African Journals Online (AJOL)
user
2011-02-07
Feb 7, 2011 ... Haciseferogullari H, Gezer I, Bahtiyarca Y, Menges HO (2003). Determination of some chemical and physical properties of sakis faba bean (Vicia faba L. var. major). J. Food .Eng. 60: 475-479. Hanelt P, Mettin D (1989). Biosystematics of the Genus vicia L. (Leguminosae). Annu. Rev. Ecol. Syst. 20: 199-223.
African Journals Online (AJOL)
evaluate symbiotic characteristics between the crop and the rhizobia in major faba bean producing areas in Tigray ... Nodulation status of the field crops was poor except Ofla, D/Temben and Alaje districts. Though the ..... acknowledge Solomon Hishe and Biadglegn Desmisse for GIS data processing. 6. REFERENCE.
African Journals Online (AJOL)
ABSTRACT: The failure of faba bean production in some regions of Semien. Shewa necessitated a research for a ... ppm) and potassium, a high concentration of calcium and magnesium, and a lower population density of .... Magnesium sulphate, 0.5g; Sodium chloride, 0.2g; Yeast extract, 0.1g;. Mannitol, 10g; Agar, 15.
African Journals Online (AJOL)
the color of nodules (pink which is effective, white which is ineffective in nitrogen fixation). The variation in nodule number and color in turn induce variation in growth and yield of the host due to variation in fixed N (Lupwayi and Mkandawire, 1996; Amijee and Giller, 1998). Faba bean in association with rhizobia can fix up to ...
African Journals Online (AJOL)
Buzayehu
Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of ..... of the isolates were utilized all amino acids sources.
Improvement of faba bean ( Vicia faba L .) yield and quality through ...
African Journals Online (AJOL)
Improvement of faba bean ( Vicia faba L .) yield and quality through biotechnological approach: A review. ... yield and quality. This review work examines the role of various techniques with reference to faba bean improvement. Key words: Vicia faba, faba bean, grain quality, resistance breeding, nitrogen fixation, zero tannin.
Words denoting faba bean (Vicia faba in European languages
Directory of Open Access Journals (Sweden)
Mikić Aleksandar
2011-01-01
Full Text Available Faba bean (Vicia faba L took part in the 'agricultural revolution' of post-glacial Europe along with other grain legumes and cereals. In order to assess the diversity and the origin of the words denoting faba bean in the languages of Europe, a lexicological study was carried out with emphasis upon etymological dictionaries. The words in almost all modern Indo-European languages in Europe owe their origin to the Proto-Indo-European root *bhabh bhabhā, also denoting faba bean. The Proto-Altaic root *bŭkrV, denoting pea nut and cone, through the Proto-Turkic *burčak, denoting both pea and bean is responsible for the words in several modern Altaic languages of Europe while the others are borrowings from Arabic. The origin of the words in modern Caucasian languages is the Proto-Caucasian root *howł[ā], meaning both bean and lentil. The words in Uralic languages are either borrowings, mostly from Slavic, or derived from their own words denoting pea.
Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals
Jansman, A.J.M.
1993-01-01
Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid
Leaf traits associated with drought adaptation in faba bean (Vicia faba L.)
Khazaei, Hamid
2014-01-01
The potential for use of faba bean (Vicia faba L.) is increasing worldwide due to its positive environmental impact and nutritional interest, but there are many challenges for faba bean breeding and cultivation. These include its mixed breeding system, its unknown origin and wild progenitor, its large genome being the biggest diploid genome among field crops, and its relative sensitivity to biotic and abiotic stresses (e.g., drought). Little is known about the ecological adaptation of faba be...
Rhizobium laguerreae sp. nov. nodulates Vicia faba on several continents.
Saïdi, Sabrine; Ramírez-Bahena, Martha-Helena; Santillana, Nery; Zúñiga, Doris; Álvarez-Martínez, Estela; Peix, Alvaro; Mhamdi, Ridha; Velázquez, Encarna
2014-01-01
Several fast-growing strains nodulating Vicia faba in Peru, Spain and Tunisia formed a cluster related to Rhizobium leguminosarum. The 16S rRNA gene sequences were identical to that of R. leguminosarum USDA 2370(T), whereas rpoB, recA and atpD gene sequences were phylogenetically distant, with sequence similarities of less than 96 %, 97 % and 94 %, respectively. DNA-DNA hybridization analysis showed a mean relatedness value of 43 % between strain FB206(T) and R. leguminosarum USDA 2370(T). Phenotypic characteristics of the novel strains also differed from those of the closest related species of the genus Rhizobium. Therefore, based on genotypic and phenotypic data obtained in this study, we propose to classify this group of strains nodulating Vicia faba as a novel species of the genus Rhizobium named Rhizobium laguerreae sp. nov. The type strain is FB206(T) ( = LMG 27434(T) = CECT 8280(T)).
National Research Council Canada - National Science Library
Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P
2008-01-01
... identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba...
Van der Poel, A F; Dellaert, L M; Van Norel, A; Helsper, J P
1992-11-01
Seed samples from two near-isogenic faba bean (Vicia faba L.) lines were examined for the levels of so-called anti-nutritional factors (ANF). From the ANF known to be present in faba beans, trypsin inhibitor activity, functional lectins, condensed tannins and pyrimidine glycosides were analysed. It was concluded that the lines differed only in the content of condensed tannins being 0.05). A multienzyme technique was used to predict the in vitro protein digestibility (IVPD) of the two lines. The IVPD of the LT line was 0.965 and about 0.05 higher than the HT line, confirming the difference in digestibility as measured in vivo. The present study shows the positive effects on digestibility of removal of condensed tannins in faba beans which was achieved by plant breeding.
Characterization of Phosphate Solubilizing Faba Bean ( Vicia faba L ...
African Journals Online (AJOL)
Some species of rhizobial bacteria nodulating faba bean are characterized by phosphate solubilization. In order to study their in vitro and symbiotic characteristics, twelve rhizobial isolates nodulating faba bean were collected from acidic soil of Wollega, Ethiopia. Solubilization index of the isolates ranges from 1.25 to 2.10.
Meiotic changes in Vicia faba L. subsequent to treatments of hydrazine hydrate and maleic hydrazide
Directory of Open Access Journals (Sweden)
Shaheen Husain
2013-01-01
Full Text Available Assessing the impact of mutagens for creating variations in crops like faba bean (Vicia faba L. is an important criterion in the contemporary world where food insecurity and malnutrition is alarming at the doors of various nations. Impact of two chemical mutagens viz. hydrazine hydrate (HZ and maleic hydrazide (MH on the two varieties (NDF-1 and HB-405 of Vicia faba were analysed in terms of meiotic behavior and pollen sterility. Since there are not enough data about the effect of these mutagens on the chromosomal behaviors of Vicia faba, this study presents the role of hydrazine hydrate and maleic hydrazide as well as various types of chromosomal aberrations in crop improvement. The lower concentration of mutagens showed less pollen sterility compared to the higher concentrations. Manipulation of plant structural component to induce desirable alternations provides valuable material for the breeders and could be used favorably for increasing mutation rate and obtaining a desirable spectrum of mutation in faba beans based on preliminary studies of cell division.
Genetic diversity and population structure of faba bean (Vicia faba) from Turkey
Göl, Şurhan; DOĞANLAR, Sami; FRARY, Anne
2016-01-01
Faba bean (Vicia faba L.) is an important food and feed legume because of the nutritional value of its seed protein and starch content, good biomass, and high efficiency nitrogen fixation.This study analyzed the molecular genetic diversity and population structure of 101 Turkish faba bean accessions using simple sequence repeat (SSR) markers.A total of 32 SSR markers yielded 281 loci of which 277 (98.6%) were polymorphic.Mean dissimilarity between genotypes was 0.355, a relatively high value ...
Nutritional response of growing rats to faba beans (Vicia faba L., minor) and faba bean fractions.
Rubio, L A; Grant, G; Bardocz, S; Dewey, P; Pusztai, A
1991-11-01
The effects of raw faba bean (Vicia faba L., minor) meal (VFM) and its fractions on the growth and nitrogen utilization of rats have been determined in two experiments. Two commercial varieties of VFM were tested, local VFM (409-439 g/kg diet) and Troy VFM (439 g/kg diet). The bean fractions tested were V. faba lectin-depleted protein (VFDP), V. faba lectin (VFL) and V. faba cotyledon residue (VFCR). All diets were supplemented with amino acids to target requirements. Body-weight, body N and lipid contents of rats fed on VFM were reduced significantly in comparison with control rats fed on lactalbumin. This was due, in part, to the lower digestibility of the protein, lipid and dry matter (DM) of VFM diets. As a result, net protein utilization (NPU) and biological value (BV) of faba bean proteins were less than expected. Urine and urea-N outputs of the VFM-fed rats were also elevated in both experiments. Increasing the energy content of local VFM diets led to significantly higher dry body-weight, body N and lipid contents, with the result that the NPU and BV values of the protein also increased. However, the NPU values for VFM-fed rats were still significantly lower than those for the controls in both experiments. In contrast, true N, lipid and DM digestibilities in rats given local VFM were not significantly affected by the difference in the energy content of the diets. The replacement of two-thirds of the lactalbumin in the diet with VFDP (65 g/kg) reduced dry body-weight, N and lipid contents, NPU and BV compared with the control rats, even though N, lipid and DM digestibilities were not significantly different. The nutritional performance of rats fed on lactalbumin-based diets containing 7 g VFL/kg was similar to that of the controls. Similarly, the inclusion of the cotyledon residue (237 g VFCR/kg diet) had no appreciable effect on any of the variables studied. As VFL and VFCR had no antinutritional effects in these rats, it appears that the low nutritional
Large-Scale Transcriptome Analysis in Faba Bean (Vicia faba L. under Ascochyta fabae Infection.
Directory of Open Access Journals (Sweden)
Sara Ocaña
Full Text Available Faba bean is an important food crop worldwide. However, progress in faba bean genomics lags far behind that of model systems due to limited availability of genetic and genomic information. Using the Illumina platform the faba bean transcriptome from leaves of two lines (29H and Vf136 subjected to Ascochyta fabae infection have been characterized. De novo transcriptome assembly provided a total of 39,185 different transcripts that were functionally annotated, and among these, 13,266 were assigned to gene ontology against Arabidopsis. Quality of the assembly was validated by RT-qPCR amplification of selected transcripts differentially expressed. Comparison of faba bean transcripts with those of better-characterized plant genomes such as Arabidopsis thaliana, Medicago truncatula and Cicer arietinum revealed a sequence similarity of 68.3%, 72.8% and 81.27%, respectively. Moreover, 39,060 single nucleotide polymorphism (SNP and 3,669 InDels were identified for genotyping applications. Mapping of the sequence reads generated onto the assembled transcripts showed that 393 and 457 transcripts were overexpressed in the resistant (29H and susceptible genotype (Vf136, respectively. Transcripts involved in plant-pathogen interactions such as leucine rich proteins (LRR or plant growth regulators involved in plant adaptation to abiotic and biotic stresses were found to be differently expressed in the resistant line. The results reported here represent the most comprehensive transcript database developed so far in faba bean, providing valuable information that could be used to gain insight into the pathways involved in the resistance mechanism against A. fabae and to identify potential resistance genes to be further used in marker assisted selection.
Large-Scale Transcriptome Analysis in Faba Bean (Vicia faba L.) under Ascochyta fabae Infection
Ocaña, Sara; Seoane, Pedro; Bautista, Rocio; Palomino, Carmen; Claros, Gonzalo M.; Torres, Ana M.; Madrid, Eva
2015-01-01
Faba bean is an important food crop worldwide. However, progress in faba bean genomics lags far behind that of model systems due to limited availability of genetic and genomic information. Using the Illumina platform the faba bean transcriptome from leaves of two lines (29H and Vf136) subjected to Ascochyta fabae infection have been characterized. De novo transcriptome assembly provided a total of 39,185 different transcripts that were functionally annotated, and among these, 13,266 were assigned to gene ontology against Arabidopsis. Quality of the assembly was validated by RT-qPCR amplification of selected transcripts differentially expressed. Comparison of faba bean transcripts with those of better-characterized plant genomes such as Arabidopsis thaliana, Medicago truncatula and Cicer arietinum revealed a sequence similarity of 68.3%, 72.8% and 81.27%, respectively. Moreover, 39,060 single nucleotide polymorphism (SNP) and 3,669 InDels were identified for genotyping applications. Mapping of the sequence reads generated onto the assembled transcripts showed that 393 and 457 transcripts were overexpressed in the resistant (29H) and susceptible genotype (Vf136), respectively. Transcripts involved in plant-pathogen interactions such as leucine rich proteins (LRR) or plant growth regulators involved in plant adaptation to abiotic and biotic stresses were found to be differently expressed in the resistant line. The results reported here represent the most comprehensive transcript database developed so far in faba bean, providing valuable information that could be used to gain insight into the pathways involved in the resistance mechanism against A. fabae and to identify potential resistance genes to be further used in marker assisted selection. PMID:26267359
Variability in yield of faba beans (Vicia faba L.)
Grashoff, C.
1992-01-01
Yield variability is one of the major problems in growing faba beans. In this thesis, the effect of water supply pattern on yield variability of the crop is studied with experiments in the field and under controlled conditions, and with a simulation model. In a series of field experiments,
Genetic Diversity Assessment of Portuguese Cultivated Vicia faba L. through IRAP Markers
Directory of Open Access Journals (Sweden)
Diana Tomás
2016-03-01
Full Text Available Faba bean have been grown in Portugal for a long time and locally adapted populations are still maintained on farm. The genetic diversity of four Portuguese faba bean populations that are still cultivated in some regions of the country was evaluated using the Inter Retrotransposons Amplified Polymorphism (IRAP technique. It was shown that molecular markers based on retrotransposons previously identified in other species can be efficiently used in the genetic variability assessment of Vicia faba. The IRAP experiment targeting Athila yielded the most informative banding patterns. Cluster analysis using the neighbor-joining algorithm generated a dendrogram that clearly shows the distribution pattern of V. faba samples. The four equina accessions are separated from each other and form two distinct clades while the two major faba bean accessions are not unequivocally separated by the IRAP. Fluorescent In Situ Hybridization (FISH analysis of sequences amplified by IRAP Athila revealed a wide distribution throughout V. faba chromosomes, confirming the whole-genome coverage of this molecular marker. Morphological characteristics were also assessed through cluster analysis of seed characters using the unweighted pair group method arithmetic average (UPGMA and principal component analysis (PCA, showing a clear discrimination between faba bean major and equina groups. It was also found that the seed character most relevant to distinguish accessions was 100 seed weight. Seed morphological traits and IRAP evaluation give similar results supporting the potential of IRAP analysis for genetic diversity studies.
Induction of sister-chromatid exchanges in Vicia faba by arsenic-contaminated drinking water.
Gómez-Arroyo, S; Hernández-García, A; Villalobos-Pietrini, R
1988-07-01
Arsenic-contaminated drinking water from various towns of Comarca Lagunera, Coahuila, Mexico, was tested for its ability to induce sister-chromatid exchanges (SCE) in Vicia faba. 3-h treatments were applied and the differential staining technique of Tempelaar et al. (1982) was used. Atomic absorption spectrophotometry showed that the arsenic concentration in drinking water was 0.11-0.695 ppm, well over the maximum limit of 0.05 ppm (EPA, 1984). In all cases the SCE frequencies were significantly different from the controls. Some concentrations (0.2, 0.3, 0.5 and 1.0 ppm) of sodium arsenate (V) and potassium arsenite (III) were also applied to Vicia faba and all produced significant SCE frequencies, except 0.2 ppm of sodium arsenate.
Rhizobium anhuiense sp. nov., isolated from effective nodules of Vicia faba and Pisum sativum.
Zhang, Yu Jing; Zheng, Wen Tao; Everall, Isobel; Young, J Peter W; Zhang, Xiao Xia; Tian, Chang Fu; Sui, Xin Hua; Wang, En Tao; Chen, Wen Xin
2015-09-01
Four rhizobia-like strains, isolated from root nodules of Pisum sativum and Vicia faba grown in Anhui and Jiangxi Provinces of China, were grouped into the genus Rhizobium but were distinct from all recognized species of the genus Rhizobium by phylogenetic analysis of 16S rRNA and housekeeping genes. The combined sequences of the housekeeping genes atpD, recA and glnII for strain CCBAU 23252(T) showed 86.9 to 95% similarity to those of known species of the genus Rhizobium. All four strains had nodC and nifH genes and could form effective nodules with Pisum sativum and Vicia faba, and ineffective nodules with Phaseolus vulgaris, but did not nodulate Glycine max, Arachis hypogaea, Medicago sativa, Trifolium repens or Lablab purpureus in cross-nodulation tests. Fatty acid composition, DNA-DNA relatedness and a series of phenotypic tests also separated these strains from members of closely related species. Based on all the evidence, we propose a novel species, Rhizobium anhuiense sp. nov., and designate CCBAU 23252(T) ( = CGMCC 1.12621(T) = LMG 27729(T)) as the type strain. This strain was isolated from a root nodule of Vicia faba and has a DNA G+C content of 61.1 mol% (Tm).
Lepse, Līga; Dane, Sandra; Zeipiņa, Solvita; Domínguez-Perles, Raul; Rosa, Eduardo As
2017-10-01
Monoculture is used mostly in conventional agriculture, where a single crop is cultivated on the same land for a period of at least 12 months. In an organic and integrated growing approach, more attention is paid to plant-environment interactions and, as a result, diverse growing systems applying intercropping, catch crops, and green manure are being implemented. Thus, field experiments for evaluation of vegetable/faba bean full intercropping efficiency, in terms of vegetable and faba bean yield and protein content, were set up during two consecutive growing seasons (2014 and 2015). Data obtained showed that the most efficient intercropping variants were cabbage/faba bean (cabbage yield 1.27-2.91 kg m-2 , immature faba bean pods 0.20-0.43 kg m-2 ) and carrot/faba bean (carrot yield 1.67-2.28 kg m-2 , immature faba bean pods 0.10-0.52 kg m-2 ), whilst onion and faba bean intercrop is not recommended for vegetable growing since it induces a very low onion yield (0.66-1.09 kg m-2 ), although the highest immature faba bean pod yield was found in the onion/faba bean intercropping scheme (up to 0.56 kg m-2 ). Vegetable/faba bean intercropping can be used in practical horticulture for carrot and cabbage growing in order to ensure sustainable farming and environmentally friendly horticultural production. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Molecular tools for utilization of mitochondrial diversity in faba bean (Vicia faba
Directory of Open Access Journals (Sweden)
Aleksić Jelena M.
2014-01-01
Full Text Available We performed in silico PCR analyses utilizing complete mitochondrial (mtDNA genome sequences of faba bean (Vicia faba and two related species, Vigna angularis and Vigna radiata, currently available in GenBank, to infer whether 15 published universal primer pairs for amplification of all 14 cis-spliced introns in genes of NADH subunits (nad genes are suitable for V. faba and related species. Then, we tested via PCR reactions whether seven out of 15 primer pairs would generate PCR products suitable for further manipulation in 16 genotypes of V. faba representing all botanical varieties of this species (major, minor, equina and subsp. paucijuga of various levels of improvement (traditional and improved cultivars originating from Europe, Africa, Asia and south America. We provide new PCR primers for amplification of nad1 intron 2/3 in V. faba, and demonstrate intraspecific variability in primary nucleotide sequences at this locus. Based on outcomes of both in silico predictions and PCR amplification, we report a set of PCR primers for amplification of five introns in nad genes that are promising molecular tools for future phylogeographic and other studies in this species for which unambiguous data on wild ancestors, centre of origin and domestication are lacking. [Projekat Ministarstva nauke Republike Srbije, br. 173005
Anjum, Naser A.; Singh, Neetu; Singh, Manoj K.; Shah, Zahoor A.; Duarte, Armando C.; Pereira, Eduarda; Ahmad, Iqbal
2013-07-01
Adsorbents based on single-bilayer graphene oxide sheet (hereafter termed "graphene oxide") are widely used in contaminated environments cleanup which may easily open the avenues for their entry to different environmental compartments, exposure to organisms and their subsequent transfer to human/animal food chain. Considering a common food crop—faba bean ( Vicia faba L.) germinating seedlings as a model plant system, this study assesses the V. faba-tolerance to different concentrations (0, 100, 200, 400, 800, and 1600 mg L-1) of graphene oxide (0.5-5 μm) and evaluates glutathione (γ-glutamyl-cysteinyl-glycine) redox system significance in this context. The results showed significantly increased V. faba sensitivity under three graphene oxide concentrations (in order of impact: 1,600 > 200 > 100 mg graphene oxide L-1), which was accompanied by decreased glutathione redox (reduced glutathione-to-oxidized glutathione) ratio, reduced glutathione pool, as well as significant and equally elevated activities of glutathione-regenerating (glutathione reductase) and glutathione-metabolizing (glutathione peroxidase; glutathione sulfo-transferase) enzymes. Contrarily, the two graphene oxide concentrations (in order of impact: 800 > 400 graphene oxide mg L-1) yielded promising results; where, significant improvements in V. faba health status (measured as increased graphene oxide tolerance) were clearly perceptible with increased ratio of the reduced glutathione-to-oxidized glutathione, reduced glutathione pool and glutathione reductase activity but decreased activities of glutathione-metabolizing enzymes. It is inferred that V. faba seedlings-sensitivity and/or tolerance to graphene oxide concentrations depends on both the cellular redox state (reduced glutathione-to-oxidized glutathione ratio) and the reduced glutathione pool which in turn are controlled by a finely tuned modulation of the coordination between glutathione-regenerating and glutathione-metabolizing enzymes.
Directory of Open Access Journals (Sweden)
Salem S. Alghamdi
2012-12-01
Full Text Available Sequence-related amplified polymorphism (SRAP markers were used to assess the genetic diversity and relationship among 58 faba bean (Vicia faba L. genotypes. Fourteen SRAP primer combinations amplified a total of 1036 differently sized well-resolved peaks (fragments, of which all were polymorphic with a 0.96 PIC value and discriminated all of the 58 faba bean genotypes. An average pairwise similarity of 21% was revealed among the genotypes ranging from 2% to 65%. At a similarity of 28%, UPGMA clustered the genotypes into three main groups comprising 78% of the genotypes. The local landraces and most of the Egyptian genotypes in addition to the Sudan genotypes were grouped in the first main cluster. The advanced breeding lines were scattered in the second and third main clusters with breeding lines from the ICARDA and genotypes introduced from Egypt. At a similarity of 47%, all the genotypes formed separated clusters with the exceptions of Hassawi 1 and Hassawi 2. Group analysis of the genotypes according to their geographic origin and type showed that the landraces were grouped according to their origin, while others were grouped according to their seed type. To our knowledge, this is the first application of SRAP markers for the assessment of genetic diversity in faba bean. Such information will be useful to determine optimal breeding strategies to allow continued progress in faba bean breeding.
