding, the wild-type and high-mannose lectins possess higher stability compared with the deglycosylated recombinant lectin and both mutants, as measured by a higher Tm of denaturation or a greater free energy change, respectively. Reversibility experiments after thermal denaturation reveal that deglycosylated proteins tend to aggregate during thermal inactivation but the wild type shows a much greater recovery to the native state upon refolding. These results suggest that N-glycosylation in turmeric lectin is important for the maintenance of its proper folding upon changes in pH, and that the oligosaccharides help in maintaining the active conformation and prevent aggregation in unfolded or partially folded molecules. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Differentiation of Bacillus Anthracis and Other Bacillus Species by Use of Lectins
1983-07-18
cNAc = -D-GlcNAc Helix Aspersa (HMA) ci-D-GalNAc = ca-D-GlcNkc Helix pomatia (lHPA) ci-D-GalNAc > cx-D-GlcNAc a-D-Gal Limulus polyphemus (LPA) sialic...mycoides) were strongly reactive with the lectin from Helix pomatia and weakly reactive with the Glycine max lectin. The differential interactions between
Ohta, Masahiro; Kawahara, Nobuaki; Liu, Miao; Taketa,Kazuhisa; Kudo, Takafumi; Taga, Hiroko
1998-01-01
Affinity electrophoresis of human alpha-fetoprotein (AFP) in amniotic fluid from pregnant women between 6 to 42 weeks of gestation and in the serum of a yolk sac tumor was performed with concanavalin A (Con A), lentil lectin (LCA), erythroagglutinating phytohemagglutinin (E-PHA) and Allomyrina dichotoma lectin (allo A). Separated AFP bands were detected by sensitive antibody-affinity blotting. In the first trimester, amniotic fluid AFP showed elevated percentages of Con A-nonreacting AFP (AFP...
Pereyra, Ali; Agundis, Concepcion; Barrera, Baltazar; Alpuche, Juan; Sierra, Claudia; Zenteno, Roberto; Zenteno, Edgar; Vazquez, Lorena
2009-01-01
We determined the cross-reactivity of a monoclonal antibody against the Macrobrachium rosenbergii lectin with proteins in the hemolymph from Procambarus clarkii (Pc), Procambarus americanus (Pa), Litopenaeus setiferus (Ls), and Pseudothelphusa americana (Psa). Crustaceans' hemolymph agglutinated erythrocytes from rat, mouse, guinea pig, and rabbit. Decapods' hemolymph hemagglutinating activity was inhibited by N-acetylated carbohydrates as well as by antibodies. Western blot assays indicated that the antibodies recognized two main proteins of 97.5 and 80.9 kDa in all hemolymphs studied; moreover, ELISA assays indicated that, in PSa, 7.2% of total proteins showed crossreactivity with antibodies in Pa, Pc, and Lc hemolymphs represented 4.2, 3.1%, and 2.5%, respectively. Our results suggested that antibodies recognize the lectin active site in the crustacean species tested; we propose the use of antibodies as an immunological marker for lectin identification and quantification among crustaceans.
Liu, Wei; Yang, Na; Ding, Jingjin; Huang, Ren-huai; Hu, Zhong; Wang, Da-Cheng
2005-04-15
Two isoforms of an antifungal protein, gastrodianin, were isolated from two subspecies of the orchid Gastrodia elata, belonging to the protein superfamily of monocot mannose-specific lectins. In the context that all available structures in this superfamily are oligomers so far, the crystal structures of the orchid lectins, both at 2.0 A, revealed a novel monomeric structure. It resulted from the rearrangement of the C-terminal peptide inclusive of the 12th beta-strand, which changes from the "C-terminal exchange" into a "C-terminal self-assembly" mode. Thus, the overall tertiary scaffold is stabilized with an intramolecular beta-sheet instead of the hybrid observed on subunit/subunit interface in all known homologous dimeric or tetrameric lectins. In contrast to the constrained extended conformation with a cis peptide bond between residues 98 and 99 commonly occurring in oligomers, a beta-hairpin forms from position 97 to 101 with a normal trans peptide bond at the corresponding site in gastrodianin, which determines the topology of the C-terminal peptide and thereby its unique fold pattern. Sequence and structure comparison shows that residue replacement and insertion at the position where the beta-hairpin occurs in association with cis-trans inter-conversion of the specific peptide bond (97-98) are possibly responsible for such a radical structure switch between monomers and oligomers. Moreover, this seems to be a common melody controlling the quaternary states among bulb lectins through studies on sequence alignment. The observations revealed a structural mechanism by which the quaternary organization of monocot mannose binding lectins could be governed. The mutation experiment performed on maltose-binding protein-gastrodianin fusion protein followed by a few biochemical detections provides direct evidence to support this conclusion. Potential carbohydrate recognition sites and biological implications of the orchid lectin based on its monomeric state are also
Advances in lectin microarray technology: Optimized protocols for piezoelectric print conditions
Pilobello, Kanoelani T.; Agrawal, Praveen; Rouse, Richard; Mahal, Lara K.
2015-01-01
Lectin microarray technology has been used to profile the glycosylation of a multitude of biological and clinical samples, leading to new clinical biomarkers and advances in glycobiology. Lectin microarrays, which include over 90 plant lectins, recombinant lectins, and selected antibodies, are used to profile N-linked, O-linked, and glycolipid glycans. The specificity and depth of glycan profiling depends upon the carbohydrate-binding proteins arrayed. Our current set targets mammalian carbohydrates including fucose, high mannose, branched and complex N-linked, α- and β- Galactose and GalNAc, α-2,3- and α-2,6- sialic acid, LacNAc and Lewis X epitopes. In previous protocols, we have described the use of a contact microarray printer for lectin microarray manufacture. Herein, we present an updated protocol using a non-contact, piezoelectric printer, which leads to increased lectin activity on the array. We describe optimization of print conditions and sample hybridization, and methods of analysis. PMID:23788322
Legume Lectins Inhibit Human Parainfluenza Virus Type 2 Infection by Interfering with the Entry
Directory of Open Access Journals (Sweden)
Myles O’Brien
2012-07-01
Full Text Available Three lectins with different sugar binding specificities were investigated for anti-viral activity against human parainfluenza virus type 2 (hPIV-2. The lectins, concanavalin A (Con A, lens culinaris agglutinin (LCA and peanut agglutinin (PNA, inhibited cell fusion and hemadsorption induced by hPIV-2. Virus nucleoprotein (NP gene synthesis was largely inhibited, but fusion (F and hemagglutinin-neuraminidase (HN gene syntheses were not. An indirect immunofluorescence study showed that Con A inhibited virus NP, F and HN protein syntheses, but LCA did not completely inhibit them, and that PNA inhibited only NP protein synthesis. Using a recombinant green fluorescence protein-expressing hPIV-2, without matrix protein (rghPIV-2ΔM, it was found that virus entry into the cells was not completely prevented. The lectins considerably reduced the number of viruses released compared with that of virus infected cells. The lectins bound to cell surface within 10 min, and many aggregates were observed at 30 min. Con A and LCA slightly disrupted actin microfilaments and microtubules, but PNA had almost no effect on them. These results indicated that the inhibitory effects of the lectins were caused mainly by the considerable prevention of virus adsorption to the cells by the lectin binding to their receptors.
Identification of lectin counter-receptors on cell membranes by proximity labeling.
Wu, Gang; Nagala, Manjula; Crocker, Paul R
2017-09-01
Lectin-glycan interactions play important roles in many biological systems, but the nature of glycoprotein counter-receptors expressed on cell membranes is often poorly understood. To help overcome this problem, we developed a method based on proximity labeling technology. Using a peroxidase-coupled lectin, addition of H2O2 and tyramide-biotin substrates leads to generation of short-range biotin radicals that biotinylate proteins in the immediate vicinity of the bound lectin, which can subsequently be identified. As a proof-of-principle, sialoadhesin-horseradish peroxidase-human IgG1 Fc recombinant protein constructs were precomplexed with anti-Fc antibodies, bound to human erythrocytes and reacted with H2O2 and tyramide-SS-biotin. The erythrocyte membrane protein with strongest biotinylation was identified as glycophorin A, in agreement with early studies using lectin overlay and reglycosylation approaches. As a further test of the method, the plant lectin MAL II was conjugated with horseradish peroxidase and used in proximity labeling of human erythrocytes. Glycophorin A was again selectively labeled, which is consistent with previous reports that MAL II has high affinity for glycophorin. This method could be applied to other lectins to identify their membrane counter-receptors. © The Author 2017. Published by Oxford University Press.
Giménez, M A; Drago, S R; Bassett, M N; Lobo, M O; Sammán, N C
2016-05-15
In this study, the nutritional quality of pasta-like product (spaghetti-type), made with corn (Zea mays) flour enriched with 30% broad bean (Vicia faba) flour and 20% of quinoa (Chenopodium quinoa) flour, was determined. Proximate chemical composition and iron, zinc and dietary fiber were determined. A biological assay was performed to assess the protein value using net protein utilization (NPU), true digestibility (TD) and protein digestibility-corrected amino acid score (PDCAAS). Iron and zinc availability were estimated by measuring dialyzable mineral fraction (%Da) resulting from in vitro gastrointestinal digestion. Nutritionally improved, gluten-free spaghetti (NIS) showed significantly increased NPU and decreased TD compared with a non-enriched control sample. One NIS-portion supplied 10-20% of recommended fiber daily intake. Addition of quinoa flour had a positive effect on the FeDa% as did broad bean flour on ZnDa%. EDTA increased Fe- and ZnDa% in all NIS-products, but it also impaired sensorial quality. Copyright © 2016. Published by Elsevier Ltd.
Shahid, M; Pinelli, E; Pourrut, B; Silvestre, J; Dumat, C
2011-01-01
Formation of organometallic complexes in soil solution strongly influence metals phytoavailability. However, only few studies deal with the influence of metal speciation both on plant uptake and genotoxicity. In the present study, Vicia faba seedlings were exposed for 6h in controlled hydroponic conditions to 5 μM of lead nitrate alone and chelated to varying degrees by different organic ligands. Ethylenediaminetetraacetic acid and citric acid were, respectively, chosen as models of humic substances and low weight organic acids present in natural soil solutions. Visual Minteq software was used to estimate free lead cations concentration and ultimately to design the experimental layout. For all experimental conditions, both micronucleus test and measure of lead uptake by plants were finally performed. Chelation of Pb by EDTA, a strong chelator, dose-dependently increased the uptake in V. faba roots while its genotoxicity was significantly reduced, suggesting a protective role of EDTA. A weak correlation was observed between total lead concentration absorbed by roots and genotoxicity (r(2)=0.65). In contrast, a strong relationship (r(2)=0.93) exists between Pb(2+) concentration in exposure media and genotoxicity in the experiment performed with EDTA. Citric acid induced labile organometallic complexes did not demonstrate any significant changes in lead genotoxicity or uptake. These results demonstrate that metal speciation knowledge could improve the interpretation of V. faba genotoxicity test performed to test soil quality. Copyright © 2010 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Paul B. Tchounwou
2012-05-01
Full Text Available The use of silver nanoparticles (AgNPs in commercial products has increased significantly in recent years. Although there have been some attempts to determine the toxic effects of AgNPs in mammalian and human cell-lines, there is little information on plants which play a vital role in ecosystems. The study reports the use of Vicia faba root-tip meristem to investigate the genotoxicity of AgNPs under modified GENE-TOX test conditions. The root tip cells of V. faba were treated with four different concentrations of engineered AgNPs dispersion to study toxicological endpoints such as mitotic index (MI, chromosomal aberrations (CA and micronucleus induction (MN. For each concentration, five sets of microscopy observations were carried out. The results demonstrated that AgNPs exposure significantly increased (p < 0.05 the number of chromosomal aberrations, micronuclei, and decreased the MI in exposed groups compared to control. From this study we infer that AgNPs might have penetrated the plant system and may have impaired mitosis causing CA and MN. The results of this study demonstrate that AgNPs are genotoxic to plant cells. Since plant assays have been integrated as a genotoxicity component in risk assessment for detection of environmental mutagens, they should be given full consideration when evaluating the overall toxicological impact of the nanoparticles in the environment.
Ruban, Yu.; Illienko, V.; Nesterova, N.; Pareniuk, O.; Shavanova, K.
2017-12-01
The presented research was aimed to determine the parameters of chlorophyll fluorescence (IChH) curve induction for Vicia sativa L. that were grown on radionuclide contaminated soils by using "Floratest" fluorometer. Plants were inoculated with 5 species of bacteria that might potentially block radionuclide uptake (Agrobacterium radiobacter IMBB-7246, Azotobacter chroococcum UKMB-6082, A. chroococcum UKMB-6003, Bacillus megaterium UKMB-5724, Rhizobium leguminosarum bv. viceae) and grown in sod-podzolic, chernozem and peat-bog soils, contaminated with 137Cs (4000±340 Bq/kg). As a result of research, it was determined that the most stressful factors for vetch plants are combination of soil radionuclide and presence of Bacillus megaterium UKM B-5724, as the number of inactive chlorophyll increased. In addition, the vetch plants significantly increased fixed level of fluorescence (Fst) under the influence of radioactive contamination in presence of Bacillus megaterium UKM B-5724, indicating inhibition of photosynthetic reactions. Other bacteria showed radioprotective properties in almost all types of soil.
Göl, Şurhan; Doğanlar, Sami; Frary, Anne
2017-05-11
Faba bean (Vicia faba L.) is an important legume species because of its high protein and starch content. Broad bean can be grown in different climatic conditions and is an ideal rotation crop because of the nitrogen fixing bacteria in its roots. In this work, 255 faba bean germplasm accessions were characterized using 32 SSR primers which yielded 302 polymorphic fragments. According to the results, faba bean individuals were divided into two main groups based on the neighbor-joining algorithm (r = 0.91) with some clustering based on geographical origin as well as seed size. Population structure was also determined and agreed with the dendrogram analysis in splitting the accessions into two subpopulations. Analysis of molecular variance (AMOVA) revealed high levels of within population genetic variation. Genetic similarity and geographical proximity were related with separation of European accessions from African and Asian ones. Interestingly, there was no significant difference between landrace (38%) and cultivar (40%) diversity indicating that genetic variability has not yet been lost due to breeding. A total of 44 genetically well-characterized faba bean individuals were selected for a core collection to be further examined for yield and nutritional traits.
Directory of Open Access Journals (Sweden)
Constanza López
2011-03-01
Full Text Available Se analizaron algunas propiedades funcionales del almidón de haba (Vicia faba, con dos niveles de proteína -12,89% y 4,41%-, obtenido por fraccionamiento por vía húmeda de las semillas secas. Se comparan el secado en rodillos y la liofilización como métodos para deshidratar la muestra, así como las propiedades funcionales del almidón antes y después de acetilarlo con anhídrido acético. También se investigaron ciertas propiedades de interés nutricional con el fin de observar la influencia de la modificación química en la biodisponibilidad del almidón de haba. Se realizó la determinación de almidón total, almidón resistente por retrogradación (AR3, almidón disponible y la velocidad de hidrólisis enzimática en el almidón nativo y en el modificado.
Austruy, A; Wanat, N; Moussard, C; Vernay, P; Joussein, E; Ledoigt, G; Hitmi, A
2013-04-01
In order to revegetate an industrial soil polluted by trace metals and metalloids (As, Pb, Cu, Cd, Sb), the impact of pollution on three plant species, Solanum nigrum and Agrostis capillaris, both native species in an industrial site, and Vicia faba, a plant model species, is studied. Following the study of soil pollution from the industrial wasteland of Auzon, it appears that the As is the principal pollutant. Particular attention is given to this metalloid, both in its content and its speciation in the soil that the level of its accumulation in plants. In V. faba and A. capillaris, the trace metals and metalloids inhibit the biomass production and involve a lipid peroxidation in the leaves. Furthermore, these pollutants cause a photosynthesis perturbation by stomatal limitations and a dysfunction of photosystem II. Whatever the plant, the As content is less than 0.1 percent of dry matter, the majority of As absorbed is stored in the roots which play the role of trap organ. In parallel, the culture of S. nigrum decreases significantly the exchangeable and weakly adsorbed fraction of As in rhizospheric soil. This study has highlighted the ability of tolerance to trace metals of S. nigrum and to a lesser extent A. capillaris. Our data indicate that V. faba is not tolerant to soil pollution and is not a metallophyte species. Copyright © 2012 Elsevier Inc. All rights reserved.
Thavarajah, Pushparajah; Thavarajah, Dil; Premakumara, G A S; Vandenberg, Albert
2012-12-15
Detection of adulteration of split red lentil (Lens culinaris L.) seeds with low level addition of split common vetch (Vicia sativa L.) is hampered by a lack of reliable detection methods. An analytical method was developed using high performance liquid chromatography with diode array detection (HPLC-DAD) based on two unique chemical markers found in common vetch: ß-cyanoalanine (BCA) and γ-glutamyl-ß-cyanoalanine (GCA). These two markers were present in samples of common vetch seed grown in Canada and Serbia. Authentic lentil samples grown in Canada, Australia, USA, Turkey, Syria, and Morocco had no detectable levels of these chemical markers. Commercial lentil samples for export from lentil processing plants in Saskatchewan, Canada, also had no detectable levels of GCA and BCA. The presence of vetch in intentionally adulterated lentil samples could be determined via chemical markers with a detection limit of 5% (w/w). The proposed method is a simple sample extraction and rapid HPLC analysis that could be widely used to detect intentional adulteration of lentils with common vetch. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Sara Lombardo
2016-12-01
Full Text Available Field bean (Vicia faba L. var. minor is one of the major leguminous crops cultivated in the world and mainly destined for animal feed. Although its seed is generally recognised as a good protein source, little is known about its mineral elements profile, which is an important aspect for a balanced animal diet. Therefore, the aim of the present work was to assess the seed mineral elements composition, along with some key production parameters, in eight field bean genotypes grown in a Mediterranean environment, without intensive management, over two years (2009/10 and 2010/11. Independently of the year, the seed of Chiaro di Torre Lama was the richest in phosphorus (P, magnesium, calcium and iron contents, while that of Sint 6 and Motta Chiaro 69 were the most effective accumulators of potassium and zinc, respectively. While all the genotypes yielded better in the second year (with more rainfall, the seasonal effect on seed mineral elements composition depended on the genotype. Indeed, the P content was 46% lower in Chiaro di Torre Lama, Motta Chiaro 69 and Sint 6 in the second year, while there was only a negligible seasonal effect for Sint 8 with respect to Fe content. Overall, this crop is reasonably productive under a low management regime and its seed can supply significant amounts of certain minerals (particularly P in feed formulations. Both aspects are important in a perspective of optimising field bean production in the Mediterranean area and, hence, improving farmers’ income.
Directory of Open Access Journals (Sweden)
Mikić Aleksandar
2015-01-01
Full Text Available Bitter vetch (Vicia ervilia (L. Willd. was a part of the everyday diet of the Eurasian Neanderthal population and the modern human Palaeolithic hunter-gatherers at the end of the last Ice Age. The major criteria to determine the domestication in bitter vetch and other ancient grain legumes are non-dehiscent pods, larger seed size and smooth seed testa. Bitter vetch seeds were found among the earliest findings of cultivated crops at the site of Tell El-Kerkh, Syria, from 10th millennium BP. Along with cereals, pea and lentil, bitter vetch has become definitely associated with the start of the 'agricultural revolution' in the Old World. Bitter vetch entered Europe in its south-east regions and progressed into its interior via Danube. Its distribution was rapid, since the available evidence reveals its presence in remote places at similar periods. Recently the first success has been obtained in the extraction of ancient DNA from charred bitter vetch seeds. The linguistic evidence supports the fact that most of Eurasian peoples have their own words denoting bitter vetch, meaning that its cultivation preceded the diversification of their own proto-languages. [Projekat Ministarstva nauke Republike Srbije, br. TR-31024 i br. 173005
Winnicki, Konrad; Żabka, Aneta; Bernasińska, Joanna; Matczak, Karolina; Maszewski, Janusz
2015-06-01
In plants, phosphorylated MAPKs display constitutive nuclear localization; however, not all studied plant species show co-localization of activated MAPKs to mitotic microtubules. The mitogen-activated protein kinase (MAPK) signaling pathway is involved not only in the cellular response to biotic and abiotic stress but also in the regulation of cell cycle and plant development. The role of MAPKs in the formation of a mitotic spindle has been widely studied and the MAPK signaling pathway was found to be indispensable for the unperturbed course of cell division. Here we show cellular localization of activated MAPKs (dually phosphorylated at their TXY motifs) in both interphase and mitotic root meristem cells of Lupinus luteus, Pisum sativum, Vicia faba (Fabaceae) and Lycopersicon esculentum (Solanaceae). Nuclear localization of activated MAPKs has been found in all species. Co-localization of these kinases to mitotic microtubules was most evident in L. esculentum, while only about 50% of mitotic cells in the root meristems of P. sativum and V. faba displayed activated MAPKs localized to microtubules during mitosis. Unexpectedly, no evident immunofluorescence signals at spindle microtubules and phragmoplast were noted in L. luteus. Considering immunocytochemical analyses and studies on the impact of FR180204 (an inhibitor of animal ERK1/2) on mitotic cells, we hypothesize that MAPKs may not play prominent role in the regulation of microtubule dynamics in all plant species.
Directory of Open Access Journals (Sweden)
D. Gatta
2010-04-01
Full Text Available 18 Massese lactating ewes, divided into 3 homogeneous groups for parity and milk yield, were used to evaluate the replacement effects of soybean meal by Faba bean (Vicia faba minor and Pea (Pisum sativum seeds. During a 70 days trial (beginning after weaning: 30±1.5 days after lambing animals were fed three isonitrogenous and isocaloric diets. Each diet was characterised by the presence of only one protein feed. The diets consisted of alfalfa hay (1.1 kg/head/d and a decreasing amount of mixed feed (from 1.1 to 0.7 kg/head/d to fit animals’ requirements. Milk yield, milk chemical composition, animals live weight and BCS, health state and hematochemical parameters were regularly monitored. No diets palatability problems were detected. No significant differences resulted for live weight, BCS, milk yield and milk chemical composition, except for milk protein: higher for faba bean (6.54% and soybean (6.39% respect pea (5.66% diets, P<0.05. No differences resulted for blood parameters too and no clinical signs of illness were observed. Therefore faba bean and pea seeds seem to be able to replace the soybean well.
Antifungal activity of acetone extracts from Punica granatum L., Quercus suber L. and Vicia faba L.