Directory of Open Access Journals (Sweden)
Runqiang Yang
2015-06-01
Full Text Available The γ-aminobutyric acid (GABA is a non-protein amino acid with some functional properties for human health. Its content is usually lower in plant seeds. Hypoxia or salt (NaCl stress is an effective way for accumulating GABA during seed germination. However, NaCl stress on GABA accumulation under hypoxia is currently infrequent. The effect of NaCl on GABA accumulation in germinating faba bean (Vicia faba L. under hypoxia was therefore investigated in this study. Faba bean seeds were steeped in citric acid buffer (pH 3.5 containing NaCl with a final O2 concentration of 5.5 mg L-1 and germinated for 5 d. Results showed that 60 mmol L-1 NaCl was the optimum concentration for GABA accumulation in germinating faba beans under hypoxia. Germination for 5 d under hypoxia-NaCl stress was less beneficial for GABA accumulation than only hypoxia (control. Polyamine degradation pathway played a more important role for accumulating GABA in germinating faba bean as an adaptive response to NaCl stress. Removing NaCl significantly increased GABA content, while it decreased glutamate decarboxylase (GAD activity. Simultaneously, polyamine was accumulated, which might be related to the enhancement of physiological activity after recovery. When treated with aminoguanidine (AG for 3 d, GABA content decreased by 29.82%. These results indicated that the tolerance ability of GABA shunt to NaCl stress was weaker than that of polyamine degradation pathway. The NaCl treatment for 3 d under hypoxia could raise the contribution ratio of polyamine degradation pathway for GABA accumulation. The contribution ratio of polyamine degradation pathway for GABA formation was 29.82% when treated for at least 3 d
Mathematical modeling of biological growth for some Vicia faba varieties
Ionel, Samfira; Andreea, Ghica; Marius, Boldea; Monica, Butnariu; Marius, Sendroni; Andrei, M.-Kiss
2013-10-01
Vicia faba is one of the legume species of importance for human and animal nutrition. Over the past decade, the areas cultivated with this species have significantly increased. Given that the levels of the yield and quality obtained from this species depend largely on the specific soil and climate conditions, the present paper focuses on the study of the morpho-productive features under the conditions in Banat Plain, in the west of Romania. A collection of varieties and genetic lines was studied, with focus on the interdependence between plant height, characteristics of the foliage and in the end the foliar surface of the leaf and of the entire plant. The observations led to the conclusion that variety Melodie has the best response of biological growth on the plain.
Genetic diversity of Palestine landraces of faba bean (Vicia faba) based on RAPD markers.
Basheer-Salimia, R; Shtaya, M; Awad, M; Abdallah, J; Hamdan, Y
2013-09-03
Until now, neither phenotypic nor molecular approaches have been used to characterize the landraces of Palestine faba beans (Vicia faba). We used PCR-based RAPD markers to determine the genetic diversity and relatedness among 26 Palestinian faba bean landraces (traditional farmers' varieties) from 8 localities in the West Bank, Palestine. In tests with 37 primers, 14 generated no polymorphic bands, 12 exhibited weak and unclear products, and 11 primers produced good amplification products with high intensity and pattern stability. Ninety-four DNA fragments (loci) were detected, with an average of 8.54 loci per primer and size ranging from 160 to 1370 bp. A minimum of 4 and a maximum of 14 DNA fragments were obtained using (OPA-05 and OPA-09) and (BC-261) primers, respectively. The maximum percentage of polymorphic markers was 71.4 (BC-298) and the minimum was 50.0 (OPA-05, -09, -16). The 11 primers exhibited relatively high collective resolving power (Rp) values of 26.316, and varied from 0.154 for the OPA-09 primer to 5.236 for the BC-261, with an overall mean of 2.392. The primers BC-261, -322, and -298 were found to be the most useful RAPD primers to assess the genetic diversity of Palestinian faba beans, as they revealed relatively high Rp rates (5.236, 3.618, and 3.150, respectively). Based on the Jaccard coefficient, the genetic distance ranged from 0.358 to 0.069, with a mean of 0.213. We conclude that the RAPD technique is useful for determining genetic diversity and for developing suitable fingerprints for faba bean landraces grown in Palestine.
Directory of Open Access Journals (Sweden)
B. Lorestani
2012-11-01
Full Text Available Pollution results when a change in the environment harmfully affects the quality of human life including effect on animals, microorganisms and plants. Among the broad range of organic pollutants contaminating soil-water environment, polycyclic aromatic hydrocarbons are of great environment concern. Oil contaminated soil will affect germination, plant height, leaf area and biomass production. The aim of this research was to elucidate effects of oil pollution on morphological characteristics in Fabaceae family. For this purpose species of Faba vulgaris and Vicia ervilia were planted in different concentrations of oil in soil. For morphological studies, studied species were removed from polluted and non polluted soils separately and some morphological characters were studied in these species, then these characters were compared in plants, collected from polluted and non polluted soil. Finally, the level of significance of these differences was elucidated by using of SPSS. Obtained results showed that oil pollution can cause some abnormalities in structure of vegetative parts in plants grown on polluted soils. Decreasing of plant length and stem diameter and changing the leaf shape was among the most important effects of oil on morphological characteristics in Faba vulgaris and Vicia ervilia.
[Effect of soil compaction on Vicia faba of growth in the Loess Plateau].
Nan, Zhibiao; Zhao, Hongyang; Nie, Bin
2002-08-01
The effect of soil compaction on the growth of Vicia faba was studied by pot experiment, field plot experiment, and farmers' field production during two consecutive years. The results showed that increasing soil bulk density at 0-7 cm depth significantly decreased the root and shoot dry weight per plant, increased plant mortality caused by Fusarium species, and decreased seed yields. Field experiments indicated that compared to the plants grown on the plots with soil bulk density of 1.55 and 1.64 g.cm-3, the root and shoot dry weight of plants grown on the plots with soil bulk density of 1.84 g.cm-3 decreased by 30.8% and 27.9%, respectively, while the plant mortality rate increased by 21.0-48.7%, and seed yields decreased by 19.8%. The trials conducted on eight farmers' land illustrated that there existed significant negative correlations between soil bulk density in Spring and root and shoot dry weight of Vicia faba seedlings, and between soil bulk density in Autumn and seed yields. The causes of high soil compaction were discussed, and suggestions for improving soil quality were presented.
Directory of Open Access Journals (Sweden)
Jiaojiao Wang
2014-02-01
Full Text Available To analyze the nutritional composition of faba bean (Vicia faba L. seed, estimation models were developed for protein, starch, oil, and total polyphenol using near infrared spectroscopy (NIRS. Two hundred and forty-four samples from twelve producing regions were measured in both milled powder and intact seed forms. Partial least squares (PLS regression was applied for model development. The model based on ground seed powder was generally superior to that based on the intact seed. The optimal seed powder-based models for protein, starch, and total polyphenol had coefficients of correlation (r2 of 0.97, 0.93 and 0.89, respectively. The relationship between nutrient contents and twelve producing areas was determined by two-step cluster analysis. Three distinct groupings were obtained with region-constituent features, i.e., Group 1 of high oil, Group 2 of high protein, and Group 3 of high starch as well as total polyphenol. The clustering accuracy was 79.5%. Moreover, the nutrition contents were affected by seeding date, longitude, latitude, and altitude of plant location. Cluster analysis revealed that the differences in the seed were strongly influenced by geographical factors.
Energy Technology Data Exchange (ETDEWEB)
Foltete, Anne-Sophie, E-mail: as.foltete@yahoo.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Masfaraud, Jean-Francois, E-mail: masfa@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Bigorgne, Emilie, E-mail: emilie.bigorgne@umail.univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Nahmani, Johanne, E-mail: Johanne.nahmani@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Chaurand, Perrine, E-mail: chaurand@cerege.fr [Centre Europeen de Recherches et d' Enseignement des Geosciences de l' Environnement (CEREGE), UMR 6635 CNRS/Aix-Marseille Universite, Europole de l' Arbois, 13545 Aix-en-Provence (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France)
2011-10-15
Mineral sunscreen nanocomposites, based on a nano-TiO{sub 2} core, coated with aluminium hydroxide and dimethicone films, were submitted to an artificial ageing process. The resulting Altered TiO{sub 2} Nanocomposites (ATN) were then tested in the liquid phase on the plant model Vicia faba, which was exposed 48 h to three nominal concentrations: 5, 25 and 50 mg ATN/L. Plant growth, photosystem II maximum quantum yield, genotoxicity (micronucleus test) and phytochelatins levels showed no change compared to controls. Oxidative stress biomarkers remained unchanged in shoots while in roots, glutathione reductase activity decreased at 50 mg ATN/L and ascorbate peroxidase activity decreased for 5 and 25 mg ATN/L. Nevertheless, despite the weak response of biological endpoints, ICP-MS measurements revealed high Ti and Al concentrations in roots, and X-ray fluorescence micro-spectroscopy revealed titanium internalization in superficial root tissues. Eventual long-term effects on plants may occur. - Highlights: > TiO{sub 2}-containing sunscreen nanocomposites were artificially aged. > Vicia faba was exposed 48 h to the alteration byproducts in liquid phase. > Few endpoints were modified significantly from control. > A clogging on the roots and titanium penetration in tissues were suspected. > Eventual long-term effects of the particles may occur. - Artificially aged TiO{sub 2}-containing sunscreen nanocomposites caused few damages to Vicia faba in 48 h exposure, but particles clogged on roots and Ti entered the root tissues.
Lead-induced DNA damage in Vicia faba root cells: potential involvement of oxidative stress.
Pourrut, Bertrand; Jean, Séverine; Silvestre, Jérôme; Pinelli, Eric
2011-12-24
Genotoxic effects of lead (0-20μM) were investigated in whole-plant roots of Vicia faba L., grown hydroponically under controlled conditions. Lead-induced DNA damage in V. faba roots was evaluated by use of the comet assay, which allowed the detection of DNA strand-breakage and with the V. faba micronucleus test, which revealed chromosome aberrations. The results clearly indicate that lead induced DNA fragmentation in a dose-dependant manner with a maximum effect at 10μM. In addition, at this concentration, DNA damage time-dependently increased until 12h. Then, a decrease in DNA damages was recorded. The significant induction of micronucleus formation also reinforced the genotoxic character of this metal. Direct interaction of lead with DNA was also evaluated with the a-cellular comet assay. The data showed that DNA breakages were not associated with a direct effect of lead on DNA. In order to investigate the relationship between lead genotoxicity and oxidative stress, V. faba were exposed to lead in the presence or absence of the antioxidant Vitamin E, or the NADPH-oxidase inhibitor dephenylene iodonium (DPI). The total inhibition of the genotoxic effects of lead (DNA breakage and micronucleus formation) by these compounds reveals the major role of reactive oxygen species (ROS) in the genotoxicity of lead. These results highlight, for the first time in vivo and in whole-plant roots, the relationship between ROS, DNA strand-breaks and chromosome aberrations induced by lead. Copyright © 2011 Elsevier B.V. All rights reserved.
Role of bioinoculants in development of salt-tolerance of Vicia faba ...
African Journals Online (AJOL)
Through biological inoculation technology, the bacterial-mycorrhizal-legume tripartite symbiosis in saline conditions was documented and the effects of dual inoculation with Azospirillum brasilense (NFB) and Arbuscular mycorrhizal (Am) fungus Glomus clarum on the host plants (Vicia faba) in pot cultures were investigated ...
Leeuwen, P. van; Jansman, A.J.M.; Wiebenga, J.; Koninkx, J.F.J.G.; Mouwen, J.M.V.M.
1995-01-01
The objective of the present study was to evaluate effects of condensed tannins in faba beans (Vicia faba L.) on morphological and functional variables of the small-intestinal mucosa of piglets. In an experiment with young piglets (8-17 kg body weight), fed on either a control diet or a diet
Webster, Ben; Gezan, Salvador; Bruce, Toby; Hardie, Jim; Pickett, John
2010-01-01
Ratios of volatile phytochemicals potentially offer a means for insects to recognise their host-plant species. However, for this to occur ratios of volatiles would need to be sufficiently consistent between plants and over time to constitute a host-characteristic cue. In this context we collected headspace samples from Vicia faba plants to determine how consistent ratios of key volatile phytochemicals used in host location by one of its insect pests, the black bean aphid, Aphis fabae, were. These were (E)-2-hexenal, (Z)-3-hexen-1-ol, 1-hexanol, benzaldehyde, 6-methyl-5-hepten-2-one, octanal, (Z)-3-hexen-1-yl acetate, (R)-linalool, methyl salicylate, decanal, undecanal, (E)-caryophyllene, (E)-beta-farnesene, (S)-germacrene D, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene, which had previously been found to be electrophysiologically and behaviourally active to A. fabae. Although the quantities of volatiles produced by V. faba showed large between plant and diurnal variation, correlations between quantities of compounds indicated that the ratios of certain pairs of volatiles were very consistent. This suggests that there is a host-characteristic cue available to A. fabae in the form of ratios of volatiles. 2009 Elsevier Ltd. All rights reserved.
Antioxidant Activities of Phenolic Compounds in Green and White Faba Bean (Vicia faba L.)
Yu-wei Luo; Wei-hua Xie; Xiao-xiao Jin; Qian (Janice) Wang; Zhen-ping Hao; Bei-bei Tao
2014-01-01
Polyphenols and tannins have implications for health and nutrition because of their antioxidant activities. Foods with high content of phenolics, such as fruits, vegetables, grains and legumes, show decreasing incidence of several diseases upon their consumption. However, there are limited reports on ant oxidative properties of tannins present in legumes. Faba bean seed has been known for high content of condensed tannin which is attributed as one of the ant nutritional factors in this highly...
Flores-Maya, Saúl; Gómez-Arroyo, Sandra; Calderón-Segura, María Elena; Villalobos-Pietrini, Rafael; Waliszewski, Stefan M; de la Cruz, Leticia Gómez
2005-03-01
The aim of our study was the induction of sister chromatid exchanges (SCE) in human lymphocytes in vitro and in root tip meristems of Vicia faba to evaluate the genotoxic effects of metribuzin and ametryn. Direct treatments of these herbicides on human lymphocytes in vitro applied 24 h after the beginning of culture did not induce SCE; however, they showed a cytotoxic effect in the cultures expressed as cellular death. On the contrary, when extracts of V. faba roots, treated for 4 h with metribuzin and ametryn (in vivo activation), were added to the lymphocyte cultures, SCEs were significantly induced with an asymptotic response. Negative responses appeared with the in vitro assays, in which metribuzin and ametryn were added directly to the 48 h lymphocyte cultures for 4 h. Nevertheless, in treatments in which the S10 metabolic mix was added, the SCE frequencies were significantly different to the control, although a concentration-response relationship was only observed with metribuzin. The results showed that both herbicides needed the V. faba metabolism to produce SCE in human lymphocyte cultures. Metribuzin and ametryn applied to V. faba root tip meristems for 4 h increased SCE frequency significantly, and a concentration-response relationship was observed with both herbicides.
Göl, Şurhan; Doğanlar, Sami; Frary, Anne
2017-05-11
Faba bean (Vicia faba L.) is an important legume species because of its high protein and starch content. Broad bean can be grown in different climatic conditions and is an ideal rotation crop because of the nitrogen fixing bacteria in its roots. In this work, 255 faba bean germplasm accessions were characterized using 32 SSR primers which yielded 302 polymorphic fragments. According to the results, faba bean individuals were divided into two main groups based on the neighbor-joining algorithm (r = 0.91) with some clustering based on geographical origin as well as seed size. Population structure was also determined and agreed with the dendrogram analysis in splitting the accessions into two subpopulations. Analysis of molecular variance (AMOVA) revealed high levels of within population genetic variation. Genetic similarity and geographical proximity were related with separation of European accessions from African and Asian ones. Interestingly, there was no significant difference between landrace (38%) and cultivar (40%) diversity indicating that genetic variability has not yet been lost due to breeding. A total of 44 genetically well-characterized faba bean individuals were selected for a core collection to be further examined for yield and nutritional traits.
Directory of Open Access Journals (Sweden)
Helena Łabuda
2012-12-01
Full Text Available This study, conducted during the period 2008–2009, related to the growth, flowering, pod set, and yield of faba bean (Vicia faba L. var. major cultivars and breeding lines. Biometric measurements, made on 20 randomly selected plants, included the following traits: plant height, number of branches per plant, number of inflorescences per plant and number of flowers per inflorescence, number of pods per plant: large pods (marketable, small pods (undeveloped, and pods with disease symptoms. Moreover, the following characters were determined: pod and seed weight per plant in faba bean plants harvested once at processing maturity of fresh green seeds, pod length, width and weight as well as single seed weight. The evaluated cultivars and breeding lines of faba bean were characterized by large variations in the most important commercial traits. The abundance and duration of flowering as well as the number and weight of pods per plant were clearly modified by weather factors during the growth of plants. The new breeding lines R-366/1 and R-384 as well as the cultivars 'Bachus' and 'Jankiel Biały' were characterized by quite stable pod and seed yield per plant. Single harvesting of faba bean pods for green seeds at green maturity stage produced positive results in the case of all cultivars and breeding lines investigated; marketable pods per plant accounted for 75–80% of the total number of pods.
Abd-Alla, Mohamed Hemida; El-Enany, Abdel-Wahab Elsadek; Nafady, Nivien Allam; Khalaf, David Mamdouh; Morsy, Fatthy Mohamed
2014-01-20
Egyptian soils are generally characterized by slightly alkaline to alkaline pH values (7.5-8.7) which are mainly due to its dry environment. In arid and semi-arid regions, salts are less concentrated and sodium dominates in carbonate and bicarbonate forms, which enhance the formation of alkaline soils. Alkaline soils have fertility problems due to poor physical properties which adversely affect the growth and the yield of crops. Therefore, this study was devoted to investigating the synergistic interaction of Rhizobium and arbuscular mycorrhizal fungi for improving growth of faba bean grown in alkaline soil. A total of 20 rhizobial isolates and 4 species of arbuscular mycorrhizal fungi (AMF) were isolated. The rhizobial isolates were investigated for their ability to grow under alkaline stress. Out of 20 isolates 3 isolates were selected as tolerant isolates. These 3 rhizobial isolates were identified on the bases of the sequences of the gene encoding 16S rRNA and designated as Rhizobium sp. Egypt 16 (HM622137), Rhizobium sp. Egypt 27 (HM622138) and Rhizobium leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The best alkaline tolerant was R. leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The effect of R. leguminosarum bv. viciae STDF-Egypt 19 and mixture of AMF (Acaulospora laevis, Glomus geosporum, Glomus mosseae and Scutellospora armeniaca) both individually and in combination on nodulation, nitrogen fixation and growth of Vicia faba under alkalinity stress were assessed. A significant increase over control in number and mass of nodules, nitrogenase activity, leghaemoglobin content of nodule, mycorrhizal colonization, dry mass of root and shoot was recorded in dual inoculated plants than plants with individual inoculation. The enhancement of nitrogen fixation of faba bean could be attributed to AMF facilitating the mobilization of certain elements such as P, Fe, K and other minerals that involve in synthesis of nitrogenase and leghaemoglobin. Thus it is
Directory of Open Access Journals (Sweden)
D. Gatta
2010-04-01
Full Text Available 18 Massese lactating ewes, divided into 3 homogeneous groups for parity and milk yield, were used to evaluate the replacement effects of soybean meal by Faba bean (Vicia faba minor and Pea (Pisum sativum seeds. During a 70 days trial (beginning after weaning: 30±1.5 days after lambing animals were fed three isonitrogenous and isocaloric diets. Each diet was characterised by the presence of only one protein feed. The diets consisted of alfalfa hay (1.1 kg/head/d and a decreasing amount of mixed feed (from 1.1 to 0.7 kg/head/d to fit animals’ requirements. Milk yield, milk chemical composition, animals live weight and BCS, health state and hematochemical parameters were regularly monitored. No diets palatability problems were detected. No significant differences resulted for live weight, BCS, milk yield and milk chemical composition, except for milk protein: higher for faba bean (6.54% and soybean (6.39% respect pea (5.66% diets, P<0.05. No differences resulted for blood parameters too and no clinical signs of illness were observed. Therefore faba bean and pea seeds seem to be able to replace the soybean well.
Directory of Open Access Journals (Sweden)
F Eslami Khalili
2016-05-01
Full Text Available In order to study the intercropping of barley (Hordeum vulgare L. and faba bean (Vicia faba L. an experiment was conducted as factorial based on randomized complete block design with two factors and three replications at Sari Agricultural Science and Natural Resources University during 2009. The first factor was two seed ratios include D1: 75 and 150 kg.ha-1 of faba bean and barley, respectively (optimum seed ratio and D2: 100 and 200 kg.ha-1 of faba bean and barley, respectively (high seed ratio and the second factor consisted of different planting ratio, P1: sole cropping of faba bean, P2: 50% faba bean + 50 % barley, P3: 75% faba bean + 25% barley, P4: 25% faba bean + 75% barley, P5: sole cropping of barley. Land equivalent ratio (LER indicated that intercropping of 25% faba bean + 75% barley was better than 50% faba bean + 50% barley. According to significant interaction effects of density and intercropping ratio in terms of seed yield and some competitive indices for both crop species, the highest barley and faba bean yield (3306.66 and 4884.56 kg.ha-1, respectively were observed in sole cropping with high density. In this experiment, the 75 % faba bean + 25 % mixture with high density was recorded highest intercropping yield, barley aggressivity value and 27% yield increases of barley in mix-proportion compared to sole crops. Also, the most of faba bean aggressivity value and faba bean yield increases in mix-proportion compared to sole crop were obtained when 25% faba bean + 75% barley mixture with optimum density was used. Furthermore the 75% faba bean + 25% barley treatment plus optimum seed ratio had highest system productivity index.
Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P
2008-08-09
The development of genetic markers is complex and costly in species with little pre-existing genomic information. Faba bean possesses one of the largest and least studied genomes among cultivated crop plants and no gene-based genetic maps exist. Gene-based orthologous markers allow chromosomal regions and levels of synteny to be characterised between species, reveal phylogenetic relationships and chromosomal evolution, and enable targeted identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba), using an F6 population developed from a cross between the lines Vf6 (equina type) and Vf27 (paucijuga type). Of 796 intron-targeted amplified polymorphic (ITAP) markers screened, 151 markers could be used to construct a comparative genetic map. Linkage analysis revealed seven major and five small linkage groups (LGs), one pair and 12 unlinked markers. Each LG was comprised of three to 30 markers and varied in length from 23.6 cM to 324.8 cM. The map spanned a total length of 1685.8 cM. A simple and direct macrosyntenic relationship between faba bean and Medicago truncatula was evident, while faba bean and lentil shared a common rearrangement relative to M. truncatula. One hundred and four of the 127 mapped markers in the 12 LGs, which were previously assigned to M. truncatula genetic and physical maps, were found in regions syntenic between the faba bean and M. truncatula genomes. However chromosomal rearrangements were observed that could explain the difference in chromosome numbers between these three legume species. These rearrangements suggested high conservation of M. truncatula chromosomes 1, 5 and 8; moderate conservation of chromosomes 2, 3, 4 and 7 and no conservation with M. truncatula chromosome 6. Multiple PCR amplicons and comparative mapping were suggestive of small-scale duplication events in faba bean
Directory of Open Access Journals (Sweden)
Avila Carmen M
2008-08-01
Full Text Available Abstract Background The development of genetic markers is complex and costly in species with little pre-existing genomic information. Faba bean possesses one of the largest and least studied genomes among cultivated crop plants and no gene-based genetic maps exist. Gene-based orthologous markers allow chromosomal regions and levels of synteny to be characterised between species, reveal phylogenetic relationships and chromosomal evolution, and enable targeted identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba, using an F6 population developed from a cross between the lines Vf6 (equina type and Vf27 (paucijuga type. Results Of 796 intron-targeted amplified polymorphic (ITAP markers screened, 151 markers could be used to construct a comparative genetic map. Linkage analysis revealed seven major and five small linkage groups (LGs, one pair and 12 unlinked markers. Each LG was comprised of three to 30 markers and varied in length from 23.6 cM to 324.8 cM. The map spanned a total length of 1685.8 cM. A simple and direct macrosyntenic relationship between faba bean and Medicago truncatula was evident, while faba bean and lentil shared a common rearrangement relative to M. truncatula. One hundred and four of the 127 mapped markers in the 12 LGs, which were previously assigned to M. truncatula genetic and physical maps, were found in regions syntenic between the faba bean and M. truncatula genomes. However chromosomal rearrangements were observed that could explain the difference in chromosome numbers between these three legume species. These rearrangements suggested high conservation of M. truncatula chromosomes 1, 5 and 8; moderate conservation of chromosomes 2, 3, 4 and 7 and no conservation with M. truncatula chromosome 6. Multiple PCR amplicons and comparative mapping were suggestive of
Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals
Jansman, A.J.M.
1993-01-01
Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid hypertrophy of the parotid glands in rats and increase
CAPs markers to assist selection for low vicine and convicine contents in faba bean (Vicia faba L.).
Gutierrez, N; Avila, C M; Duc, G; Marget, P; Suso, M J; Moreno, M T; Torres, A M
2006-12-01
The antinutritional factors (ANFs) present in Vicia spp. seeds are a major constraint to the wider utilization of these crops as grain legumes. In the case of faba bean (Vicia faba L.), a breeding priority is the absence vicine and convicine (v-c); responsible for favism in humans and for the reduced animal performance or low egg production in laying hens. The discovery of a spontaneous mutant allele named vc-, which induces a 10-20 fold reduction of v-c contents, may facilitate the process. However, the high cost and difficulty of the chemical detection of v-c seriously restricts the advances in breeding-selection. To identify random amplified polymorphic DNA (RAPD) markers linked to this gene, we have analysed an F(2 )population derived from a cross between a line with high v-c content (Vf6) and the vc- genotype (line 1268). Quantification of v-c was done by spectrophotometry on the parents and the F(2 )population (n = 136). By using bulked segregant analysis (BSA), two RAPD markers linked in coupling and repulsion phase to the allele vc- were identified and further converted into sequence characterized amplified regions (SCARs). Amplification of SCARS was more consistent, although the initial polymorphism between pools was lost. To recover the polymorphisms several approaches were explored. Restriction digestion with HhaI (for SCAR SCH01(620)) and RsaI (for SCAR SCAB12(850)) revealed clear differences between the parental lines. The simultaneous use of the two cleavage amplified polymorphism (CAP) markers will allow the correct fingerprinting of faba bean plants and can be efficiently used in breeding selection to track the introgression of the vc- allele to develop cultivars with low v-c content and improved nutritional value.
Seed Filling Trend of Faba bean (Vicia faba L. as Affected by Planting Date and Density
Directory of Open Access Journals (Sweden)
Ali Rahemi Karizaki
2016-03-01
Full Text Available To investigate the effect of planting date and plant density on phenology, seed yield, its components, seed filling rate and grain filling period of faba bean, a factorial experiment based on randomized complete block design with four replications was conducted at Research Farm of Agricultural Sciences and Natural Resources of Gonbad University, Iran, during growing season of 2012-2013. The factors were three planting dates (4th of November, 4th of December 2013 and 3th of January 2014 and four planting densities (8, 12, 16 and 18 plant/m2. The results showed that planting dates significantly affected on phenology, yield and its components, seed filling rate and periods while the effect of plant density on seed filling period was not significant. Comparison of sigmoid equation coefficients showed that seed filling rates in three planting dates were different. The highest seed filling rate was obtained in 3th of January and the lowest at November 4, planting dates. The effect of planting date on seed filling duration was also significant, but it was not on plant density. Regression analysis showed that increasing 0.01g seed growth rate in seed unit, resulted in seed weight increase by 45.11, 32.43 and 26.66 g for November 4, December 4 and January 3 planting dates respectively. Delaying planting dates decreased seed filling period by 8.53 days and seed weight by 0.27 g. due to its effect on day length and temperature changes. Delayed planting dates were more effective on the rate and period of seed filling and phenology of faba bean. Delaying in planting date increased time to emergence, while decreased seed filling period and seed yield because of coincidence of this period with high temperatures.
Structure and function of seed storage proteins in faba bean (Vicia faba L.).
Liu, Yujiao; Wu, Xuexia; Hou, Wanwei; Li, Ping; Sha, Weichao; Tian, Yingying
2017-05-01
The protein subunit is the most important basic unit of protein, and its study can unravel the structure and function of seed storage proteins in faba bean. In this study, we identified six specific protein subunits in Faba bean (cv. Qinghai 13) combining liquid chromatography (LC), liquid chromatography-electronic spray ionization mass (LC-ESI-MS/MS) and bio-information technology. The results suggested a diversity of seed storage proteins in faba bean, and a total of 16 proteins (four GroEL molecular chaperones and 12 plant-specific proteins) were identified from 97-, 96-, 64-, 47-, 42-, and 38-kD-specific protein subunits in faba bean based on the peptide sequence. We also analyzed the composition and abundance of the amino acids, the physicochemical characteristics, secondary structure, three-dimensional structure, transmembrane domain, and possible subcellular localization of these identified proteins in faba bean seed, and finally predicted function and structure. The three-dimensional structures were generated based on homologous modeling, and the protein function was analyzed based on the annotation from the non-redundant protein database (NR database, NCBI) and function analysis of optimal modeling. The objective of this study was to identify the seed storage proteins in faba bean and confirm the structure and function of these proteins. Our results can be useful for the study of protein nutrition and achieve breeding goals for optimal protein quality in faba bean.
Screening of faba bean (Vicia faba L.) accessions to acidity and aluminium stresses
Stoddard, Frederick L.
2017-01-01
Background Faba bean is an important starch-based protein crop produced worldwide. Soil acidity and aluminium toxicity are major abiotic stresses affecting its production, so in regions where soil acidity is a problem, there is a gap between the potential and actual productivity of the crop. Hence, we set out to evaluate acidity and aluminium tolerance in a range of faba bean germplasm using solution culture and pot experiments. Methods A set of 30 accessions was collected from regions where acidity and aluminium are or are not problems. The accessions were grown in solution culture and a subset of 10 was grown first in peat and later in perlite potting media. In solution culture, morphological parameters including taproot length, root regrowth and root tolerance index were measured, and in the pot experiments the key measurements were taproot length, plant biomass, chlorophyll concentration and stomatal conductance. Result Responses to acidity and aluminium were apparently independent. Accessions Dosha and NC 58 were tolerant to both stress. Kassa and GLA 1103 were tolerant to acidity showing less than 3% reduction in taproot length. Aurora and Messay were tolerant to aluminium. Babylon was sensitive to both, with up to 40% reduction in taproot length from acidity and no detectable recovery from Al3+ challenge. Discussion The apparent independence of the responses to acidity and aluminium is in agreement with the previous research findings, suggesting that crop accessions separately adapt to H+ and Al3+ toxicity as a result of the difference in the nature of soil parent materials where the accession originated. Differences in rankings between experiments were minor and attributable to heterogeneity of seed materials and the specific responses of accessions to the rooting media. Use of perlite as a potting medium offers an ideal combination of throughput, inertness of support medium, access to leaves for detection of their stress responses, and harvest of clean
Screening of faba bean (Vicia faba L. accessions to acidity and aluminium stresses
Directory of Open Access Journals (Sweden)
Kiflemariam Y. Belachew
2017-02-01
Full Text Available Background Faba bean is an important starch-based protein crop produced worldwide. Soil acidity and aluminium toxicity are major abiotic stresses affecting its production, so in regions where soil acidity is a problem, there is a gap between the potential and actual productivity of the crop. Hence, we set out to evaluate acidity and aluminium tolerance in a range of faba bean germplasm using solution culture and pot experiments. Methods A set of 30 accessions was collected from regions where acidity and aluminium are or are not problems. The accessions were grown in solution culture and a subset of 10 was grown first in peat and later in perlite potting media. In solution culture, morphological parameters including taproot length, root regrowth and root tolerance index were measured, and in the pot experiments the key measurements were taproot length, plant biomass, chlorophyll concentration and stomatal conductance. Result Responses to acidity and aluminium were apparently independent. Accessions Dosha and NC 58 were tolerant to both stress. Kassa and GLA 1103 were tolerant to acidity showing less than 3% reduction in taproot length. Aurora and Messay were tolerant to aluminium. Babylon was sensitive to both, with up to 40% reduction in taproot length from acidity and no detectable recovery from Al3+ challenge. Discussion The apparent independence of the responses to acidity and aluminium is in agreement with the previous research findings, suggesting that crop accessions separately adapt to H+ and Al3+ toxicity as a result of the difference in the nature of soil parent materials where the accession originated. Differences in rankings between experiments were minor and attributable to heterogeneity of seed materials and the specific responses of accessions to the rooting media. Use of perlite as a potting medium offers an ideal combination of throughput, inertness of support medium, access to leaves for detection of their stress responses, and
Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli
2015-03-01
There is a need to conduct research on the selection of microbial isolates from rhizosphere of plants growing on heavy metal contaminated soils for specific restoration programs. This article suggest a consortium of bacteria combining Rhizobium sp. CCNWSX0481, Rhizobium leguminosarum bv. viciae, Enterobacter cloacae and Pseudomonas sp. 2(2010) that was examined for the ability to promote Vicia faba.L. growth when cultivated on the vineyard of soil moderately contaminated with copper. Data showed that inoculation was significant in nodulation; it increases the number and the weight of nodules of 50%. Co-inoculation was also found to positively influence growth and seed yield, through increasing fresh shoot and fresh root weights by 33 and 26%, respectively, and through rising numbers of seed per pod and pods per plant. In contrast, co-inoculation produced a significant reduction of accumulated copper in roots attending 35%, however, the treatment revealed no significant effects on the copper contents in pods and seeds. The tested inoculum could be an option to promote V. faba growth and to enhance soil fertilization in moderate copper contaminated soils. Further studies on the influence of co-inoculation practices on copper migration in soil-plant systems are recommended to acquire more information for evaluation of this legume safety. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
National Research Council Canada - National Science Library
I.M. El-Metwally; M.T. Abdelhamid
2008-01-01
Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential...
DNA Damage in Vicia faba by Exposure to Agricultural Soils from Tlaxcala, Mexico.
Juárez-Santacruz, L; García-Nieto, E; García-Gallegos, E; Romo-Gómez, C; Ortiz-Ortiz, E; Costilla-Salazar, R; Luna-Zendejas, H S
2015-12-01
The aim of this research was to quantify some POPs, such as p,p' DDT, p,p' DDE, and PCBs in agricultural soils of Tlaxcala, Mexico and evaluate their capacity for eliciting DNA damage, using Vicia faba as bioindicator. The values of ΣDDTs and ΣPCBs ranged from 8-24 to 118-26,983 µg/kg, respectively. The samples T1 (HQ = 9.3) and T2 (HQ = 53.9) showed concentrations of ΣPCBs higher than Canadian guidelines (SQGE = 500 µg/kg). The genotoxicity testing produced percentages of DNA fragmentation higher than negative control and statistically significant (p < 0.05), both in agricultural soils and organic extracts. The soils T2, T3, N4, and N5 showed a DICA from 2.6 to 3.1 times, statistically higher (p < 0.05) than negative control. In general, the agricultural soils have greater genotoxic capacity than the organic extracts, suggesting a potential risk to biota that depends upon this ecosystem.
Helsper, J.P.F.G.; Loon, van Y.P.J.; Kwakkel, R.P.; Norel, van A.; Poel, van der A.F.B.
1996-01-01
Seeds from six pairs of near-isogenic lines of Vicia faba L., each pair consisting of a tannin-free (TF) and a tannin-containing (TC) partner line, were used to study the effect of breeding for the absence of condensed tannins on the seed content of dry matter (DM), crude protein (CP), and starch
Effect of fulvic acids on lead-induced oxidative stress to metal sensitive Vicia faba L. plant
Shahid, Muhammad; Dumat, Camille; Silvestre, Jérôme; Pinelli, Eric
2012-01-01
International audience; Lead (Pb) is a ubiquitous environmental pollutant capable to induce various morphological, physiological, and biochemical functions in plants. Only few publications focus on the influence of Pb speciation both on its phytoavailability and phytotoxicity. Therefore, Pb toxicity (in terms of lipid peroxidation, hydrogen peroxide induction, and photosynthetic pigments contents) was studied in Vicia faba plants in relation with Pb uptake and speciation. V. faba seedlings we...
Vicia faba Hypersensitivity and ASA Intolerance in a Farmer: A Case Report
Directory of Open Access Journals (Sweden)
Elisabetta Damiani
2011-01-01
Full Text Available The IgE-mediated allergic reactions to food are caused, generally, by ingestion. However, they can be rarely induced by exposure to airborne food particles through the handling or the cooking. Vicia faba is a vegetable which belongs to Legumes or Fabaceae family, Fabales order. Allergic reactions after ingestion of legumes and cases of asthma after exposure to the cooking vapors have been reported in the literature. A paper assessed the volatile substances (insect repellents released by V. faba. The authors demonstrated that this plant produces several chemical substances, such as small quantities of methyl salicylate. We describe a case of occupational allergy, induced by handling during picking up of fresh broad beans, in a farmer with history of adverse reaction after eating the cooked and raw vegetable.
Isolation and biological activity of a new plant growth regulator of Vicia faba L
Energy Technology Data Exchange (ETDEWEB)
Sembdner, G.; Dathe, W.; Bergner, C.; Roensch, H. (Akademie der Wissenschaften der DDR, Halle/Saale. Inst. fuer Biochemie der Pflanzen)
1983-01-01
Jasmonic acid was identified as a plant growth inhibitor of the pericarp of Vicia faba by means of gas-liquid chromatography, high resolution mass spectrometry as well as /sup 1/H and /sup 13/C NMR. The highest level of jasmonic acid was reached during intensive pericarp growth. Jasmonic acid is a plant growth inhibitor possessing a relative activity in the wheat seedling bioassay of 1-2.5 % compared to ABA (=100%). Contrary to ABA, jasmonic acid does not cause retardation of leaf emergence. In the dwarf rice gibberellin bioassay relative low concentrations of jasmonic acid inhibit both autonomous and GA/sub 3/-stimulated growth. Jasmonic acid does not influence seed germination of Amaranthus caudatus. The possible physiological role of jasmonic acid in the Vicia pericarp and the distribution in plants of this new plant growth regulator type are discussed.
Influence of salicylic acid on seed germination of Vicia faba L. under salt stress
Fatima Anaya; Rachid Fghire; Said Wahbi; Kenza Loutfi
2018-01-01
Seed germination is the critical stage for species survival. Salinity affects germination and seedling growth and yield of several crop species, such as broad bean. That is why this study was carried to evaluate the effects of NaCl on seed germination and influence of salicylic acid on seed in order to improving salt tolerant on broad bean. Vicia faba L. is an important pulse crop in the Mediterranean region. In many cases broad bean is grown on saline soils where growth and yield are limited...
Weihua, WU; Sarah M., ASSMANN; The Biological Laboratories, Harvard University:(Current)Biology Department, Pennsylvania State University
1993-01-01
The properties of photosynthetic O_2 evolution by mesophyll cell chloroplasts (MCC) and guard cell chloroplasts (GCC) isolated from protoplasts of Vicia faba L. have been studied and effects on O_2 evolution of factors known to regulate stomatal movements have been compared. The O_2 evolution of GCC was CO_2-dependent. The saturating light intensity for O_2 evolution was between 150 and 200 μmol m^ s^ for MCC and was between 400 and 1,000μmol m^ s^ for GCC. Light quality (red vs. blue) had no...
Faba beans (Vicia faba) in dairy cow diet: effect on milk production and quality
Rosanna Scipioni; Maurizio Moschini; Domenico Pietro Lo Fiego; Francesco Masoero; Michele Comellini; Luisa Antonella Volpelli
2010-01-01
The use of alternative plant proteins in place of the soybean meal protein in diets for farmed animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among the possible alternatives, the heat-processed (flaked) faba beans appears interesting for dairy cow diet. Two consecutive experiments were carried out to test flaked faba beans as a partial substitute for soybean meal in the diet of Reggiana breed dairy cows producing milk for Parmigiano-Regg...
Evaluation of dehulled faba bean ( Vicia faba cv. Fiord) as a protein ...
African Journals Online (AJOL)
Fiord) as a protein source for laying hens. ... South African Journal of Animal Science ... Although food intake increased linearly with faba bean inclusion, reflecting a need by the hens to consume more in an attempt to obtain sufficient of some unidentified limiting nutrient, laying performance was the same on all feeds in the ...
Evaluation of dehulled faba bean (Vicia faba cv. Fiord) as a protein ...
African Journals Online (AJOL)
p2492989
Abstract. Dehulled faba beans were evaluated as an alternative to soybeans as a protein source for laying hens using 240 ... industry that is being forced to exclude animal protein sources in animal feeds. ... Wilson &. Teague (1974) reported that this latter rate of inclusion had no effect on laying performance or food intake,.
Evaluation of faba bean (Vicia faba cv. Fiord) as a protein source for ...
African Journals Online (AJOL)
p2492989
linearly, and food intake increased linearly, with increasing faba bean content, but when the feeds were ... higher proanthocyanidin (condensed tannin) content of the hulls of these varieties compared with the ..... qualitative treatments such as sex, vaccine, strain or growth promoter and are inappropriate for response.
Faba beans (Vicia faba in dairy cow diet: effect on milk production and quality
Directory of Open Access Journals (Sweden)
Rosanna Scipioni
2010-02-01
Full Text Available The use of alternative plant proteins in place of the soybean meal protein in diets for farmed animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among the possible alternatives, the heat-processed (flaked faba beans appears interesting for dairy cow diet. Two consecutive experiments were carried out to test flaked faba beans as a partial substitute for soybean meal in the diet of Reggiana breed dairy cows producing milk for Parmigiano-Reggiano cheese-making. In both experiments a “Control” concentrate (12% soybean meal, no faba beans was compared with a “Faba” concentrate (7.5% soybean meal and 10% flaked faba beans. Forages fed to animals were hay (mixed grass and alfalfa plus mixed grass in experiment 1, hay only in experiment 2. Milk yield and quality and the characteristics of grab faecal samples as empirical indicators of digestibility, were similar between feeding groups. The milk urea content was slightly lower in the “Faba” group, particularly in experiment 2 (“Control” vs “Faba”: 34.6 vs 32.9 mg/dL in experiment 1, P<0.1; 27.4 vs 23.4 mg/dL in experiment 2, P<0.01; the plasma urea content in experiment 2 confirmed the trend observed in milk (3.9 vs 3.0 mmol/L, P<0.01. The inclusion of faba beans, within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation, could represent a feasible opportunity for a partial substitution of soybean meal.
Winnicki, Konrad; Żabka, Aneta; Bernasińska, Joanna; Matczak, Karolina; Maszewski, Janusz
2015-06-01
In plants, phosphorylated MAPKs display constitutive nuclear localization; however, not all studied plant species show co-localization of activated MAPKs to mitotic microtubules. The mitogen-activated protein kinase (MAPK) signaling pathway is involved not only in the cellular response to biotic and abiotic stress but also in the regulation of cell cycle and plant development. The role of MAPKs in the formation of a mitotic spindle has been widely studied and the MAPK signaling pathway was found to be indispensable for the unperturbed course of cell division. Here we show cellular localization of activated MAPKs (dually phosphorylated at their TXY motifs) in both interphase and mitotic root meristem cells of Lupinus luteus, Pisum sativum, Vicia faba (Fabaceae) and Lycopersicon esculentum (Solanaceae). Nuclear localization of activated MAPKs has been found in all species. Co-localization of these kinases to mitotic microtubules was most evident in L. esculentum, while only about 50% of mitotic cells in the root meristems of P. sativum and V. faba displayed activated MAPKs localized to microtubules during mitosis. Unexpectedly, no evident immunofluorescence signals at spindle microtubules and phragmoplast were noted in L. luteus. Considering immunocytochemical analyses and studies on the impact of FR180204 (an inhibitor of animal ERK1/2) on mitotic cells, we hypothesize that MAPKs may not play prominent role in the regulation of microtubule dynamics in all plant species.
Antifungal activity of acetone extracts from Punica granatum L., Quercus suber L. and Vicia faba L.
Akroum, S
2017-03-01
Human and animal mycoses become more frequent and more resistant to traditional treatments. In this work, we tested the in vitro antifungal activity of acetonic extracts of Punica granatum L., Quercus suber L. and Vicia faba L. against seven pathogen fungi and the in vivo antifungal activity against Candida albicans and Trichophyton mentagrophytes. The phytochemical screening was also carried out and showed that the extracts contained mainly proanthocyanidins. Other polyphenols were also present but in low quantity. The acetone extract of V. faba L. gave a good in vitro inhibition of yeasts and was the most active for treating candidiasis in mice. It decreased the percentage of mortality with only 20μg. But the in vivo antifungal activity of this extract on T. mentagrophytes was low. It only showed a small diminution of crusting and erythema after the administration of 100μg. On the contrary, the acetone extracts of P. granatum L. had a poor activity against yeasts and a better one against moulds. It gave the best in vivo antifungal activity against T. mentagrophytes by healing animals with 40μg. The extract of P. granatum L. gave also an interesting in vivo antifungal activity against T. mentagrophytes with an active dose of 80μg. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Rosa, Edson V Cordova; Valgas, Cleidson; Souza-Sierra, Maria M; Corrêa, Albertina X R; Radetski, Claudemir Marcos
2003-03-01
Biomass growth, micronucleus induction, and antioxidative stress enzymes (superoxide dismutase, peroxidase, glutathione reductase, and catalase) were investigated simultaneously in the Vicia faba plant exposed to cadmium in solution. The biomass lowest-observed-effect concentration (LOEC) value was 2,000 microM Cd2+. In the shoots, enzymic activities increased without concentration-response relationships. In the roots, after an initial increase, activities of all enzymes showed negative concentration-response relationships. A significant increase in micronucleus induction was observed at 20 microM Cd2+. Regarding sensitivity, our results showed that biomass endpoint was less sensitive than micronucleus induction, which was less sensitive than antioxidative enzyme activities. The increase of antioxidant stress enzyme activities in response to cadmium exposure may be taken as evidence for an enhanced detoxification capacity of V. faba plants toward reactive oxygen species (and derivatives) that might be generated in the stressed plants. Concomitant micronucleus induction may be also interpreted as a consequence of oxidative stress, upholding the view that cadmium-induced DNA damage is, to some extent, via generation of reactive (intermediate) oxygen species.