Akroum, S
2017-03-01
Human and animal mycoses become more frequent and more resistant to traditional treatments. In this work, we tested the in vitro antifungal activity of acetonic extracts of Punica granatum L., Quercus suber L. and Vicia faba L. against seven pathogen fungi and the in vivo antifungal activity against Candida albicans and Trichophyton mentagrophytes. The phytochemical screening was also carried out and showed that the extracts contained mainly proanthocyanidins. Other polyphenols were also present but in low quantity. The acetone extract of V. faba L. gave a good in vitro inhibition of yeasts and was the most active for treating candidiasis in mice. It decreased the percentage of mortality with only 20μg. But the in vivo antifungal activity of this extract on T. mentagrophytes was low. It only showed a small diminution of crusting and erythema after the administration of 100μg. On the contrary, the acetone extracts of P. granatum L. had a poor activity against yeasts and a better one against moulds. It gave the best in vivo antifungal activity against T. mentagrophytes by healing animals with 40μg. The extract of P. granatum L. gave also an interesting in vivo antifungal activity against T. mentagrophytes with an active dose of 80μg. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Helena Łabuda
2012-12-01
Full Text Available This study, conducted during the period 2008–2009, related to the growth, flowering, pod set, and yield of faba bean (Vicia faba L. var. major cultivars and breeding lines. Biometric measurements, made on 20 randomly selected plants, included the following traits: plant height, number of branches per plant, number of inflorescences per plant and number of flowers per inflorescence, number of pods per plant: large pods (marketable, small pods (undeveloped, and pods with disease symptoms. Moreover, the following characters were determined: pod and seed weight per plant in faba bean plants harvested once at processing maturity of fresh green seeds, pod length, width and weight as well as single seed weight. The evaluated cultivars and breeding lines of faba bean were characterized by large variations in the most important commercial traits. The abundance and duration of flowering as well as the number and weight of pods per plant were clearly modified by weather factors during the growth of plants. The new breeding lines R-366/1 and R-384 as well as the cultivars 'Bachus' and 'Jankiel Biały' were characterized by quite stable pod and seed yield per plant. Single harvesting of faba bean pods for green seeds at green maturity stage produced positive results in the case of all cultivars and breeding lines investigated; marketable pods per plant accounted for 75–80% of the total number of pods.
Directory of Open Access Journals (Sweden)
Lesław B. Lahuta
2011-01-01
Full Text Available Beside RFOs, which are commonly present in legume seeds, seeds of some species contain galactosyl pinitols (GPs. These carbohydrates, like RFOs, have been hypothesized to constitute an important energy and carbon skeletal source during germination. To test this hypothesis we have applied a specific α-galactosidase inhibitor (1-deoxygalactonojirimycin, DGJ to germinating winter vetch (Vicia villosa Roth. seeds, containing more galactosyl pinitols than RFOs. The breakdown of RFOs but not that of GPs was completely blocked in both embryonic axes and cotyledons tissues, during the first 18 h of imbibition in DGJ. The inhibitor only decreased the rate of GPs degradation. The inhibitory effect of DGJ on GPs degradation was partially alleviated by addition of sucrose or galactose to DGJ solutions. After three days of germination in water, RFOs and GPs disappeared in axial tissues of seeds imbibed in water, galactose or sucrose. Eighteen-hour imbibition of seeds in DGJ drastically reduced germination, by ca 50%, during the first three days. The inhibitory effect of DGJ decreased during the next seven days of germination. The presence of galactose or sucrose in imbibition solution initially stimulated seed germination, but later this effect was not statistically significant. Our study provides clear evidence that galactosyl pinitols play an important role in early winter vetch seeds germination. Additionally, we suggest that galactosyl pinitols can replace RFOs as reserve material necessary for early germination.
Webster, Ben; Gezan, Salvador; Bruce, Toby; Hardie, Jim; Pickett, John
2010-01-01
Ratios of volatile phytochemicals potentially offer a means for insects to recognise their host-plant species. However, for this to occur ratios of volatiles would need to be sufficiently consistent between plants and over time to constitute a host-characteristic cue. In this context we collected headspace samples from Vicia faba plants to determine how consistent ratios of key volatile phytochemicals used in host location by one of its insect pests, the black bean aphid, Aphis fabae, were. These were (E)-2-hexenal, (Z)-3-hexen-1-ol, 1-hexanol, benzaldehyde, 6-methyl-5-hepten-2-one, octanal, (Z)-3-hexen-1-yl acetate, (R)-linalool, methyl salicylate, decanal, undecanal, (E)-caryophyllene, (E)-beta-farnesene, (S)-germacrene D, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene, which had previously been found to be electrophysiologically and behaviourally active to A. fabae. Although the quantities of volatiles produced by V. faba showed large between plant and diurnal variation, correlations between quantities of compounds indicated that the ratios of certain pairs of volatiles were very consistent. This suggests that there is a host-characteristic cue available to A. fabae in the form of ratios of volatiles. 2009 Elsevier Ltd. All rights reserved.
Barbafieri, Meri; Giorgetti, Lucia
2016-12-01
In this work, the model plant for genotoxicity studies Vicia faba L. was used to investigate the relation between Boron (B) content and bioavailability in soil and plant genotoxic/phytotoxic response. A total of nine soil samples were investigated: two soil samples were collected from a B-polluted industrial area in Cecina (Tuscany, Italy), the other samples were obtained by spiking control soil (from a not polluted area of the basin) with seven increased doses of B, from about 20 to 100 mg B kg(-1). As expected, B availability, evaluated by chemical extraction, was higher (twofold) in spiked soils when compared with collected polluted soils with the same B total content. To analyze the phytotoxic effects of B, seed germination, root elongation, biomass production, and B accumulation in plant tissues were considered in V. faba plants grown in the various soils. Moreover, the cytotoxic/genotoxic effects of B were investigated in root meristems by mitotic index (MI) and micronuclei frequency (MCN) analysis. The results highlighted that V. faba was a B-sensitive plant and the appearance of phytotoxic effects, which altered plant growth parameters, were linearly correlated to the bioavailable B concentration in soils. Concerning the occurrence of cytotoxic/genotoxic effects induced by B, no linear correlation was observed even if MCN frequency was logarithmic correlated with the concentration of B bioavailable in soils.
Directory of Open Access Journals (Sweden)
Adrian J Tett
Full Text Available Salicylic acid is an important signalling molecule in plant-microbe defence and symbiosis. We analysed the transcriptional responses of the nitrogen fixing plant symbiont, Rhizobium leguminosarum bv viciae 3841 to salicylic acid. Two MFS-type multicomponent efflux systems were induced in response to salicylic acid, rmrAB and the hitherto undescribed system salRAB. Based on sequence similarity salA and salB encode a membrane fusion and inner membrane protein respectively. salAB are positively regulated by the LysR regulator SalR. Disruption of salA significantly increased the sensitivity of the mutant to salicylic acid, while disruption of rmrA did not. A salA/rmrA double mutation did not have increased sensitivity relative to the salA mutant. Pea plants nodulated by salA or rmrA strains did not have altered nodule number or nitrogen fixation rates, consistent with weak expression of salA in the rhizosphere and in nodule bacteria. However, BLAST analysis revealed seventeen putative efflux systems in Rlv3841 and several of these were highly differentially expressed during rhizosphere colonisation, host infection and bacteroid differentiation. This suggests they have an integral role in symbiosis with host plants.
Rui, Haiyun; Chen, Chen; Zhang, Xingxing; Shen, Zhenguo; Zhang, Fenqin
2016-01-15
We examined the effects of Cd on growth, lipid peroxidation, reactive oxygen species (ROS) accumulation, antioxidant enzymatic activity, and lignin content in the roots of two varieties of Vicia sativa. Treatment with Cd decreased plant growth and increased ROS and lipid peroxidation levels to a greater extent in the Cd-sensitive variety ZM than in the Cd-tolerant variety L3. Most hydrogen peroxide (H2O2) and superoxide anion (O2(•-)) were accumulated in the cell walls and extracellular spaces in response to Cd treatments. Chemical assays and experiments using inhibitors showed that larger increases in H2O2 and O2(•-) production in ZM than in L3 were probably attributed to elevated Cd-induced nicotinamide adenine dinucleotide-peroxidase (NADH-POD) activity. Cd treatment increased the accumulation of lignin and the guaiacol peroxidase (GPOD) activities in the apoplast more significantly in ZM root than in L3. Howerver, root laccase activity was higher in L3 than in ZM. Thus Cd toxicity induced significant lignification in the roots of V. sativa, and increases in H2O2 accumulation and apoplastic GPOD activity were likely responsible for this effect. Copyright © 2015 Elsevier B.V. All rights reserved.
Buckley, Thomas N; Vice, Heather; Adams, Mark A
2017-08-31
The Kok effect - an abrupt decline in quantum yield (QY) of net CO2 assimilation at low photosynthetic photon flux density (PPFD) - is widely used to estimate respiration in the light (R), which assumes the effect is caused by light suppression of R. A recent report suggested much of the Kok effect can be explained by declining chloroplastic CO2 concentration (cc ) at low PPFD. Several predictions arise from the hypothesis that the Kok effect is caused by declining cc , and we tested these predictions in Vicia faba. We measured CO2 exchange at low PPFD, in 2% and 21% oxygen, in developing and mature leaves, which differed greatly in R in darkness. Our results contradicted each of the predictions based on the cc effect: QY exceeded the theoretical maximum value for photosynthetic CO2 uptake; QY was larger in 21% than 2% oxygen; and the change in QY at the Kok effect breakpoint was unaffected by oxygen. Our results strongly suggest the Kok effect arises largely from a progressive decline in R with PPFD that includes both oxygen-sensitive and -insensitive components. We suggest an improved Kok method that accounts for high cc at low PPFD. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
Rosa, Edson V Cordova; Valgas, Cleidson; Souza-Sierra, Maria M; Corrêa, Albertina X R; Radetski, Claudemir Marcos
2003-03-01
Biomass growth, micronucleus induction, and antioxidative stress enzymes (superoxide dismutase, peroxidase, glutathione reductase, and catalase) were investigated simultaneously in the Vicia faba plant exposed to cadmium in solution. The biomass lowest-observed-effect concentration (LOEC) value was 2,000 microM Cd2+. In the shoots, enzymic activities increased without concentration-response relationships. In the roots, after an initial increase, activities of all enzymes showed negative concentration-response relationships. A significant increase in micronucleus induction was observed at 20 microM Cd2+. Regarding sensitivity, our results showed that biomass endpoint was less sensitive than micronucleus induction, which was less sensitive than antioxidative enzyme activities. The increase of antioxidant stress enzyme activities in response to cadmium exposure may be taken as evidence for an enhanced detoxification capacity of V. faba plants toward reactive oxygen species (and derivatives) that might be generated in the stressed plants. Concomitant micronucleus induction may be also interpreted as a consequence of oxidative stress, upholding the view that cadmium-induced DNA damage is, to some extent, via generation of reactive (intermediate) oxygen species.
Directory of Open Access Journals (Sweden)
Fernandez-Alonso José Luis
2009-12-01
Full Text Available This is the third study of lectin and mucilage detection in Labiatae nutlets fromColombia. It was carried out on 30 taxa; 15 of them belonging to 14 genera inwhich no previous studies have been carried out in this fi eld, the other 15 belongingto previously studied genera. A differential response was observed in the group ofgenera and species studied in terms of mucilage presence as well as lectin activitywhich consistently increased after extract treatment with Pectinex. Lectin activity wasdetected in 26 species, being important (more than 60% activity in at least 75% ofthem. Genera such as Aegiphila, Agastache, Ballota, Mentha and Origanum, whilstnot presenting mucilage, did present lectin activity, with high activity in most cases.This is the fi rst time that a lectin has been reported in these genera. Salvia (in all butSalvia sections studied presented mucilage and important lectin activity.
Alen'kina, S A; Nikitina, V E
2015-01-01
The lectins of associative nitrogen-fixing strains Azospirillum brasilense Sp7 and Sp245 were shown to exerte a multidirectional effect on the activity of acidic (pH 3.5), neutral (6.8), and alkaline (pH 7.8) proteinases. The lectin of the epiphytic A. brasilense Sp7 decreased proteolytic activity at all pH values, whereas the lectin of the endophytic A. brasilense Sp245 activated neutral and alkaline proteinases, while not affecting the alkaline ones. Experiments with protease inhibitors made it possible to conclude that the lectins of the studied A. brasilense strains alter the ratio between the activities of different protease types in germinating seeds. The activity of trypsin inhibitors in wheat seedling roots was found to increase in the presence of the lectins. Our results indicate a broader spectrum of effects of azospirilla lectins on the host plant organism.
Ye, X Y; Ng, T B; Tsang, P W; Wang, J
2001-07-01
A homodimeric lectin adsorbed on Affi-gel blue gel and CM-Sepharose and possessing a molecular weight of 67 kDa was isolated from red kidney beans. The hemagglutinating activity of this lectin was inhibited by glycoproteins but not by simple sugars. The lectin manifested inhibitory activity on human immunodeficiency virus-1 reverse transcriptase and alpha-glucosidase. The N-terminal sequence of the lectin exhibited some differences from previously reported lectins from Phaseolus vulgaris but showed some similarity to chitinases. It exerted a suppressive effect on growth of the fungal species Fusarium oxysporum, Coprinus comatus, and Rhizoctonia solani. The lectin had low ribonuclease and negligible translation-inhibitory activities.
Directory of Open Access Journals (Sweden)
Mirandeli Bautista
2011-03-01
Full Text Available Lectins comprise a heterogeneous class of proteins that recognize the carbohydrate moieties of glycoconjugates with high specificity. Numerous studies have shown that lectins are capable of recognizing specific carbohydrate moieties displayed by malignant cells or tissues. The present work was performed to investigate the effects of tepary bean (Phaseolus acutifolius lectins on proliferation, colony formation, and alteration of DNA synthesis of human malignant cells. Tepary bean lectin showed dose dependent effects on the inhibition of viability as well as on colony formation in two human malignant cells lines (C33-A, Sw480; By contrast, tepary bean lectin only showed significant effects on DNA synthesis on Sw480 cells. Our results provide evidence of the anti- proliferative and cytotoxic effects of the tepary bean lectins on C33-A and Sw480 cells lines.
EFFECT OF PLANT LECTINS ON HUMAN BLOOD GROUP ANTIGENS WITH SPECIAL FOCUS ON PLANT FOODS AND JUICES
B. Venkata Raman; B. Sravani; P. Phani Rekha; K.V.N. Lalitha; B. Narasimha Rao
2012-01-01
Different plant lectins have been studied for lectin binding activity on ABO blood group system individually to study their suitability for consumption. 45% of plants were found to show blood group agglutination activity against A, B, AB and O groups. These results showed more suitability for consumption of investigated plants and their products to entire human population. Data also alarming human to be more careful about the plant lectins reacting with blood groups as the similar reactions ...
Yagoda-Shagam, Janet; Barton, Larry L.; Reed, William P.; Chiovetti, Robert
1988-01-01
The cell surface of Azospirillum brasilense was probed by using fluorescein isothiocyanate (FITC)-labeled lectins, with binding determined by fluorescence-activated flow cytometry. Cells from nitrogen-fixing or ammonium-assimilating cultures reacted similarly to FITC-labeled lectins, with lectin binding in the following order: Griffonia simplicifolia II agglutinin > Griffonia simplicifolia I agglutinin > Triticum vulgaris agglutinin > Glycine max agglutinin > Canavalia ensiformis agglutinin >...
Ottinger, C.A.; Johnson, S.C.; Ewart, K.V.; Brown, L.L.; Ross, N.W.
1999-01-01
We investigated the effects of a calcium-dependent mannose-binding lectin isolated from the serum of Atlantic salmon on Aeromonassalmonicida viability and the anti-A. salmonicida activity of Atlantic salmon macrophages. In the absence of other factors, binding of this lectin at concentrations of 0.8, 4.0 and 20.0 ng ml−1 to virulent A. salmonicida failed to significantly reduce (P>0.05) cell viability. However, binding of the lectin to A. salmonicida did result in significant (P≤0.05) dose-dependent increases in phagocytosis, and bactericidal activity. Significant increases (P≤0.05) were also observed in phagocyte respiratory burst activity within the lectin concentration range of 4.0–20.0 ng ml−1 but the stimulation was not dose dependent at these lectin concentrations. At the lowest lectin concentration tested (0.32 ng ml−1), a significant decrease (P≤0.05) in respiratory burst was observed. The structure and activity of this lectin are similar to that of mammalian mannose-binding lectins, which are known to play a pivotal role in innate immunity. The presence of this lectin may be an important defense mechanism against Gram-negative bacteria such as A. salmonicida.
Energy Technology Data Exchange (ETDEWEB)
Nagano, Celso S.; Gallego del Sol, Francisca [Instituto de Biomedicina de Valencia, CSIC, Valencia (Spain); Cavada, Benildo S.; Nascimento, Kyria Santiago Do [Departamento de Bioquímica e Biologia Molecular, Universidade Federal do Ceará, Fortaleza, CE 60451-970 (Brazil); Nunes, Eudismar Vale; Sampaio, Alexandre H. [Laboratorio de Bioquímica Marinha, Departamento de Engenharia de Pesca, Universidade Federal do Ceará, Fortaleza, CE 60451-970 (Brazil); Calvete, Juan J., E-mail: jcalvete@ibv.csic.es [Instituto de Biomedicina de Valencia, CSIC, Valencia (Spain)
2005-11-01
The crystallization and preliminary X-ray diffraction analysis of a red marine alga lectin isolated from H. musciformis is reported. HML, a lectin from the red marine alga Hypnea musciformis, defines a novel lectin family. Orthorhombic crystals of HML belonging to space group P2{sub 1}2{sub 1}2{sub 1} grew within three weeks at 293 K using the hanging-drop vapour-diffusion method. A complete data set was collected at 2.4 Å resolution. HML is the first marine alga lectin to be crystallized.
Some new species of Axonopus (Gramineae)
Henrard, J.Th.
1942-01-01
During the preparation of an account of the grasses for the flora of Dutch Guiana many difficulties were found in the identification of species of the genus Axonopus. Our knowledge as to the most recent treatment is entirely based upon Doell’s work for the Flora Brasiliensis. It is, however, evident
Nitrogen fixation in the phyllosphere of Gramineae
Bessems, E.P.M.
1973-01-01
The investigation was carried out with Zea mays , grown under temperate conditions, and with Tripsacum laxum Nash, grown in the tropics. The conditions for nitrogen fixation were found to be unfavourable in the leachate, obtained by spray irrigation of the aerial plant
Directory of Open Access Journals (Sweden)
Rafael Almeida Fighera
2005-04-01
Full Text Available Descrevem-se as lesões cutâneas macroscópicas em 10 e histológicas em 8 vacas afetadas por doença granulomatosa sistêmica associada ao pastoreio de ervilhaca (Vicia spp.. Em todos os casos, as lesões cutâneas eram caracterizadas por múltiplas áreas coalescentes de alopecia, liquenificação e descamação. Os locais mais atingidos pela lesão de pele foram: cabeça e pescoço (10/10, tronco (4/10, períneo (3/10 e mama (2/10. Em todos os 8 casos avaliados histologicamente, as lesões se caracterizavam por dermatite perivascular superficial granulomatosa de intensidade variável. Outros achados histológicos incluíram dermatite perivascular profunda (1/8, perifoliculite (2/8, foliculite mural (3/8, hiperqueratose ortoqueratótica compacta (6/8, erosões (1/8, úlceras (2/8, microabscessos de Munro (8/8, crostas serocelulares (1/8, espongiose (4/8, degeneração hidrópica (5/8, acantólise (1/8, corpúsculos de Civatte (2/8, exocitose linfoplasmocitária (6/8, edema superficial (6/8, incontinência pigmentar (2/8, basofilia (6/8 e mineralização distrófica do colágeno (2/8, tumefação do núcleo das células endoteliais (8/8 e ectasia de glândulas sudoríparas (8/8.Gross and histopathological lesions in the skin of respectively 10 and 8 cows affected with systemic granulomatous disease associated with pasturing vetch (Vicia spp. are described. In all cases, the cutaneous lesions were characterized by multiple coalescent areas of alopecia, lichenification and desquamation. More frequently affected sites were the skin covering the head and neck (10/10, trunk (4/10, escutcheon (3/10 and mammary gland (2/10. In all 8 histologically examined cases the lesions were characterized by superficial perivascular granulomatous dermatitis of varying intensity. Other histological findings included deep perivascular dermatitis (1/8, perifoliculitis (2/8, mural foliculitis (3/8, compact orthokeratotic hyperkeratosis (6/8, erosions (1/8, ulcers (2
Bocsi, József; Nieschke, Kathleen; Mittag, Anja; Reichert, Thomas; Laffers, Wiebke; Marecka, Monika; Pierzchalski, Arkadiusz; Piltz, Joachim; Esche, Hans-Jürgen; Wolf, Günther; Dähnert, Ingo; Baumgartner, Adolf; Tarnok, Attila
2014-03-01
Myocardial infarction (MI) is an acute life-threatening disease with a high incidence worldwide. Aim of this study was to test lectin-carbohydrate binding-induced red blood cell (RBC) agglutination as an innovative tool for fast, precise and cost effective diagnosis of MI. Five lectins (Ricinus communis agglutinin (RCA), Phaseolus vulgaris erythroagglutinin (PHA), Datura stramonium agglutinin (DSA), Artocarpus agglutinin (ArA), Triticum agglutinin (TA)) were tested for ability to differentiate between agglutination characteristics in patients with MI (n = 101) or angina pectoris without MI (AP) (n = 34) and healthy volunteers (HV) as control (n =68) . RBC agglutination was analyzed by light absorbance of a stirred RBC suspension in the green to red light spectrum in an agglutimeter (amtec, Leipzig, Germany) for 15 min after lectin addition. Mean cell count in aggregates was estimated from light absorbance by a mathematical model. Each lectin induced RBC agglutination. RCA led to the strongest RBC agglutination (~500 RBCs/aggregate), while the others induced substantially slower agglutination and lead to smaller aggregate sizes (5-150 RBCs/aggregate). For all analyzed lectins the lectin-induced RBC agglutination of MI or AP patients was generally higher than for HV. However, only PHA induced agglutination that clearly distinguished MI from HV. Variance analysis showed that aggregate size after 15 min. agglutination induced by PHA was significantly higher in the MI group (143 RBCs/ aggregate) than in the HV (29 RBC-s/aggregate, p = 0.000). We hypothesize that pathological changes during MI induce modification of the carbohydrate composition on the RBC membrane and thus modify RBC agglutination. Occurrence of carbohydrate-lectin binding sites on RBC membranes provides evidence about MI. Due to significant difference in the rate of agglutination between MI > HV the differentiation between these groups is possible based on PHA-induced RBC-agglutination. This novel assay
Nayar, J K; Mikarts, L L; Chikilian, M L; Knight, J W; Bradley, T J
1995-11-01
Binding patterns of fluorescein isothiocyanate (FITC)- and gold-conjugated lectins to extracellularly melanized sheathed and exsheathed microfilariae of subperiodic Brugia malayi, isolated from and in situ in the abdominal hemocoel of Anopheles quadrimaculatus 72-hr postinfection, were examined. Five FITC-conjugated lectins [Helix pomatia agglutinin (HPA), Arachis hypogaea (peanut agglutinin-PNA), Triticum vulgaris (wheat germ agglutinin-WGA), Lens culinaris (lentil-LCH), and Concanavalin A (Con A)] with specificities for different carbohydrate moieties were tested for binding to isolated melanized microfilariae and observed with transmitted light and fluorescence microscopy. All five FITC-lectins bound strongly to the acellular material accompanying the melanin deposits on the surface of isolated melanized microfilariae. Significant inhibition of FITC-lectin binding occurred when lectins were preincubated with their complementary carbohydrates before testing. H. pomatia agglutinin binding was totally inhibited by N-acetyl-D-glucosamine and N-acetyl-D-galactosamine. Other lectins were partially inhibited, such as PNA by galactose and lactose; WGA by N-acetylneuraminic acid; LCH by N-acetyl-D-glucosamine, mannose, glucose, and methyl alpha-D-mannopyranoside; and Con A by mannose and methyl alpha-D-mannopyranoside. Three gold-conjugated lectins (HPA, PNA, and Con A), examined by using transmission electron microscopy, bound to the outer surface of the acellular material associated with the melanin deposits on isolated melanized microfilarial sheaths and melanized microfilariae and to the remnants of lysed hemocytes found in the proximity of the melanized deposits. Con A in the presence of gold-labeled horseradish peroxidase, examined by using transmission electron microscopy, showed random binding within the melanized capsule formed around the microfilarial sheath in situ. These results indicate that the acellular material accompanying melanin deposits on melanized
Proteins with an Euonymus lectin-like domain are ubiquitous in Embryophyta
Directory of Open Access Journals (Sweden)
Ongenaert Maté
2009-11-01
Full Text Available Abstract Background Cloning of the Euonymus lectin led to the discovery of a novel domain that also occurs in some stress-induced plant proteins. The distribution and the diversity of proteins with an Euonymus lectin (EUL domain were investigated using detailed analysis of sequences in publicly accessible genome and transcriptome databases. Results Comprehensive in silico analyses indicate that the recently identified Euonymus europaeus lectin domain represents a conserved structural unit of a novel family of putative carbohydrate-binding proteins, which will further be referred to as the Euonymus lectin (EUL family. The EUL domain is widespread among plants. Analysis of retrieved sequences revealed that some sequences consist of a single EUL domain linked to an unrelated N-terminal domain whereas others comprise two in tandem arrayed EUL domains. A new classification system for these lectins is proposed based on the overall domain architecture. Evolutionary relationships among the sequences with EUL domains are discussed. Conclusion The identification of the EUL family provides the first evidence for the occurrence in terrestrial plants of a highly conserved plant specific domain. The widespread distribution of the EUL domain strikingly contrasts the more limited or even narrow distribution of most other lectin domains found in plants. The apparent omnipresence of the EUL domain is indicative for a universal role of this lectin domain in plants. Although there is unambiguous evidence that several EUL domains possess carbohydrate-binding activity further research is required to corroborate the carbohydrate-binding properties of different members of the EUL family.
Dorkina, E G
2010-04-01
Experiments on white female rats showed that chronic ethanol consumption leads to activation of the NADPH - GSH dependent system of the liver, which provides protection against ethanol-induced oxidative stress. Post-treatment administration of dry extract from Vicia truncatula Fish ex Bieb. (300 mg/kg body weight) on the background of 40% ethanol increased this adaptive reaction without depletion in the system, in contrast to what was observed in rats treated with carsil. These results suggest a significant hepatoprotective effect of the dry extract during the chronic alcohol-induced injury of the liver.
Directory of Open Access Journals (Sweden)
María Inés Zamar
2012-03-01
Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F
Siebert, HC; vonderLieth, CW; Kaptein, R; Beintema, JJ; Dijkstra, K; vanNuland, N; Soedjanaatmadja, UMS; Rice, A; Vliegenthart, JFG; Wright, CS; Gabius, HJ
Carbohydrate recognition by lectins often involves the side chains of tyrosine, tryptophan, and histidine residues. These moieties are able to produce chemically induced dynamic nuclear polarization (CIDNP) signals after laser irradiation in the presence of a suitable radical pair-generating dye.
DEFF Research Database (Denmark)
Kjærup, Rikke Munkholm; Dalgaard, Tina Sørensen; Norup, Liselotte Rothmann
2014-01-01
Mannose-binding lectin (MBL) plays a major role in the immune response as a soluble pattern-recognition receptor. MBL deficiency and susceptibility to different types of infections have been subject to extensive studies over the last decades. In humans and chickens, several studies have shown tha...... chickens receiving vaccine and FOS makes FOS a potential adjuvant candidate in an IBV vaccine....
Directory of Open Access Journals (Sweden)
Tambalo Dinah D
2010-08-01
Full Text Available Abstract Background Rhizobium leguminosarum bv. viciae establishes symbiotic nitrogen fixing partnerships with plant species belonging to the Tribe Vicieae, which includes the genera Vicia, Lathyrus, Pisum and Lens. Motility and chemotaxis are important in the ecology of R. leguminosarum to provide a competitive advantage during the early steps of nodulation, but the mechanisms of motility and flagellar assembly remain poorly studied. This paper addresses the role of the seven flagellin genes in producing a functional flagellum. Results R. leguminosarum strains 3841 and VF39SM have seven flagellin genes (flaA, flaB, flaC, flaD, flaE, flaH, and flaG, which are transcribed separately. The predicted flagellins of 3841 are highly similar or identical to the corresponding flagellins in VF39SM. flaA, flaB, flaC, and flaD are in tandem array and are located in the main flagellar gene cluster. flaH and flaG are located outside of the flagellar/motility region while flaE is plasmid-borne. Five flagellin subunits (FlaA, FlaB, FlaC, FlaE, and FlaG are highly similar to each other, whereas FlaD and FlaH are more distantly related. All flagellins exhibit conserved amino acid residues at the N- and C-terminal ends and are variable in the central regions. Strain 3841 has 1-3 plain subpolar flagella while strain VF39SM exhibits 4-7 plain peritrichous flagella. Three flagellins (FlaA/B/C and five flagellins (FlaA/B/C/E/G were detected by mass spectrometry in the flagellar filaments of strains 3841 and VF39SM, respectively. Mutation of flaA resulted in non-motile VF39SM and extremely reduced motility in 3841. Individual mutations of flaB and flaC resulted in shorter flagellar filaments and consequently reduced swimming and swarming motility for both strains. Mutant VF39SM strains carrying individual mutations in flaD, flaE, flaH, and flaG were not significantly affected in motility and filament morphology. The flagellar filament and the motility of 3841 strains
Directory of Open Access Journals (Sweden)
Yau Sang Chan
Full Text Available A 70-kDa galactose-specific lectin was purified from the tubers of Dioscorea opposita cv. nagaimo. The purification involved three chromatographic steps: anion exchange chromatography on a Q-Sepharose column, FPLC-anion exchange chromatography on a Mono Q column, and FPLC-gel filtration on a Superdex 75 column. The purified nagaimo lectin presented as a single 35-kDa band in reducing SDS-PAGE while it exhibited a 70-kDa single band in non-reducing SDS-PAGE suggesting its dimeric nature. Nagaimo lectin displayed moderate thermostability, retaining full hemagglutinating activity after heating up to 62°C for 30 minutes. It also manifested stability over a wide pH range from pH 2 to 13. Nagaimo lectin was a galactose-specific lectin, as evidenced by binding with galactose and galactose-containing sugars such as lactose and raffinose. The minimum concentration of galactose, lactose and raffinose required to exert an inhibitory effect on hemagglutinating activity of nagaimo lectin was 20 mM, 5 mM and 40 mM, respectively. Nagaimo lectin inhibited the growth of some cancer cell lines including breast cancer MCF7 cells, hepatoma HepG2 cells and nasopharyngeal carcinoma CNE2 cells, with IC(50 values of 3.71 µM, 7.12 µM and 19.79 µM, respectively, after 24 hour treatment with nagaimo lectin. The induction of phosphatidylserine externalization and mitochondrial depolarization indicated that nagaimo lectin evoked apoptosis in MCF7 cells. However, the anti-proliferative activity of nagaimo lectin was not blocked by application of galactose, signifying that the activity was not related to the carbohydrate binding specificity of the lectin.
Soga, Keisuke; Teruya, Futaba; Tateno, Hiroaki; Hirabayashi, Jun; Yamamoto, Kazuo
2013-01-01
Millettia japonica was recently reclassified into the genus Wisteria japonica based on chloroplast and nuclear DNA sequences. Because the seed of Wisteria floribunda expresses leguminous lectins with unique N-acetylgalactosamine-binding specificity, we purified lectin from Wisteria japonica seeds using ion exchange and gel filtration chromatography. Glycan microarray analysis demonstrated that unlike Wisteria floribunda and Wisteria brachybotrys lectins, which bind to both terminal N-acetylgalactosamine and galactose residues, Wisteria japonica lectin (WJA) specifically bound to both α- and β-linked terminal N-acetylgalactosamine, but not galactose residues on oligosaccharides and glycoproteins. Further, frontal affinity chromatography using more than 100 2-aminopyridine-labeled and p-nitrophenyl-derivatized oligosaccharides demonstrated that the ligands with the highest affinity for Wisteria japonica lectin were GalNAcβ1-3GlcNAc and GalNAcβ1-4GlcNAc, with Ka values of 9.5 × 104 and 1.4 × 105 M-1, respectively. In addition, when binding was assessed in a variety of cell lines, Wisteria japonica lectin bound specifically to EBC-1 and HEK293 cells while other Wisteria lectins bound equally to all of the cell lines tested. Wisteria japonica lectin binding to EBC-1 and HEK293 cells was dramatically decreased in the presence of N-acetylgalactosamine, but not galactose, mannose, or N-acetylglucosamine, and was completely abrogated by β-hexosaminidase-digestion of these cells. These results clearly demonstrate that Wisteria japonica lectin binds to terminal N-acetylgalactosamine but not galactose. In addition, histochemical analysis of human squamous cell carcinoma tissue sections demonstrated that Wisteria japonica lectin specifically bound to differentiated cancer tissues but not normal tissue. This novel binding characteristic of Wisteria japonica lectin has the potential to become a powerful tool for clinical applications. PMID:24349556
Directory of Open Access Journals (Sweden)
Keisuke Soga
Full Text Available Millettia japonica was recently reclassified into the genus Wisteria japonica based on chloroplast and nuclear DNA sequences. Because the seed of Wisteria floribunda expresses leguminous lectins with unique N-acetylgalactosamine-binding specificity, we purified lectin from Wisteria japonica seeds using ion exchange and gel filtration chromatography. Glycan microarray analysis demonstrated that unlike Wisteria floribunda and Wisteria brachybotrys lectins, which bind to both terminal N-acetylgalactosamine and galactose residues, Wisteria japonica lectin (WJA specifically bound to both α- and β-linked terminal N-acetylgalactosamine, but not galactose residues on oligosaccharides and glycoproteins. Further, frontal affinity chromatography using more than 100 2-aminopyridine-labeled and p-nitrophenyl-derivatized oligosaccharides demonstrated that the ligands with the highest affinity for Wisteria japonica lectin were GalNAcβ1-3GlcNAc and GalNAcβ1-4GlcNAc, with K(a values of 9.5 × 10(4 and 1.4 × 10(5 M(-1, respectively. In addition, when binding was assessed in a variety of cell lines, Wisteria japonica lectin bound specifically to EBC-1 and HEK293 cells while other Wisteria lectins bound equally to all of the cell lines tested. Wisteria japonica lectin binding to EBC-1 and HEK293 cells was dramatically decreased in the presence of N-acetylgalactosamine, but not galactose, mannose, or N-acetylglucosamine, and was completely abrogated by β-hexosaminidase-digestion of these cells. These results clearly demonstrate that Wisteria japonica lectin binds to terminal N-acetylgalactosamine but not galactose. In addition, histochemical analysis of human squamous cell carcinoma tissue sections demonstrated that Wisteria japonica lectin specifically bound to differentiated cancer tissues but not normal tissue. This novel binding characteristic of Wisteria japonica lectin has the potential to become a powerful tool for clinical applications.
C-type Lectin Receptors for Tumor Eradication: Future Directions
Energy Technology Data Exchange (ETDEWEB)
Streng-Ouwehand, Ingeborg; Unger, Wendy W. J.; Kooyk, Yvette van, E-mail: y.vankooyk@vumc.nl [Department of Molecular Cell Biology and Immunology, VU University Medical Center, P.O. Box 7057, 1007 MB Amsterdam (Netherlands)
2011-08-08
Dendritic cells are key regulators in directing immune responses and therefore are under extensive research for the induction of anti-tumor responses. DCs express a large array of receptors by which they scan their surroundings for recognition and uptake of pathogens. One of the receptor-families is the C-type lectins (CLR), which bind carbohydrate structures and internalize antigens upon recognition. Intracellular routing of antigen through CLR enhances loading and presentation of antigen through MHC class I and II, inducing antigen-specific CD4{sup +} and CD8{sup +} T-cell proliferation and skewing T-helper cells. These characteristics make CLRs very interesting targets for DC-based immunotherapy. Profound research has been done on targeting specific tumor antigens to CLR using either antibodies or the natural ligands such as glycan structures. In this review we will focus on the current data showing the potency of CLR-targeting and discuss improvements that can be achieved to enhance anti-tumor activity in the near future.
Targeting C-type Lectin Receptors for Cancer Immunity
Directory of Open Access Journals (Sweden)
Huimin eYan
2015-08-01
Full Text Available C-type lectin receptors (CLRs are a large family of soluble and trans-membrane pattern recognition receptors that are widely and primarily expressed on myeloid cells. CLRs are important for cell-cell communication and host defense against pathogens through the recognition of specific carbohydrate structures. Similar to a family of Toll-like receptors (TLRs, CLRs signaling are involved in the various steps for initiation of innate immune responses and promote secretion of soluble factors such as cytokines and interferons, Moreover, CLRs contribute to endocytosis and antigen-presentation, thereby fine-tune adaptive immune responses. In addition, there may also be a direct activation of acquired immunity. On the other hand, glycans, such as mannose structures, Lewis-type antigens or GalNAc are components of tumor antigens and ligate CLRs, leading to immunoregulation. Therefore agonists or antagonists of CLRs signaling are potential therapeutic reagents for cancer immunotherapy. We aim to overview the current knowledge of CLRs signaling and the application of their ligands on tumor-associating immune response.
Entamoeba histolytica: Adhesins and Lectins in the Trophozoite Surface
Directory of Open Access Journals (Sweden)
Magdalena Aguirre García
2015-02-01
Full Text Available Entamoeba histolytica is the causative agent of amebiasis in humans and is responsible for 100,000 deaths annually, making it the third leading cause of death due to a protozoan parasite. Pathogenesis appears to result from the potent cytotoxic activity of the parasite, which kills host cells within minutes. Although the mechanism is unknown, it is well established to be contact-dependent. The life cycle of the parasite alternates with two forms: the resistant cyst and the invasive trophozoite. The adhesive interactions between the parasite and surface glycoconjugates of host cells, as well as those lining the epithelia, are determinants for invasion of human tissues, for its cytotoxic activity, and finally for the outcome of the disease. In this review we present an overview of the information available on the amebic lectins and adhesins that are responsible of those adhesive interactions and we also refer to their effect on the host immune response. Finally, we present some concluding remarks and perspectives in the field.
NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling in Vicia faba guard cells.
Yi, Min; Bai, Heli; Xue, Meizhao; Yi, Huilan
2017-04-01
NO and H2O2 have been implicated as important signals in biotic and abiotic stress responses of plants to the environment. Previously, we have shown that SO2 exposure increased the levels of NO and H2O2 in plant cells. We hypothesize that, as signaling molecules, NO and H2O2 mediate SO2-caused toxicity. In this paper, we show that SO2 hydrates caused guard cell death in a concentration-dependent manner in the concentration range of 0.25 to 6 mmol L-1, which was associated with elevation of intracellular NO, H2O2, and Ca2+ levels in Vicia faba guard cells. NO donor SNP enhanced SO2 toxicity, while NO scavenger c-PTIO and NO synthesis inhibitors L-NAME and tungstate significantly prevented SO2 toxicity. ROS scavenger ascorbic acid (AsA) and catalase (CAT), Ca2+ chelating agent EGTA, and Ca2+ channel inhibitor LaCl3 also markedly blocked SO2 toxicity. In addition, both c-PTIO and AsA could completely block SO2-induced elevation of intracellular Ca2+ level. Moreover, c-PTIO efficiently blocked SO2-induced H2O2 elevation, and AsA significantly blocked SO2-induced NO elevation. These results indicate that extra NO and H2O2 are produced and accumulated in SO2-treated guard cells, which further activate Ca2+ signaling to mediate SO2 toxicity. Our findings suggest that both NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling.
McAnulla, Craig; Edwards, Anne; Sanchez-Contreras, Maria; Sawers, R Gary; Downie, J Allan
2007-07-01
Transfer of the Rhizobium leguminosarum biovar viciae symbiosis plasmid pRL1JI is regulated by a cascade of gene induction involving three LuxR-type quorum-sensing regulators, TraR, BisR and CinR. TraR induces the plasmid transfer traI-trb operon in a population-density-dependent manner in response to N-acylhomoserine lactones (AHLs) made by TraI. Expression of the traR gene is primarily induced by BisR in response to AHLs made by CinI, and expression of cinI is induced by CinR and repressed by BisR. Analysis of transcription initiation of cinI, traR and traI identified potential regulatory domains recognized by the CinR, BisR and TraR regulators. Deletion and mutation of the cinI promoter identified potential recognition motifs for activation by CinR and repression by BisR. Analysis of the DNA sequence upstream of traI and expression of transcriptional gene fusions revealed a predicted TraR-binding (tra-box) domain. Two transcript initiation sites were identified upstream of the plasmid replication gene repA, which is divergently transcribed from traI; one of these repA transcripts requires the quorum-sensing cascade mediated via BisR and TraR, showing that the pRL1JI plasmid replication genes are co-regulated with the plasmid transfer genes.
Anjum, Naser A.; Singh, Neetu; Singh, Manoj K.; Shah, Zahoor A.; Duarte, Armando C.; Pereira, Eduarda; Ahmad, Iqbal
2013-07-01
Adsorbents based on single-bilayer graphene oxide sheet (hereafter termed "graphene oxide") are widely used in contaminated environments cleanup which may easily open the avenues for their entry to different environmental compartments, exposure to organisms and their subsequent transfer to human/animal food chain. Considering a common food crop—faba bean ( Vicia faba L.) germinating seedlings as a model plant system, this study assesses the V. faba-tolerance to different concentrations (0, 100, 200, 400, 800, and 1600 mg L-1) of graphene oxide (0.5-5 μm) and evaluates glutathione (γ-glutamyl-cysteinyl-glycine) redox system significance in this context. The results showed significantly increased V. faba sensitivity under three graphene oxide concentrations (in order of impact: 1,600 > 200 > 100 mg graphene oxide L-1), which was accompanied by decreased glutathione redox (reduced glutathione-to-oxidized glutathione) ratio, reduced glutathione pool, as well as significant and equally elevated activities of glutathione-regenerating (glutathione reductase) and glutathione-metabolizing (glutathione peroxidase; glutathione sulfo-transferase) enzymes. Contrarily, the two graphene oxide concentrations (in order of impact: 800 > 400 graphene oxide mg L-1) yielded promising results; where, significant improvements in V. faba health status (measured as increased graphene oxide tolerance) were clearly perceptible with increased ratio of the reduced glutathione-to-oxidized glutathione, reduced glutathione pool and glutathione reductase activity but decreased activities of glutathione-metabolizing enzymes. It is inferred that V. faba seedlings-sensitivity and/or tolerance to graphene oxide concentrations depends on both the cellular redox state (reduced glutathione-to-oxidized glutathione ratio) and the reduced glutathione pool which in turn are controlled by a finely tuned modulation of the coordination between glutathione-regenerating and glutathione-metabolizing enzymes.
Babikova, Zdenka; Gilbert, Lucy; Randall, Kate C; Bruce, Toby J A; Pickett, John A; Johnson, David
2014-10-01
Arbuscular mycorrhizal (AM) fungi, important plant mutualists, provide plants with nutrients such as phosphorus (P) in return for carbon. AM fungi also enhance the attractiveness of plants to aphids via effects on emissions of plant volatiles used in aphid host location. We tested whether increased P uptake by plants is the mechanism through which AM fungi alter the volatile profile of plants and aphid behavioural responses by manipulating the availability of P and AM fungi to broad beans (Vicia faba L.) in a multi-factorial design. If AM fungi affect plant volatiles only via increased P acquisition, we predicted that the emission of volatiles and the attractiveness of mycorrhizal beans to aphids would be similar to those of non-mycorrhizal beans supplied with additional P. AM fungi and P addition increased leaf P concentrations by 40 and 24%, respectively. The production of naphthalene was less in mycorrhizal plants, regardless of P addition. By contrast, production of (S)-linalool, (E)-caryophyllene and (R)-germacrene D was less in plants colonized by AM fungi but only in the absence of P additions. The attractiveness of plants to pea aphids (Acyrthosiphon pisum Harris) was positively affected by AM fungi and correlated with the extent of root colonization; however, attractiveness was neither affected by P treatment nor correlated with leaf P concentration. These findings suggest that increased P uptake is not the main mechanism by which mycorrhiza increase the attractiveness of plants to aphids. Instead, the mechanism is likely to operate via AM fungi-induced plant systemic signalling. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Directory of Open Access Journals (Sweden)
Runqiang Yang
2015-06-01
Full Text Available The γ-aminobutyric acid (GABA is a non-protein amino acid with some functional properties for human health. Its content is usually lower in plant seeds. Hypoxia or salt (NaCl stress is an effective way for accumulating GABA during seed germination. However, NaCl stress on GABA accumulation under hypoxia is currently infrequent. The effect of NaCl on GABA accumulation in germinating faba bean (Vicia faba L. under hypoxia was therefore investigated in this study. Faba bean seeds were steeped in citric acid buffer (pH 3.5 containing NaCl with a final O2 concentration of 5.5 mg L-1 and germinated for 5 d. Results showed that 60 mmol L-1 NaCl was the optimum concentration for GABA accumulation in germinating faba beans under hypoxia. Germination for 5 d under hypoxia-NaCl stress was less beneficial for GABA accumulation than only hypoxia (control. Polyamine degradation pathway played a more important role for accumulating GABA in germinating faba bean as an adaptive response to NaCl stress. Removing NaCl significantly increased GABA content, while it decreased glutamate decarboxylase (GAD activity. Simultaneously, polyamine was accumulated, which might be related to the enhancement of physiological activity after recovery. When treated with aminoguanidine (AG for 3 d, GABA content decreased by 29.82%. These results indicated that the tolerance ability of GABA shunt to NaCl stress was weaker than that of polyamine degradation pathway. The NaCl treatment for 3 d under hypoxia could raise the contribution ratio of polyamine degradation pathway for GABA accumulation. The contribution ratio of polyamine degradation pathway for GABA formation was 29.82% when treated for at least 3 d
Directory of Open Access Journals (Sweden)
Zhipeng Liu
Full Text Available BACKGROUND: Vicia sativa (the common vetch possesses a predominant zygomorphic flower and belongs to the subfamily Papilionoideae, which is related to Arabidopsis thaliana in the eurosid II clade of the core eudicots. Each vetch flower consists of 21 concentrically arranged organs: the outermost five sepals, then five petals and ten stamens, and a single carpel in the center. METHODOLOGY/PRINCIPAL FINDINGS: We explored the floral transcriptome to examine a genome-scale genetic model of the zygomorphic flower of vetch. mRNA was obtained from an equal mixture of six floral organs, leaves and roots. De novo assembly of the vetch transcriptome using Illumina paired-end technology produced 71,553 unigenes with an average length of 511 bp. We then compared the expression changes in the 71,553 unigenes in the eight independent organs through RNA-Seq Quantification analysis. We predominantly analyzed gene expression patterns specific to each floral organ and combinations of floral organs that corresponded to the traditional ABC model domains. Comparative analyses were performed in the floral transcriptomes of vetch and Arabidopsis, and genomes of vetch and Medicago truncatula. CONCLUSIONS/SIGNIFICANCE: Our comparative analysis of vetch and Arabidopsis showed that the vetch flowers conform to a strict ABC model. We analyzed the evolution and expression of the TCP gene family in vetch at a whole-genome level, and several unigenes specific to three different vetch petals, which might offer some clues toward elucidating the molecular mechanisms underlying floral zygomorphy. Our results provide the first insights into the genome-scale molecular regulatory network that controls the evolution and development of the zygomorphic flower in Papilionoideae.