Gema and Šarac: The first Serbian cultivars of spring feed faba bean (Vicia Faba
Directory of Open Access Journals (Sweden)
Mikić Aleksandar
2009-01-01
Full Text Available In 2007 and 2008, the trials of the Department of Variety Protection and Registration of the Ministry of Agriculture, Forestry and Water Management of the Republic of Serbia were carried out on four locations, including two new Novi Sad spring feed faba bean lines, B-412 and B-413, and the control cultivar Uran. In average, the highest grain yield was in the cultivar Gema (2905 kg ha-1, although there were no significant differences between three tested cultivars. In comparison to the control, Gema and Šarac had significantly higher crude protein content in grain dry matter, with 341.4 g kg-1 and 341.1 g kg-1. .
N-(jasmonoyl)tyrosine-derived compounds from flowers of broad beans (Vicia faba).
Kramell, Robert; Schmidt, Jürgen; Herrmann, Gabriele; Schliemann, Willibald
2005-09-01
Two new amide-linked conjugates of jasmonic acid, N-[(3R,7R)-(-)-jasmonoyl]-(S)-dopa (3) and N-[(3R,7R)-(-)-jasmonoyl]-dopamine (5), were isolated in addition to the known compound N-[(3R,7R)-(-)-jasmonoyl]-(S)-tyrosine (2) from the methanolic extract of flowers of broad bean (Vicia faba). Their structures were proposed on the basis of spectroscopic data (LC-MS/MS) and chromatographic properties on reversed and chiral phases and confirmed by partial syntheses. Furthermore, tyrosine conjugates of two cucurbic acid isomers (7, 8) were detected and characterized by LC-MS. Crude enzyme preparations from flowers of V. faba hydroxylated both (+/-)-2 and N-[(3R,7R/3S,7S)-(-)-jasmonoyl]tyramine [(+/-)-4] to (+/-)-3 and (+/-)-5, respectively, suggesting a possible biosynthetic relationship. In addition, a commercial tyrosinase (mushroom) and a tyrosinase-containing extract from hairy roots of red beet exhibited the same catalytic properties, but with different substrate specificities. The conjugates (+/-)-2, (+/-)-3, (+/-)-4, and (+/-)-5 exhibited in a bioassay low activity to elicit alkaloid formation in comparison to free (+/-)-jasmonic acid [(+/-)-1].
Intercropping of wheat (Triticum aestivum) and bean (Vicia faba ...
African Journals Online (AJOL)
use
2011-12-05
Dec 5, 2011 ... Details of field and soil characteristics and meteoro- logical data of experimental site are given in Tables 1 and 2. Experimental design. The treatments were compared in a complete randomized block design with four replications. Five treatments were included in the experiment as showed in Table 3.
Intercropping of wheat ( Triticum aestivum ) and bean ( Vicia faba ...
African Journals Online (AJOL)
The experiment was carried out as randomized complete block design with four replications. The results show that intercropping systems had a significant effect on environmental resources consumption, where intercropping systems had more light interception and water, and nutrient uptake compared to sole crops, ...
The dynamics of faba bean (Vicia faba L. parasitism by Orobanche foetida
Directory of Open Access Journals (Sweden)
Zouhaier ABBES
2010-09-01
Full Text Available Normal 0 14 false false false MicrosoftInternetExplorer4 The dynamics of Orobanche foetida parasitizing faba bean are examined using Petri dish experiments. Rates of broomrape seed germination and seedling attachment to the host roots were quantified on three resistant genotypes (the Egyptian line Giza 429, the Spanish cultivar Baraca, and the Tunisian cultivar Najeh [XBJ90.03-16-1-1-1] and the susceptible cv. Bachaar. The percentage of O. foetida seed germination (11 to 38% was lower near the roots of resistant host plants than it was near the roots of ‘Bachaar’ (67%. O. foetida parasitism was followed using three parametric logistic functions. In this way some major parameters of the infection process were quantified: the maximal number (Nmax and the maximal rate (Rmax of broomrape attachments to the host roots, the median time required for attachment (T50, the maximal percentage of established tubercles reaching the final growth stage at 70 days after inoculation (DAI (%max, and the maximal rate of established tubercle growth (R’max. Broomrape attachment was lower and slower in resistant plants, as indicated by low Nmax and Rmax values combined with high T50 values. Furthermore the precocity of the resistant genotypes was correlated with low attachment. The parameters %max and R’max did not discriminate the susceptible cultivar Bachaar from Giza 429 or Baraca. On the other hand, the %max and the R’max were lower in the ‘Najeh’ plants. The findings indicated that both low attachment and limited growth of established tubercles contributed to resistance in the Najeh cultivar.
Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli
2015-04-01
Plant-growth-promoting bacteria (PGPR) may help reduce the toxicity of heavy metals in plants in polluted environments. In this work, the effects of dual inoculation with Rhizobium and PGPR strains on the growth of Vicia faba grown under copper stress were assessed during hydroponic culture. Growth parameters, copper (Cu) accumulation and antioxidant enzyme activities were studied. Copper concentrations above 1mM damaged plant growth, but co-inoculation reduced its harmful effect. Co-inoculation of plants treated with 1mM Cu and 2mM Cu increased the dry weights as compared with Cu-treated and uninoculated plants. However, it decreased copper uptake up to 80% in the roots of 1-mM-Cu-treated plants as compared to non-inoculated control. Copper tolerance in Vicia faba is linked to the activity of antioxidant systems that are modulated by metal concentrations: both superoxide dismutase (SOD) and catalase (CAT) were higher in the presence of Cu; a lower Cu dose of 0.5mM stimulated ascorbate peroxidase (APX) and/or peroxidase (POX) activities in shoots and roots; however in nodules CAT appeared to be the main peroxidase in H2O2 scavenging. The 1mM Cu treatment enhanced SOD, CAT and APX activities in roots and only SOD and POX were activated in shoots. All enzyme activities were inhibited by inoculation of 2mM Cu. The effect of inoculation with copper-accumulating PGPRs and the status of the antioxidant enzyme system were linked to changes in the copper tolerance status of Vicia faba. Our results suggested that Vicia faba inoculation with Rhizobium and PGPR Enterobacter clocae and Pseudomonas sp. could help to alleviate copper stress under hydroponic conditions. This result should be tested under field conditions for soil fertilization and phytostabilisation purposes. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.
The Effect of Humic Acid on Nutrient Composition in Broad Bean (Vicia faba L. Roots
Directory of Open Access Journals (Sweden)
Sener AKINCI
2009-12-01
Full Text Available Humic acids promote the conversion of mineral nutrients into forms available to plants. It also stimulates seed germination and viability, and its main effect usually being more prominent in the roots. The objective of this study was to determine of the influence of humic acid on broad bean (Vicia faba L. cultivar �Eresen 87� on root growth and development as well as nutrient uptake, during investigation in a pot experiment. Treatment with leonardite, as humic acid source positively affected both germination and harvesting, enhancing root length and biomass. Humic acid (HA caused significant increase of fresh (RFW and dry (RDW weights by 30.1% and 56.6% of broad bean roots, respectively. Flame photometer and atomic absorption spectrophotometry analyses revealed that K content was major nutrient among the tested elements. Humic acid increased the contents of Na and K significantly. The content of Ca and Fe was not significantly increased whereas Cu, Mn and Zn content decreased under HA treatment.
Giménez, M A; Drago, S R; Bassett, M N; Lobo, M O; Sammán, N C
2016-05-15
In this study, the nutritional quality of pasta-like product (spaghetti-type), made with corn (Zea mays) flour enriched with 30% broad bean (Vicia faba) flour and 20% of quinoa (Chenopodium quinoa) flour, was determined. Proximate chemical composition and iron, zinc and dietary fiber were determined. A biological assay was performed to assess the protein value using net protein utilization (NPU), true digestibility (TD) and protein digestibility-corrected amino acid score (PDCAAS). Iron and zinc availability were estimated by measuring dialyzable mineral fraction (%Da) resulting from in vitro gastrointestinal digestion. Nutritionally improved, gluten-free spaghetti (NIS) showed significantly increased NPU and decreased TD compared with a non-enriched control sample. One NIS-portion supplied 10-20% of recommended fiber daily intake. Addition of quinoa flour had a positive effect on the FeDa% as did broad bean flour on ZnDa%. EDTA increased Fe- and ZnDa% in all NIS-products, but it also impaired sensorial quality. Copyright © 2016. Published by Elsevier Ltd.
Jordan Aguilar, Bladimir
2011-01-01
En México el haba (Vicia faba L.) es importante para la alimentación de los habitantes del medio rural y urbano, contiene un alto contenido nutritivo, es un alimento balanceado, asimismo en la actualidad los productores demandan variedades con mayor calidad de semilla. El rango en cuanto al contenido de taninos en las semillas de haba cultivadas por los agricultores fue determinado, se estimaron las relaciones entre las variedades de haba mediante la utilización de marcadores moleculares tipo...
Ca2+-mediated remote control of reversible sieve tube occlusion in Vicia faba
DEFF Research Database (Denmark)
Furch, Alexandra C.U.; Hafke, Jens B.; Schulz, Alexander
2007-01-01
(EPWs), and is reversible in intact plants. The time-course of the wound response was studied in sieve elements of main veins of intact Vicia faba plants using confocal and multiphoton microscopy. Only 15-45 s after burning a leaf tip, forisomes (giant protein bodies specific for legume sieve tubes...... reversible; callose degraded over the subsequent 1-2 h. The heat induction of both modes of occlusion coincided with the passage of an EPW visualized by electrophysiology or the potential-sensitive dye RH-414. In contrast to burning, cutting of the leaf tip induced neither an EPW nor callose deposition...
Oxidative stress and DNA damage in broad bean (Vicia faba L.) seedlings induced by thallium.
Radić, Sandra; Cvjetko, Petra; Glavas, Katarina; Roje, Vibor; Pevalek-Kozlina, Branka; Pavlica, Mirjana
2009-01-01
Thallium (Tl) is a metal of great toxicological concern because it is highly toxic to all living organisms through mechanisms that are yet poorly understood. Since Tl is accumulated by important crops, the present study aimed to analyze the biological effects induced by bioaccumulation of Tl in broad bean (Vicia faba L.) as well as the plant's antioxidative defense mechanisms usually activated by heavy metals. Thallium toxicity was related to production of reactive oxygen species in leaves and roots of broad bean seedlings following short-term (72 h) exposure to thallium (I) acetate (0, 0.5, 1, 5, and 10 mg/L) by evaluating DNA damage and oxidative stress parameters as well as antioxidative response. The possible antagonistic effect of potassium (K) was tested by combined treatment with 5 mg/L of Tl (Tl+) and 10 mg/L of potassium (K+) acetate. Accumulation of Tl+ in roots was 50 to 250 times higher than in broad bean shoots and was accompanied by increase in dry weight and proline. Despite responsive antioxidative defense (increased activities of superoxide dismutase, ascorbate peroxidase, and pyrogallol peroxidase), Tl+ caused oxidative damage to lipids and proteins as evaluated by malondialdehyde and carbonyl group levels, and induced DNA strand breaks. Combined treatment caused no oxidative alternations to lipids and proteins though it induced DNA damage. The difference in Tl-induced genotoxicity following both acellular and cellular exposure implies indirect DNA damage. Results obtained indicate that oxidative stress is involved in the mechanism of Tl toxicity and that the tolerance of broad bean to Tl is achieved, at least in part, through the increased activity of antioxidant enzymes.
Hefni, Mohammed E; Shalaby, Mohamed T; Witthöft, Cornelia M
2015-01-01
Faba beans are an important source of folate and commonly consumed in Egypt. This study examined the effects of Egyptian industrial food processing (e.g., canning and freezing), germination, cultivar, and maturity stages on folate content, with the aim to develop a candidate functional canned faba bean food with increased folate content. The folate content in four cultivars of green faba beans ranged from 110 to 130 μg 100 g−1 fresh weight (535–620 μg 100 g−1 dry matter [DM]), which was four- to sixfold higher than in dried seeds. Industrial canning of dried seeds resulted in significant folate losses of ∼20% (P = 0.004), while industrial freezing had no effect. Germination of faba beans increased the folate content by >40% (P faba beans resulted in a net folate content of 194 μg 100 g−1 DM, which is 52% more than in conventional canned beans. The consumption of green faba beans should be recommended, providing ∼120 μg dietary folate equivalents per 100 g/portion. PMID:25650294
Management of faba bean gall in faba bean producing area of Eastern Amhara, Ethiopia
Directory of Open Access Journals (Sweden)
Bogale Nigir Hailemariam
2017-12-01
Full Text Available Faba bean new disease (faba bean gall (Olpidium viciae (Kusano is the most destructive disease of faba bean ((Vicia faba L. in Ethiopia, particularly in Amhara, Tigray and some part of Oromia region. This problem needs immediate sound management strategy to maximize faba bean productivity. A field study was carried out in Geregera and Jama during the 2013 and 2014 main crop season and Maybar watershed in 2014 to verify the fungicide to faba bean gall. The objective of this study was evaluating effective fungicides for the management of faba bean new disease. The treatments were baylaton in the form of seed dressing and foliar spray; mancozeb, redomil, chlorotalonin and cruzet in the form of foliar spray and apron star and theram used as a foliar spray and also untreated check used as a comparison. The result showed that significantly differ between treatments (p
Directory of Open Access Journals (Sweden)
María Inés Zamar
2012-03-01
. occidentalis utilizan la planta en forma temporal y oportunista en Prepuna, mientras que la presencia de F. gemina en Puna es esporádica. Se amplía el número de especies de tisanópteros asociadas al cultivo de haba en ArgentinaThysanoptera (Insecta-Vicia faba (Fabaceae association in Prepuna and Puna in Jujuy, Argentina. The different phenological stages of Vicia faba provide food resources and substrates for the development of a significant diversity of insects. This study aimed to identify the complex of anthophyllous thrips, analyze the species population fluctuations, to obtain some bioecological aspects and the role they play in this association. The study and sampling was conducted during the flowering-fruiting bean crop stages in two phytogeographical regions of Jujuy: Prepuna (2 479m asl on a weekly basis, from October-December 1995-1996 and Puna (3 367m asl every two weeks, from December 2007-March 2008. Each sample consisted of 25 flowers taken at random; only at Prepuna a complementary sampling of three hits per plant (n=10 plants was conducted. Observations were made on oviposition sites, admission to the flower, pupation sites, feeding behavior and injuries caused. In Prepuna, the Thysanoptera complex consisted of Frankliniella australis, F. occidentalis, F. gemina, F. schultzei and Thrips tabaci; in Puna, the specific diversity was restricted to F. australis and F. gemina. Although the planting-harvest period in both areas did not match, the fluctuations in populations showed the same pattern: as flowering progressed, the number of thrips coincided with the availability of food resources. In both areas, F. australis was the dominant species and maintained successive populations; it layed eggs in flower buds, and larvae hatched when flowers opened; feeding larvae and adults brought about silvery stains with black spots. In Prepuna, F. australis went through the mobile immature stages on flowers, while quiescent stages were on the ground; in the Puna, all
Shahid, M; Pinelli, E; Pourrut, B; Silvestre, J; Dumat, C
2011-01-01
Formation of organometallic complexes in soil solution strongly influence metals phytoavailability. However, only few studies deal with the influence of metal speciation both on plant uptake and genotoxicity. In the present study, Vicia faba seedlings were exposed for 6h in controlled hydroponic conditions to 5 μM of lead nitrate alone and chelated to varying degrees by different organic ligands. Ethylenediaminetetraacetic acid and citric acid were, respectively, chosen as models of humic substances and low weight organic acids present in natural soil solutions. Visual Minteq software was used to estimate free lead cations concentration and ultimately to design the experimental layout. For all experimental conditions, both micronucleus test and measure of lead uptake by plants were finally performed. Chelation of Pb by EDTA, a strong chelator, dose-dependently increased the uptake in V. faba roots while its genotoxicity was significantly reduced, suggesting a protective role of EDTA. A weak correlation was observed between total lead concentration absorbed by roots and genotoxicity (r(2)=0.65). In contrast, a strong relationship (r(2)=0.93) exists between Pb(2+) concentration in exposure media and genotoxicity in the experiment performed with EDTA. Citric acid induced labile organometallic complexes did not demonstrate any significant changes in lead genotoxicity or uptake. These results demonstrate that metal speciation knowledge could improve the interpretation of V. faba genotoxicity test performed to test soil quality. Copyright © 2010 Elsevier Inc. All rights reserved.
Austruy, A; Wanat, N; Moussard, C; Vernay, P; Joussein, E; Ledoigt, G; Hitmi, A
2013-04-01
In order to revegetate an industrial soil polluted by trace metals and metalloids (As, Pb, Cu, Cd, Sb), the impact of pollution on three plant species, Solanum nigrum and Agrostis capillaris, both native species in an industrial site, and Vicia faba, a plant model species, is studied. Following the study of soil pollution from the industrial wasteland of Auzon, it appears that the As is the principal pollutant. Particular attention is given to this metalloid, both in its content and its speciation in the soil that the level of its accumulation in plants. In V. faba and A. capillaris, the trace metals and metalloids inhibit the biomass production and involve a lipid peroxidation in the leaves. Furthermore, these pollutants cause a photosynthesis perturbation by stomatal limitations and a dysfunction of photosystem II. Whatever the plant, the As content is less than 0.1 percent of dry matter, the majority of As absorbed is stored in the roots which play the role of trap organ. In parallel, the culture of S. nigrum decreases significantly the exchangeable and weakly adsorbed fraction of As in rhizospheric soil. This study has highlighted the ability of tolerance to trace metals of S. nigrum and to a lesser extent A. capillaris. Our data indicate that V. faba is not tolerant to soil pollution and is not a metallophyte species. Copyright © 2012 Elsevier Inc. All rights reserved.
Barbafieri, Meri; Giorgetti, Lucia
2016-12-01
In this work, the model plant for genotoxicity studies Vicia faba L. was used to investigate the relation between Boron (B) content and bioavailability in soil and plant genotoxic/phytotoxic response. A total of nine soil samples were investigated: two soil samples were collected from a B-polluted industrial area in Cecina (Tuscany, Italy), the other samples were obtained by spiking control soil (from a not polluted area of the basin) with seven increased doses of B, from about 20 to 100 mg B kg(-1). As expected, B availability, evaluated by chemical extraction, was higher (twofold) in spiked soils when compared with collected polluted soils with the same B total content. To analyze the phytotoxic effects of B, seed germination, root elongation, biomass production, and B accumulation in plant tissues were considered in V. faba plants grown in the various soils. Moreover, the cytotoxic/genotoxic effects of B were investigated in root meristems by mitotic index (MI) and micronuclei frequency (MCN) analysis. The results highlighted that V. faba was a B-sensitive plant and the appearance of phytotoxic effects, which altered plant growth parameters, were linearly correlated to the bioavailable B concentration in soils. Concerning the occurrence of cytotoxic/genotoxic effects induced by B, no linear correlation was observed even if MCN frequency was logarithmic correlated with the concentration of B bioavailable in soils.
NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling in Vicia faba guard cells.
Yi, Min; Bai, Heli; Xue, Meizhao; Yi, Huilan
2017-04-01
NO and H2O2 have been implicated as important signals in biotic and abiotic stress responses of plants to the environment. Previously, we have shown that SO2 exposure increased the levels of NO and H2O2 in plant cells. We hypothesize that, as signaling molecules, NO and H2O2 mediate SO2-caused toxicity. In this paper, we show that SO2 hydrates caused guard cell death in a concentration-dependent manner in the concentration range of 0.25 to 6 mmol L-1, which was associated with elevation of intracellular NO, H2O2, and Ca2+ levels in Vicia faba guard cells. NO donor SNP enhanced SO2 toxicity, while NO scavenger c-PTIO and NO synthesis inhibitors L-NAME and tungstate significantly prevented SO2 toxicity. ROS scavenger ascorbic acid (AsA) and catalase (CAT), Ca2+ chelating agent EGTA, and Ca2+ channel inhibitor LaCl3 also markedly blocked SO2 toxicity. In addition, both c-PTIO and AsA could completely block SO2-induced elevation of intracellular Ca2+ level. Moreover, c-PTIO efficiently blocked SO2-induced H2O2 elevation, and AsA significantly blocked SO2-induced NO elevation. These results indicate that extra NO and H2O2 are produced and accumulated in SO2-treated guard cells, which further activate Ca2+ signaling to mediate SO2 toxicity. Our findings suggest that both NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling.
Directory of Open Access Journals (Sweden)
Maurizio Moschini
2012-04-01
Full Text Available The use of alternative plant proteins in place of the soybean meal protein in diets for producing animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among possible alternatives, the heat-processed legume grains seem interesting for dairy cow diets. Two consecutive experiments were carried out to evaluate flaked pea and faba beans as substitute for soybean meal in diets for Reggiana breed dairy cows producing milk for Parmigiano-Reggiano cheese-making. In both experiments a C concentrate (110 g/kg soybean meal, no pea and faba beans was compared to a PF concentrate (150 g/kg flaked pea, 100 g/kg flaked faba beans, no soybean meal. Forages fed to animals were hay (mixed grass and alfalfa in experiment 1 and hay plus mixed grass in experiment 2. Concentrate intake, milk yield and milk quality (rennet coagulation traits included were similar between feeding groups. Parameters on the grab faecal samples, as empirical indicators of digestibility, had a smaller (Pvs 3.1 and 2.3 vs 2.8%, respectively for PF and C in experiment 1 and 2. Some blood indicators of nitrogen metabolism (protein, albumin, urea were similar between the feeding groups. The inclusion of pea and faba beans, within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation, could represent a feasible opportunity for a total substitution of soybean meal.
Corrêa, Albertina X R; Cotelle, Sylvie; Millet, Maurice; Somensi, Cleder A; Wagner, Theodoro M; Radetski, Claudemir M
2016-05-01
Diesel exhaust particulate matter (PM) can have an impact on the environment due to its chemical constitution. A large number of substances such as organic compounds, sulfates, nitrogen derivatives and metals are adsorbed to the particles and desorption of these contaminants could promote genotoxic effects. The objective of this study was to assess the in vivo genotoxicity profile of diesel exhaust PM from heavy-duty engines. Extracts were obtained through leaching with pure water and chemical extraction using three organic solvents (dichloromethane, hexane, and acetone). The in vivo Vicia faba micronucleus test (ISO 29200 protocol) was used to assess the environmental impact of the samples collected from diesel exhaust PM. The solid diesel PM (soot) dissolved in water, and the different extracts, showed positive results for micronucleus formation. After the addition of EDTA, the aqueous extracts did not show a genotoxic effect. The absence of metals in the organic solvent extract indicated that organic compounds also had a genotoxic effect, which was not observed for a similar sample cleaned in a C18 column. Thus, considering the ecological importance of higher plants in relation to ecosystems (in contrast to Salmonella spp., which are commonly used in mutagenicity studies), the Vicia micronucleus test was demonstrated to be appropriate for complementing prokaryotic or in vitro tests on diesel exhaust particulate matter included in risk assessments. Copyright © 2016 Elsevier Inc. All rights reserved.