Kaku, H; Van Damme, E J; Peumans, W J; Goldstein, I J
1990-06-01
The carbohydrate binding specificity of the daffodil (Narcissus pseudonarcissus; NPA) and amaryllis (Hippeastrum hybr.; HHA) lectins, isolated from extracts of their bulbs by affinity chromatography on immobilized mannose, was studied by quantitative precipitation, sugar hapten inhibition, and affinity chromatography on the immobilized lectins. These lectins gave strong precipitation reactions with several yeast mannans, but did not precipitate with alpha-D-glucans (e.g., dextrans and glycogen). Interestingly, both lectins reacted strongly with yeast galactomannans having multiple nonreducing terminal alpha-D-galactosyl groups, a synthetic linear alpha-1,6-mannan, and an alpha-1,3-mannan (DP = 30). Treatment of the linear alpha-1,3-mannan with periodate, resulting in oxidation of the terminal, nonreducing mannosyl group, did not reduce its reactivity with NPA or HHA. Taken together, these observations suggest that NPA and HHA react not only with terminal but also with internal alpha-D-mannosyl residues. Sugar hapten inhibition studies showed these lectins to possess the greatest specific activity for alpha-D-mannosyl units whereas D-Glc and D-GlcNAc did not inhibit either lectin precipitation system. Of the oligosaccharides tested, the best inhibitor of NPA interaction was alpha-1,6-linked mannotriose, which was twice as good an inhibitor as Man alpha 1,6Man alpha-O-Me and 10 times better than methyl alpha-D-mannoside. On the other hand, oligosaccharides containing either 1,3- or 1,6-linked mannosyl units were good inhibitors of the HHA-mannan precipitation system (6- to 20-fold more active than D-Man). These results indicate that both lectins appear to possess an extended binding site(s) complementary to at least three 1,6-linked alpha-mannosyl units. Various glycosylasparagine glycopeptides which contain alpha-1,6-Man units were retarded on the immobilized NPA column. On the other hand, those containing either alpha-1,3- or alpha-1,6-mannosyl residues were
Isolation and properties of a lectin from sainfoin (Onobrychis viciifolia, Scop.).
Hapner, K D; Robbins, J E
1979-09-29
A glycoprotein capable of binding simple carbohydrates and causing hemagglutination has been isolated from seeds of the legume plant sainfoin (Onobrychis viciifolia, Scop. var Eski). The phytolectin was prepared by affinity chromatography of pH 7.0 sodium phosphate extracts on columns of Sepharose-4B containing covalently attached D-mannose. Molecular weight determinations showed the lectin to be a dimer consisting of 26 000 dalton, non-covalently associated monomers. Amino acid analyses indicated high amounts of aspartate, glutamate, threonine and serine which accounted for 41% of all amino acids. One residue of cysteine was present and methionine was totally absent. The lectin contained 2.6% (w/w) neutral carbohydrate and two residues of N-acetylglucosamine/monomer. Carbohydrate-binding specificity was directed toward D-mannose and D-glucose and their alpha-glycosidic derivatives. The purified protein agglutinated cat erythrocytes at 5 micrograms/ml. Antiserum to seed lectin showed a single common immunoprecipitation line in Ouchterlony double diffusion against both the seed and root antigen. Lectin isolated from sainfoin seedling roots showed molecular weight, amino acid and carbohydrate values similar to that of the seed lectin.
Mann, Benjamin F; Mann, Amanda K P; Skrabalak, Sara E; Novotny, Milos V
2013-02-05
A new, mechanically stable silica microparticle with macrosized internal pores (1.6 μm particles with 100 nm pores) has been developed for chromatography. The particles are characterized by an extensive network of interconnected macropores with a high intraparticle void volume, as observed by transmission electron microscopy (TEM). They are synthesized by an aerosol assembly technique called ultrasonic spray pyrolysis (USP). The particles have a high surface area for a macroporous material, ∼200 m(2)/g, making them suitable for large biomolecular separations. To demonstrate their potential for bioseparations, they have been functionalized with lectins for affinity enrichment of glycoproteins. The material was derivatized with two lectins, Concanavalin A (Con A) and Aleuria aurantia lectin (AAL), and binding properties were tested with standard glycoproteins. The columns exhibited excellent binding capacities for microaffinity enrichment: Con A was able to bind 75 μg of a standard glycoprotein in a 50 × 1 mm column. Following initial tests, the lectin microcolumns were utilized for enrichment of glycoproteins from 1 μL volumes of blood serum samples, performed in triplicate for each lectin. The enriched serum fractions were subjected to side-by-side glycomic and glycoproteomic profiling analyses with mass spectrometry to show that the new particles offer excellent sensitivity for microscale analyses of precious biological sample materials. The unique combination of the macroporous architecture and small particle diameter suggests the material may have advantages for conventional modes of chromatographic separation of macromolecules in an ultra-high-pressure liquid chromatography (UHPLC) format.
PLecDom: a program for identification and analysis of plant lectin domains.
Shridhar, Smriti; Chattopadhyay, Debasis; Yadav, Gitanjali
2009-07-01
PLecDom is a program for detection of Plant Lectin Domains in a polypeptide or EST sequence, followed by a classification of the identified domains into known families. The web server is a collection of plant lectin domain families represented by alignments and profile Hidden Markov Models. PLecDom was developed after a rigorous analysis of evolutionary relationships between available sequences of lectin domains with known specificities. Users can test their sequences for potential lectin domains, catalog the identified domains into broad substrate classes, estimate the extent of divergence of new domains with existing homologs, extract domain boundaries and examine flanking sequences for further analysis. The high prediction accuracy of PLecDom combined with the ease with which it handles large scale input, enabled us to apply the program to protein and EST data from 48 plant genome-sequencing projects in various stages of completion. Our results represent a significant enrichment of the currently annotated plant lectins, and highlight potential targets for biochemical characterization. The search algorithm requires input in fasta format and is designed to process simultaneous connection requests from multiple users, such that huge sets of input sequences can be scanned in a matter of seconds. PLecDom is available at http://www.nipgr.res.in/plecdom.html.
Purification of a lectin from Eugenia uniflora L. seeds and its potential antibacterial activity.
Oliveira, M D L; Andrade, C A S; Santos-Magalhães, N S; Coelho, L C B B; Teixeira, J A; Carneiro-da-Cunha, M G; Correia, M T S
2008-03-01
The aim of this work was to analyse the antimicrobial properties of a purified lectin from Eugenia uniflora L. seeds. The E. uniflora lectin (EuniSL) was isolated from the seed extract and purified by ion-exchange chromatography in DEAE-Sephadex with a purification factor of 11.68. The purified lectin showed a single band on denaturing electrophoresis, with a molecular mass of 67 kDa. EuniSL agglutinated rabbit and human erythrocytes with a higher specificity for rabbit erythrocytes. The haemagglutination was not inhibited by the tested carbohydrates but glycoproteins exerted a strong inhibitory action. The lectin proved to be thermo resistant with the highest stability at pH 6.5 and divalent ions did not affect its activity. EuniSL demonstrated a remarkable nonselective antibacterial activity. EuniSL strongly inhibited the growth of Staphylococcus aureus, Pseudomonas aeruginosa and Klebsiella sp. with a minimum inhibitory concentration (MIC) of 1.5 microg ml(-1), and moderately inhibited the growth of Bacillus subtilis, Streptococcus sp. and Escherichia coli with a MIC of 16.5 microg ml(-1). EuniSL was found to be effective against bacteria. The strong antibacterial activity of the studied lectin indicates a high potential for clinical microbiology and therapeutic applications.
Inhibition of Pasteurella multocida Adhesion to Rabbit Respiratory Epithelium Using Lectins
Directory of Open Access Journals (Sweden)
Magda Patricia Carrillo
2015-01-01
Full Text Available This study aimed to evaluate the ability of a panel of lectins to inhibit the ability of Pasteurella multocida to adhere to and affect the rabbit respiratory epithelium. Nasal septa from rabbit fetuses were cultured with various lectins before the addition of P. multocida. The percentage of bacteria adhering to the epithelium was evaluated semiquantitatively by indirect immunoperoxidase (IIP staining. The goblet cells (GCs were counted in semithin sections stained with toluidine blue and served as the main morphological criterion to evaluate the inhibitory effect of the lectins. The lectins PNA, WGA, RCA120, and DBA significantly inhibited the adhesion of P. multocida to the ciliated epithelium P<0.05 and prevented the pathogen-induced increase in the number of GCs P<0.05 compared with those of positive control tissues. In addition, VVA, SJA, UEA I, DSL, SBA, and ECL significantly inhibited the increase in GCs compared with that of the control tissues. The results suggest that less aggressive therapeutic strategies, such as treatment with lectins, may represent alternative approaches to control bacterial respiratory infections.
Characterization and cloning of GNA-like lectin from the mushroom Marasmius oreades.
Shimokawa, Michiko; Fukudome, Ayako; Yamashita, Ryoko; Minami, Yuji; Yagi, Fumio; Tateno, Hiroaki; Hirabayashi, Jun
2012-10-01
A new mannose-recognizing lectin (MOL) was purified on an asialofetuin-column from fruiting bodies of Marasmius oreades grown in Japan. The lectin (MOA) from the fruiting bodies of the same fungi is well known to be a ribosome-inactivating type lectin that recognizes blood-group B sugar. However, in our preliminary investigation, MOA was not found in Japanese fruiting bodies of M. oreades, and instead, MOL was isolated. Gel filtration showed MOL is a homodimer noncovalently associated with two subunits of 13 kDa. The N-terminal sequence of MOL was blocked. The sequence of MOL was determined by cloning from cDNA and by protein sequencing of enzyme-digested peptides. The sequence shows mannose-binding motifs of bulb-type mannose-binding lectins from plants, and similarity to the sequences. Analyses of sugar-binding specificity by hemagglutination inhibition revealed the preference of MOL toward mannose and thyroglobulin, but asialofetuin was the strongest inhibitor of glycoproteins tested. Furthermore, glycan-array analysis showed that the specificity pattern of MOL was different from those of typical mannose-specific lectins. MOL preferred complex-type N-glycans rather than high-mannose N-glycans.
Xu, Jun; Guo, Yijie; Nakamura, Shuichi; Islam, Md Shafiqul; Tomioka, Rintaro; Yoneyama, Hiroshi; Isogai, Emiko
2015-02-01
Mannose-binding lectin (MBL) plays key role in lectin pathway of innate immunity, and shows the ability of triggering opsonization intermediately. Substantial increase in the serum level of MBL has been confirmed during leptospirosis, which caused by a pathogenic spirochete, Leptospira. Leptospira has a fascinating locomotion pattern, which simultaneously gyrating and swimming forward, such motility enables that Leptospira is difficult to be captured by immune cells if without any assistance. In this study, the effect of mannose-binding lectin to Leptospira was quantitatively investigated by measuring some kinematic parameters, to discover the mechanism behind MBL-mediated immune responses during leptospiral infection. The results showed that mannose-binding lectin is capable of inhibiting the motility of Leptospira by transforming free swimming cells to tumbled rotating cells, resulted in the increase number of rotating cells. Otherwise, decrease in rotation rate of rotating cell has been observed. However, the swimming speed of swimming Leptospira cells showed no observable change under the effect of MBL. The inhibitory effect were only valid in a relatively short period, Leptospira cells regained their original motility after 2 h. This raises an interesting topic that Leptospira is somehow able to escape from the inhibitory effect of MBL by dragging such unfavorable molecules toward to the cell end and eventually throwing it out. The inhibitory effect of MBL on the motility of Leptospira is expected to provide a new insight into lectin pathway. Copyright © 2015 Elsevier GmbH. All rights reserved.
Receptors of garlic (Allium sativum) lectins and their role in insecticidal action.
Upadhyay, Santosh K; Singh, Pradhyumna K
2012-08-01
Garlic (Allium sativum) lectins are promising candidate molecules for the protection against chewing (lepidopteran) as well as sap sucking (homopteran) insect pests. Molecular mechanism of toxicity and interaction of lectins with midgut receptor proteins has been described in many reports. Lectins show its effect right from sensory receptors of mouth parts by disrupting the membrane integrity and food detection ability. Subsequently, enter into the gut lumen and interact with midgut glycosylated proteins like alkaline phosphatase (ALP), aminopeptidase-N (APN), cadherin-like proteins, polycalins, sucrase, symbionin and others. These proteins play critical role in life cycle of insect directly or indirectly. Lectins interfere with the activity of these proteins and causes physiological disorders leading to the death of insects. Lectins further transported across the insect gut, accumulated in various body parts (like haemolymph and ovary) and interact with intracellular proteins like symbionin and cytochrome p450. Binding with cytochrome p450 (which involve in ecdysone synthesis) might interfere in the development of insects, which results in growth retardation and pre-mature death.
Targeting the Immune System with Plant Lectins to Combat Microbial Infections
Directory of Open Access Journals (Sweden)
Jannyson J. B. Jandú
2017-10-01
Full Text Available The arsenal of drugs available to treat infections caused by eukaryotic and prokaryotic microbes has been declining exponentially due to antimicrobial resistance phenomenon, leading to an urgent need to develop new therapeutic strategies. Host-directed immunotherapy has been reported as an attractive option to treat microbial infections. It consists in the improvement of host defenses by increasing the expression of inflammatory mediators and/or controlling of inflammation-induced tissue injury. Although the in vitro antimicrobial and immunomodulatory activities of lectins have been extensively demonstrated, few studies have evaluated their in vivo effects on experimental models of infections. This review aims to highlight the experimental use of immunomodulatory plant lectins to improve the host immune response against microbial infections. Lectins have been used in vivo both prophylactically and therapeutically resulting in the increased survival of mice under microbial challenge. Other studies successfully demonstrated that lectins could be used in combination with parasite antigens in order to induce a more efficient immunization. Therefore, these plant lectins represent new candidates for management of microbial infections. Furthermore, immunotherapeutic studies have improved our knowledge about the mechanisms involved in host–pathogen interactions, and may also help in the discovery of new drug targets.
Schalla, W O; Rice, R J; Biddle, J W; Jeanlouis, Y; Larsen, S A; Whittington, W L
1985-01-01
A total of 40 Neisseria gonorrhoeae isolates, representing 19 penicillin-resistant isolates (from 8 heterosexual patients and 11 homosexual patients) and 21 penicillin-susceptible isolates (from 15 heterosexual patients and 6 homosexual patients) and obtained from the same geographic area, were examined. Lectin agglutination patterns were based on the reactivity of the isolates with the following 14 lectins: concanavalin A, Lens culinaris, Trichosanthes kinlowii, Griffonia simplicifolia I, Arachis hypogeae (peanut agglutinin), Glycine max (soybean agglutinin), Dolichos bifloris, Griffonia simplicifolia II, Solanum tuberosum (potato starch agglutinin), Triticum vulgaris (wheat germ agglutinin), Limax flavus, Phaseolus vulgaris, Ulex europaeus I, and Lotus tetragonolobus. All isolates were serotyped with monoclonal antibodies specific for gonococcal outer membrane protein I and auxotyped, and the plasmid content was determined. Resistant patient isolates were selected for their decreased penicillin susceptibility, and control isolates were selected for their penicillin susceptibility. Even though the patient isolates demonstrated resistance to penicillin, no phenotypic differences in lectin-grouping patterns were demonstrated between the two study groups; i.e., two predominant lectin groups were observed. No resistance-associated plasmids were detected. All patient isolates were serogroup IB (serovars IB-1, IB-2, and IB-4), whereas 12 of 21 control isolates were serogroup IA (P less than 0.05). Isolates obtained from different anatomical sites in the same patient (cervical and rectal) agreed with regard to lectin patterns and serovars but not auxotypes. PMID:3935658
Inhibition of Pasteurella multocida Adhesion to Rabbit Respiratory Epithelium Using Lectins
Carrillo, Magda Patricia; Martinez, Nhora María; Patiño, María del Pilar; Iregui, Carlos Arturo
2015-01-01
This study aimed to evaluate the ability of a panel of lectins to inhibit the ability of Pasteurella multocida to adhere to and affect the rabbit respiratory epithelium. Nasal septa from rabbit fetuses were cultured with various lectins before the addition of P. multocida. The percentage of bacteria adhering to the epithelium was evaluated semiquantitatively by indirect immunoperoxidase (IIP) staining. The goblet cells (GCs) were counted in semithin sections stained with toluidine blue and served as the main morphological criterion to evaluate the inhibitory effect of the lectins. The lectins PNA, WGA, RCA120, and DBA significantly inhibited the adhesion of P. multocida to the ciliated epithelium (P < 0.05) and prevented the pathogen-induced increase in the number of GCs (P < 0.05) compared with those of positive control tissues. In addition, VVA, SJA, UEA I, DSL, SBA, and ECL significantly inhibited the increase in GCs compared with that of the control tissues. The results suggest that less aggressive therapeutic strategies, such as treatment with lectins, may represent alternative approaches to control bacterial respiratory infections. PMID:25810949
Cavada, Benildo Sousa; Araripe, David Alencar; Silva, Ivanice Bezerra; Pinto-Junior, Vanir Reis; Osterne, Vinicius Jose Silva; Neco, Antonio Hadson Bastos; Laranjeira, Eva Pollyanna Peixe; Lossio, Claudia Figueiredo; Correia, Jorge Luis Almeida; Pires, Alana Freitas; Assreuy, Ana Maria Sampaio; Nascimento, Kyria Santiago
2018-02-01
A native lectin (nPELa), purified from seeds of the species Platypodium elegans, Dalbergieae tribe, was crystallized and structurally characterized by X-ray diffraction crystallography and bioinformatics tools. The obtained crystals diffracted to 1.6Å resolution, and nPELa structure were solved through molecular substitution. In addition, nPELa has a metal binding site and a conserved carbohydrate recognition domain (CRD) similar to other Dalbergieae tribe lectins, such as PAL (Pterocarpus angolensis) and CTL (Centrolobium tomentosum). Molecular docking analysis indicated high affinity of this lectin for different mannosides, mainly trimannosides, formed by α-1,3 or α-1,6 glycosidic bond, as evidenced by the obtained scores. In addition, molecular dynamics simulations were performed to demonstrate the structural behavior of nPELa in aqueous solution. In solution, nPELa was highly stable, and structural modifications in its carbohydrate recognition site allowed interaction between the lectin and the different ligands. Different modifications were observed during simulations for each one of the glycans, which included different hydrogen bonds and hydrophobic interactions through changes in the relevant residues. In addition, nPELa was evaluated for its nociceptive activity in mice and was reported to be the first lectin of the Dalbergieae tribe to show CRD-dependent hypernociceptive activity. Copyright © 2017 Elsevier B.V. All rights reserved.
Lectins from bulbs of the Chinese daffodil Narcissus tazetta (family Amaryllidaceae).
Ooi, L S; Ng, T B; Geng, Y; Ooi, V E
2000-01-01
The isolation of three lectins with similar N-terminal amino acid sequences from the bulbs of the Chinese daffodil Narcissus tazetta was achieved. The isolation protocol involved ion exchange chromatography on DEAE-cellulose, affinity chromatography on mannose-agarose, and fast protein liquid chromatography-gel filtration on Superose 12. The lectins were all adsorbed on mannose-agarose and demonstrated a single band with a molecular weight of 13 kDa in SDS-polyacrylamide gel electrophoresis and a single 26 kDa peak in gel filtration, indicating that they were mannose-binding, dimeric proteins. The lectins differed in hemagglutinating activity, with the magnitude of the activity correlating with the ionic strength of the buffer required to elute the lectin from the DEAE-cellulose column. The bulb lectin did not exert potent cytotoxicity against cancer cell lines or fetal bovine lung cells but inhibited syncytium formation in, and reinstated viability of, fetal bovine lung cells infected with bovine immunodeficiency virus.
Roos, Anja; Garred, Peter; Wildenberg, Manon E.; Lynch, Nicholas J.; Munoz, Jeric R.; Zuiverloon, Tahlita C. M.; Bouwman, Lee H.; Schlagwein, Nicole; Fallaux van den Houten, Francien C.; Faber-Krol, Maria C.; Madsen, Hans O.; Schwaeble, Wilhelm J.; Matsushita, Misao; Fujita, Teizo; Daha, Mohamed R.
2004-01-01
Deficiency of mannose-binding lectin (MBL), a recognition molecule of the lectin pathway of complement, is associated with increased susceptibility to infections. The high frequency of MBL deficiency suggests that defective MBL-mediated innate immunity can be compensated by alternative defense
Chicken Mannose-binding lectin (MBL) gene variants with influence on MBL serum concentration
DEFF Research Database (Denmark)
Kjærup, Rikke Munkholm; Norup, Liselotte Rothmann; Skjødt, Karsten
2013-01-01
Mannose-binding lectin (MBL) plays a major role in the innate immune defence by activating the lectin complement pathway or by acting as an opsonin. Two forms of MBL have been characterised from several species, but for humans and chickens, only one form of functional MBL has been described...
DEFF Research Database (Denmark)
Sandoval, José Raul; Madsen, Hans O; De Stefano, Gianfranco
2014-01-01
Mannose-binding lectin (MBL) is one of the five recognition molecules in the lectin complement pathway. Common variant alleles in the promoter and structural regions of the human MBL gene (MBL2) influence the stability and serum concentration of the protein. Epidemiological studies have shown tha...
Directory of Open Access Journals (Sweden)
Mayron Alves Vasconcelos
2014-01-01
Full Text Available This study aimed to evaluate the abilities of plant and algae lectins to inhibit planktonic growth and biofilm formation in bacteria and yeasts. Initially, ten lectins were tested on Staphylococcus epidermidis, Staphylococcus aureus, Klebsiella oxytoca, Pseudomonas aeruginosa, Candida albicans, and C. tropicalis at concentrations of 31.25 to 250 μg/mL. The lectins from Cratylia floribunda (CFL, Vatairea macrocarpa (VML, Bauhinia bauhinioides (BBL, Bryothamnion seaforthii (BSL, and Hypnea musciformis (HML showed activities against at least one microorganism. Biofilm formation in the presence of the lectins was also evaluated; after 24 h of incubation with the lectins, the biofilms were analyzed by quantifying the biomass (by crystal violet staining and by enumerating the viable cells (colony-forming units. The lectins reduced the biofilm biomass and/or the number of viable cells to differing degrees depending on the microorganism tested, demonstrating the different characteristics of the lectins. These findings indicate that the lectins tested in this study may be natural alternative antimicrobial agents; however, further studies are required to better elucidate the functional use of these proteins.
Naik, Sanjay; Rawat, Ravindra Singh; Khandai, Santripti; Kumar, Mukesh; Jena, Sidhartha S; Vijayalakshmi, Mookambeswaran A; Kumar, Sanjit
2017-12-01
This work describes purification and characterisation of a monocot mannose-specific lectin from Hyacinth bulbs. The purified lectin has a molecular mass of ∼30kDa in reducing as well as in non-reducing SDS-PAGE. In hydrodynamic studies by Dynamic Light Scattering (DLS) showed that purified lectin was monomeric in nature with a molecular size of 2.38±0.03nm. Agglutination activity of purified lectin was confirmed by rabbit erythrocytes and its agglutination activity was inhibited by d-mannose and a glycoprotein (ovalbumin). Glycoprotein nature of purified lectin was confirmed by Periodic Acid Schiff's (PAS) stain. Purified lectin showed moderate pH and thermal stability by retaining hemagglutination activity from pH 6-8 and temperature up to 60°C. It also suppressed the growth of human colon cancer cells (Caco-2) and cervical cancer cells (HeLa) with IC50 values of 127μg/mL and 158μg/mL respectively, after 24-h treatment. Morphological studies of treated cells (Caco-2 and HeLa) with hyacinth lectin by AO/EB dual staining indicated that purified lectin is capable of inducing apoptosis. Copyright © 2017 Elsevier B.V. All rights reserved.
Manalo, Trina; May, Adam; Quinn, Joshua; Lafontant, Dominique S.; Shifatu, Olubusola; He, Wei; Gonzalez-Rosa, Juan M.; Burns, Geoffrey C.; Burns, Caroline E.; Burns, Alan R.; Lafontant, Pascal J.
2016-01-01
Lectins are carbohydrate-binding proteins commonly used as biochemical and histochemical tools to study glycoconjugate (glycoproteins, glycolipids) expression patterns in cells, tissues, including mammalian hearts. However, lectins have received little attention in zebrafish (Danio rerio) and giant danio (Devario aequipinnatus) heart studies. Here, we sought to determine the binding patterns of six commonly used lectins—wheat germ agglutinin (WGA), Ulex europaeus agglutinin, Bandeiraea simplicifolia lectin (BS lectin), concanavalin A (Con A), Ricinus communis agglutinin I (RCA I), and Lycopersicon esculentum agglutinin (tomato lectin)—in these hearts. Con A showed broad staining in the myocardium. WGA stained cardiac myocyte borders, with binding markedly stronger in the compact heart and bulbus. BS lectin, which stained giant danio coronaries, was used to measure vascular reconstruction during regeneration. However, BS lectin reacted poorly in zebrafish. RCA I stained the compact heart of both fish. Tomato lectin stained the giant danio, and while low reactivity was seen in the zebrafish ventricle, staining was observed in their transitional cardiac myocytes. In addition, we observed unique staining patterns in the developing zebrafish heart. Lectins’ ability to reveal differential glycoconjugate expression in giant danio and zebrafish hearts suggests they can serve as simple but important tools in studies of developing, adult, and regenerating fish hearts. PMID:27680670
Damman, Jeffrey; Kok, Julian L.; Snieder, Harold; Leuvenink, Henri G.; van Goor, Harry; Hillebrands, Jan-Luuk; van Dijk, Marcory C.; Hepkema, Bouke G.; Reznichenko, Anna; van den Born, Jaap; de Borst, Martin H.; Bakker, Stephan J.; Navis, Gerjan J.; Ploeg, Rutger J.; Seelen, Marc A.
In kidney transplantation, complement activation was found to be induced by donor brain death, renal ischemia-reperfusion injury and allograft rejection. There are three known pathways of complement activation: the classical, lectin and the alternative pathway. The lectin complement pathway can be
Shushimita; P. van der Pol (Pieter); R.W.F. de Bruin (Ron); J.N.M. IJzermans (Jan); C. van Kooten (Cees); F.J.M.F. Dor (Frank)
2015-01-01
textabstractPreoperative fasting and dietary restriction offer robust protection against renal ischemia/ reperfusion injury (I/RI) in mice.We recently showed that Mannan-binding lectin (MBL), the initiator of the lectin pathway of complement activation, plays a pivotal role in renal I/RI. Based on
Castillo-Villanueva, Adriana; Caballero-Ortega, Heriberto; Abdullaev-Jafarova, Fikrat; Garfias, Yonathan; del Carmen Jiménez-Martínez, Maria; Bouquelet, Stéphane; Martínez, Gisela; Mendoza-Hernández, Guillermo; Zenteno, Edgar
2007-07-11
Purification of the lectin from Phaseolus acutifolius var. escumite was achieved by affinity chromatography on a column containing glutaraldehyzed membranes from blood group O erythrocytes. The lectin is a tetrameric glycoprotein of 121 kDa with 10% of sugar by weight composed by four subunits of 30 kDa as determined by SDS-PAGE. The lectin is composed of four isolectins as determined by ion-exchange chromatography on a mono-S column. The lectin and its isolectins showed identical NH2 terminal residues (ANDLSFNFQR FNETN) with homology to the PHA leucoagglutinin-precursor. Peptide mass fingerprint from each lectin isoform determined from tryptic peptides by MALDI-TOF (matrix assisted laser desorption ionization-time-of-flight) showed differences among subunits, thus suggesting microheterogeneity in their amino acid sequences or different glycosylation patterns. The lectin and its four isolectins agglutinated erythrocytes without serological specificity and showed mitogenic activity on human leukocytes; moreover, the main effect was rather toward CD8+ than to CD4+ human peripheral lymphocytes. The lectin from escumite was not inhibitable by simple sugars; however, the specificity of the lectin and its isoforms was mainly addressed toward galactose residues present in bi- or triantennary N-acetyllactosamine-type glycans.
Gunput, S.T.G.; Wouters, D.; Nazmi, K.; Cukkemane, N.; Brouwer, M.; Veerman, E.C.I.; Ligtenberg, A.J.M.
2016-01-01
Saliva interacts with blood after mucosal damage or leakage of gingival crevicular fluid. Surface-adsorbed salivary agglutinin (SAG) activates the lectin pathway (LP) of the complement system via mannose-binding lectin, while SAG in solution inhibits complement activation. In the present study we
Directory of Open Access Journals (Sweden)
RL Martins-Souza
2006-10-01
Full Text Available Lectins/carbohydrate binding can be involved in the Schistosoma mansoni recognition and activation of the Biomphalaria hemocytes. Therefore, expression of lectin ligands on Biomphalaria hemocytes would be associated with snail resistance against S. mansoni infection. To test this hypothesis, circulating hemocytes were isolated from B. glabrata BH (snail strain highy susceptible to S. mansoni, B. tenagophila Cabo Frio (moderate susceptibility, and B. tenagophila Taim (completely resistant strains, labelled with FITC conjugated lectins (ConA, PNA, SBA, and WGA and analyzed under fluorescence microscopy. The results demonstrated that although lectin-labelled hemocytes were detected in hemolymph of all snail species tested, circulating hemocytes from both strains of B. tenagophila showed a larger number of lectin-labelled cells than B. glabrata. Moreover, most of circulating hemocytes of B. tenagophila were intensively labelled by lectins PNA-FITC and WGA-FITC, while in B. glabrata small hemocytes were labeled mainly by ConA. Upon S. mansoni infection, lectin-labelled hemocytes almost disappeared from the hemolymph of Taim and accumulated in B. glabrata BH. The role of lectins/carbohydrate binding in resistance of B. tengophila infection to S. mansoni is still not fully understood, but the data suggest that there may be a correlation to its presence with susceptibility or resistance to the parasite.
DEFF Research Database (Denmark)
Ytting, Henriette; Christensen, Ib Jarle; Thiel, Steffen
2005-01-01
PURPOSE: Mannan-binding lectin-associated serine protease 2 (MASP-2) is a plasma protein involved in inflammatory processes. MASP-2 circulates in complex with the protein mannan-binding lectin (MBL) or ficolins, and is activated to recruit the complement system when MBL binds to its targets...
Damman, J.; Kok, J.L.; Snieder, H.; Leuvenink, H.G.; Goor, H. van; Hillebrands, J.L.; Dijk, M.C.R.F. van; Hepkema, B.G.; Reznichenko, A.; Born, J. van den; Borst, M.H. de; Bakker, S.J.; Navis, G.J.; Ploeg, R.J.; Seelen, M.A.
2012-01-01
In kidney transplantation, complement activation was found to be induced by donor brain death, renal ischemia-reperfusion injury and allograft rejection. There are three known pathways of complement activation: the classical, lectin and the alternative pathway. The lectin complement pathway can be
Meijvis, Sabine C. A.; Herpers, Bjorn L.; Endeman, Henrik; de Jong, Ben; van Hannen, Erik; van Velzen-Blad, Heleen; Krediet, Raymond T.; Struijk, Dirk G.; Biesma, Douwe H.; Bos, Willem Jan W.
Background. Mannose-binding lectin (MBL) and ficolin-2 (FCN) are activators of the lectin pathway of complement and act as primary defences against infection. Single-nucleotide polymorphisms (SNPs) in the MBL2 and FCN2 genes influence the functionality of the proteins. Both proteins are capable of
Li, Yan; Xu, Shan-Shan; Gao, Jing; Pan, Sha; Wang, Gen-Xuan
2014-01-01
Reactive oxygen species (ROS) have been established to participate in stomatal closure induced by live microbes and microbe-associated molecular patterns (MAMPs). Chlorella as a beneficial microorganism can be expected to trigger stomatal closure via ROS production. Here, we reported that Chlorella induced stomatal closure in a dose-and time-dependent manner in epidermal peels of Vicia faba. Using pharmacological methods in this work, we found that the Chlorella-induced stomatal closure was almost completely abolished by a hydrogen peroxide (H2O2) scavenger, catalase (CAT), significantly suppressed by an NADPH oxidase inhibitor, diphenylene iodonium chloride (DPI), and slightly affected by a peroxidase inhibitor, salicylhydroxamic acid (SHAM), suggesting that ROS production involved in Chlorella-induced stomatal closure is mainly mediated by DPI-sensitive NADPH oxidase. Additionally, Exogenous application of optimal concentrations of Chlorella suspension improved instantaneous water use efficiency (WUEi) in Vicia faba via a reduction in leaf transpiration rate (E) without a parallel reduction in net photosynthetic rate (Pn) assessed by gas-exchange measurements. The chlorophyll fluorescence and content analysis further demonstrated that short-term use of Chlorella did not influence plant photosynthetic reactions center. These results preliminarily reveal that Chlorella can trigger stomatal closure via NADPH oxidase-dependent ROS production in epidermal strips and improve WUEi in leave levels.
Directory of Open Access Journals (Sweden)
Ann M. Hirsch
2013-09-01
Full Text Available Two strains, 30N-5 and 30VD-1, identified as Bacillus simplex and B. subtilis, were isolated from the rhizospheres of two different plants, a Podocarpus and a palm, respectively, growing in the University of California, Los Angeles (UCLA Mildred E. Mathias Botanical Garden. B. subtilis is a well-known plant-growth promoting bacterial species, but B. simplex is not. B. simplex 30N-5 was initially isolated on a nitrogen-free medium, but no evidence for nitrogen fixation was found. Nevertheless, pea plants inoculated with B. simplex showed a change in root architecture due to the emergence of more lateral roots. When Pisum sativum carrying a DR5::GUSA construct, an indicator for auxin response, was inoculated with either B. simplex 30N-5 or its symbiont Rhizobium leguminosarum bv. viciae 128C53, GUS expression in the roots was increased over the uninoculated controls. Moreover, when pea roots were coinoculated with either B. simplex 30N-5 or B. subtilis 30VD-1 and R. leguminosarum bv. viciae 128C53, the nodules were larger, clustered, and developed more highly branched vascular bundles. Besides producing siderophores and solubilizing phosphate, the two Bacillus spp., especially strain 30VD-1, exhibited anti-fungal activity towards Fusarium. Our data show that combining nodulating, nitrogen-fixing rhizobia with growth-promoting bacteria enhances plant development and strongly supports a coinoculation strategy to improve nitrogen fixation, increase biomass, and establish greater resistance to fungal disease.
Villadas, Pablo J; Lasa, Ana V; Martínez-Hidalgo, Pilar; Flores-Félix, José David; Martínez-Molina, Eustoquio; Toro, Nicolás; Velázquez, Encarna; Fernández-López, Manuel
2017-03-01
Forest fires lead to the annual disappearance of many natural formations that require the creation of firewall areas. They can be maintained by enriching their pastures with attractive plants for grazing livestock, mainly legumes, which have a high protein content and low dependence on N fertilizers due to their ability to establish nitrogen-fixing symbiosis with rhizobia. In this study, the rhizobia isolated from the nodules of six legumes from the genera Vicia, Lathyrus and Trifolium were analysed in a firewall zone established in Lanjarón (Granada) close to the Sierra Nevada National Park (Spain). The results showed a high genetic diversity of the isolated strains that had 3, 16, 14 and 13 different types of rrs, recA, atpD and glnII genes, respectively. All strains were phylogenetically close to the species from the Rhizobium leguminosarum group, although they were not identified as any of them. The isolated strains belonged to the symbiovars viciae and trifolii but high phylogenetic diversity was found within both symbiovars, since there were 16 and 14 nodC gene types, respectively. Some of these strains clustered with strains isolated in other countries and continents, but others formed atpD, recA, glnII and nodC clusters and lineages only found to date in this study. Copyright © 2016 Elsevier GmbH. All rights reserved.
Corrêa, Albertina X R; Cotelle, Sylvie; Millet, Maurice; Somensi, Cleder A; Wagner, Theodoro M; Radetski, Claudemir M
2016-05-01
Diesel exhaust particulate matter (PM) can have an impact on the environment due to its chemical constitution. A large number of substances such as organic compounds, sulfates, nitrogen derivatives and metals are adsorbed to the particles and desorption of these contaminants could promote genotoxic effects. The objective of this study was to assess the in vivo genotoxicity profile of diesel exhaust PM from heavy-duty engines. Extracts were obtained through leaching with pure water and chemical extraction using three organic solvents (dichloromethane, hexane, and acetone). The in vivo Vicia faba micronucleus test (ISO 29200 protocol) was used to assess the environmental impact of the samples collected from diesel exhaust PM. The solid diesel PM (soot) dissolved in water, and the different extracts, showed positive results for micronucleus formation. After the addition of EDTA, the aqueous extracts did not show a genotoxic effect. The absence of metals in the organic solvent extract indicated that organic compounds also had a genotoxic effect, which was not observed for a similar sample cleaned in a C18 column. Thus, considering the ecological importance of higher plants in relation to ecosystems (in contrast to Salmonella spp., which are commonly used in mutagenicity studies), the Vicia micronucleus test was demonstrated to be appropriate for complementing prokaryotic or in vitro tests on diesel exhaust particulate matter included in risk assessments. Copyright © 2016 Elsevier Inc. All rights reserved.
Modulation of ovomucoid-specific oral tolerance in mice fed plant extracts containing lectins
DEFF Research Database (Denmark)
Kjær, Tanja; Frøkiær, Hanne
2002-01-01
We investigated the effect of feeding extracts of four different legumes (red kidney bean (Phaseolus vulgaris), peanut (Arachis hypogaea), soyabean (Glycine max) and pea (Pisum sativum) on the specific immune response against a food protein. Mice were fed ovomucoid and the specific immune response...... was evaluated. Ovomucoid fed alone resulted in oral tolerance induction measured as both a reduced ovomucoid-pecific spleen cell proliferation and antibody response. Feeding kidney-bean extract prevented induction of oral tolerance to ovomucoid measured as spleen cell proliferation in vitro. Pure kidney......-bean lectin also prevented oral tolerance induction, suggesting that lectin in the kidney-bean extract caused inhibition of oral tolerance. Parenteral administration (intravenous and intraperitoneal) of pure kidney-bean lectin had no significant influence on oral tolerance induction. Soyabean extract also...
Evidence of gene conversion in genes encoding the Gal/GalNac lectin complex of Entamoeba.
Directory of Open Access Journals (Sweden)
Gareth D Weedall
2011-06-01
Full Text Available The human gut parasite Entamoeba histolytica, uses a lectin complex on its cell surface to bind to mucin and to ligands on the intestinal epithelia. Binding to mucin is necessary for colonisation and binding to intestinal epithelia for invasion, therefore blocking this binding may protect against amoebiasis. Acquired protective immunity raised against the lectin complex should create a selection pressure to change the amino acid sequence of lectin genes in order to avoid future detection. We present evidence that gene conversion has occurred in lineages leading to E. histolytica strain HM1:IMSS and E. dispar strain SAW760. This evolutionary mechanism generates diversity and could contribute to immune evasion by the parasites.
Toward a structure-based comprehension of the lectin pathway of complement
DEFF Research Database (Denmark)
Kjaer, Troels R; Thiel, Steffen; Andersen, Gregers R
2013-01-01
To initiate the lectin pathway of complement pattern recognition molecules bind to surface-linked carbohydrates or acetyl groups on pathogens or damaged self-tissue. This leads to activation of the serine proteases MASP-1 and MASP-2 resulting in deposition of C4 on the activator and assembly...... concerning the lectin pathway proteins and derive overall models for their glycan bound complexes. These models are used to discuss cis- versus trans-activation of MASP proteases and the geometry of C4 deposition occurring on glycans in the lectin pathway...... of the C3 convertase. In addition MASP-3 and the non-catalytic MAp19 and MAp44 presumably play regulatory functions, but the exact function of the MASP-3 protease remains to be established. Recent functional studies have significantly advanced our understanding of the molecular events occurring...
Soybean Lectin Enhances Biofilm Formation by Bradyrhizobium japonicum in the Absence of Plants
Directory of Open Access Journals (Sweden)
Julieta Pérez-Giménez
2009-01-01
Full Text Available Soybean lectin (SBL purified from soybean seeds by affinity chromatography strongly bound to Bradyrhizobium japonicum USDA 110 cell surface. This lectin enhanced biofilm formation by B. japonicum in a concentration-dependent manner. Presence of galactose during biofilm formation had different effects in the presence or absence of SBL. Biofilms were completely inhibited in the presence of both SBL and galactose, while in the absence of SBL, galactose was less inhibitory. SBL was very stable, since its agglutinating activity of B. japonicum cells as well as of human group A+ erythrocytes was resistant to preincubation for one week at 60°C. Hence, we propose that plant remnants might constitute a source of this lectin, which might remain active in soil and thus favor B. japonicum biofilm formation in the interval between soybean crop seasons.
Albuquerque, Lidiane Pereira de; Santana, Giselly Maria de Sá; Napoleão, Thiago Henrique; Coelho, Luana Cassandra Breitenbach Barroso; Silva, Márcia Vanusa da; Paiva, Patrícia Maria Guedes
2014-01-01
Fusarium oxysporum f. sp. lycopersici races 1, 2, and 3 deteriorate tomato crops since they cause a vascular wilt. Lectins are carbohydrate-binding proteins with hemagglutinating and antifungal activities. This work reports that Microgramma vacciniifolia rhizome lectin (MvRL) inhibits F. oxysporum f. sp. lycopersici race 3 growth (61 %) more intensely than of races 1 (55 %) and 2 (45 %). The hemagglutinating activity of MvRL was inhibited by glycoprotein preparations from mycelia of races 1, 2, and 3, and these data indicate that lectin carbohydrate-binding sites recognized glycosylated molecules from races. Inter-simple sequence repeat (ISSR) marker system showed that race 3 is genetically distinct from races 1 and 2, and thus the highest sensitiveness of F. oxysporum f. sp. lycopersici race 3 to MvRL may be due to molecular characteristics of this race.
Solid phase measurements of antibody and lectin binding to xenogenic carbohydrate antigens
DEFF Research Database (Denmark)
Kirkeby, Svend; André, Sabine; Gabius, Hans-Joachim
2004-01-01
a naturally occurring subfraction from human serum, to Galalpha containing neoglycoproteins and mouse laminin that were immobilized on microtiter plates. RESULTS: Galalpha reactive antibodies with similar monosaccharide specificity have distinct structural preference for sugar ligands. Laminin...... and neoglycoproteins were treated with alpha-galactosidase and subsequently incubated with antibodies and lectins. The enzyme treatment was more deleterious on antibody binding than on lectin binding. CONCLUSION: Antibodies and lectins may bind to different galactose determinants on the glycoproteins. Two anti......-Galalpha1 antibodies that both have been raised against glycans on rabbit red blood cells may recognize Galalpha-antigens with varying specificities. Binding results obtained after digestion with alpha-galactosidase indicate that some xenoreactive Galalpha groups are not directly accessible for removal...
Antimicrobial properties of avian eggshell-specific C-type lectin-like proteins.
Wellman-Labadie, Olivier; Lakshminarayanan, Rajamani; Hincke, Maxwell T
2008-03-05
C-type lectin-like proteins are major components of the calcified eggshell of multiple avian species. In this study, two representative avian C-type lectin-like proteins, ovocleidin-17 and ansocalcin, were purified from decalcified chicken and goose eggshell protein extracts and investigated for carbohydrate binding activity as well as antimicrobial activity. Purified ovocleidin-17 and ansocalcin were found to bind bacterial polysaccharides, and were bactericidal against Bacillus subtilis, Staphylococcus aureus and Pseudomona aeruginosa. Bactericidal activity was found to be enhanced in the presence of calcium but was not dependent on its presence. The results suggest that avian C-type lectin-like proteins may play an important antimicrobial role in defence of the avian embryo.
Directory of Open Access Journals (Sweden)
I Moebedi
2007-04-01
Full Text Available Background: To determine the morphological specifications of the bird schistosomes cercaria from Lymnaea gedrosiana and to detect the surface carbohydrates as receptors for host lectins in the host-parasite relationship systems such as avian schistosomiasis and human cercarial dermatitis. Methods: One hundred ninety two snails collected from Dezful areas in Khuzestan Province, in the south west of Iran, during 2005-2006 were examined for cercariae using shedding and crushing methods. In addition, surface carbohydrates on the cercariae were detected by lentil (Lens culinaris lectins. Results: From the total number of Lymnaea gedrosiana, which examined for bird schistosomes cercaria, 9(4% snails were found to be infected with furcocercus cercaria of the bird schistosomes (probably Gigantobilharzia sp.. Mannose monosaccharide CH2OH (CHOH4CHO as surface carbohydrate was also detected on the cercariae. Conclusion: Mannose carbohydrate on these cercariae may be used as receptor by lectins.
Epidemiology of chronic wound patients and relation to serum levels of mannan-binding lectin
DEFF Research Database (Denmark)
Bitsch, Mikael; Laursen, Inga; Engel, Anne-Mari
2009-01-01
consecutive patients with chronic foot and leg ulcers. A clinical classification of wound- aetiology was performed, and mannan-binding lectin was measured in the sera of patients and healthy controls. The patients presented with 639 wounds altogether; diabetic foot ulcers (309), venous leg ulcers (188......), arterial ulcers (109), and vasculitis (33). The mannan-binding lectin levels of patients with venous leg ulcer, alone or in combination with other types of wounds, differed significantly from the control group, and the frequency of values ulcer...... patients the frequency of values >or= 3000 ng/ml was significantly higher than that of the control group. This suggests a role for the innate immunity in the pathology of venous leg ulcers, and indicates different roles for mannan-binding lectin in the development of ulcers with different aetiologies...
Lectin and alliinase are the predominant proteins in nectar from leek (Allium porrum L.) flowers.
Peumans, W J; Smeets, K; Van Nerum, K; Van Leuven, F; Van Damme, E J
1997-01-01
Analysis of nectar from leek (Allium porrum) flowers by SDS-PAGE revealed the presence of two major polypeptide bands of 50 kDa and 13 kDa, respectively. Using a combination of agglutination tests, enzyme assays and N-terminal sequencing, the polypeptides have been identified as subunits of alliin lyase (alliinase, EC 4.4.1.4) and mannose-binding lectin, respectively. The latter protein is particularly abundant since it represents about 75% of the total nectar protein. Honey produced by bees foraging on flowering leek plants still contains biologically active lectin and alliinase. However, the levels of both proteins are strongly reduced as compared to those in the original nectar. It is evident, therefore, that the lectin as well as the alliinase are inactivated/degraded during the conversion of nectar into honey.