Influence of ionizing irradiation on the antioxidant enzymes of Vicia faba L.
Directory of Open Access Journals (Sweden)
El-Beltagi, Hossam E. S.
2010-09-01
Full Text Available The seeds of Vicia faba L. Giza 834 were exposed to γ-irradiation at dose levels of 2.5, 5.0, 10.0 and 20.0 kGy and after that exposed to He–Ne (632.8 nm or diode (650.0 nm laser irradiation for 5 min. The activities of POD, APOX, CAT, SOD and GST enzymes were significantly stimulated and this stimulation reached its maximum at a dose level of 5.0 kGy for enzymes POD, APOX, CAT and SOD, but for GST enzyme at a dose level 10.0 kGy. For He- Ne laser, with or without different doses (2.5, 5.0, 10.0 and 20.0 kGy of γ-irradiation, enzyme induction was significantly stimulated and positively correlated with the dose levels of γ-irradiation in combination with the He-Ne treatment. There was a significant increase in the concentration of MDA and this increase was more pronounced at dose level 20.0 kGy (38.2 μmol/g d.w compared to the control (3.9 μmol/g d.w. Laser treatment by He–Ne laser or diode laser only caused a slight increase (P 2O2 content significantly increased in all treatments and this increase reached its maximum at dose level 20.0 kGy (36.3 μmol/g d.w compared to the control (2.3 μmol/g d.w.. On the other hand, He-Ne or diode laser treatments combined with γ-irradiation significantly decreased in comparison with γ-irradiation treatments alone. In the case of glutathione content, there were significant increases by γ-irradiation at dose levels 2.5, 5.0, 10.0 and 20.0 kGy. Furthermore, with a combination of γ-irradiation and He-Ne or diode laser, a marked increase in glutathione content was found and was more pronounced than that of gamma irradiation alone.Semillas de Vicia faba L. Giza 834 fueron expuestas a γ-irradiación a dosis de 2.5, 5.0, 10.0 y 20.0 kGy y después expuesta a una radiación laser de He–Ne (632.8 nm o de diodo (650.0 nm durante 5 minutos. Las actividades de las enzimas POD, APOX, CAT, SOD y GST fueron favorecidas significativamente, y éstas alcanzaron un máximo a una dosis de 5.0 kGy para las enzimas
ESTUDIO DE LA CALIDAD PROTEICA Y DEL CONTENIDO DE ENERGÍA METABOLIZABLE DEL HABA (VICIA FABA*
Directory of Open Access Journals (Sweden)
Ana Silvia Bermudez
2010-09-01
Full Text Available In order to determínate the faba bean CEP, the possible role of bis hemaglutinine on this valué and to know the metabolizable energy in this legume we made two experiments in the poultry section of the experimental Center of Tibaitatá. In each experiment we used 45 chickens in random distribution in groups of five. In the first experiment we used diets whose proteic source was respectively isolated soybean protein (control diet, raw faba bean, and faba bean treated with steam in an autoclave. The results obtained show a low utilization of food when the ratio was prepared with faba beans, probably due to the aminoacids imbalance, also it produced hypertrophia of the páncreas due probably to the presence of antitriptyc agents which were not destroyed by the heat treatment. The nutritional valué of the faba bean protein increase 67o with the inactivation of the favine, although it is still lower (27% compared with the control diet. In the second experiment we obtain relatively high valúes for the faba beans metabolical useful energy compared with other legume valúes like ajonjolí, which shows us that this bean is a good energy supplier.
Osman, Asha Mohamed Ali; Hassan, Amro B; Osman, Gammaa A M; Mohammed, Nagat; Rushdi, Mohamed A H; Diab, Eiman E; Babiker, Elfadil E
2014-08-01
The effect of gamma irradiation (0.5 and 1.0 kGy) and/or cooking on the proximate composition, mineral content, tannin content, phytic acid content and the in vitro protein digestibility (IVPD) of two Sudanese faba bean cultivars (BB7-S1 and SH-S2) was investigated in the present study. The results obtained revealed that gamma irradiation and/or cooking treatments have slight effect in chemical composition and mineral content, while they caused significant (P ≤ 0.05) reduction on tannin content for both cultivars. Cooking of faba bean seeds also insignificantly (P ≤ 0.05) reduced phytic acid content for both cultivars, while irradiation process and/or cooking had fluctuated effect. For both cultivars, irradiation of seeds and/or cooking increased the in vitro protein digestibility (IVPD), with maximum value of IVPD (79.97%) obtained for cultivar BB7-S1. The results indicate that the treatments used in this study might improve the nutritive quality of faba bean seed due to reduction in antinutritional factors with a concomitant increase in IVPD.
Gómez-Arroyo, S; Armienta, M A; Cortés-Eslava, J; Villalobos-Pietrini, R
1997-11-27
Sister chromatid exchanges (SCE) in Vicia faba root tips were used to examine well water containing high levels of arsenic. The increased amount of arsenic was contained in well water from different towns of Zimapan, Hidalgo, Mexico. Treatments of 3 h were applied followed by the differential staining technique of Tempelaar et al. (Mutation Res. 103 (1982) 321-326). Concentrations of arsenic from 0.267 up to 1.070 mg/l were determined by colorimetry in the polluted samples used for this study. These values were above the permissible limit of 0.05 mg/l in drinking water. In all cases, except one in which the As concentration was 0.021, the arsenic-contaminated water produced significant increases of SCE compared with the control (p Comarca Lagunera and the results observed in Zimapan.
Directory of Open Access Journals (Sweden)
Jinguo Hu
2015-07-01
Full Text Available Background: Parkinson’s disease (PD is the second most common neurodegenerative disorder characterized by the loss of muscle control, which causes trembling of the limbs and head as well as impaired balance. L-DOPA (L-3,4-dihydroxy phenylalanine is the major ingredient of several prescription drugs used to treat PD. Faba bean (Vicia faba L. is one of the few plant species that is known to produce L-DOPA and has the potential to be developed as a functional food crop for people suffering with PD. Objective: Aimed to provide needed information for people who want to use faba bean as a natural remedy or functional food to relieve PD symptoms, this study analyzed the variation of L-DOPA concentration in the leaf and flower tissues of six faba bean lines with common and rare flower colors. Methods: Leaf and flower samples were taken from field grown plants with different flower colors, namely, pink with purple lines and black dots, pure white, brown, and crimson. Samples were freeze-dried and L-DOPA was quantified by a LC-MS system consisting of an ACQUITY UPLC in line with a Synapt G2 HDMS quadrupole time-of-flight mass spectrometer. This experiment was carried out in two consecutive years (2012 and 2013 and the plants used in the second year were grown from the seeds harvested from the plants used in the first year. Results and Discussion: Our two-year study revealed a high level of variation in L-DOPA concentration for leaf and flower tissues among the six faba bean lines studied. The average L-DOPA concentration based on dry weight (DW in flowers ranged from 27.8 to 63.5 mg/g and 18.2 to 48.7 mg/g for leaf tissues. There was no significant correlation between L-DOPA concentrations in flowers and leaves. The L-DOPA concentration in flowers and in leaves of the same line varied but were not statistically significant between the two years. Ideally, the genotype with the highest average L-DOPA concentration in both flowers and leaves would be grown
Osman, Asha Mohamed Ali; Hassan, Amro B.; Osman, Gammaa A. M.; Mohammed, Nagat; Rushdi, Mohamed A. H.; Diab, Eiman E.; Babiker, Elfadil E.
2012-01-01
The effect of gamma irradiation (0.5 and 1.0 kGy) and/or cooking on the proximate composition, mineral content, tannin content, phytic acid content and the in vitro protein digestibility (IVPD) of two Sudanese faba bean cultivars (BB7-S1 and SH-S2) was investigated in the present study. The results obtained revealed that gamma irradiation and/or cooking treatments have slight effect in chemical composition and mineral content, while they caused significant (P ≤ 0.05) reduction on tannin conte...
Directory of Open Access Journals (Sweden)
Paul B. Tchounwou
2012-05-01
Full Text Available The use of silver nanoparticles (AgNPs in commercial products has increased significantly in recent years. Although there have been some attempts to determine the toxic effects of AgNPs in mammalian and human cell-lines, there is little information on plants which play a vital role in ecosystems. The study reports the use of Vicia faba root-tip meristem to investigate the genotoxicity of AgNPs under modified GENE-TOX test conditions. The root tip cells of V. faba were treated with four different concentrations of engineered AgNPs dispersion to study toxicological endpoints such as mitotic index (MI, chromosomal aberrations (CA and micronucleus induction (MN. For each concentration, five sets of microscopy observations were carried out. The results demonstrated that AgNPs exposure significantly increased (p < 0.05 the number of chromosomal aberrations, micronuclei, and decreased the MI in exposed groups compared to control. From this study we infer that AgNPs might have penetrated the plant system and may have impaired mitosis causing CA and MN. The results of this study demonstrate that AgNPs are genotoxic to plant cells. Since plant assays have been integrated as a genotoxicity component in risk assessment for detection of environmental mutagens, they should be given full consideration when evaluating the overall toxicological impact of the nanoparticles in the environment.
Witten, Stephanie; Aulrich, Karen
2015-01-01
In Organic Farming, grain legumes are important protein feedstuffs. There are hints indicating that the amino acid (AA) profile is affected by factors associated with varying crude protein (CP) contents of crops. The knowledge on this relationship between CP and AA profile needs to be extended to optimize feeding strategies for monogastrics as well as the selection of cultivars and varieties in fodder crop cultivation. Therefore, samples of 67 field beans (Vicia faba L.) and 86 field peas (Pi...
National Research Council Canada - National Science Library
I.M. El-Metwally; M.T. Abdelhamid
2008-01-01
Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential...
Directory of Open Access Journals (Sweden)
Helena Klenotičová
2013-01-01
Full Text Available Optimisation of in vitro regeneration systems of two explant types for low-tannine cultivars of faba bean based on culturing of shoot apices and cotyledonary nodes were provided by usage of various antioxidants - ascorbic acid, citric acid, glutathione and activated charcoal. In subsequent testing, the combined effects of antioxidants with transformation co-cultivation compounds acetosyringone and L-cysteine was studied. The application of antioxidants lead to decreased callogenesis, citric acids treatments (50 mg.l−1 dramatically decreased necrotic response of explants. However, citric acid, used together with ascorbic acid completely inhibited shoot growth in shoot apex cultures. Glutathion evoked hyperhydricity of explants. Activated charcoal induced rooting on media which are commonly used for shoot proliferation. Combination of acetosyringone with antioxidants influenced shoot proliferation, except of variant with ascorbic acid. Citric acid was the best and universal antioxidant in faba bean in vitro cultures and its use is recommended for faba bean genetic transformation experiments.
Thidiazuron-induced plant regeneration from protoplasts of Vicia faba cv. Mythos.
Tegeder, M; Gebhardt, D; Schieder, O; Pickardt, T
1995-12-01
Protoplasts of 10 cultivars of V. faba were isolated from etiolated shoot-tips and tested for their regeneration capacity. After purification, protoplasts were embedded in sodium alginate and cultivated in the medium of Kao and Michayluk (1975) containing 0.5 mg·1(-1) of each 2,4-dichlorophenoxyacetic acid, naphthylacetic acid and 6-benzylaminopurine. Depending on cultivar, division frequencies of up to 40% were obtained. Six weeks after embedding, protoplast-derived calluses were transferred to Gelrite-solidified media with different combinations of growth regulators. A two step protocol (auxin high/low) was tested for its ability to induce somatic embryogenesis. The formation of globular structures was observed, but no embryo formation could be achieved. In contrast, cultivation of protocalluses on medium supplemented with thidiazuron resulted in shoot development in cultivar Mythos. To generate mature plants, the shoots were grafted onto young seedlings. In order to optimize the in vitro-conditions, different concentrations of thidiazuron alone or in combination with naphthylacetic acid were tested, showing that an increase of thidiazuron and the addition of naphthylacetic acid positively affects both the viability of protocalluses and the regeneration frequency.
Xu, Kai Wei; Zou, Lan; Penttinen, Petri; Wang, Ke; Heng, Nan Nan; Zhang, Xiao Ping; Chen, Qiang; Zhao, Ke; Chen, Yuan Xue
2015-10-01
A total of 54 rhizobial strains were isolated from faba bean root nodules in 21 counties of Sichuan hilly areas in China, and their symbiotic effectiveness, genetic diversity and phylogeny were assessed. Only six strains increased the shoot dry mass of the host plant significantly (P ≤ 0.05). Based on the cluster analysis of combined 16S rDNA and intergenic spacer region (IGS) PCR-RFLP, the strains were divided into 31 genotypes in 11 groups, indicating a high degree of genetic diversity among the strains. The sequence analysis of three housekeeping genes (atpD, glnII and recA) and 16S rDNA indicated that the strains represented two R. leguminosarum, two Rhizobium spp., R. mesosinicum, Agrobacterium sp. and A. tumefaciens. The strains representing four Rhizobium species were divided into two distinct nodC and nifH genotypes. However, the phylogeny of housekeeping genes and symbiotic genes was not congruent, implying that the strains had been shaped by vertical evolution of the housekeeping genes and lateral evolution of the symbiotic genes. Copyright © 2015 Elsevier GmbH. All rights reserved.
Evaluation of faba beans (Vicia faDa cv. Fiord) and sweet lupins ...
African Journals Online (AJOL)
OLCKERS, R.C., 1991. Evaluering van gars as voedingsbron in varkdi€te in die Winterreenstreek. MSc.(Agric)-tesis. Universiteit van Stellenbosch,. Stellenbosch 7600, Suid-Afiika. ORTIZ, L.T., CENTENO, C. & TREVINO, J., 1993. Tannins in faba bean seeds: effects on the digestion of protein and antino acids in growing.
Coda, Rossana; Melama, Leena; Rizzello, Carlo Giuseppe; Curiel, José Antonio; Sibakov, Juhani; Holopainen, Ulla; Pulkkinen, Marjo; Sozer, Nesli
2015-01-16
The effects of air classification and lactic acid bacteria fermentation on the reduction of anti-nutritional factors (vicine and convicine, trypsin inhibitor activity, condensed tannins and phytic acid) and in vitro protein and starch digestibility of faba bean flour were studied. Free amino acid (FAA) profile analysis was also carried out. Air classification allowed the separation of the flour into protein and starch rich fractions, showing different chemical compositions and microstructures. Lactobacillus plantarum growth and acidification in faba bean flour and its fractions were assessed. The anti-nutritional compounds were separated mostly to the fine protein-rich fraction. Fermentation caused the decrease of vicine and convicine contents by more than 91% and significantly reduced trypsin inhibitor activity and condensed tannins (by more than 40% in the protein-rich fraction). No significant (P>0.05) variation was observed for total phenols and phytic acid content. Fermentation increased the amount of FAA, especially of the essential amino acids and γ-aminobutyric acid, enhanced the in vitro protein digestibility and significantly lowered the hydrolysis index. This work showed that the combination of air classification and fermentation improved nutritional functionality of faba bean flour which could be utilized in various food applications. Copyright © 2014 Elsevier B.V. All rights reserved.
Arve, Louise E; Carvalho, Dália RA; Olsen, Jorunn E; Torre, Sissel
2014-01-01
Plants developed under constant high (> 85%) relative air humidity (RH) have larger stomata that are unable to close completely. One of the hypotheses for the less responsive stomata is that the plants have reduced sensitivity to abscisic acid (ABA). Both ABA and darkness are signals for stomatal closure and induce the production of the secondary messenger hydrogen peroxide (H2O2). In this study, the ability of Vicia faba plants developed in moderate or high RH to close the stomata in response to darkness, ABA and H2O2 was investigated. Moreover, the ability of the plants to produce H2O2 when treated with ABA or transferred to darkness was also assessed. Our results show that the ABA concentration in moderate RH is not increased during darkness even though the stomata are closing. This indicates that stomatal closure in V. faba during darkness is independent of ABA production. ABA induced both H2O2 production and stomatal closure in stomata formed at moderate RH. H2O2 production, as a result of treatment with ABA, was also observed in stomata formed at high RH, though the closing response was considerably smaller as compared with moderate RH. In either RH, leaf ABA concentration was not affected by darkness. Similarly to ABA treatment, darkness elicited both H2O2 production and stomatal closure following plant cultivation at moderate RH. Contrary to this, neither H2O2 production nor stomatal closure took place when stomata were formed at high RH. These results suggest that the reduced stomatal response in plants developed in continuous high RH is caused by one or more factors downstream of H2O2 in the signaling pathway toward stomatal closure. PMID:25763494
Arve, Louise E; Carvalho, Dália R A; Olsen, Jorunn E; Torre, Sissel
2014-01-01
Plants developed under constant high (> 85%) relative air humidity (RH) have larger stomata that are unable to close completely. One of the hypotheses for the less responsive stomata is that the plants have reduced sensitivity to abscisic acid (ABA). Both ABA and darkness are signals for stomatal closure and induce the production of the secondary messenger hydrogen peroxide (H2O2). In this study, the ability of Vicia faba plants developed in moderate or high RH to close the stomata in response to darkness, ABA and H2O2 was investigated. Moreover, the ability of the plants to produce H2O2 when treated with ABA or transferred to darkness was also assessed. Our results show that the ABA concentration in moderate RH is not increased during darkness even though the stomata are closing. This indicates that stomatal closure in V. faba during darkness is independent of ABA production. ABA induced both H2O2 production and stomatal closure in stomata formed at moderate RH. H2O2 production, as a result of treatment with ABA, was also observed in stomata formed at high RH, though the closing response was considerably smaller as compared with moderate RH. In either RH, leaf ABA concentration was not affected by darkness. Similarly to ABA treatment, darkness elicited both H2O2 production and stomatal closure following plant cultivation at moderate RH. Contrary to this, neither H2O2 production nor stomatal closure took place when stomata were formed at high RH. These results suggest that the reduced stomatal response in plants developed in continuous high RH is caused by one or more factors downstream of H2O2 in the signaling pathway toward stomatal closure.
Directory of Open Access Journals (Sweden)
Constanza López
2011-03-01
Full Text Available Se analizaron algunas propiedades funcionales del almidón de haba (Vicia faba, con dos niveles de proteína -12,89% y 4,41%-, obtenido por fraccionamiento por vía húmeda de las semillas secas. Se comparan el secado en rodillos y la liofilización como métodos para deshidratar la muestra, así como las propiedades funcionales del almidón antes y después de acetilarlo con anhídrido acético. También se investigaron ciertas propiedades de interés nutricional con el fin de observar la influencia de la modificación química en la biodisponibilidad del almidón de haba. Se realizó la determinación de almidón total, almidón resistente por retrogradación (AR3, almidón disponible y la velocidad de hidrólisis enzimática en el almidón nativo y en el modificado.
Directory of Open Access Journals (Sweden)
Sara Lombardo
2016-12-01
Full Text Available Field bean (Vicia faba L. var. minor is one of the major leguminous crops cultivated in the world and mainly destined for animal feed. Although its seed is generally recognised as a good protein source, little is known about its mineral elements profile, which is an important aspect for a balanced animal diet. Therefore, the aim of the present work was to assess the seed mineral elements composition, along with some key production parameters, in eight field bean genotypes grown in a Mediterranean environment, without intensive management, over two years (2009/10 and 2010/11. Independently of the year, the seed of Chiaro di Torre Lama was the richest in phosphorus (P, magnesium, calcium and iron contents, while that of Sint 6 and Motta Chiaro 69 were the most effective accumulators of potassium and zinc, respectively. While all the genotypes yielded better in the second year (with more rainfall, the seasonal effect on seed mineral elements composition depended on the genotype. Indeed, the P content was 46% lower in Chiaro di Torre Lama, Motta Chiaro 69 and Sint 6 in the second year, while there was only a negligible seasonal effect for Sint 8 with respect to Fe content. Overall, this crop is reasonably productive under a low management regime and its seed can supply significant amounts of certain minerals (particularly P in feed formulations. Both aspects are important in a perspective of optimising field bean production in the Mediterranean area and, hence, improving farmers’ income.
Buckley, Thomas N; Vice, Heather; Adams, Mark A
2017-08-31
The Kok effect - an abrupt decline in quantum yield (QY) of net CO2 assimilation at low photosynthetic photon flux density (PPFD) - is widely used to estimate respiration in the light (R), which assumes the effect is caused by light suppression of R. A recent report suggested much of the Kok effect can be explained by declining chloroplastic CO2 concentration (cc ) at low PPFD. Several predictions arise from the hypothesis that the Kok effect is caused by declining cc , and we tested these predictions in Vicia faba. We measured CO2 exchange at low PPFD, in 2% and 21% oxygen, in developing and mature leaves, which differed greatly in R in darkness. Our results contradicted each of the predictions based on the cc effect: QY exceeded the theoretical maximum value for photosynthetic CO2 uptake; QY was larger in 21% than 2% oxygen; and the change in QY at the Kok effect breakpoint was unaffected by oxygen. Our results strongly suggest the Kok effect arises largely from a progressive decline in R with PPFD that includes both oxygen-sensitive and -insensitive components. We suggest an improved Kok method that accounts for high cc at low PPFD. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
Prior, René; Mittelbach, Moritz; Begerow, Dominik
2017-06-03
In this study, the impacts of three different fungicides to fungal phyllosphere communities on broad bean (Vicia faba, Fabaceae) and common bean (Phaseolus vulgaris, Fabaceae) were analyzed. The fungicides included copper, sulfur, and azoxystrobin. The plants were sowed, grown, and treated under conditions occurring in conventional and organic farming. A culture-based approach was used to identify changes in the phyllosphere fungal community after the treatment. Different effects on species richness and growth index of the epiphytic and endophytic communities for common bean and broad bean could be shown. Treatments with sulfur showed the weakest effect, followed by those based on copper and the systemic azoxystrobin, which showed the strongest effect especially on endophytic communities. The epiphytic fungal community took five weeks to recover after treatment with azoxystrobin. However, the effect of azoxystrobin on the endophytic community lasted more than five weeks. Finally, the data suggest that the surface structure of the host leaves have a huge impact on the mode of action that the fungicides exert.