Lectins Labelled with Digoxin as a Novel Tool to Study Glycoconjugates
Directory of Open Access Journals (Sweden)
Jerka Dumić
2002-01-01
Full Text Available In recent years it has become clear that carbohydrate portions of glycoconjugates are performing numerous vital physiological functions in higher organisms. However, since glycobiology is a relatively new science, and carbohydrate structures are highly complex, the continuous development of novel analytical techniques is necessary to support the process of understanding the intricate nature of glycoconjugate structure and function. The introduction of digoxin as a novel tag for labelling of lectins that are being used to analyse glycoconjugates in immunoassay-like techniques is described. Lectins labelled with digoxin have significant advantages over biotin- or digoxigenin-labelled lectins and will hopefully prove to be a useful addition to the repertoire of glycobiological tools.
Franceschini, V; Ciani, F
1992-01-01
Seven biotinylated lectins were utilized as histochemical markers for the study of microglial cells in the brain of Salamandra salamandra. It has been demonstrated that SBA, BSA-I, BSA-I-B4 and RCA120 label the microglial cells and, on the basis of the binding selectivity of the single lectins for specific carbohydrates, it was found that alpha-galactosyl residues are present in high density on the microglial membrane of S. salamandra. The reaction was localized not only to the ramified microglial cells, but also to other round cells without extensions, interpreted as ameboid microglial cells. The results show that lectin binding is a reliable molecular probe for identifying microglial cells in urodels.
Luz, Luciana de Andrade; Silva, Mariana Cristina Cabral; Ferreira, Rodrigo da Silva; Santana, Lucimeire Aparecida; Silva-Lucca, Rosemeire Aparecida; Mentele, Reinhard; Oliva, Maria Luiza Vilela; Paiva, Patricia Maria Guedes; Coelho, Luana Cassandra Breitenbach Barroso
2013-07-01
Lectins are carbohydrate recognition proteins. cMoL, a coagulant Moringa oleifera Lectin, was isolated from seeds of the plant. Structural studies revealed a heat-stable and pH resistant protein with 101 amino acids, 11.67 theoretical pI and 81% similarity with a M. oleifera flocculent protein. Secondary structure content was estimated as 46% α-helix, 12% β-sheets, 17% β-turns and 25% unordered structures belonging to the α/β tertiary structure class. cMoL significantly prolonged the time required for blood coagulation, activated partial thromboplastin (aPTT) and prothrombin times (PT), but was not so effective in prolonging aPTT in asialofetuin presence. cMoL acted as an anticoagulant protein on in vitro blood coagulation parameters and at least on aPTT, the lectin interacted through the carbohydrate recognition domain. Copyright © 2013 Elsevier B.V. All rights reserved.
Gasmi, Leila; Ferré, Juan; Herrero, Salvador
2017-03-01
Lectins are carbohydrate-interacting proteins that play a pivotal role in multiple physiological and developmental aspects of all organisms. They can specifically interact with different bacterial and viral pathogens through carbohydrate-recognition domains (CRD). In addition, lectins are also of biotechnological interest because of their potential use as biosensors for capturing and identifying bacterial species. In this work, three C-type lectins from the Lepidoptera Spodoptera exigua were produced as recombinant proteins and their bacterial agglutination properties were characterized. The lowest protein concentration producing bacterial agglutination against a panel of different Gram+ and Gram- as well as their carbohydrate binding specificities was determined for the three lectins. One of these lectins, BLL2, was able to agglutinate cells from a broad range of bacterial species at an extremely low concentration, becoming a very interesting protein to be used as a biosensor or for other biotechnological applications involving bacterial capture.
Directory of Open Access Journals (Sweden)
Adeel Malik
Full Text Available Lectins play major roles in biological processes such as immune recognition and regulation, inflammatory responses, cytokine signaling, and cell adhesion. Recently, glycan microarrays have shown to play key roles in understanding glycobiology, allowing us to study the relationship between the specificities of glycan binding proteins and their natural ligands at the omics scale. However, one of the drawbacks in utilizing glycan microarray data is the lack of systematic analysis tools to extract information. In this work, we attempt to group various lectins and their interacting carbohydrates by using community-based analysis of a lectin-carbohydrate network. The network consists of 1119 nodes and 16769 edges and we have identified 3 lectins having large degrees of connectivity playing the roles of hubs. The community based network analysis provides an easy way to obtain a general picture of the lectin-glycan interaction and many statistically significant functional groups.
Cervén, C; Stibler, H; Borg, S
1981-01-01
A new method for the determination of terminal sugars in immunologically defined glycoproteins with microheterogeneity in the sugar residue has been developed. The method has been elaborated for transferrin and involves the following three steps: 1. Binding of antitransferrin antibodies to cyanogen bromide activated Sepharose. 2. Adsorption to the antitransferrin gel of transferrin from serum or from standard solutions of defined composition of terminal glycoprotein sugars. 3. Adsorption of a 125I - labelled lectin to the Sepharose-antitransferrin-transferrin complex. A galactose-binding lectin from Crotalaria juncea and a sialic acid-binding lectin from Limulus polyphemus have been successfully labelled with the Bolton-Hunter reagent and used in the radio-lectin immunoassay determinations. Care must be taken that significant amounts of lectins are not lost from the transferrin complex during washing. The resolving power of the method was at best 20 pmoles of asialotransferrin, a figure that probably can be improved significantly by optimizing the assay conditions.
Gauthier, J.D.; Jenkins, J.A.; La Peyre, Jerome F.
2004-01-01
Parasite surface glycoconjugates are frequently involved in cellular recognition and colonization of the host. This study reports on the identification of Perkinsus marinus surface carbohydrates by flow cytometric analyses of fluorescein isothiocyanate-conjugated lectin binding. Lectin-binding specificity was confirmed by sugar inhibition and Kolmogorov-Smirnov statistics. Clear, measurable fluorescence peaks were discriminated, and no parasite autofluorescence was observed. Parasites (GTLA-5 and Perkinsus-1 strains) harvested during log and stationary phases of growth in a protein-free medium reacted strongly with concanavalin A and wheat germ agglutinin, which bind to glucose-mannose and N-acetyl-D-glucosamine (GlcNAc) moieties, respectively. Both P. marinus strains bound with lower intensity to Maclura pomifera agglutinin, Bauhinia purpurea agglutinin, soybean agglutinin (N-acetyl-D-galactosamine-specific lectins), peanut agglutinin (PNA) (terminal galactose specific), and Griffonia simplicifolia II (GlcNAc specific). Only background fluorescence levels were detected with Ulex europaeus agglutinin I (L-fucose specific) and Limulus polyphemus agglutinin (sialic acid specific). The lectin-binding profiles were similar for the 2 strains except for a greater relative binding intensity of PNA for Perkinsus-1 and an overall greater lectin-binding capacity of Perkinsus-1 compared with GTLA-5. Growth stage comparisons revealed increased lectin-binding intensities during stationary phase compared with log phase of growth. This is the first report of the identification of surface glycoconjugates on a Perkinsus spp. by flow cytometry and the first to demonstrate that differential surface sugar expression is growth phase and strain dependent. ?? American Society of Parasitologists 2004.
A novel core fucose-specific lectin from the mushroom Pholiota squarrosa.
Kobayashi, Yuka; Tateno, Hiroaki; Dohra, Hideo; Moriwaki, Kenta; Miyoshi, Eiji; Hirabayashi, Jun; Kawagishi, Hirokazu
2012-10-05
Fucα1-6 oligosaccharide has a variety of biological functions and serves as a biomarker for hepatocellular carcinoma because of the elevated presence of fucosylated α-fetoprotein (AFP) in this type of cancer. In this study we purified a novel Fucα1-6-specific lectin from the mushroom Pholiota squarrosa by ion-exchange chromatography and affinity chromatography on thyroglobulin-agarose. The purified lectin was designated as PhoSL (P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa and consists of 40 amino acids (NH(2)-APVPVTKLVCDGDTYKCTAYLDFGDGRWVAQWDTNVFHTG-OH). Isoelectric focusing of the lectin showed bands near pI 4.0. The lectin activity was stable between pH 2.0 and 11.0 and at temperatures ranging from 0 to 100 °C for incubation times of 30 min. When PhoSL was investigated with frontal affinity chromatography using 132 pyridylaminated oligosaccharides, it was found that the lectin binds only to core α1-6-fucosylated N-glycans and not to other types of fucosylated oligosaccharides, such as α1-2-, α1-3-, and α1-4-fucosylated glycans. Furthermore, PhoSL bound to α1-6-fucosylated AFP but not to non-fucosylated AFP. In addition, PhoSL was able to demonstrate the differential expression of α1-6 fucosylation between primary and metastatic colon cancer tissues. Thus, PhoSL will be a promising tool for analyzing the biological functions of α1-6 fucosylation and evaluating Fucα1-6 oligosaccharides as cancer biomarkers.
Wu, A M; Wu, J H; Chen, Y Y; Song, S C; Kabat, E A
1999-11-01
Bandeiraea (Griffonia) simplicifolia lectin-I, isolectin A(4)(GS I-A(4)), which is cytotoxic to the human colon cancer cell lines, is one of two lectin families derived from its seed extract. It contains only a homo-oligomer of subunit A, and is most specific for GalNAcalpha1-->. In order to elucidate the GS I-A(4)-glycoconjugate interactions in greater detail, the combining site of this lectin was further characterized by enzyme linked lectino-sorbent assay (ELLSA) and by inhibition of lectin-glycoprotein interactions. This study has demonstrated that the Tn-containing glycoproteins tested, consisting of mammalian salivary glycoproteins (armadillo, asialo-hamster sublingual, asialo-ovine, -bovine, and -porcine submandibular), are bound strongly by GS I-A(4.)Among monovalent inhibitors so far tested, p-NO2-phenylalphaGalNAc is the most potent, suggesting that hydrophobic forces are important in the interaction of this lectin. GS I-A(4)is able to accommodate the monosaccharide GalNAc at the nonreducing end of oligosaccharides. This suggests that the combining site of the lectin is a shallow cavity. Among oligosaccharides and monosaccharides tested as inhibitors of the binding of GS I-A(4), the hierarchy of potencies are: GalNAcalpha1-->3GalNAcbeta1-->3Galalpha1-->4Galbeta 1-->4Glc (Forssman pentasaccharide) > GalNAcalpha1-->3(LFucalpha1-->2)Gal (blood group A)()> GalNAc > Galalpha1-->4Gal > Galalpha1-->3Gal (blood group B-like)> Gal.
Influence of major surgery on the mannan-binding lectin pathway of innate immunity
DEFF Research Database (Denmark)
Ytting, H.; Christensen, I.J.; Basse, L.
2006-01-01
The mannan-binding lectin (MBL) pathway of complement activation is important in host defence against pathogens and possibly against cancer. We investigated the effect of major surgery on two central components of the MBL pathway; MBL and the MBL-associated serine protease MASP-2, and for compari......The mannan-binding lectin (MBL) pathway of complement activation is important in host defence against pathogens and possibly against cancer. We investigated the effect of major surgery on two central components of the MBL pathway; MBL and the MBL-associated serine protease MASP-2...
Inactivation and fragmentation of lectin from Bothrops leucurus snake venom by gamma irradiation
Nunes, E. S.; Souza, M. A. A.; Vaz, A. F. M.; Coelho, L. C. B. B.; Aguiar, J. S.; Silva, T. G.; Guarnieri, M. C.; Melo, A. M. M. A.; Oliva, M. L. V.; Correia, M. T. S.
2012-04-01
Gamma radiation alters the molecular structure of biomolecules and is able to mitigate the action of snake venoms and their isolated toxins. The effect of γ-radiation on the folding of Bothrops lecurus venom lectin was measured by a hemagglutinating assay, intrinsic and bis-ANS fluorescence. Intrinsic and bis-ANS fluorescence analyses indicated that irradiation caused unfolding followed by aggregation of the lectin. Our results suggest that irradiation can lead to significant changes in the protein structure, which may promote the loss of its binding property and toxic action.
Targeting of macrophage galactose-type C-type lectin (MGL) induces DC signaling and activation
DEFF Research Database (Denmark)
Napoletano, Chiara; Zizzari, Ilaria G; Rughetti, Aurelia
2012-01-01
Dendritic cells (DCs) sense the microenvironment through several types of receptors recognizing pathogen-associated molecular patterns. In particular, C-type lectins, expressed by distinct subsets of DCs, recognize and internalize specific carbohydrate antigen in a Ca(2+) -dependent manner....... Targeting of these receptors is becoming an efficient strategy of delivering antigens in DC-based anticancer immunotherapy. Here we investigated the role of the macrophage galactose type C-lectin receptor (MGL), expressed by immature DCs (iDCs), as a molecular target for a-N-acetylgalactosamine (Gal...
Brinck, U; Bosbach, R; Korabiowska, M; Schauer, A; Gabius, H J
1995-01-01
By using histochemical methods, the binding pattern of various lectins in the epithelium of normal human appendix vermiformis was assessed. In addition to plant and invertebrate sugar receptors with nominal monosaccharide specificity for alpha-L-Fuc (UEA-I), alpha-D-Man and alpha-D-Gluc (Con A), alpha-D-GalNAc (DBA), D-GalNAc (SBA, HPA) beta-D-Gal (RCA-I) and D-Gal (VAA), a mammalian beta-galactoside-specific lectin (MW, 14 kDa) was included in the applied panel. The apical surface of enterocytes presented binding sites for RCA-I on all cells, binding sites of UEA-I, DBA, SBA, HPA and VAA heterogeneously and no binding sites of Con A and 14 kDa. Binding sites of DBA, SBA, HPA, VAA and RCA-I within enterocytes were located primarily focally in a supranuclear position, whereas Con A and 14 kDa bound to the cytoplasm both in apical and basal cell parts. In the follicle-associated epithelium more enterocytes expressed SBA- and VAA-binding sites than in the crypt epithelium. No differences between the lectin-binding pattern of M-cells and enterocytes were found in the follicle-associated epithelium. Intraepithelial macrophages were heterogeneously positive for the full panel of applied lectins. In contrast, intraepithelial lymphatic cells expressed binding sites only for RCA-I and less prominently for Con A, VAA and 14 kDa. Goblet cell mucus contained lectin-binding sites in a heterogeneous manner: binding sites for Con A were not detected in goblet cells for DBA, SBA, VAA and 14 kDa in less than 20%, for UEA-I in 20-40%, for HPA in 40-60% and for RCA-I in 60-100% of the goblet cells. Secreted mucus differed in its lectin-binding capacity from intracellular goblet cell mucus selectively by an increase of UEA-I, SBA- and RCA-I-binding sites and a lack of 14 kDa-binding sites. Comparative study of lectin binding to goblet cell mucin in another region of the large intestine, namely the rectosigmoid, demonstrated that DBA, SBA and 14 kDa bound mainly to the distal colon
Lectin Domains of Polypeptide GalNAc Transferases Exhibit Glycopeptide Binding Specificity
DEFF Research Database (Denmark)
Pedersen, Johannes W; Bennett, Eric P; Schjoldager, Katrine T-B G
2011-01-01
UDP-GalNAc:polypeptide a-N-acetylgalactosaminyltransferases (GalNAc-Ts) constitute a family of up to 20 transferases that initiate mucin-type O-glycosylation. The transferases are structurally composed of catalytic and lectin domains. Two modes have been identified for the selection of glycosylat......UDP-GalNAc:polypeptide a-N-acetylgalactosaminyltransferases (GalNAc-Ts) constitute a family of up to 20 transferases that initiate mucin-type O-glycosylation. The transferases are structurally composed of catalytic and lectin domains. Two modes have been identified for the selection...
Ficolin-3-mediated lectin complement pathway activation in patients with subarachnoid hemorrhage
DEFF Research Database (Denmark)
Zanier, Elisa R; Zangari, Rosalia; Munthe-Fog, Lea
2014-01-01
OBJECTIVES: To assess the involvement of ficolin-3, the main initiator of the lectin complement pathway (LCP), in subarachnoid hemorrhage (SAH) pathology and outcome. METHODS: In this preliminary exploratory study, plasma concentration of ficolin-3 and of ficolin-3-mediated functional LCP activity...... was measured, along with that of other LCP initiators (mannose-binding lectin, ficolin-2, and ficolin-1), C3 activation products, and soluble C5b-9 terminal complex, in a prospective cohort of 39 patients with SAH and 20 healthy controls. The following parameters were recorded: SAH severity, assessed using...
An insecticidal N-acetylglucosamine-specific lectin gene from Griffonia simplicifolia (Leguminosae).
Zhu, K; Huesing, J E; Shade, R E; Bressan, R A; Hasegawa, P M; Murdock, L L
1996-01-01
Griffonia simplicifolia II, an N-acetylglucosamine-specific legume lectin, has insecticidal activity when fed to the cowpea weevil, Callosobruchus maculatus (F.). A cDNA clone encoding G. simplicifolia II was isolated from a leaf cDNA library, sequenced, and expressed in a bacterial expression system. The recombinant protein exhibited N-acetylglucosamine-binding and insecticidal activity against cowpea weevil, indicating that glycosylation and multimeric structure are not required for these properties. These results support the hypothesis that genes of the legume lectin gene family encode proteins that function in plant defense against herbivores.
Carbohydrate composition of peripheral, cultured and leukaemic human lymphocyte plasma membranes.
Newman, R A; Glöckner, W M; Uhlenbruck, G
1978-03-01
Plasma membranes isolated from peripheral blood lymphocytes of normal donors, lymphocytes from patients with chronic lymphatic leukaemia (CLL), a T cell and B cell line (MOLT-3 and RPMI-1788) were analysed and compared for total carbohydrate contents. T cells and peripheral blood lymphocytes contained the highest relative amounts of sialic acid and fucose, whereas chronic lymphatic leukaemic cells possessed the highest amounts of N-acetylgalactosamine and also more total cell surface carbohydrate. The Thomsen-Friedenreich antigen (TF) was detected serologically on membrane fractions by the use of anti-TF containing sera and specific lectins from Arachis hypogaea, Agaricus bisporus and Vicia graminea. The disaccharide beta-D-galactosyl(1-3)-N-acetyl-D-galactosamine is the immunogdominant carbohydrate group of the FT antigen and was detected as its reduced form, by gas chromatography, in all cells, thus correlating serological and analytical evidence. The haemagglutinating activity of the lectins and sera used was only inhibited by plasma membranes after the removal of sialic acid showong that the native form of this antigen is normally masked by sialic acid in CLL cells as well as normal lymphocytes.
DEFF Research Database (Denmark)
Hansen, J E; Nielsen, C; Vestergaard, B F
1991-01-01
Five lectins with specificity for N- and O-linked oligosaccharides were examined for inhibition of HIV-1 and HSV-1 infectivity in vitro. HIV-1 isolate HTLVIIIB was preincubated with lectin and subsequently inoculated onto MT-4 cells. Lectins specific for N-linked oligosaccharides blocked HIV infe......-1 infection, the most potent inhibition was found with the lectin HPA. These results indicate that lectins may have a broad antiviral effect on enveloped viruses only limited by types of oligosaccharides present on individual viruses....
Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina
Directory of Open Access Journals (Sweden)
María Inés Zamar
2012-03-01
Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F
Safronova, Vera I; Kuznetsova, Irina G; Sazanova, Anna L; Belimov, Andrey A; Andronov, Evgeny E; Chirak, Elizaveta R; Osledkin, Yuri S; Onishchuk, Olga P; Kurchak, Oksana N; Shaposhnikov, Alexander I; Willems, Anne; Tikhonovich, Igor A
2017-01-01
Gram-stain-negative strains V5/3MT, V5/5K, V5/5M and V5/13 were isolated from root nodules of Vicia alpestris plants growing in the North Ossetia region (Caucasus). Sequencing of the partial 16S rRNA gene (rrs) and four housekeeping genes (dnaK, gyrB, recA and rpoB) showed that the isolates from V. alpestris were most closely related to the species Microvirga zambiensis (order Rhizobiales, family Methylobacteriaceae) which was described for the single isolate from root nodule of Listia angolensis growing in Zambia. Sequence similarities between the Microvirga-related isolates and M. zambiensis WSM3693T ranged from 98.5 to 98.7 % for rrs and from 79.7 to 95.8 % for housekeeping genes. Cellular fatty acids of the isolates V5/3MT, V5/5K, V5/5M and V5/13 included important amounts of C18 : 1ω7c (54.0-67.2 %), C16 : 0 (6.0-7.8 %), C19 : 0 cyclo ω8c (3.1-10.2 %), summed feature 2 (comprising one or more of iso-C16 : 1 I, C14 : 0 3-OH and unknown ECL 10.938, 5.8-22.5 %) and summed feature 3 (comprising C16 : 1ω7c and/or iso-C15 : 02-OH, 2.9-4.0 %). DNA-DNA hybridization between the isolate V5/3MT and M. zambiensis WSM3693T revealed DNA-DNA relatedness of 35.3 %. Analysis of morphological and physiological features of the novel isolates demonstrated their unique phenotypic profile in comparison with reference strains from closely related species of the genus Microvirga. On the basis of genotypic and phenotypic analysis, a novel species named Microvirga ossetica sp. nov. is proposed. The type strain is V5/3MT (=LMG 29787T=RCAM 02728T). Three additional strains of the species are V5/5K, V5/5M and V5/13.
Effect of Calcium and Potassium on Antioxidant System of Vicia faba L. Under Cadmium Stress
Directory of Open Access Journals (Sweden)
Hayssam M. Ali
2012-05-01
Full Text Available Cadmium (Cd in soil poses a major threat to plant growth and productivity. In the present experiment, we studied the effect of calcium (Ca2+ and/or potassium (K+ on the antioxidant system, accumulation of proline (Pro, malondialdehyde (MDA, and content of photosynthetic pigments, cadmium (Cd and nutrients, i.e., Ca2+ and K+ in leaf of Vicia faba L. (cv. TARA under Cd stress. Plants grown in the presence of Cd exhibited reduced growth traits [root length (RL plant−1, shoot length (SL plant−1, root fresh weight (RFW plant−1, shoot fresh weight (SFW plant−1, root dry weight (RDW plant−1 and shoot dry weight (SDW plant−1] and concentration of Ca2+, K+, Chlorophyll (Chl a and Chl b content, except content of MDA, Cd and (Pro. The antioxidant enzymes [peroxidase (POD and superoxide dismutase (SOD] slightly increased as compared to control under Cd stress. However, a significant improvement was observed in all growth traits and content of Ca2+, K+, Chl a, Chl b ,Pro and activity of antioxidant enzymes catalase (CAT, POD and SOD in plants subjected to Ca2+ and/or K+. The maximum alleviating effect was recorded in the plants grown in medium containing Ca2+ and K+ together. This study indicates that the application of Ca2+ and/or K+ had a significant and synergistic effect on plant growth. Also, application of Ca2+ and/or K+ was highly effective against the toxicity of Cd by improving activity of antioxidant enzymes and solute that led to the enhanced plant growth of faba bean plants.
Lear, Calli; Chen, Li; Yantosca, L. Michael; Scully, Corinne; Sarraju, Ashish; Sokolovska, Anna; Zariffard, M. Reza; Eisen, Damon P.; Mungall, Bruce A.; Kotton, Darrell N.; Omari, Amel; Huang, I-Chueh; Farzan, Michael; Takahashi, Kazue; Stuart, Lynda; Stahl, Gregory L.; Ezekowitz, Alan B.; Spear, Gregory T.; Olinger, Gene G.; Schmidt, Emmett V.; Michelow, Ian C.
2013-01-01
Mannose-binding lectin (MBL) is a key soluble effector of the innate immune system that recognizes pathogen-specific surface glycans. Surprisingly, low-producing MBL genetic variants that may predispose children and immunocompromised individuals to infectious diseases are more common than would be expected in human populations. Since certain immune defense molecules, such as immunoglobulins, can be exploited by invasive pathogens, we hypothesized that MBL might also enhance infections in some circumstances. Consequently, the low and intermediate MBL levels commonly found in human populations might be the result of balancing selection. Using model infection systems with pseudotyped and authentic glycosylated viruses, we demonstrated that MBL indeed enhances infection of Ebola, Hendra, Nipah and West Nile viruses in low complement conditions. Mechanistic studies with Ebola virus (EBOV) glycoprotein pseudotyped lentiviruses confirmed that MBL binds to N-linked glycan epitopes on viral surfaces in a specific manner via the MBL carbohydrate recognition domain, which is necessary for enhanced infection. MBL mediates lipid-raft-dependent macropinocytosis of EBOV via a pathway that appears to require less actin or early endosomal processing compared with the filovirus canonical endocytic pathway. Using a validated RNA interference screen, we identified C1QBP (gC1qR) as a candidate surface receptor that mediates MBL-dependent enhancement of EBOV infection. We also identified dectin-2 (CLEC6A) as a potentially novel candidate attachment factor for EBOV. Our findings support the concept of an innate immune haplotype that represents critical interactions between MBL and complement component C4 genes and that may modify susceptibility or resistance to certain glycosylated pathogens. Therefore, higher levels of native or exogenous MBL could be deleterious in the setting of relative hypocomplementemia which can occur genetically or because of immunodepletion during active
Directory of Open Access Journals (Sweden)
Matthew Brudner
Full Text Available Mannose-binding lectin (MBL is a key soluble effector of the innate immune system that recognizes pathogen-specific surface glycans. Surprisingly, low-producing MBL genetic variants that may predispose children and immunocompromised individuals to infectious diseases are more common than would be expected in human populations. Since certain immune defense molecules, such as immunoglobulins, can be exploited by invasive pathogens, we hypothesized that MBL might also enhance infections in some circumstances. Consequently, the low and intermediate MBL levels commonly found in human populations might be the result of balancing selection. Using model infection systems with pseudotyped and authentic glycosylated viruses, we demonstrated that MBL indeed enhances infection of Ebola, Hendra, Nipah and West Nile viruses in low complement conditions. Mechanistic studies with Ebola virus (EBOV glycoprotein pseudotyped lentiviruses confirmed that MBL binds to N-linked glycan epitopes on viral surfaces in a specific manner via the MBL carbohydrate recognition domain, which is necessary for enhanced infection. MBL mediates lipid-raft-dependent macropinocytosis of EBOV via a pathway that appears to require less actin or early endosomal processing compared with the filovirus canonical endocytic pathway. Using a validated RNA interference screen, we identified C1QBP (gC1qR as a candidate surface receptor that mediates MBL-dependent enhancement of EBOV infection. We also identified dectin-2 (CLEC6A as a potentially novel candidate attachment factor for EBOV. Our findings support the concept of an innate immune haplotype that represents critical interactions between MBL and complement component C4 genes and that may modify susceptibility or resistance to certain glycosylated pathogens. Therefore, higher levels of native or exogenous MBL could be deleterious in the setting of relative hypocomplementemia which can occur genetically or because of immunodepletion
Energy Technology Data Exchange (ETDEWEB)
Kojima, Shuji; Jay, M.
1987-10-01
The labeling efficiency, biological activity and biodistribution of /sup 125/I labeled and /sup 67/Ga chelating agent conjugated lectins were investigated. Pisum sativum agglutinin (PSA) and Lens culinaris agglutinin (LCH) were efficiently labeled with /sup 67/Ga using bifunctional chelating agents such as diethylenetriaminepentaacetic acid (DTPA) and deferoxamine (DFO), whereas labeling with /sup 125/I was significantly less efficient. The agglutinating activity of these lectins towards Ehrlich ascites tumor (EAT) cells was retained on conjugation with DFO, but not with DTPA. The in vitro binding ratio of /sup 67/Ga-DFO-lectins for EAT cells was almost the same as that of /sup 125/I-lectins. However, the value was significantly decreased in the case of /sup 67/Ga-DTPA-lectins. In the biodistribution study of radiolabeled lectins in Ehrlich solid tumor (EST) bearing mice, the accumulation of radioactivity in tumor tissue was very much less with /sup 67/Ga-DTPA-lectins than with /sup 125/I-lectins. However, the concentration was significantly elevated in the case of /sup 67/Ga-DFO-lectins. While, these lectins accumulated in liver, spleen, lung, and kidney to a greater extent than /sup 67/Ga citrate, the tumor to organ ratios became very low. These low tumor to organ ratios, in contrast to /sup 67/Ga citrate, will certainly inhibit the tumor delineation, and therefore it seems that in spite of a high accumulation ratio of /sup 67/Ga-DFO-lectins in tumor tissue, these agents are not useful in tumor detection.
Gohier, A; Espinosa, J F; Jimenez-Barbero, J; Carrupt, P A; Pérez, S; Imberty, A
1996-12-01
Ulex europaeus isolectin I is specific for fucose-containing oligosaccharide such as H type 2 trisaccharide alpha-L-Fuc (1-->2) beta-D-Gal (1-->4) beta-D-GlcNAc. Several legume lectins have been crystallized and modeled, but no structural data are available concerning such fucose-binding lectin. The three-dimensional structure of Ulex europaeus isolectin I has been constructed using seven legume lectins for which high-resolution crystal structures were available. Some conserved water molecules, as well as the structural cations, were taken into account for building the model. In the predicted binding site, the most probable locations of the secondary hydroxyl groups were determined using the GRID method. Several possible orientations could be determined for a fucose residue. All of the four possible conformations compatible with energy calculations display several hydrogen bonds with Asp-87 and Ser-132 and a stacking interaction with Tyr-220 and Phe-136. In two orientations, the O-3 and O-4 hydroxyl groups of fucose are the most buried ones, whereas two other, the O-2 and O-3 hydroxyl groups are at the bottom of the site. Possible docking modes are also studied by analysis of the hydrophobic and hydrophilic surfaces for both the ligand and the protein. The SCORE method allows for a quantitative evaluation of the complementarity of these surfaces, on the basis of molecular lipophilicity calculations. The predictions presented here are compared with known biochemical data.
Fälth-Magnusson, K; Magnusson, K E
1995-05-01
Lectins recognize carbohydrate moities of glycoproteins and glycolipids, and can elicit several biological effects, including cell agglutination, cell activation and mitogenesis. According to the gluten-lectin theory, celiac lesions represent a response to a toxic lectin, putatively wheat germ agglutinin (WGA). In this study we compared the serum antibody levels IgA, IgG and IgM to WGA and to gliadin in children under investigation for celiac disease (CD), as compared to reference children. We found that the levels of IgA and IgG to WGA as well as gliadin were significantly higher in celiac children on a gluten-containing diet, compared to children on gluten-free diet and reference children. These findings lend support to the concept that WGA is a biologically significant component of gluten. Since WGA can mimic the effects of epidermal growth factor (EGF) at the cellular level, we hypothesize that the crypt hyperplasia seen in celiac children could be due to a mitogenic response induced by WGA.
Directory of Open Access Journals (Sweden)
Larissa Balabanova
Full Text Available A fusion between the genes encoding the marine bacterium Cobetia marina alkaline phosphatase (CmAP and Far Eastern holothurian Apostichopus japonicus mannan-binding C-type lectin (MBL-AJ was performed. Expression of the fusion gene in E. coli cells resulted in yield of soluble recombinant chimeric protein CmAP/MBL-AJ with the high alkaline phosphatase activity and specificity of the lectin MBL-AJ. The bifunctional hybrid CmAP/MBL-AJ was produced as a dimer with the molecular mass of 200 kDa. The CmAP/MBL-AJ dimer model showed the two-subunit lectin part that is associated with two molecules of alkaline phosphatase functioning independently from each other. The highly active CmAP label genetically linked to MBL-AJ has advantaged the lectin-binding assay in its sensitivity and time. The double substitution A156N/F159K in the lectin domain of CmAP/MBL-AJ has enhanced its lectin activity by 25 ± 5%. The bifunctional hybrid holothurian's lectin could be promising tool for developing non-invasive methods for biological markers assessment, particularly for improving the MBL-AJ-based method for early detection of a malignant condition in cervical specimens.
Directory of Open Access Journals (Sweden)
Imtiaj Hasan
2014-09-01
Full Text Available A specific galactose-binding lectin was shown to inhibit the hemolytic effect of streptolysin O (SLO, an exotoxin produced by Streptococcus pyogenes. Commercially available lectins that recognize N-acetyllactosamine (ECA, T-antigen (PNA, and Tn-antigen (ABA agglutinated rabbit erythrocytes, but had no effect on SLO-induced hemolysis. In contrast, SLO-induced hemolysis was inhibited by AKL, a lectin purified from sea hare (Aplysia kurodai eggs that recognizes α-galactoside oligosaccharides. This inhibitory effect was blocked by the co-presence of d-galactose, which binds to AKL. A possible explanation for these findings is that cholesterol-enriched microdomains containing glycosphingolipids in the erythrocyte membrane become occupied by tightly stacked lectin molecules, blocking the interaction between cholesterol and SLO that would otherwise result in penetration of the membrane. Growth of S. pyogenes was inhibited by lectins from a marine invertebrate (AKL and a mushroom (ABA, but was promoted by a plant lectin (ECA. Both these inhibitory and promoting effects were blocked by co-presence of galactose in the culture medium. Our findings demonstrate the importance of glycans and lectins in regulating mechanisms of toxicity, creation of pores in the target cell membrane, and bacterial growth.
Tsutsui, Shigeyuki; Yamaguchi, Motoki; Hirasawa, Ai; Nakamura, Osamu; Watanabe, Tasuku
2009-08-01
A lactose-specific lectin with a molecular mass of about 25 kDa was purified from the skin mucus of a cartilaginous fish-the common skate (Raja kenojei). The complementary DNA sequence of the lectin was 1540 bp long and contained a reading frame encoding 226 amino acids, which showed approximately 38% identity to pentraxins of mammals and teleosts. Gene expression was observed in the skin, gill, stomach and intestine in the healthy skate. We also identified an isotype gene from the liver whose deduced amino-acid sequence shared 69.0% identity with the skin type gene. The antiserum detected protein in the skin, where the lectin is localized in the epidermal cells, and in the blood plasma. The lectin genes are multicopied in the common skate genome. Although pentraxins are acute phase proteins, mRNAs of both the isotypes were not upregulated after the in vivo challenge with formalin-killed Escherichia coli, which suggests that they are constantly present in the skin mucus and blood plasma to protect against pathogenic invasion. This lectin is the fifth type of lectin found in the cutaneous secretions of fish, demonstrating that skin mucus lectins have evolved with marked molecular diversity in fish.
Energy Technology Data Exchange (ETDEWEB)
Saveriano, N.; Drinnan, M.; Santer, V.; Osmond, D.G.
1981-11-01
Cells from mouse bone marrow, thymus and spleen were exposed to /sup 125/I-labeled concanavalin A (Con A), Lens culinaris lectin (LCL), soybean agglutinin (SBA), Hignoreomatia agglutinin (HPA), phytohemagglutinin-P (PHA-P), peanut agglutinin (PNA), or wheat germ agglutinin (WGA) in a range of concentrations and examined radioautographically. Small lymphocytes in the three organs differed in the minimal concentration of each lectin which gave detectable surface labeling, while at optimal lectin concentrations, their labeling intensity profiles differed markedly. Inhibition by sugars demonstrated the labeling specificity. Major populations of bone marrow small lymphocytes bound WGA strongly, while Con A, SBA, HPA, PHA-P and LCL were bound only weakly, and PNA binding was lacking. Most thymus cells bound Con A, SBA, HPA, PHA-P and PNA strongly. WGA and LCL weakly. Subsets of bone marrow and thymus small lymphocytes differed from the major populations in their lectin-binding intensities. Spleen small lymphocytes were heterogeneous in the binding of each lectin. However, a major population bound LCL exceptionally strongly, while few cells bound PNA. Using a panel of lectins under standardized conditions, these studies show distinctive lectin-binding patterns for small lymphocytes in the bone marrow, thymus and spleen, resepctively. Major and minor cell populations are distinguishable in each organ, providing an approach to discriminating lymphocyte lineages, subtypes and differentiation stages.
Singh, D D; Saikrishnan, K; Kumar, Prashant; Surolia, A; Sekar, K; Vijayan, M
2005-10-01
The crystal structure of a complex of methyl-alpha-D-mannoside with banana lectin from Musa paradisiaca reveals two primary binding sites in the lectin, unlike in other lectins with beta-prism I fold which essentially consists of three Greek key motifs. It has been suggested that the fold evolved through successive gene duplication and fusion of an ancestral Greek key motif. In other lectins, all from dicots, the primary binding site exists on one of the three motifs in the three-fold symmetric molecule. Banana is a monocot, and the three motifs have not diverged enough to obliterate sequence similarity among them. Two Greek key motifs in it carry one primary binding site each. A common secondary binding site exists on the third Greek key. Modelling shows that both the primary sites can support 1-2, 1-3, and 1-6 linked mannosides with the second residue interacting in each case primarily with the secondary binding site. Modelling also readily leads to a bound branched mannopentose with the nonreducing ends of the two branches anchored at the two primary binding sites, providing a structural explanation for the lectin's specificity for branched alpha-mannans. A comparison of the dimeric banana lectin with other beta-prism I fold lectins, provides interesting insights into the variability in their quaternary structure.
Directory of Open Access Journals (Sweden)
Sarah R. Ambrose
2015-09-01
Full Text Available Developing a urine test to detect bladder tumours with high sensitivity and specificity is a key goal in bladder cancer research. We hypothesised that bladder cancer-specific glycoproteins might fulfill this role. Lectin-ELISAs were used to study the binding of 25 lectins to 10 bladder cell lines and serum and urine from bladder cancer patients and non-cancer controls. Selected lectins were then used to enrich glycoproteins from the urine of bladder cancer patients and control subjects for analysis by shotgun proteomics. None of the lectins showed a strong preference for bladder cancer cell lines over normal urothlelial cell lines or for urinary glycans from bladder cancer patients over those from non-cancer controls. However, several lectins showed a strong preference for bladder cell line glycans over serum glycans and are potentially useful for enriching glycoproteins originating from the urothelium in urine. Aleuria alantia lectin affinity chromatography and shotgun proteomics identified mucin-1 and golgi apparatus protein 1 as proteins warranting further investigation as urinary biomarkers for low-grade bladder cancer. Glycosylation changes in bladder cancer are not reliably detected by measuring lectin binding to unfractionated proteomes, but it is possible that more specific reagents and/or a focus on individual proteins may produce clinically useful biomarkers.
Pacheco, Judith; Shibayama, Mineko; Campos, Rafael; Beck, David L; Houpt, Erick; Petri, William A; Tsutsumi, Víctor
2004-03-01
The Gal/GalNAc lectin of Entamoeba histolytica trophozoites plays an important role in adhesion. The distribution and final destiny of the lectin during the interaction with host cells are poorly understood. Using monoclonal and polyclonal antibodies against the lectin we studied by immunocytochemistry the in vitro and in vivo interaction of E. histolytica trophozoites with human and hamster hepatocytes. We also analyzed the presence and distribution of the lectin in a mouse model of intestinal amoebiasis. In all cases, trophozoites were highly labeled by anti-lectin antibodies. Cultured human and hamster hepatocytes in contact with, or localized at the vicinity of parasites were also labeled by anti-lectin antibodies. Most of the labeled hepatocytes showed variable degrees of cell damage. Hepatocytes distantly localized from the parasites were also stained with the anti-lectin antibodies. Immunolabeling of tissue sections from different stages of the development of experimental amoebic liver abscess in hamsters showed inflammatory foci containing lectin-labeled trophozoites, hepatocytes, and sinusoidal and inflammatory cells. Lectin-containing hepatocytes had vacuolated cytoplasm with some nuclei with a condensed appearance. Damaged intestinal epithelium also was labeled with anti-lectin antibodies in a mouse model of intestinal amoebiasis. Electron microscopy of axenically cultured trophozoites using gold-labeled monoclonal and polyclonal anti-lectin antibody showed that plasma membrane, vacuole membranes and areas of cell cytosol were labeled. Higher deposits of gold particles in plasma membrane suggestive of cell secretion were observed. Our results demonstrated that Gal/GalNAc lectin was bound and captured by different target cells, and that host cells containing the lectin showed signs of cell damage. The contribution of lectin transfer to host cells in adherence and cell injury remains to be determined.
Association of mannose-binding lectin genotype with cardiovascular abnormalities in Kawasaki disease
Biezeveld, Maarten H.; Kuipers, Irene M.; Geissler, Judy; Lam, Jan; Ottenkamp, Jaap J.; Hack, C. Erik; Kuijpers, Taco W.
2003-01-01
Kawasaki disease is an acute vasculitis of possible infectious cause, which in particular affects the coronary arteries. Young children rely mostly on their innate immune system for protection against invading microorganisms, of which mannose-binding lectin is an important component. We aimed to
In vivo and in vitro antibacterial activity of conglutinin, a mammalian plasma lectin
DEFF Research Database (Denmark)
Friis-Christiansen, P; Thiel, S; Svehag, S E
1990-01-01
Conglutinin is a mammalian C-type lectin which agglutinates iC3b-coated erythrocytes. Ingram [13] found that euglobulin from bovine serum may confer partial protection against experimental infections in mice. We now present evidence that the protective activity in euglobulin against infections...
DMPD: C-type lectin receptors in antifungal immunity. [Dynamic Macrophage Pathway CSML Database
Lifescience Database Archive (English)
Full Text Available nds Microbiol. 2008 Jan;16(1):27-32. Epub 2007 Dec 21. (.png) (.svg) (.html) (.csml) Show C-type lectin rece... 2007 Dec 21. Pathway - PNG File (.png) SVG File (.svg) HTML File (.html) CSML File (.csml) Open .csml file
Structure of the C-type lectin carbohydrate recognition domain of human tetranectin
DEFF Research Database (Denmark)
Kastrup, J S; Nielsen, B B; Rasmussen, H
1998-01-01
Tetranectin (TN) is a C-type lectin involved in fibrinolysis, being the only endogenous ligand known to bind specifically to the kringle 4 domain of plasminogen. TN was originally isolated from plasma, but shows a wide tissue distribution. Furthermore, TN has been found in the extracellular matrix...
Dusting the sugar fingerprint: C-type lectin signaling in adaptive immunity
den Dunnen, Jeroen; Gringhuis, Sonja I.; Geijtenbeek, Teunis B. H.
2010-01-01
Pathogen recognition by dendritic cells (DCs) is central to the induction of adaptive immunity. Pattern recognition receptors (PRRs) on DCs interact with pathogens, leading to signaling events that dictate adaptive immune responses. It is becoming clear that C-type lectins are important PRRs that
Transmission-blocking antibodies against mosquito C-type lectins for dengue prevention.
Directory of Open Access Journals (Sweden)
Yang Liu
2014-02-01
Full Text Available C-type lectins are a family of proteins with carbohydrate-binding activity. Several C-type lectins in mammals or arthropods are employed as receptors or attachment factors to facilitate flavivirus invasion. We previously identified a C-type lectin in Aedes aegypti, designated as mosquito galactose specific C-type lectin-1 (mosGCTL-1, facilitating the attachment of West Nile virus (WNV on the cell membrane. Here, we first identified that 9 A. aegypti mosGCTL genes were key susceptibility factors facilitating DENV-2 infection, of which mosGCTL-3 exhibited the most significant effect. We found that mosGCTL-3 was induced in mosquito tissues with DENV-2 infection, and that the protein interacted with DENV-2 surface envelop (E protein and virions in vitro and in vivo. In addition, the other identified mosGCTLs interacted with the DENV-2 E protein, indicating that DENV may employ multiple mosGCTLs as ligands to promote the infection of vectors. The vectorial susceptibility factors that facilitate pathogen invasion may potentially be explored as a target to disrupt the acquisition of microbes from the vertebrate host. Indeed, membrane blood feeding of antisera against mosGCTLs dramatically reduced mosquito infective ratio. Hence, the immunization against mosGCTLs is a feasible approach for preventing dengue infection. Our study provides a future avenue for developing a transmission-blocking vaccine that interrupts the life cycle of dengue virus and reduces disease burden.
C-type lectin receptors in the control of T helper cell differentiation
Geijtenbeek, Teunis B. H.; Gringhuis, Sonja I.
2016-01-01
Pathogen recognition by C-type lectin receptors (CLRs) expressed by dendritic cells is important not only for antigen presentation, but also for the induction of appropriate adaptive immune responses via T helper (TH) cell differentiation. CLRs act either by themselves or in cooperation with other
Influence of major surgery on the mannan-binding lectin pathway of innate immunity
DEFF Research Database (Denmark)
Ytting, H; Christensen, I J; Basse, L
2006-01-01
The mannan-binding lectin (MBL) pathway of complement activation is important in host defence against pathogens and possibly against cancer. We investigated the effect of major surgery on two central components of the MBL pathway; MBL and the MBL-associated serine protease MASP-2, and for compari...
Modulation of the immune system by ligands of the C-type lectin DC-SIGN
Gijzen, K.
2007-01-01
DC-SIGN is a C-type lectin specifically expressed on dendritic cells that recognize high-mannose and fucose glycans. This carbohydrate specificity of DC-SIGN enables recognition of a large array of ligands which include both pathogen-derived as well as endogenous glycoconjugates. Because of the wide
Innate signaling by the C-type lectin DC-SIGN dictates immune responses
Dunnen, den J.; Gringhuis, S.I.; Geijtenbeek, T.B.H.
2009-01-01
Effective immune responses depend on the recognition of pathogens by dendritic cells (DCs) through pattern recognition receptors (PRRs). These receptors induce specific signaling pathways that lead to the induction of immune responses against the pathogens. It is becoming evident that C-type lectins
Isolation and characterization of a new mannose-binding lectin gene ...
Indian Academy of Sciences (India)
Unknown
and is a kind of valuable medicinal plant of family Tax- aceae in gymnosperms. Up to now, there is no report on the molecular cloning of lectin gene from T. .... important role in sugar-binding activity and thus are pre- served in evolution. As shown in figure 3B, it was very noteworthy that β-sheets occurred predominantly and ...
Lectin microarrays: a powerful tool for glycan-based biomarker discovery.
Zhou, Shu-Min; Cheng, Li; Guo, Shu-Juan; Zhu, Heng; Tao, Sheng-Ce
2011-09-01
Cell surfaces, especially mammalian cell surfaces, are heavily coated with complex poly- and oligosaccharides, and these glycans have been implicated in many functions, such as cell-to-cell communication, host-pathogen interactions and cell matrix interactions. Not surprisingly then, the aberrations of glycosylation are usually indicative of the onset of specific diseases, such as cancer. Therefore, glycans are expected to serve as important biomarkers for disease diagnosis and/or prognosis. Recent development of the lectin microarray technology has allowed researchers to profile the glycans in complex biological samples in a high throughput fashion. This relatively new tool is highly suitable for both live cell and cell lysate analyses and has the potential for rapid discovery of glycan-based biomarkers. In this review, we will focus on the basic concepts and the latest advances of lectin microarray technology. We will also emphasize the application of lectin microarrays for biomarker discovery, and then discuss the challenges faced by this technology and potential future directions. Based on the tremendous progress already achieved, it seems apparent that lectin microarrays will soon become an indispensible tool for glycosylation biomarker discovery.