Effect of Calcium and Potassium on Antioxidant System of Vicia faba L. Under Cadmium Stress
Directory of Open Access Journals (Sweden)
Hayssam M. Ali
2012-05-01
Full Text Available Cadmium (Cd in soil poses a major threat to plant growth and productivity. In the present experiment, we studied the effect of calcium (Ca2+ and/or potassium (K+ on the antioxidant system, accumulation of proline (Pro, malondialdehyde (MDA, and content of photosynthetic pigments, cadmium (Cd and nutrients, i.e., Ca2+ and K+ in leaf of Vicia faba L. (cv. TARA under Cd stress. Plants grown in the presence of Cd exhibited reduced growth traits [root length (RL plant−1, shoot length (SL plant−1, root fresh weight (RFW plant−1, shoot fresh weight (SFW plant−1, root dry weight (RDW plant−1 and shoot dry weight (SDW plant−1] and concentration of Ca2+, K+, Chlorophyll (Chl a and Chl b content, except content of MDA, Cd and (Pro. The antioxidant enzymes [peroxidase (POD and superoxide dismutase (SOD] slightly increased as compared to control under Cd stress. However, a significant improvement was observed in all growth traits and content of Ca2+, K+, Chl a, Chl b ,Pro and activity of antioxidant enzymes catalase (CAT, POD and SOD in plants subjected to Ca2+ and/or K+. The maximum alleviating effect was recorded in the plants grown in medium containing Ca2+ and K+ together. This study indicates that the application of Ca2+ and/or K+ had a significant and synergistic effect on plant growth. Also, application of Ca2+ and/or K+ was highly effective against the toxicity of Cd by improving activity of antioxidant enzymes and solute that led to the enhanced plant growth of faba bean plants.
Directory of Open Access Journals (Sweden)
Gianfranco Piva
2010-01-01
Full Text Available The ban of the meat and bone meal for entering animal diets and the concern of transgenic feeds poses a challenge toanimal nutritionists in Europe. The challenge is to find homegrown protein-rich feedstuffs, making sure no antinutritionalfactors are present which could interfere in the animals’ performance. The raw Pea (Pisum sativum (RP, raw Fababean (Vicia faba, variety minor (RFb and raw Lupin (Lupinus albus, variety multitalia (RL were evaluated as alternativeprotein sources into broiler diets. Six hundred thirty 1d-old Ross male chicks, Marek vaccinated, were randomlyassigned to seven dietary treatments (5 pens per treatment/18 birds per pen. Chicks were floor housed, ad libitum fedisocaloric and isonitrogenous diets and had free access to water. Artificial light was provided 10 h/d. The bulk of the basediet (control diet was corn (48.7%, 56.6% and 57%, solvent-extracted soybean meal (42.8%, 37.3% and 33.4%, cornoil (4.4%, 5.2% and 6.3%, plus synthetic amino acids, minerals, trace minerals and vitamins, respectively for the 1-10d-old, 11-28d-old and 29 to 42d-old growing periods. The RP, RFb and RL entered diets in substitution of the soybeanand corn according to the cost optimization (P100, Fb100 and L100, respectively for RP, RFb and RL and at half of theoptimized quantity (RP50, RFb50 and RL50, respectively for RP, RFb and RL. The amount used as fed basis for the higherlevel of inclusion were: P100: 350 g/kg for all diets; Fb100: 480 g/kg (1-10d-old and 500 g/kg (11-42d-old; L100:360 g/kg (1-10d-old and 300 g/kg (11-42d-old. The average daily gain (ADG were lower (P compared to the control group. Over the whole period of growth, the RFb group had similar ADG compared to the controlgroup and for both levels of inclusion, whereas reduced (P (P growth. Birds performance was improved (P and breast and leg quarter cuts. The RFb and RL could represent valuable protein feeds in broilers diet formulation.
Babikova, Zdenka; Gilbert, Lucy; Randall, Kate C; Bruce, Toby J A; Pickett, John A; Johnson, David
2014-10-01
Arbuscular mycorrhizal (AM) fungi, important plant mutualists, provide plants with nutrients such as phosphorus (P) in return for carbon. AM fungi also enhance the attractiveness of plants to aphids via effects on emissions of plant volatiles used in aphid host location. We tested whether increased P uptake by plants is the mechanism through which AM fungi alter the volatile profile of plants and aphid behavioural responses by manipulating the availability of P and AM fungi to broad beans (Vicia faba L.) in a multi-factorial design. If AM fungi affect plant volatiles only via increased P acquisition, we predicted that the emission of volatiles and the attractiveness of mycorrhizal beans to aphids would be similar to those of non-mycorrhizal beans supplied with additional P. AM fungi and P addition increased leaf P concentrations by 40 and 24%, respectively. The production of naphthalene was less in mycorrhizal plants, regardless of P addition. By contrast, production of (S)-linalool, (E)-caryophyllene and (R)-germacrene D was less in plants colonized by AM fungi but only in the absence of P additions. The attractiveness of plants to pea aphids (Acyrthosiphon pisum Harris) was positively affected by AM fungi and correlated with the extent of root colonization; however, attractiveness was neither affected by P treatment nor correlated with leaf P concentration. These findings suggest that increased P uptake is not the main mechanism by which mycorrhiza increase the attractiveness of plants to aphids. Instead, the mechanism is likely to operate via AM fungi-induced plant systemic signalling. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Directory of Open Access Journals (Sweden)
I.M. El-Metwally
2008-01-01
Full Text Available Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential. The experiment included five treatments, composed of organic and mineral fertilizers, alone and mixed at different rates, along with a control and six weed control treatments, including oxadiargyl, prometryn, hand hoeing treatments alone or mixed with the herbicides, and a nonweeded treatment (control.The herbicide treatments were not superior to the two hand-hoeing treatments. Using compost favored growth and yield of faba bean more than of weeds. Adding fertilizer also improved most yield parameters. Application of compost alone or combined with 50 or 100% of the recommended NPK rate improved faba bean growth in terms of net assimilation rate, specific leaf area, and leaf weight ratio as components of relative growth rate. This improvement in growth resulted in increase of seed yield, yield components and protein of faba bean. Faba bean yield performance improved under interactive fertilizer effects and weed control treatments as growth improved, as a result of nutrient release from fertilizers and weed control.Dois experimentos em condições de campo foram conduzidos em duas épocas sucessivas - 2005/2006 e 2006/2007 - para determinar se o manejo pode melhorar a competitividade do feijão-fava contra plantas daninhas e contribuir para um maior potencial de produção. Os experimentos incluíram cinco tratamentos, compostos de: fertilizantes orgânicos e minerais, isoladamente ou em mistura em diferentes doses, além do tratamento controle, e seis tratamentos de controle de plantas daninhas, incluindo tratamentos usando oxadiargyl, prometryn, manualmente ou misturados com os herbicidas e um tratamento sem plantas daninhas (controle. Os tratamentos com os herbicidas não foram superiores aos dois tratamentos manuais (hand hoeing
Li, Yan; Xu, Shan-Shan; Gao, Jing; Pan, Sha; Wang, Gen-Xuan
2014-01-01
Reactive oxygen species (ROS) have been established to participate in stomatal closure induced by live microbes and microbe-associated molecular patterns (MAMPs). Chlorella as a beneficial microorganism can be expected to trigger stomatal closure via ROS production. Here, we reported that Chlorella induced stomatal closure in a dose-and time-dependent manner in epidermal peels of Vicia faba. Using pharmacological methods in this work, we found that the Chlorella-induced stomatal closure was almost completely abolished by a hydrogen peroxide (H2O2) scavenger, catalase (CAT), significantly suppressed by an NADPH oxidase inhibitor, diphenylene iodonium chloride (DPI), and slightly affected by a peroxidase inhibitor, salicylhydroxamic acid (SHAM), suggesting that ROS production involved in Chlorella-induced stomatal closure is mainly mediated by DPI-sensitive NADPH oxidase. Additionally, Exogenous application of optimal concentrations of Chlorella suspension improved instantaneous water use efficiency (WUEi) in Vicia faba via a reduction in leaf transpiration rate (E) without a parallel reduction in net photosynthetic rate (Pn) assessed by gas-exchange measurements. The chlorophyll fluorescence and content analysis further demonstrated that short-term use of Chlorella did not influence plant photosynthetic reactions center. These results preliminarily reveal that Chlorella can trigger stomatal closure via NADPH oxidase-dependent ROS production in epidermal strips and improve WUEi in leave levels.
Ford, J E; Hewitt, D
1979-09-01
1. Polyethyleneglycol (PEG 4000) was examined for its influence on relative nutritional value (RNV) and available methionine in sorghum (Sorghum vulgare Pers.), field beans (Vicia faba L.) and barley, as measured microbiologically with Streptococcus zymogenes. The results were assessed in relation to the content of tannins in the test samples. 2. In grain of hybrid sorghum the RNV averaged 87 (range 79--92) for six low-tannin varieties and 41 (30--53) for eleven high-tannin varieties. The corresponding available methionine values averaged 17.0 (15.7--18.9) and 8.9 (6.7--11.0) g/kg protein. Addition of PEG 4000 to the test samples increased the average RNV of the high-tannin varieties from 41 to 78, and the average available methionine content from 8.9 to 16.2 g/kg protein. 3. With seed of ten coloured flowered varieties of field beans, treatment with PEG gave a small but consistent increase in the available methionine content, which resulted from the inactivation of tannins in the testa. 4. In twenty-three samples of barley grain, treatment with PEG had no effect on the values obtained for available methionine. 5. Treatment of high-tannin sorghum grain with ammonia has been reported to inactivate the tannins and increase the nutritional value for rats and chicks. This finding was confirmed. The present study showed that ammonia and PEG 4000 were equally effective in enhancing the nutritional quality as measured in the microbiological tests.
Ruffini Castiglione, Monica; Giorgetti, Lucia; Becarelli, Simone; Siracusa, Giovanna; Lorenzi, Roberto; Di Gregorio, Simona
2016-04-01
Two bacterial strains, Achromobacter sp. (ACH01) and Sphingomonas sp. (SPH01), were isolated from a heavily polycyclic aromatic hydrocarbon (PAH)-contaminated soil (5431.3 ± 102.3 ppm) for their capacity to use a mixture of anthracene, pyrene, phenanthrene and fluorene as sole carbon sources for growth and for the capacity to produce biosurfactants. The two strains were exploited for bioaugmentation in a biopile pilot plant to increase the bioavailability and the degradation of the residual PAH contamination (99.5 ± 7.1 ppm) reached after 9 months of treatment. The denaturing gel gradient electrophoresis (DGGE) profile of the microbial ecology of the soil during the experimentation showed that the bioaugmentation approach was successful in terms of permanence of the two strains in the soil in treatment. The bioaugmentation of the two bacterial isolates positively correlated with the PAH depletion that reached 7.9 ± 2 ppm value in 2 months of treatment. The PAH depletion was assessed by the loss of the phyto-genotoxicity of soil elutriates on the model plant Vicia faba L., toxicological assessment adopted also to determine the minimum length of the decontamination process for obtaining both the depletion of the PAH contamination and the detoxification of the soil at the end of the process. The intermediate phases of the bioremediation process were the most significant in terms of toxicity, inducing genotoxic effects and selective DNA fragmentation in the stem cell niche of the root tip. The selective DNA fragmentation can be related to the selective induction of cell death of mutant stem cells that can compromise offsprings.
Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina
Directory of Open Access Journals (Sweden)
María Inés Zamar
2012-03-01
Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F
Directory of Open Access Journals (Sweden)
Gianfranco Piva
2010-01-01
Full Text Available The effect of extrusion of pea seeds (Pisum sativum (PS, faba bean (Vicia faba, variety minor (FB and lupin seeds (Lupinus albus, variety multitalia (LS on broiler performance were evaluated. Four hundred sixty two 1d-old Ross male chicks, Marek vaccinated, were randomly assigned to seven dietary treatments (3 pens per treatment/22 birds per pen. Chicks were floor housed, ad libitum fed isocaloric and isonitrogenous diets and had free access to water. Artificial light was provided 10 h/d. The bulk of the base diet (control diet was corn (48.8%, 53.7% and 57%, solvent-extracted soy- bean meal (42.8%, 37.3% and 33.4%, corn oil (4.4%, 5.2% and 6.3%, plus synthetic amino acids, minerals, trace minerals and vitamins, respectively for the 1-10d-old, 11-28d-old and 29 to 42d-old growing periods. The amounts of PS, FB and LS used on an as fed basis were: PS and extruded PS (EPS: 353 (1-10d-old, 356 (11-28d-old and 350 (29- 42d-old g/kg; FB and extruded FB (EFB: 479 (1-10d-old, 497 (11-28d-old and 500 (29-42d old g/kg; LS and extrud- ed LS (ELS: 360 (1-10d-old and 300 (11-42d-old g/kg. High levels of pea (350 g/kg and faba bean (500 g/kg did not show negative effects on body weight gain (BWG and bird feed intake compared to control. Lupin at the 300 g/kg level reduced (P< 0.05 the BWG during the finishing period (22 to 42 d, however the effect disappeared over the whole experimental period (1-42 d compared to the control group. The ELS group had a lower (P< 0.01 feed intake com- pared to the control group and to the LS group. The feed conversion rate (FCR was similar among groups for the whole experimental period; however during the grower period the FCR was higher (P< 0.05 for the PS, FB and EFB groups com- pared to the control group. Birds consuming the PS diet had a reduced (P< 0.05 eviscerated carcass yield compared to the control group. The breast meat percent yield was higher (P< 0.01 for birds consuming the FB and EFB diets compared to the control
Directory of Open Access Journals (Sweden)
J. Hamzei
2016-05-01
Full Text Available The chemical control of weeds raises serious concerns about food safety and environmental quality, which have necessitated the need for non chemical weed management techniques such as intercropping. Intercropping can suppress weeds and reduce the use of herbicides in production systems. Therefore, the objective of this work was to evaluate the effects of intercropping of faba bean and maize, as well as hand-weeding on maize grain yield and total grain yield. The experiment was carried out during growing season of 2010 as a randomized complete block design with three replications at the Agricultural Research Station, Faculty of Agriculture, Bu-Ali Sina University, Hamedan, Iran. Sole cropping of maize with weed control (MWF, sole cropping of maize without weed control (MWI, intercropping of 15% faba bean+maize (M+15%F, 30% faba bean+maize (M+30%F, 45% faba bean+maize (M+45%F and sole cropping of faba bean were the experimental treatments. Weed biomass and density were affected by treatments. With increasing faba bean density in the intercropping treatments, weed biomass and density decreased significantly from 85 plants and 310 g m-2 for MWI treatment to 22 plants and 63 g m-2 for M+45%F treatment, respectively. The greatest number of seed row per ear, seed number per ear and grain and biological yields (8033 and 17933 kg ha-1, respectively were achieved at MWF treatment and the smallest values for these attributes were revealed at MWI treatment. There was no significant difference between MWF and M+45%F treatments for total grain yield (i.e. grain yield of maize + faba bean. Sole cropping of faba bean led to the greatest yield components and grain and biological yields. With increasing faba bean density in intercropping treatments, above mentioned traits (except number of pods per plant were increased significantly. The great values for weed control efficiency (73% and total relative value (1.14 were achieved at M+45%F treatment. Results of
Abdelhamid, Magdi T; Horiuchi, Takatsugu; Oba, Shinya
2004-06-01
Composting of rice straw with poultry manure and oilseed rape cake and its effects on growth and yield of faba bean and soil properties was studied in pot experiments at Gifu University, Japan in 2001/2002. The composts reached maturity in 90 days, were rich in organic matter and mineral nutrients, had a high level of stability, and no phytotoxicity. The addition of compost (20-200 g pot(-1)) improved selected soil chemical (increased total N, total C and CEC), physical (decreased particle density) and biological (increased soil respiration rate) properties. Application of composts at a rate of 20 g pot(-1) significantly increased growth, yield, yield components and total crude protein of faba bean plants. The benefit of this compost without chemical fertilizer demonstrated the validity and possibility of sustainable agronomic performance of faba bean using locally available recycled organic materials. Copyright 2003 Elsevier Ltd.
Siah, Siem D; Konczak, Izabela; Agboola, Samson; Wood, Jennifer A; Blanchard, Christopher L
2012-08-01
The functional properties, including antioxidant and chemopreventative capacities as well as the inhibitory effects on angiotensin-converting enzyme (ACE), α-glucosidase and pancreatic lipase, of three Australian-grown faba bean genotypes (Nura, Rossa and TF(Ic*As)*483/13) were investigated using an array of in vitro assays. Chromatograms of on-line post column derivatisation assay coupled with HPLC revealed the existence of active phenolics (hump) in the coloured genotypes, which was lacking in the white-coloured breeding line, TF(Ic*As)*483/13. Roasting reduced the phenolic content, and diminished antioxidant activity by 10-40 % as measured by the reagent-based assays (diphenylpicrylhydrazyl, 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) and oxygen radical absorbance capacity) in all genotypes. Cell culture-based antioxidant activity assay (cellular antioxidant activity) showed an increase of activity in the coloured genotypes after roasting. Faba bean extracts demonstrated cellular protection ability against H₂O₂-induced DNA damage (assessed using RAW264.7 cells), and inhibited the proliferation of all human cancer cell lines (BL13, AGS, Hep G2 and HT-29) evaluated. However, the effect of faba bean extracts on the non-transformed human cells (CCD-18Co) was negligible. Flow cytometric analyses showed that faba bean extracts successfully induced apoptosis of HL-60 (acute promyelocytic leukaemia) cells. The faba bean extracts also exhibited ACE, α-glucosidase and pancreatic lipase inhibitory activities. Overall, extracts from Nura (buff-coloured) and Rossa (red-coloured) were comparable, while TF(Ic*As)*483/13 (white-coloured) contained the lowest phenolic content and exhibited the least antioxidant and enzyme inhibition activities. These results are important to promote the utilisation of faba beans in human diets for various health benefits.
Directory of Open Access Journals (Sweden)
Raúl Antonio Beltrán Orbegoso
2017-01-01
Full Text Available La evaluación de la toxicidad de las aguas de los ríos como método complementario al análisis físico, químico y biológico proporciona una información integral de la calidad del agua, por tanto, el objetivo del estudio fue determinar los niveles de citotoxicidad y genotoxicidad de las aguas de las cuencas alta, media y baja de los ríos Moche y Jequetepeque, usando el bioindicador ambiental Vicia faba L. “haba” (2n = 12. Se germinaron semillas de V. faba L.; luego las raicillas emergentes se expusieron, durante tres horas, a siete tratamientos: T1 (100 ml de agua destilada, T2 (1 ml agua de río Jequetepeque / 99 ml de agua destilada, T3 (5 ml agua de río Jequetepeque/ 95 ml de agua destilada, T4 (10 ml agua de río Jequetepeque/ 90 ml de agua destilada, T5 (1 ml agua de río Moche/ 99 ml de agua destilada, T6 (5 ml agua de río Moche/ 95 ml de agua destilada y T7 (10 ml agua de río Moche/ 90 ml de agua destilada. Los ápices de las raicillas fueron sometidos a la técnica de Tjio y Levan. El agua de la cuenca media del río Moche del T7, presenta una alta citotoxicidad (índice mitótico de 5,4 % y alteraciones de los índices de fases y un alto efecto genotóxico; las aguas del río Jequetepeque no evidencian efecto citotóxico ni genotóxico de importancia.
van Bel, Aart J. E.
2015-01-01
Sieve elements of legumes contain forisomes—fusiform protein bodies that are responsible for sieve-tube occlusion in response to damage or wound signals. Earlier work described the existence of tailless and tailed forisomes. This study intended to quantify and compare location and position of tailless (in Vicia faba) and tailed (in Phaseolus vulgaris) forisomes inside sieve elements and to assess their reactivity and potential mobility in response to a remote stimulus. Location (distribution within sieve elements) and position (forisome tip contacts) of more than altogether 2000 forisomes were screened in 500 intact plants by laser scanning confocal microscopy in the transmission mode. Furthermore, we studied the dispersion of forisomes at different locations in different positions and their positional behaviour in response to distant heat shocks. Forisome distribution turned out to be species-specific, whereas forisome positions at various locations were largely similar in bushbean (Phaseolus) and broadbean (Vicia). In general, the tailless forisomes had higher dispersion rates in response to heat shocks than the tailed forisomes and forisomes at the downstream (basal) end dispersed more frequently than those at the upstream end (apical). In contrast to the tailless forisomes that only oscillate in response to heat shocks, downstream-located tailed forisomes can cover considerable distances within sieve elements. This displacement was prevented by gentle rubbing of the leaf (priming) before the heat shock. Movement of these forisomes was also prohibited by Latrunculin A, an inhibitor of actin polymerization. The apparently active mobility of tailed forisomes gives credence to the idea that at least the latter forisomes are not free-floating, but connected to other sieve-element structures. PMID:26624625
Furch, Alexandra C U; Buxa, Stefanie V; van Bel, Aart J E
2015-01-01
Sieve elements of legumes contain forisomes-fusiform protein bodies that are responsible for sieve-tube occlusion in response to damage or wound signals. Earlier work described the existence of tailless and tailed forisomes. This study intended to quantify and compare location and position of tailless (in Vicia faba) and tailed (in Phaseolus vulgaris) forisomes inside sieve elements and to assess their reactivity and potential mobility in response to a remote stimulus. Location (distribution within sieve elements) and position (forisome tip contacts) of more than altogether 2000 forisomes were screened in 500 intact plants by laser scanning confocal microscopy in the transmission mode. Furthermore, we studied the dispersion of forisomes at different locations in different positions and their positional behaviour in response to distant heat shocks. Forisome distribution turned out to be species-specific, whereas forisome positions at various locations were largely similar in bushbean (Phaseolus) and broadbean (Vicia). In general, the tailless forisomes had higher dispersion rates in response to heat shocks than the tailed forisomes and forisomes at the downstream (basal) end dispersed more frequently than those at the upstream end (apical). In contrast to the tailless forisomes that only oscillate in response to heat shocks, downstream-located tailed forisomes can cover considerable distances within sieve elements. This displacement was prevented by gentle rubbing of the leaf (priming) before the heat shock. Movement of these forisomes was also prohibited by Latrunculin A, an inhibitor of actin polymerization. The apparently active mobility of tailed forisomes gives credence to the idea that at least the latter forisomes are not free-floating, but connected to other sieve-element structures.
Chroust, K; Kuglík, P; Relichová, J; Holoubek, I; Cáslavský, J; Veselská, R; Rysková, M; Benedík, J
1997-01-01
The Somatic Mutation and Recombination Test (SMART) in wing cells of Drosophila melanogaster, the Vicia faba cytogenetic tests-Sister Chromatid Exchange (SCE) and Micronucleus Test (MN), and the Müller test for gametic mutations in Arabidopsis thaliana were used for genotoxicity testing of environmental samples of pollutants from the surroundings of LACHEMA chemical factory (Brno, Czech Republic) and DEZA factory in Valasské Mezirící (Moravia, Czech Republic). Tested soil and air samples were taken from the near vicinity of both factories. The surroundings of both sites are heavy loaded by exhalation of chemicals from the factories. Chemical analyses of the 16 Polycyclic Aromatic Hydrocarbons (PAHs) according to the United States Environmental Protection Agency (US EPA) list of priority pollutants and heavy metals were performed in both soil and air samples. The Drosophila wing spot test was positive in 70.6% of the tested samples, the Vicia sister chromatid exchange test in 62.5%, and the Arabidopsis Müller test in 58.9%. The micronucleus Vicia faba test was quite insensitive in tested environmental samples. The concordance between SMART and SCE was 62.5%, between SMART and Müller test 76.5%, and between Müller test and SCE 100%. Total concordance of these three tests was 79.7%. Müller test for gametic mutation in Arabidopsis thaliana and cytogenetic SCE test in Vicia faba seem to be quite sensitive and convenient plant bioassays for assessing the mutagenic potential of environmental agents, when compared to the SMART test in Drosophila melanogaster.