Effects of mannose-binding lectin polymorphisms on irinotecan-induced febrile neutropenia
J.M. van der Bol (Jessica); M.J.A. de Jonge (Maja); R.H.N. van Schaik (Ron); A. Sparreboom (Alex); M.A. van Fessem (Marianne); F.E. Geijn (Fleur); P.L.A. van Daele (Paul); J. Verweij (Jaap); S. Sleijfer (Stefan); A.H.J. Mathijssen (Ron)
2010-01-01
textabstractObjective. Mannose-binding lectin (MBL) is important in the innate immune response. MBL2 gene polymorphisms affect MBL expression, and genotypes yielding low MBL levels have been associated with an elevated risk for infections in hematological cancer patients undergoing chemotherapy.
C-type lectin interactions with Schistosoma mansoni SEA : Molecular basis and function
Liempt, van P.A.G.
2007-01-01
Outline of this thesis The studies described in this thesis have been performed to gain more insight in the recognition of Schistosoma mansoni glycans by C-type lectins and the consequences for dendritic cell mediated immune responses. As a first approach to understand the molecular interactions
Horst, G.J. ter; Karst, H.; Luiten, P.G.M.
1984-01-01
The autoradiographic pattern of anterograde labeling as a result from injections with tritiated amino acids is compared to the labeling of efferents with Phaseolus vulgaris leuco-agglutinin after lectin injections in the same nucleus visualized by immunohistochemical methods. This comparison is made
Directory of Open Access Journals (Sweden)
Grażyna Końska
2014-01-01
Full Text Available Preliminary investigations were conducted to determine the presence of active lectins in carpophores of fungi from the class Basidiomycetes, collected from natural localities in southern and south-eastern Poland. The degree of agglutination activity (expressed as the titre of agglutination of aqueous extracts was determined at room temperature (18-20°C and at +4°C in respect to human and animal erythrocytes suspended in physiological saline, part of which were additionally treated with proteolytic enzymes. From among the 104 tested species, extracts from 41 of them showed agglutination activity, among which 18 were high. In six cases, specific activity against human ABH group antigens was found. Extracts from 5 species agglutinated only animal erythrocytes, with pigeon erythrocytes being exceptionally sensitive to the lectins. Extracts from two species had distinctly higher agglutination activity at 4°C, which suggests that lectins of the "cold" agglutinin type are present in these species. Analysis of extracts from caps and stems showed that caps had a higher lectin content.
Mannose-binding lectin genotypes and susceptibility to epstein-barr virus infection in infancy
DEFF Research Database (Denmark)
Friborg, Jeppe T; Jarrett, Ruth F; Koch, Anders
2010-01-01
In a cohort study of children <4 years of age in Greenland, mannose-binding lectin (MBL2) genotypes and Epstein-Barr virus (EBV) antibody levels were determined. EBV seropositivity was significantly lower and time to seroconversion increased in MBL-insufficient compared with MBL-sufficient childr...
Entomotoxic and nematotoxic lectins and protease inhibitors from fungal fruiting bodies
Sabotič, Jerica; Ohm, Robin A|info:eu-repo/dai/nl/304837628; Künzler, Markus
2016-01-01
Fruiting bodies or sporocarps of dikaryotic (ascomycetous and basidiomycetous) fungi, commonly referred to as mushrooms, are often rich in entomotoxic and nematotoxic proteins that include lectins and protease inhibitors. These protein toxins are thought to act as effectors of an innate defense
Evaluation de l\\'activité hémagglutinante des lectines des graines de ...
African Journals Online (AJOL)
% de saturation, de l\\'extrait brut de Csp présente l\\'activité hémagglutinante la plus élevée (512). Le traitement thermique à 100°C pendant 15 minutes réduit significativement l\\'activité hémagglutinante des lectines des extraits bruts des graines ...
Lectin Digestibility and Stability of Elderberry Antioxidants to Heat Treatment In Vitro.
Jiménez, Pilar; Cabrero, Patricia; Cordoba-Diaz, Damian; Cordoba-Diaz, Manuel; Garrosa, Manuel; Girbés, Tomás
2017-01-06
Elderberry contains healthy low molecular weight nutraceuticals and lectins which are sequence-related to the elderberry allergen Sam n1. Some of these lectins are type II ribosome-inactivating proteins. The sensitivity of native lectins present in elderberry fruits and bark to the proteolysis triggered by in vitro simulated gastric and duodenal fluids has been investigated. It was found that these lectins are refractory to proteolysis. Nonetheless, incubation for 5-10 min in a boiling water bath completely sensitized them to the hydrolytic enzymes in vitro. Under these conditions neither total Folin-Ciocalteau's reagent reactive compounds, total anthocyanins and the mixture of cyanidin-3-glucoside plus cyanidin-3-sambubioside, nor antioxidant and free-radical scavenging activities were affected by more than 10% for incubations of up to 20 min. Therefore, short-time heat treatment reduces potential allergy-related risks deriving from elderberry consumption without seriously affecting its properties as an antioxidant and free-radical scavenging food.
Lectin Digestibility and Stability of Elderberry Antioxidants to Heat Treatment In Vitro
Directory of Open Access Journals (Sweden)
Pilar Jiménez
2017-01-01
Full Text Available Elderberry contains healthy low molecular weight nutraceuticals and lectins which are sequence-related to the elderberry allergen Sam n1. Some of these lectins are type II ribosome-inactivating proteins. The sensitivity of native lectins present in elderberry fruits and bark to the proteolysis triggered by in vitro simulated gastric and duodenal fluids has been investigated. It was found that these lectins are refractory to proteolysis. Nonetheless, incubation for 5–10 min in a boiling water bath completely sensitized them to the hydrolytic enzymes in vitro. Under these conditions neither total Folin-Ciocalteau’s reagent reactive compounds, total anthocyanins and the mixture of cyanidin-3-glucoside plus cyanidin-3-sambubioside, nor antioxidant and free-radical scavenging activities were affected by more than 10% for incubations of up to 20 min. Therefore, short-time heat treatment reduces potential allergy-related risks deriving from elderberry consumption without seriously affecting its properties as an antioxidant and free-radical scavenging food.
Carbohydrate Microarray on Glass: a Tool for Carbohydrate-Lectin Interactions
Tetala, K.K.R.; Giesbers, M.; Visser, G.M.; Sudhölter, E.J.R.; Beek, van T.A.
2007-01-01
A simple method to immobilize carbohydrates on a glass surface to obtain a carbohydrate microarray is described. The array was used to study carbohydrate-lectin interactions. The glass surface was modified with aldehyde terminated linker groups of various chain lengths. Coupling of carbohydrates
Histochemical investigations on lectin binding in normal and irradiated mouse embryos
Energy Technology Data Exchange (ETDEWEB)
Nievergelt-Egido, M.C.; Michel, C. (Zurich Univ. (Switzerland). Inst. for Medical Radiobiology); Schmahl, W. (GSF-Inst. fuer Pathologie, Neuherberg (Germany))
1993-04-01
Lectin binding in normal and irradiated embryonic mouse tissues on day 10 of gestation was studied by peroxidase techniques. Specific binding of Dolichos biflorus lectin (DBA) was detected in the mesodermal blood vessels and in the otic vesicles. The amount of DBA as well as that of soybean agglutinin (SBA) and peanut agglutinin (PNA) increased after exposure to low doses of radiation (0.25, 0.50 and 0.75 Gy). The modifying influence of ionizing radiation was observed in the pituitary region, in the otic vesicles and in the blood vessel endothelium. The greatest effect appeared in the pituitary region at 0.75 Gy, while in the otic vesicles it appeared at 0.50 Gy. A dose-effect relationship was established for the DBA lectin affinity of the vascular endothelium. In comparison to DBA, SBA and PNA displayed more extensive staining after irradiation. The reactivity of these lectins appeared especially pronounced on the blood vessels within the central nervous system and in the luminal surface of the ependymal cells. It is of interest that maximal binding for PNA was observed at 0.25 Gy and for SBA at 0.50 Gy at the junctions between neuroepithelial cells. (orig.).
J.M. Pekelharing
1989-01-01
textabstractThe aim of this work is to determine if lectins can be used in "sandwich" ELISA techniques so that the glycosylation of specific proteins in mixtures could be characterised in a fast and sensitive way without prior purification of the protein. Furthermore, the feasability of
The typing of Staphylococcus epidermidis by a lectin-binding assay
DEFF Research Database (Denmark)
Jarløv, J O; Hansen, J E; Rosdahl, V T
1992-01-01
A new typing method for Staphylococcus epidermidis was developed. Four biotinylated lectins--wheat germ agglutinin (WGA), soy bean agglutinin (SBA), lentil agglutinin (LCA) and Concanavalin A (ConA)--were added to immobilised whole cells of coagulase-negative staphylococci (CNS) in microtitration...
Glycophenotype Evaluation in Cutaneous Tumors Using Lectins Labeled with Acridinium Ester
Directory of Open Access Journals (Sweden)
Luiza Rayanna Amorim Lima
2013-01-01
Full Text Available Background. Tumor cells show alterations in their glycosylation patterns when compared to normal cells. Lectins can be used to evaluate these glycocode changes. Chemiluminescence assay is an effective technique for quantitative analysis of proteins, nucleic acids, and carbohydrates due to its high sensitivity, specificity, and rapid testing. Objective. To use histochemiluminescence based on lectin conjugated to acridinium ester (AE for the investigation of glycophenotype changes in cutaneous tumors. Methods. Concanavalin A (Con A, Peanut agglutinin (PNA, Ulex europaeus agglutinin-I (UEA-I, and Maackia amurensis agglutinin (MAA were conjugated to acridinium ester. Biopsies of cutaneous tumors and normal skin were incubated with the lectins-AE, and chemiluminescence was quantified and expressed as Relative Light Units (RLU. Results. Actinic keratosis (AK, keratoacanthoma (KA, squamous cell carcinoma (SCC, and basal cell carcinoma (BCC showed lower expression of α-D-glucose/mannose and α-L-fucose residues compared to normal tissue. Cutaneous tumors displayed higher expression of Gal-β(1-3-GalNAc residues than normal tissue. AK and SCC exhibited higher expression of Neu5Ac-α(2,3Gal residues than normal epidermis. KA and BCC showed equivalent RLU values compared to normal tissue. Conclusions. Lectin histochemiluminescence allowed quantitative assessment of the carbohydrate expression in cutaneous tissues, contributing to eliminate the subjectivity of conventional techniques used in the histopathological diagnosis.
Evaluation of glycophenotype in breast cancer by quantum dot-lectin histochemistry
Andrade, Camila G; Cabral Filho, Paulo E; Tenório, Denise PL; Santos, Beate S; Beltrão, Eduardo IC; Fontes, Adriana; Carvalho, Luiz B
2013-01-01
Cell surface glycoconjugates play an important role in differentiation/dedifferentiation processes and lectins are employed to evaluate them by several methodologies. Fluorescent probes are considered a valuable tool because of their ability to provide a particular view, and are more detailed and sensitive in terms of cell structure and molecular content. The aim of this study was to evaluate and compare the expression and distribution of glycoconjugates in normal human breast tissue, and benign (fibroadenoma), and malignantly transformed (invasive ductal carcinoma) breast tissues. For this, we used mercaptosuccinic acid-coated Cadmium Telluride (CdTe) quantum dots (QDs) conjugated with concanavalin A (Con A) or Ulex europaeus agglutinin I (UEA I) lectins to detect α-D-glucose/mannose and L-fucose residues, respectively. The QD-lectin conjugates were evaluated by hemagglutination activity tests and carbohydrate inhibition assays, and were found to remain functional, keeping their fluorescent properties and carbohydrate recognition ability. Fluorescence images showed that different regions of breast tissue expressed particular types of carbohydrates. While the stroma was preferentially and intensely stained by QD-Con A, ductal cells were preferentially labeled by QD-UEA I. These results indicate that QD-lectin conjugates can be used as molecular probes and can help to elucidate the glycoconjugate profile in biological processes. PMID:24324334
Glycophenotype evaluation in cutaneous tumors using lectins labeled with acridinium ester.
Lima, Luiza Rayanna Amorim; Bezerra, Matheus Filgueira; Almeida, Sinara Mônica Vitalino; Silva, Lúcia Patrícia Bezerra Gomes; Beltrão, Eduardo Isidoro Carneiro; Carvalho Júnior, Luiz Bezerra
2013-01-01
Tumor cells show alterations in their glycosylation patterns when compared to normal cells. Lectins can be used to evaluate these glycocode changes. Chemiluminescence assay is an effective technique for quantitative analysis of proteins, nucleic acids, and carbohydrates due to its high sensitivity, specificity, and rapid testing. To use histochemiluminescence based on lectin conjugated to acridinium ester (AE) for the investigation of glycophenotype changes in cutaneous tumors. Concanavalin A (Con A), Peanut agglutinin (PNA), Ulex europaeus agglutinin-I (UEA-I), and Maackia amurensis agglutinin (MAA) were conjugated to acridinium ester. Biopsies of cutaneous tumors and normal skin were incubated with the lectins-AE, and chemiluminescence was quantified and expressed as Relative Light Units (RLU). Results. Actinic keratosis (AK), keratoacanthoma (KA), squamous cell carcinoma (SCC), and basal cell carcinoma (BCC) showed lower expression of α -D-glucose/mannose and α -L-fucose residues compared to normal tissue. Cutaneous tumors displayed higher expression of Gal- β (1-3)-GalNAc residues than normal tissue. AK and SCC exhibited higher expression of Neu5Ac- α (2,3)Gal residues than normal epidermis. KA and BCC showed equivalent RLU values compared to normal tissue. Lectin histochemiluminescence allowed quantitative assessment of the carbohydrate expression in cutaneous tissues, contributing to eliminate the subjectivity of conventional techniques used in the histopathological diagnosis.
Crystallization and X-ray analysis of the salmon-egg lectin SEL24K
Energy Technology Data Exchange (ETDEWEB)
Murata, Kenji [Department of Animal Science, University of California, Davis 95616 (United States); Fisher, Andrew J. [Department of Chemistry, University of California, Davis 95616 (United States); Hedrick, Jerry L., E-mail: jlhedrick@ucdavis.edu [Department of Animal Science, University of California, Davis 95616 (United States)
2007-05-01
The 24 kDa egg lectin of Chinook salmon (Oncorhynchus tshawytscha) was purified by affinity chromatography from salmon eggs and crystallized by the hanging-drop vapor-diffusion method using 15/4 EO/OH (pentaerythritol ethoxylate) as a precipitant. The 24 kDa egg lectin of Chinook salmon (Oncorhynchus tshawytscha) is released from the egg during the cortical reaction. The lectin functions in blocking polyspermy during the fertilization process. The egg lectin was purified by affinity chromatography from salmon eggs and crystallized by the hanging-drop vapor-diffusion method using 15/4 EO/OH (pentaerythritol ethoxylate) as a precipitant. The crystal diffracted synchrotron-radiation X-rays to 1.63 Å resolution. The crystal belongs to the monoclinic space group P2{sub 1}, with unit-cell parameters a = 93.0, b = 73.6, c = 113.6 Å, α = 90, β = 92.82, γ = 90°. The crystal is likely to contain eight molecules in the asymmetric unit (V{sub M} = 2.3 Å{sup 3} Da{sup −1}), corresponding to a solvent content of 45.5%. A self-rotation function suggests an arrangement with 222 point symmetry within the asymmetric unit.
Evasion Mechanisms Used by Pathogens to Escape the Lectin Complement Pathway
DEFF Research Database (Denmark)
Rosbjerg, Anne; Genster, Ninette; Pilely, Katrine
2017-01-01
The complement system is a crucial defensive network that protects the host against invading pathogens. It is part of the innate immune system and can be initiated via three pathways: the lectin, classical and alternative activation pathway. Overall the network compiles a group of recognition mol...
cDNA cloning and characterization of a mannose-binding lectin from ...
Indian Academy of Sciences (India)
Using RNA extracted from Zingiber officinale rhizomes and primers designed according to the conservative regions of monocot mannose-binding lectins, the full-length cDNA of Z. officinale agglutinin (ZOA) was cloned by rapid amplification of cDNA ends (RACE). The full-length cDNA of zoa was 746 bp and contained a ...
Comparison of the Amino Acid Sequences of lectins from the seeds of
African Journals Online (AJOL)
Dr GATSING
The amino acid sequence of a glucose/mannose specific lectin from the seeds of Dioclea reflexa. (Dioclea reflexa agglutinin II, DRA-II) was determined by sequential Edman analyses of the intact subunit, and of the peptides derived from the protein by enzymatic digestion with trypsin. This sequence was found to be.
A second form of collagenous lectin from the tunicate, Styela plicata.
Green, P.; Luty, J.F.; Nair, S.; Radford, J.; Raftos, D.
2006-01-01
This study characterised a 90 kDa lectin from an invertebrate chordate, the tunicate Styela plicata. One- and two-dimensional electrophoresis showed that the apparent molecular weight of this protein is maintained under both reducing and non-reducing conditions, suggesting that its native form is a
Preoperative mannan-binding lectin pathway and prognosis in colorectal cancer
DEFF Research Database (Denmark)
Ytting, Henriette; Christensen, Ib Jarle; Jensenius, Jens Christian
2005-01-01
PURPOSE: Deficiency of the mannan-binding lectin (MBL) pathway of innate immunity is associated with increased susceptibility to infections. In patients with colorectal cancer (CRC), postoperative infection is associated with poor prognosis. The aim of the present study was to evaluate (1...
Lectin receptor kinase LecRK-b2 localizes to plasma membrane and ...
African Journals Online (AJOL)
-b2, has been characterized. Confocal microscopy images showed that the LecRK-b2-GFP fusion protein is localized to plasma membrane. The results of yeast 2 hybrid showed that lectin domain of LecRK-b2 had selfinteraction, while the ...
Ternary supramolecular quantum-dot network flocculation for selective lectin detection
Oikonomou, Maria; Wang, Junyou; Carvalho, Rui Rijo; Velders, Aldrik H.
2016-01-01
We present a versatile, tuneable, and selective nanoparticle-based lectin biosensor, based on flocculation of ternary supramolecular nanoparticle networks (NPN), formed through the sequential binding of three building blocks. The three building blocks are β-cyclodextrin-capped CdTe quantum dots,
Comparison of the amino acid sequences of lectins from the seeds ...
African Journals Online (AJOL)
The amino acid sequence of a glucose/mannose specific lectin from the seeds of Dioclea reflexa (Dioclea reflexa agglutinin II, DRA-II) was determined by sequential Edman analyses of the intact subunit, and of the peptides derived from the protein by enzymatic digestion with trypsin. This sequence was found to be very ...
Lectin-binding characteristics of a Lyme borreliosis spirochete Borrelia burgdorferi sensu stricto
Czech Academy of Sciences Publication Activity Database
Vancová, M.; Nebesářová, J.; Grubhoffer, Libor
2005-01-01
Roč. 50, č. 3 (2005), s. 229-238 ISSN 0015-5632 R&D Projects: GA ČR GA206/03/1323; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z60220518 Keywords : Borrelia burgdorferi * electron microscopy * lectin binding Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005
Genotyping of mannose-binding lectin (MBL2) codon 54 and ...
African Journals Online (AJOL)
Rabah M. Shawky
2013-11-17
Nov 17, 2013 ... Abstract Background: MBL2 gene polymorphisms affect serum concentration of mannose-bind- ing lectin and are associated with infectious conditions. Acute respiratory tract infections are among the most prevalent infections in childhood with the highest incidence among children younger than. 2 years.
Mannose-binding lectin deficiency in preterm neonates | El-Shimi ...
African Journals Online (AJOL)
Background: Mannose-binding lectin (MBL) is a collagenous protein that plays a role in innate immunity. MBL deficiency is associated with an opsonization defect and has been associated with recurrent infections, especially in immunocompromised individuals. Neonates are considered to be immunocompromised because ...
Ultrastructure and lectin characterization of granular salivary cells from Ixodes ricinus females
Czech Academy of Sciences Publication Activity Database
Vancová, Marie; Zacharovová, Klára; Grubhoffer, Libor; Nebesářová, Jana
2006-01-01
Roč. 92, č. 3 (2006), s. 431-440 ISSN 0022-3395 R&D Projects: GA ČR GA206/03/1323 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * salivary glands * lectin labeling Subject RIV: EE - Microbiology, Virology Impact factor: 1.300, year: 2006
Lymphocyte activation receptors:new structural paradigms in group V of C-type animal lectins
Czech Academy of Sciences Publication Activity Database
Pavlíček, J.; Kavan, Daniel; Pompach, Petr; Novák, Petr; Lukšan, Ondřej; Bezouška, Karel
2004-01-01
Roč. 32, č. 6 (2004), s. 1124-1126 ISSN 0300-5127 R&D Projects: GA AV ČR IAA5020403 Institutional research plan: CEZ:AV0Z5020903 Keywords : lectin -type receptor * ligand identification * lymphocyte Subject RIV: EE - Microbiology, Virology Impact factor: 2.267, year: 2004
Isolation, cloning and characterization of a novel phosphomannan-binding lectin from porcine serum
Czech Academy of Sciences Publication Activity Database
Yong Ma, B.; Nakamura, N.; Dlabač, Vladimír; Naito, H.; Yamaguchi, S.; Ishikawa, M.; Nonaka, M.; Ishiguro, M.; Kawasaki, N.; Oka, S.; Kawasaki, T.
2007-01-01
Roč. 282, č. 17 (2007), s. 12963-12975 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z50200510 Keywords : phosphomannan-binding lectin * porcine serum * cloning Subject RIV: EC - Immunology Impact factor: 5.581, year: 2007
Ficolins and Mannose-Binding Lectin in Danish patients with sarcoidosis
DEFF Research Database (Denmark)
Svendsen, Claus Bo; Hummelshøj, Tina; Munthe-Fog, Lea
2008-01-01
Mannose-Binding Lectin (MBL) is a prognostic marker in pulmonary diseases. Ficolins, sharing many structural and functional similarities with MBL, may also be involved in the pathogenesis of pulmonary diseases. The objectives of the study were to establish whether plasma concentrations of Ficolin-2...
Carbohydrate signaling by C-type lectin DC-SIGN affects NF-kappaB activity
Gringhuis, Sonja I.; Geijtenbeek, Teunis B. H.
2010-01-01
Pathogen recognition is central to the induction of adaptive immunity. Dendritic cells (DCs) express different pattern recognition receptors (PRRs), such as Toll-like receptors and C-type lectins, that sense invading pathogens. Pathogens trigger a specific set of PRRs, leading to activation of
Mannan-binding lectin polymorphisms and serum levels in patients with endometriosis
DEFF Research Database (Denmark)
Kruse, Christina; Steffensen, Rudi; Nielsen, Hans J
2014-01-01
OBJECTIVE: To investigate a possible association between endometriosis and low levels of mannan-binding lectin (MBL). STUDY DESIGN: Case-control study of blood samples from 100 patients with endometriosis compared with results from a group of 350 blood donors. RESULT: The frequency of MBL levels...
Second-generation nanofiltered plasma-derived mannan-binding lectin product
DEFF Research Database (Denmark)
Laursen, I.; Houen, G.; Højrup, P.
2007-01-01
BACKGROUND AND OBJECTIVES: Mannan-binding lectin (MBL) is an important component of the innate immune defence; it binds to carbohydrate structures on pathogenic micro-organisms resulting in complement activation and opsonization. Individuals with low MBL levels are at risk of recurrent and severe...