El-Metwally, I.M.; Abdelhamid, M.T.
2008-01-01
Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential. The experiment included five treatments, composed of organic and mineral fertilizers, alone and mixed at different rates, along with a control and six weed control treatments, including oxadiargyl, prometryn, hand hoeing treatments alone or mixed with the herbicides, and a nonweed...
Gullón, Patricia; Gullón, Beatriz; Tavaria, Freni; Vasconcelos, Marta; Gomes, Ana Maria
2015-10-01
Broad beans (Vicia faba) and lupin seeds (Lupinus albus) are legumes rich in a wide range of compounds, which may represent a useful dietary approach for modulating the human gut microbiome. In this work, after in vitro digestion, legume samples were used as carbon sources in anaerobic batch cultures to evaluate their impact on the intestinal microbiota composition and on their metabolic products. The fermentations were monitored by a decrease in pH, generation of short chain fatty acids (SCFA) and lactate and the changes in the dynamic bacterial populations by fluorescence in situ hybridization (FISH). The total SCFA at the end of fermentation was 81.52 mM for lupin seeds and 78.41 mM for broad beans accompanied by a decrease of the pH for both legumes. The microbial groups that increased significantly (P < 0.05) were Bifidobacterium spp., Lactobacillus-Enterococcus, Atopobium, Bacteroides-Pretovella, Clostridium coccoides-Eubacterium rectale, Faecalibacterium prausnitzii and Roseburia intestinalis. This impact on the intestinal microbiota suggests that lupin seeds and broad beans may be used in the development of novel functional foods, which can be included in dietary strategies for human health promotion.
Karuppanapandian, T; Geilfus, C-M; Mühling, K-H; Novák, O; Gloser, V
2017-02-01
Changes in pH of the apoplast have recently been discussed as an important factor in adjusting transpiration and water relations under conditions of drought via modulatory effect on abscisic acid (ABA) concentration. Using Vicia faba L., we investigated whether changes in the root, shoot and leaf apoplastic pH correlated with (1) a drought-induced reduction in transpiration and with (2) changes in ABA concentration. Transpiration, leaf water potential and ABA in leaves were measured and correlated with root and shoot xylem pH, determined by a pH microelectrode, and pH of leaf apoplast quantified by microscopy-based in vivo ratiometric analysis. Results revealed that a reduction in transpiration rate in the early phase of soil drying could not be linked with changes in the apoplastic pH via effects on the stomata-regulating hormone ABA. Moreover, drought-induced increase in pH of xylem or leaf apoplast was not the remote effect of an acropetal transport of alkaline sap from root, because root xylem acidified during progressive soil drying, whereas the shoot apoplast alkalized. We reason that other, yet unknown signalling mechanism was responsible for reduction of transpiration rate in the early phase of soil drying. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Younis, M E; Hasaneen, M N A; Kazamel, A M S
2009-03-01
The adverse effects of either NaCl or mannitol on amino acids, protein patterns and nucleic acids in Vicia faba seeds were investigated. The exogenous addition of 4 mM ascorbic acid to the stressing media in which the broad bean seeds were germinated in combination with either the ionic (NaCl) or osmotic (mannitol) stressor induced significant protective changes in the total amount and in the relative composition of amino acids in general and in proline, glycine, glutamic, aspartic, alanine and serine in particular. It also induced changes in nucleic acids (RNA and DNA) content. These changes occurred throughout the entire period of the experiments (12 days). Separate administration of NaCl or mannitol enhanced the occurrence of particular novel proteins that were not detected in control bean seeds (water medium). Protein banding patterns of broad bean seedlings treated with NaCl or mannitol in combination with 4 mM ascorbic acid showed different de novo protein bands, with different molecular weights, at different stages of seedlings growth, with lower levels or a nearly complete absence of the major stress proteins. The pattern of changes for amino acids and nucleic acids and the range of protein bands extracted from the variously treated broad bean seedlings indicate a positive role of ascorbic acid in the alleviation of the damage effects induced by NaCl and mannitol. The importance of this role in the stress tolerance of broad beans is discussed.
Ederli, Luisa; Brunetti, Cecilia; Centritto, Mauro; Colazza, Stefano; Frati, Francesca; Loreto, Francesco; Marino, Giovanni; Salerno, Gianandrea; Pasqualini, Stefania
2017-01-01
The response of broad bean (Vicia faba) plants to water stress alone and in combination with green stink bug (Nezara viridula) infestation was investigated through measurement of: (1) leaf gas exchange; (2) plant hormone titres of abscisic acid (ABA) and its metabolites, and of salicylic acid (SA); and (3) hydrogen peroxide (H2O2) content. Furthermore, we evaluated the effects of experimentally water-stressed broad-bean plants on N. viridula performance in terms of adult host-plant preference, and nymph growth and survival. Water stress significantly reduced both photosynthesis (A) and stomatal conductance (gs ), while infestation by the green stink bug had no effects on photosynthesis but significantly altered partitioning of ABA between roots and shoots. Leaf ABA was decreased and root ABA increased as a result of herbivore attack, under both well-watered and water-deprived conditions. Water stress significantly impacted on SA content in leaves, but not on H2O2. However, infestation of N. viridula greatly increased both SA and H2O2 contents in leaves and roots, which suggests that endogenous SA and H2O2 have roles in plant responses to herbivore infestation. No significant differences were seen for green stink bug choice between well-watered and water-stressed plants. However, for green stink bug nymphs, plant water stress promoted significantly lower weight increases and significantly higher mortality, which indicates that highly water-stressed host plants are less suitable for N. viridula infestation. In conclusion two important findings emerged: (i) association of water stress with herbivore infestation largely changes plant response in terms of phytohormone contents; but (ii) water stress does not affect the preference of the infesting insects, although their performance was impaired.
Geilfus, Christoph-Martin; Mühling, Karl H; Kaiser, Hartmut; Plieth, Christoph
2014-01-01
Ratiometric analysis with H(+)-sensitive fluorescent sensors is a suitable approach for monitoring apoplastic pH dynamics. For the acidic range, the acidotropic dual-excitation dye Oregon Green 488 is an excellent pH sensor. Long lasting (hours) recordings of apoplastic pH in the near neutral range, however, are more problematic because suitable pH indicators that combine a good pH responsiveness at a near neutral pH with a high photostability are lacking. The fluorescent pH reporter protein from Ptilosarcus gurneyi (Pt-GFP) comprises both properties. But, as a genetically encoded indicator and expressed by the plant itself, it can be used almost exclusively in readily transformed plants. In this study we present a novel approach and use purified recombinant indicators for measuring ion concentrations in the apoplast of crop plants such as Vicia faba L. and Avena sativa L. Pt-GFP was purified using a bacterial expression system and subsequently loaded through stomata into the leaf apoplast of intact plants. Imaging verified the apoplastic localization of Pt-GFP and excluded its presence in the symplast. The pH-dependent emission signal stood out clearly from the background. PtGFP is highly photostable, allowing ratiometric measurements over hours. By using this approach, a chloride-induced alkalinizations of the apoplast was demonstrated for the first in oat. Pt-GFP appears to be an excellent sensor for the quantification of leaf apoplastic pH in the neutral range. The presented approach encourages to also use other genetically encoded biosensors for spatiotemporal mapping of apoplastic ion dynamics.
Directory of Open Access Journals (Sweden)
KAMEL MOHAMED
2012-05-01
Full Text Available The familiar solutes, Na+, K+, Ca2+, Mg2+, Cl-, PO4(3-, SO4(2-, soluble carbohydrates, amino acids and soluble proteins, which play a role in osmotic adjustment were estimated to investigate the role of potassium nitrate and ammonium sulphate as osmoregulators and their effects on the solutes composition. Vicia faba L. was cultivated and irrigated with 5, 10, 15 and 20 % (v:v sea water. The plants were divided to three groups. The first was irrigated with sea water only. The second was treated with 5 mM KNO3 while the third was treated with 5mM (NH42SO4. The plants were left to grow until flowering stage. The results indicated that the non treated group increased the soluble carbohydrates in the roots to avoid the influx of sodium. The treatment with KNO3 decreased the sodicity (SAR while (NH42SO4 treatment decreased the SK:Na value in the shoots at higher salinity. The availability of nitrogen as nitrate or ammonium ions enhances the accumulation of soluble carbohydrates in shoots. The plants of all groups were depended on Ca2+, as compatible solute more than Na+, and K+.Los solutos Na+, K+, Ca2+, Mg2+, Cl-, PO4(3-, SO4(2-, carbohidratos y proteínas solubles, así como amino ácidos son importantes en ajuste osmótico y fueron estimados para determinar el papel de nitrato de potasio y sulfato de amonio como osmoreguladores y su efecto en la composición de solutos. Vicia faba L. fue cultivada e irrigada con 5, 10, 15 y 20 % (v:v de agua de mar permitiendo crecimiento hasta el estado de floración. Las plantas fueron divididas en tres grupos. El primero fue irrigado con agua de mar solamente. El segundo fue tratado con 5 mM KNO3, mientras que el tercer grupo fue expuesto a 5mM (NH42SO4. Los resultados indican que las plantas del primer grupo (no tratado incrementan carbohidratos solubles en sus raíces para evitar influjo de sodio. El tratamiento con KNO3 disminuye riqueza de sodio (SAR mientras que la exposición a (NH42SO4 diminuye la de SK
Directory of Open Access Journals (Sweden)
Nora AQTBOUZ
2016-03-01
Full Text Available Drought is the most important abiotic stress responsible of the production instability and lower levels of yields of faba bean (Vicia faba L.. The cropping of tolerant varieties can be an opportunity to stabilize production. The objective of the present study was to evaluate the genetic variability and to study the drought tolerance in the juvenile plant stage in a collection of local Moroccan faba bean populations from the province of Taounate. A number of 60 local populations were studied under controlled conditions in a greenhouse. Different morphological and physiological traits were studied before and under water stress and during the recovery phase. The difference between recovery and water stress phases estimates the capacity of local populations to recover from drought. The local populations contain a wide diversity for different studied traits. The gain in dry matter has a negative and highly significant correlation with dry matter yield under water stress (r = -0.64 **. The populations 16, 47, 1 and 9 have proven to be the most drought tolerant at juvenile stage.
DEFF Research Database (Denmark)
Steen Jensen, Erik; Peoples, Mark B.; Hauggaard-Nielsen, Henrik
2010-01-01
The grain legume (pulse) faba bean (Vicia faba L.) is grown world-wide as a protein source for food and feed. At the same time faba bean offers ecosystem services such as renewable inputs of nitrogen (N) into crops and soil via biological N2 fixation, and a diversification of cropping systems. Even...... though the global average grain yield has almost doubled during the past 50 years the total area sown to faba beans has declined by 56% over the same period. The season-to-season fluctuations in grain yield of faba bean and the progressive replacement of traditional farming systems, which utilized...... legumes to provide N to maintain soil N fertility, with industrialized, largely cereal-based systems that are heavily reliant upon fossil fuels (=N fertilizers, heavy mechanization) are some of the explanations for this decline in importance. Past studies of faba bean in cropping systems have tended...
Directory of Open Access Journals (Sweden)
I.S Alsaadawi
2011-12-01
Full Text Available Field trial was conducted with the aim of utilizing allelopathic crop residues to reduce the use of synthetic herbicides in broad bean (Vicia faba fields. Sunflower residue at 600 and 1,400 g m-2 and Treflan (trifluralin at 50, 75 and 100% of recommended dose were incorporated into the soil alone or in combination with each other. Untreated plots were maintained as a control. Herbicide application in plots amended with sunflower residue had the least total weed count and biomass, which was even better than herbicide used alone. Integration of recommended dose of Treflan with sunflower residue at 1,400 g m-² produced maximum (987.5 g m-2 aboveground biomass of broad bean, which was 74 and 36% higher than control and recommended herbicide dose applied alone, respectively. Combination of herbicide and sunflower residue appeared to better enhance pod number and yield per unit area than herbicide alone. Application of 50% dose of Treflan in plots amended with sunflower residue resulted in similar yield advantage as was noticed with 100% herbicide dose. Chromatographic analysis of residue-infested field soil indicated the presence of several phytotoxic compounds of phenolic nature. Periodic data revealed that maximum suppression in weed density and dry weight synchronized with peak values of phytotoxins observed 4 weeks after incorporation of sunflower residues. Integration of sunflower residues with lower herbicide rates can produce effective weed suppression without compromising yield as a feasible and environmentally sound approach in broad bean fields.O experimento foi realizado com o objetivo de utilizar resíduos agrícolas com potencial alelopático para reduzir o uso de herbicidas sintéticos em fava (Vicia faba. Resíduos de girassol (600 e 1,400 g m-2 e Treflan (50, 75 e 100% da dose recomendada foram incorporados ao solo isoladamente ou em combinação uns com os outros. Parcelas não tratadas foram mantidas como controle. A aplicação de
Jansman, A.J.M.; Baal, van J.; Meulen, van der J.; Smits, M.A.
2012-01-01
In a small intestinal segment perfusion (SISP) study in pigs, effects were studied of intestinal perfusion of ground faba beans (Vicia faba), faba bean hulls, or saline on intestinal net fluid absorption in intestinal segments either challenged or not with an enterotoxigenic Escherichia coli (ETEC).
(Vicia faba) IN SOUTHERN ETHIOPIA
African Journals Online (AJOL)
Win7Ent
2013-06-03
Jun 3, 2013 ... iron, zinc, calcium, riboflavin, vitamin A, and vitamin C [4]. Although Ethiopia has a fairly large livestock population, availability of meat and milk for local human consumption is limited, especially in rural areas where wealth index values are in the lower quintiles, according to the most recent Demographic ...
(Vicia faba) IN SOUTHERN ETHIOPIA
African Journals Online (AJOL)
Win7Ent
2013-06-03
Jun 3, 2013 ... in 22.5, 4.7, and 8.3% of study children, respectively. Questionnaires ..... this study, however, requires preparation of the raw ingredients. .... Survey 2009/10 Report for the National Nutrition Program of Ethiopia. Ethiopian ...
Salt tolerance analysis of chickpea, faba bean and durum wheat varieties. I. Chickpea and faba bean
Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Oweis, T.
2005-01-01
Two varieties of chickpea (Cicer arietinum L.) and faba bean (Vicia faba), differing in drought tolerance according to the classification of the International Center for Agronomic Research in Dry Areas (ICARDA), were irrigated with waters of three different salinity levels in a lysimeter experiment
Francesco Masoero; Carla Cerioli; Samantha Sigolo; Mauro Morlacchini; Aldo Prandini
2011-01-01
The effect of pea and faba bean inclusion in growing-finishing heavy pig diets was evaluated. The following iso-lysinic and iso-energetic diets offered to the pigs in three phases (40-80; 80-120; 120-160 kg) were compared: CTR, control diet with soybean meal (SBM) as protein source; RP, CTR diet where pea replaced SBM; RF, CTR diet where faba bean replaced SBM. 126 animals were randomly distributed in 3 homogeneous groups with 42 animals each (7 pens with 6 animals each per treatment). The RP...
The use of whole faba beans in emulsion gel
Wang, Jing
2015-01-01
The faba bean (Vicia faba L.) is an economical protein source used in food and feed worldwide. It has high protein content and well-balanced amino acid composition. Since the starch fraction of faba beans causes problems in protein gelation, it hinders the use of whole faba beans for tofu production. Due to economical, ecological and nutritional reasons, it is worthwhile to develop a new way for producing whole faba bean tofu without discarding any part of faba beans. The aim of this thesis w...
Directory of Open Access Journals (Sweden)
Salwa A. Orabi
2016-06-01
Full Text Available To examine the effect of seawater stress on growth, yield, physiological and antioxidant responses of faba bean plant and whether the exogenous application with vitamin E could mitigate the adverse effect of salinity stress or not, a pot experiment was carried out during 2011/12 winter season under green house of the National Research Centre, Dokki, Cairo, Egypt. Two faba bean cultivars (Giza 3 and Giza 843 irrigated with diluted seawater (Tap water, 3.13 or 6.25 dS m−1 and α-tocopherol (0, 50 or 100 mg L−1 were used. At 75 days after sowing, growth sample was taken for vegetative growth measurement, proline, carotenoids, antioxidant enzyme activities (SOD, CAT, POX and PAL, lipid peroxidation, and inorganic ions as well as seed yield and yield attributes were determined. The results revealed that seawater triggered significant inhibitory effects on faba bean growth and yield especially for Giza 3 cultivar with obvious increments in MDA and Na+ ion contents. Foliar application with α-tocopherol at rate of 100 mg L−1 followed by 50 mg L−1 on faba bean plants exerted certain alleviative effects on these indices in particular on Giza 843. α-Tocopherol could play an important role in alleviation of injury of faba bean irrigated with diluted seawater through the enhancement of the protective parameters such as antioxidant enzymes, proline, carotenoids, and inorganic ions (K+ and Ca2+ to be effective in decreasing MDA content, lessening the harmful effect of salinity, and improving faba bean growth, seed yield and seed yield quality.
Rybaczek, Dorota; Maszewski, Janusz
2007-01-01
Histone H2A variant H2AX is rapidly phosphorylated on the induction of DNA double-strand breaks by ionizing radiation and hydroxyurea-mediated replication arrest, resulting in the formation of gamma-H2AX foci along megabase chromatin domains nearby the sites of incurred DNA damage. In an attempt to establish a relationship between species-specific nuclear architecture and H2AX phosphorylation in S/G(2) phase-arrested root meristem cells, immunocytochemical comparisons using an antibody raised against human gamma-H2AX were made among three plants differing with respect to DNA contents: Allium porrum, representing a reticulate type of DNA package, Vicia faba, having semireticulate cell nuclei, and Raphanus sativus, characterised by a chromocentric type of chromatin. Another approach was aimed at determining possible correlations between the extent of hydroxyurea-induced phosphorylation of H2AX histones and the quantities of root meristem cells induced by caffeine to enter aberrant mitotic division (premature chromosome condensation). It was concluded that the higher-order structure of chromatin may contribute to the accessibility of molecular factors engaged in the recognition and repair of genetic lesions. Consequently, in contrast to A. porrum and V. faba, a diffuse chromatin in chromocentric cell nuclei of R. sativus may become more vulnerable both to generate DNA double-strand breaks and to recruit molecular elements needed to arrange the cell cycle checkpoint functions, and thus, more resistant to factors which allow the cells to enter premature chromosome condensation spontaneously. On the other hand, however, caffeine-mediated overriding of the S-M checkpoint control system resulted in the typical appearance of premature chromosome condensation, irrespective of the genomic content of DNA.
Faba bean (Vicia faba L.) has been cultivated from early Neolithic times. Numerous varieties have been selected for adaptation to a wide range of environments worldwide and for different end-uses such as dry grain, vegetable, feed, forage and green manure. The USDA faba bean germplasm collection con...
Directory of Open Access Journals (Sweden)
Francesco Masoero
2011-10-01
Full Text Available The effect of pea and faba bean inclusion in growing-finishing heavy pig diets was evaluated. The following iso-lysinic and iso-energetic diets offered to the pigs in three phases (40-80; 80-120; 120-160 kg were compared: CTR, control diet with soybean meal (SBM as protein source; RP, CTR diet where pea replaced SBM; RF, CTR diet where faba bean replaced SBM. 126 animals were randomly distributed in 3 homogeneous groups with 42 animals each (7 pens with 6 animals each per treatment. The RP and RF diets did not negatively affect the carcass characteristics both of the pigs slaughtered at the conventional weight (127.5 kg and heavy pigs (158.5 kg. The pigs fed the RP and RF diets ate similarly to the pigs fed the CTR overall the trial but RF pigs grew better than CTR animals. The subcutaneous fat of the fresh hams destined for Parma ham production and obtained from pigs fed RP diet had a higher omega 3 fatty acid percentage. Moreover, the RP and RF diets resulted in fat with better omega 3/omega 6 ratio compared with CTR. All the fat samples had iodine numbers within the limit value (70 reported by the Production Disciplinary of Parma ham. No treatment effect was found on the analytical and sensorial characteristics of the Parma hams, except for the aged taste which was more intense in the hams obtained from pigs fed the RF diet. These results indicate that pea and faba bean may be used as an alternative to imported SBM.
faba bean and field pea seed proportion for intercropping system
African Journals Online (AJOL)
Administrator
Intercropping of Faba bean (Vicia fabae) and field pea (Pisum sativum) is an important cropping system in the. Horro highlands of Ethiopia, but seed proportions balance is important to intercrop productivity. An experiment was conducted to determine the optimum seed rates on component crop yield and land equivalent ...
Directory of Open Access Journals (Sweden)
Ekram Abdel Haliem
2013-01-01
Full Text Available In recent years, there has been a great deal of attention toward free radicals, reactive oxygen species (ROS generated by exposure of crop plant cells to physical radiations. Henceforth, the current study was planned to compare oxidative stress and mutagenic potential of different irradiation doses of fast neutron (FN and UV-B on meiotic-pollen mother cells (PMCs, pollen grains (PGs and seeds yielded from irradiated faba beans seedlings. On the cytogenetic level, each irradiation type had special interference with DNA of PMC and exhibited wide range of mutagenic action on the frequency and type of chromosomal anomalies, fertility of PGs and seed yield productivity based on the irradiation exposure dose and radiation sensitivity of faba bean plants compared with un-irradiated ones. On the molecular level, SDS-PAGE and RPAD-PCR analyses of seeds yielded from irradiated seedlings exhibited distinctive polymorphisms based on size, intensity, appearance, and disappearance of polypeptides bands compared with un-irradiated ones. The total values of protein and DNA polymorphisms reached 88% and 90.80% respectively. The neutron fluency (2.3 × 106 n/cm2 and UV-B dose for 1 hr were recorded as bio-positive effects. The present study proved that genetic variations revealed by cytogenetic test could be supported by gene expression (alterations in RAPD and protein profiles.
Gasim, Seif; Hamad, Solafa A.A.; Abdelmula, Awadalla; Mohamed Ahmed, Isam A.
2015-01-01
Abstract Faba beans (Vicia faba L.) represent an essential source of food protein for many people in Sudan, especially those who cannot afford to buy animal meat. The demand for faba bean seeds is greatly increased in recent years, and consequently its production area was extended southward where the climate is marginally suitable. Therefore, this study was aimed to evaluate seed yield and nutritional quality of five faba bean inbred lines grown under marginal environmental conditions of Suda...
Faba bean (Vicia faba L.) has been selected to adapt to a wide range of environments worldwide and is grown for different end-uses such as food, feed, forage and green manure. Particularly noteworthy in faba bean is the medicinally important component L-3,4-dihydroxy phenylalanine (L-DOPA), the majo...
Directory of Open Access Journals (Sweden)
Kamel Mohamed
2012-08-01
Full Text Available Vicia faba L. was cultivated with irrigation with 5, 10, 15 and 20% (v:v sea water. The plants were divided to three groups. The first was irrigated without treatments while the second was treated with 5 mM KNO3 and the third was treated with 5mM (NH42 SO4. The plants were left to grow until flowering stage. The famous solutes Na+, K+, Ca2+, Mg2+, Cl-, PO43-, SO42-, soluble carbohydrates, amino acids and soluble proteins were estimated to investigate the role of potassium nitrate and ammonium sulphates as osmoregulators. The results indicated that the non-treated group increased the soluble carbohydrates in the roots to avoid the influx of sodium. The treatment with KNO3 decreased the sodicity (SAR in the shoots. The availability of nitrogen as nitrate or ammonium ions enhances the accumulation of soluble carbohydrates in shoots. KNO3 treatment decreased SAR strongly while (NH42 SO4 treatment the SK:Na value in the shoots at higher salinity. The plants of all groups were depended on Ca2+ as compatible solute
Directory of Open Access Journals (Sweden)
Kazimierz Zalewski
2014-01-01
Full Text Available Seeds of field bean cv. Nadwiślański harvested in 1980, 1986 and 1992 were studied. Results of investigations showed that the four analysed sugars (saccharine, verbascose, raffinose and stachyose made up from 60.1 mg of 1 g dry matter of seeds harvested in 1992 to 67 mg of seeds collected in 1986. After three years of storage in laboratory conditions we observed a decline of the amount of these oligosaccharides. The saccharose:raffinose family oligosaccharides ratio grows with the seed age.
Directory of Open Access Journals (Sweden)
Hamdollah ESKANDARI
2010-12-01
Full Text Available An experiment was conducted in University of London, Kent, UK during the year 2003. The aim of experiment was to investigate the effects of planting pattern on performance of wheat and bean intercrops. A complete randomized block design with four replications was employed to compare the treatments. Treatments included wheat sole crop (W, Bean sole crop (B, within row intercropping (M1, row intercropping (M2 and mix cropping (M3. The density of intercropping was according to replacement design (one wheat replaced by three bean plants. The results showed that total dry matter achieved by intercrops was significantly higher than those achieved by either wheat or bean sole crop. Regarding to weed control, intercrops were more effective than sole crops, especially bean sole crop. Crops performance in terms dry weight, height and percentage of leaf, stem pod and ear was affected by cropping systems depending on crop species, where wheat showed more changes compared to bean . Grain yield, harvest index and thousand grain weights of wheat were decreased in intercropping while bean had reduction only in grain yield.
Association of Faba Bean Rust ( Uromyces viciae-fabae ) with ...
African Journals Online (AJOL)
... stage and field management practices. The mean incidence of the disease varied from 44.6% in Bedeno to 98% in Tullo, while severity of the disease varied from 12.7% in Bedeno to 65% in Gorogutu and Kurfachale districts. Logistic regression analysis for the association of rust incidence and severity with environmental ...
Ammar, Megahed H; Alghamdi, Salem S; Migdadi, Hussein M; Khan, Muhammad A; El-Harty, Ehab H; Al-Faifi, Sulieman A
2015-05-01
Forty faba bean (Vicia faba L.) genotypes were evaluated for their agro-morphological performance and molecular diversity under Central Region of Saudi Arabia conditions during 2010-11 and 2011-12 seasons. Field performance results showed that faba genotypes exhibited a significant amount of variation for their agro-morphological studied parameters. Giza40 recorded the tallest genotype (139.5 cm), highest number of seeds per plants (100.8), and the highest seed yield per plant (70.8 g). The best performing genotypes were Giza40, FLIP03-014FB, Gazira1 and Goff1. Genetic variability among genotypes was determined using Sequence Related Amplified Polymorphism (SRAP) and Amplified Fragment Length Polymorphism (AFLP) markers. A total of 183 amplified fragments (alleles) and 1758 polymorphic fragments (bands) in SRAP and 202 alleles and 716 bands in AFLP were obtained using six SRAP and four AFLP primer combinations respectively. Polymorphism information content (PIC) values for AFLP and SRAP markers were higher than 0.8, indicating the existence of a considerable amount of genetic diversity among faba tested genotypes. The UPGMA based clustering of faba genotypes was largely based on origin and/or genetic background. Result of cluster analysis based on SRAP showed weak and not significant correlation while, it was highly significant based on AFLP analysis with agro-morphological characters (r = 0.01, p > 0.54 and r = 0.26, p < 0.004 respectively). Combined SRAP and AFLP markers proved to be significantly useful for genetic diversity assessment at molecular level. They exhibited high discrimination power, and were able to distinguish the faba bean genotypes with high efficiency and accuracy levels.
Faba beans in diets for growing-finishing pigs
Directory of Open Access Journals (Sweden)
K. PARTANEN
2008-12-01
Full Text Available Two experiments were carried out to study the effects of using the new faba bean (Vicia faba L. cultivar Kontu as a domestic protein source for growing-finishing pigs.In Experiment 1,120 pigs were used with a body weight (BWof 25110 kg to study the effects of replacing 0, 25, 50, 75,and 100%of rapeseed meal with faba beans in barley +rapeseed meal based diets. Restrictedly fed grower and finisher diets contained 137317 and 114260 g kg1 faba beans, respectively. A barley +soya bean meal based diet was included as a control. The replacement of rapeseed meal with faba beans exerted a quadratic effect on daily weight gain and on the feed conversion ratio of pigs in the growing period and during total fattening (P
Jansman, A.J.M.; Enting, H.; Verstegen, M.W.A.; Huisman, J.
1994-01-01
The effects of condensed tannins in hulls of faba beans (Vicia faba L.) on the activities of trypsin (EC 3.4.21.4) and chymotrypsin (EC 3.4.21.1) in digesta obtained from the small intestine of pigs were studied. Using four castrated male pigs (mean body weight 83 kg) fitted with both a simple
Becker, P.M.; Meulen, van der J.; Jansman, A.J.M.; Wikselaar, van P.G.
2012-01-01
Enterotoxigenic Escherichia coli (ETEC) expressing K88 (F4) adhesins are associated with post-weaning diarrhoea in piglets. Different grain fractions from pea (Pisum sativum) and faba bean (Vicia faba) were tested in vitro for their capacity to counteract aetiological factors, which contribute to
Siczek, Anna; Lipiec, Jerzy
2016-05-20
Inoculation of legume seeds with Rhizobium affects soil microbial community and processes, especially in the rhizosphere. This study aimed at assessing the effect of Rhizobium inoculation on microbial activity in the faba bean rhizosphere during the growing season in a field experiment on a Haplic Luvisol derived from loess. Faba bean (Vicia faba L.) seeds were non-inoculated (NI) or inoculated (I) with Rhizobium leguminosarum bv. viciae and sown. The rhizosphere soil was analyzed for the enzymatic activities of dehydrogenases, urease, protease and acid phosphomonoesterase, and functional diversity (catabolic potential) using the Average Well Color Development, Shannon-Weaver, and Richness indices following the community level physiological profiling from Biolog EcoPlate™. The analyses were done on three occasions corresponding to the growth stages of: 5-6 leaf, flowering, and pod formation. The enzymatic activities were higher in I than NI (p < 0.05) throughout the growing season. However, none of the functional diversity indices differed significantly under both treatments, regardless of the growth stage. This work showed that the functional diversity of the microbial communities was a less sensitive tool than enzyme activities in assessment of rhizobial inoculation effects on rhizosphere microbial activity.
Early insights into the genome sequence of Uromyces fabae
Directory of Open Access Journals (Sweden)
Tobias eLink
2014-10-01
Full Text Available Uromyces fabae is a major pathogen of broad bean, Vicia faba. U. fabae has served as a model among rust fungi to elucidate the development of infection structures, expression and secretion of cell wall degrading enzymes and gene expression. Using U. fabae, enormous progress was made regarding nutrient uptake and metabolism and in the search for secreted proteins and effectors. Here, we present results from a genome survey of U. fabae. Paired end Illumina sequencing provided 53 Gb of data. An assembly gave 59,735 scaffolds with a total length of 216 Mb. K-mer analysis estimated the genome size to be 329 Mb. Of a representative set of 23,153 predicted proteins we could annotate 10,209, and predict 599 secreted proteins. Clustering of the protein set indicates families of highly likely effectors. We also found new homologs of RTP1p, a prototype rust effector. The U. fabae genome will be an important resource for comparative analyses with U. appendiculatus and P. pachyrhizi and provide information regarding the phylogenetic relationship of the genus Uromyces with respect to other rust fungi already sequenced, namely Puccinia graminis f. sp. tritici, P. striiformis f. sp. tritici, Melampsora lini, and Melampsora larici-populina.
Improvement of Faba Bean Yield Using Rhizobium/Agrobacterium Inoculant in Low-Fertility Sandy Soil
Directory of Open Access Journals (Sweden)
Sameh H. Youseif
2017-01-01
Full Text Available Soil fertility is one of the major limiting factors for crop’s productivity in Egypt and the world in general. Biological nitrogen fixation (BNF has a great importance as a non-polluting and a cost-effective way to improve soil fertility through supplying N to different agricultural systems. Faba bean (Vicia faba L. is one of the most efficient nitrogen-fixing legumes that can meet all of their N needs through BNF. Therefore, understanding the impact of rhizobial inoculation and contrasting soil rhizobia on nodulation and N2 fixation in faba bean is crucial to optimize the crop yield, particularly under low fertility soil conditions. This study investigated the symbiotic effectiveness of 17 Rhizobium/Agrobacterium strains previously isolated from different Egyptian governorates in improving the nodulation and N2 fixation in faba bean cv. Giza 843 under controlled greenhouse conditions. Five strains that had a high nitrogen-fixing capacity under greenhouse conditions were subsequently tested in field trials as faba bean inoculants at Ismaillia Governorate in northeast Egypt in comparison with the chemical N-fertilization treatment (96 kg N·ha−1. A starter N-dose (48 kg N·ha−1 was applied in combination with different Rhizobium inoculants. The field experiments were established at sites without a background of inoculation under low fertility sandy soil conditions over two successive winter growing seasons, 2012/2013 and 2013/2014. Under greenhouse conditions, inoculated plants produced significantly higher nodules dry weight, plant biomass, and shoot N-uptake than non-inoculated ones. In the first season (2012/2013, inoculation of field-grown faba bean showed significant improvements in seed yield (3.73–4.36 ton·ha−1 and seed N-yield (138–153 Kg N·ha−1, which were higher than the uninoculated control (48 kg N·ha−1 that produced 2.97 Kg·ha−1 and 95 kg N·ha−1, respectively. Similarly, in the second season (2013
An evaluation of fababean (Vicia faba) and lupin (Lupinus albus ...
African Journals Online (AJOL)
No significant differences in CP degra- dability between fababean and lupin seed were observed, while. DM degradability was significantly (P •••0.05) higher for lupin seed at the low outflow rate, but significantly (P •••0.05) lower for lupin seed at the high outflow rate. Several other researchers (Cronje, 1983; Freer & Dove, ...
An evaluation of fababean (Vicia faba) and lupin (Lupinus albus ...
African Journals Online (AJOL)
chemiese samestelling van fababoon- en lupiensaad en stoppel is bepaal. Skape op beide stoppellande het toegeneem in liggaams- massa (P ~ 0.01) oor die eerste 35 dae van beweiding, waama skape op beide weidings se gemiddelde liggaamsmassa afgeneem het. Die gemiddelde liggaamsmassa van die hamels het ...
An evaluation of fababean ( Vicia faba ) and lupin ( Lupinus albus ...
African Journals Online (AJOL)
Die eksperiment is uitgevoer om fababoon- en soetlupien-oesreste as somerweiding vir jong Merinohamels te vergelyk. Die droë materiaal (DM)- en ruproteïen (RP)-degradeelbaarheid sowel as die chemiese samestelling van fababoon- en lupiensaad en stoppel is bepaal. Skape op beide stoppellande het toegeneem in ...
Polyphenol content and glycemic load of pasta enriched with Faba bean flour
Imma Turco; Tiziana Bacchetti; Cecilia Bender; Ganiyu Oboh; Benno Zimmermann; Gianna Ferretti
2016-01-01
Background: Legumes contain elevated levels of health functional components. The objective of the present paper was to evaluate the nutritional properties and the post-prandial glycaemic responses of pasta obtained using 35% Vicia Faba (VF) bean flour, which is an important source of fiber and phytochemical compounds. Results: Protein and fiber content were higher in VF pasta compared with durum wheat semolina (DWS) pasta. The total phenol content in VF pasta was about two...
Faba bean forisomes can function in defence against generalist aphids.
Medina-Ortega, Karla J; Walker, Gregory P
2015-06-01
Phloem sieve elements have shut-off mechanisms that prevent loss of nutrient-rich phloem sap when the phloem is damaged. Some phloem proteins such as the proteins that form forisomes in legume sieve elements are one such mechanism and in response to damage, they instantly form occlusions that stop the flow of sap. It has long been hypothesized that one function of phloem proteins is defence against phloem sap-feeding insects such as aphids. This study provides the first experimental evidence that aphid feeding can induce phloem protein occlusion and that the aphid-induced occlusions inhibit phloem sap ingestion. The great majority of phloem penetrations in Vicia faba by the generalist aphids Myzus persicae and Macrosiphum euphorbiae triggered forisome occlusion and the aphids eventually withdrew their stylets without ingesting phloem sap. This contrasts starkly with a previous study on the legume-specialist aphid, Acyrthosiphon pisum, where penetration of faba bean sieve elements did not trigger forisome occlusion and the aphids readily ingested phloem sap. Next, forisome occlusion was demonstrated to be the cause of failed phloem ingestion attempts by M. persicae: when occlusion was inhibited by the calcium channel blocker lanthanum, M. persicae readily ingested faba bean phloem sap. © 2014 John Wiley & Sons Ltd.
Evaluation of faba beans ( Vicia faba cv. Fiord) and sweet lupins ...
African Journals Online (AJOL)
l l threed ietsw eree valuatedin a growth trial using l0 pigs( flveb oarsa ndf lve gilts)o vert heg rowthi nterval3 0-90 kg. The experimentadle signw asa 3 (diets)x 2 (sex)f 'actorialC. arcassc haracteristicwse red etermineda t thee ndo f theg rowtht rial.P igsi n the metabolisrna ndN balance trial consurned5 % less( P < 0.01)o ...
Evaluation of dehulled faba bean (Vicia faba cv. Fiord) as a protein ...
African Journals Online (AJOL)
p2492989
predicted that traditional sources of protein for livestock will become increasingly scarce because of the need to feed a progressively larger human population that will compete with an expanding intensive livestock industry that is being forced to exclude animal protein sources in animal feeds. As a result, a considerable.
Nutritional evaluation of dehulled faba bean (Vicia faba cv. Fiord) in ...
African Journals Online (AJOL)
p2492989
formulated to meet or exceed NRC (1998) nutrient requirements of weaner pigs. Diluting full-fat soya with ..... Of interest was whether a significant trend in performance would be evident as a result of the .... supplement for swine. Can. J. Anim.
Gasim, Seif; Hamad, Solafa A A; Abdelmula, Awadalla; Mohamed Ahmed, Isam A
2015-11-01
Faba beans (Vicia faba L.) represent an essential source of food protein for many people in Sudan, especially those who cannot afford to buy animal meat. The demand for faba bean seeds is greatly increased in recent years, and consequently its production area was extended southward where the climate is marginally suitable. Therefore, this study was aimed to evaluate seed yield and nutritional quality of five faba bean inbred lines grown under marginal environmental conditions of Sudan. The inbred lines have considerable (P ≤ 0.05) variability in yield and yield components, and seed chemical composition. The mean carbohydrate content was very high (501.1 g kg(-1)) and negatively correlated with seed yield, whereas the average protein content was relatively high (253.1 g kg(-1)) and positively correlated with seed yield. Globulin was the significant fraction (613.5 g kg(-1)protein) followed by albumin (200.2 g kg(-1)protein). Biplot analysis indicates that inbred lines Hudeiba/93-S5 and Ed-damar-S5 outscore other lines in terms of seed yield and nutritional quality. This study demonstrates that Hudeiba/93-S5 and Ed-damar-S5 are useful candidates in faba bean breeding program to terminate the protein deficiency malnutrition and provide healthy and nutritious meal for people living in subtropical areas.
Dong, Yan; Dong, Kun; Zheng, Yi; Tang, Li; Yang, Zhi-Xian
2014-07-01
Field experiment and hydroponic culture were conducted to investigate effects of three wheat varieties (Yunmai 42, Yunmai 47 and Mianyang 29) and faba bean intercropping on the shoot biomass, disease index of fusarium wilt, functional diversity of microbial community and the amount of Fusarium oxysporum in rhizosphere of faba bean. Contents and components of the soluble sugars, free amino acids and organic acids in the root exudates were also examined. Results showed that, compared with monocropped faba bean, shoot biomass of faba bean significantly increased by 16.6% and 13.4%, disease index of faba bean fusarium wilt significantly decreased by 47.6% and 23.3% as intercropped with Yunmai 42 and Yunmai 47, but no significant differences of both shoot biomass and disease index were found as intercropped with Mianyang 29. Compared with monocropped faba bean, the average well color development (AWCD value) and total utilization ability of carbon sources of faba bean significantly increased, the amount of Fusarium oxysporum of faba bean rhizosphere significantly decreased, and the microbial community structures of faba bean rhizosphere changed as intercropped with YM42 and YM47, while no significant effects as intercropped with MY29. Total contents of soluble sugar, free amino acids and organic acids in root exudates were in the trend of MY29>YM47>YM42. Contents of serine, glutamic, glycine, valine, methionine, phenylalanine, lysine in root exudates of MY29 were significantly higher than that in YM42 and YM47. The arginine was detected only in the root exudates of YM42 and YM47, and leucine was detected only in the root exudates of MY29. Six organic acids of tartaric acid, malic acid, citric acid, succinic acid, fumaric acid, t-aconitic acid were detected in root exudates of MY29 and YM47, and four organic acids of tartaric acid, malic acid, citric acid, fumaric acid were detected in root exudates of YM42. Malic acid content in root exudates of YM47 and MY29 was
Directory of Open Access Journals (Sweden)
A. Bouhassan
2004-12-01
Full Text Available In detached leaf tests on faba bean (Vicia faba L., genotypes partially resistant and susceptible to Botrytis fabae were examined. Expression of four components of partial resistance to a virulent isolate of B. fabae differed depending on the plant age and the leaf age of the genotypes. The incubation period of resistant genotypes at the podding stage was longer than that of susceptible genotypes at the same stage. The area under disease progress curve (AUDPC of the lesion size increased from the seedling to the flowering stage but declined at the podding stage in all genotypes. Differences between resistant and susceptible genotypes for lesion size were significant except on old leaves from plants at the podding stage. The latent period decreased, and spore production increased with increasing growth and leaf age but there was significant interaction with the genotype. These last two components of partial resistance were more clearly expressed at all growth stages on FRY167 (highly resistant but were expressed only at the seedling and podding stages on FRY7 (resistant. The resistant line BPL710 was not significantly different from the susceptible genotypes for the latent period at any growth stage, and for spore production at the seedling and flowering stages. Leaf age affected all genotypes, but with a significant interaction between leaf age and growth stage. Components of partial resistance were more strongly expressed on young leaves from plants at the seedling or flowering stage.
Rusin, Milena; Gospodarek, Janina; Nadgórska-Socha, Aleksandra; Barczyk, Gabriela
2017-04-01
The aim of the study was to determine the effects of various petroleum-derived substances, namely petrol, diesel fuel and spent engine oil, on life history traits and population dynamics of the black bean aphid Aphis fabae Scop. and on growth and chemical composition of its host plant Vicia faba L. Each substance was tested separately, using two concentrations (9 g kg-1 and 18 g kg-1). The experiment was conducted in four replications (four pots with five plants in each pot per treatment). Plants were cultivated in both control and contaminated soils. After six weeks from soil contamination and five weeks from sowing the seeds, observations of the effect of petroleum-derived substances on traits of three successive generations of aphids were conducted. Aphids were inoculated separately on leaves using cylindrical cages hermetically closed on both sides. Contamination of aphid occurred through its host plant. Results showed that all tested substances adversely affected A. fabae life history traits and population dynamics: extension of the prereproductive period, reduction of fecundity and life span, reduction of the population intrinsic growth rate. In broad bean, leaf, roots, and shoot growth was also impaired in most conditions, whereas nutrient and heavy metal content varied according to substances, their concentration, as well as plant part analysed. Results indicate that soil contamination with petroleum-derived substances entails far-reaching changes not only in organisms directly exposed to these pollutants (plants), but also indirectly in herbivores (aphids) and consequently provides information about potential negative effects on further links of the food chain, i.e., for predators and parasitoids.
Directory of Open Access Journals (Sweden)
Vincenzo Tufarelli
2015-10-01
Full Text Available The present study aimed to assess the effect of dietary substitution of soybean meal (SBM with dehulled-micronized faba bean (Vicia faba var. minor in guinea fowl broilers on their growth traits, carcass quality, and meat fatty acids composition. In this trial, 120 day-old guinea fowl keets were randomly assigned to two treatments which were fed from hatch to 12 weeks of age. Birds were fed two wheat middlings-based diets comprising of a control treatment which contained SBM (78.3 g/kg and a test diet containing dehulled-micronized faba bean (130 g/kg as the main protein source. Substituting SBM with faba bean had no adverse effect on growth traits, dressing percentage, or breast and thigh muscles relative weight of the guinea fowls. Conversely, a decrease (p<0.05 of abdominal fat was found in guinea fowls fed the faba bean-diet. Breast muscle of birds fed faba bean had higher L* score (p<0.05 and water-holding capacity (p<0.05 than the SBM control diet. Meat from guinea fowls fed faba bean had less total lipids (p<0.05 and cholesterol (p<0.01, and higher concentrations of phospholipids (p<0.01. Feeding faba bean increased polyunsaturated fatty acid concentrations in breast meat and decreased the saturated fatty acid levels. Moreover, dietary faba bean improved the atherogenic and thrombogenic indexes in guinea fowl breast meat. Results indicated that substitution of SBM with faba bean meal in guinea fowl diet can improve carcass qualitative traits, enhancing also meat lipid profile without negatively affecting growth performance.
Faba bean drought responsive gene identification and validation.
Ammar, Megahed H; Khan, Altaf M; Migdadi, Hussein M; Abdelkhalek, Samah M; Alghamdi, Salem S
2017-01-01
This study was carried out to identify drought-responsive genes in a drought tolerant faba bean variety (Hassawi 2) using a suppressive subtraction hybridization approach (SSH). A total of 913 differentially expressed clones were sequenced from a differential cDNA library that resulted in a total of 225 differentially expressed ESTs. The genes of mitochondrial and chloroplast origin were removed, and the remaining 137 EST sequences were submitted to the gene bank EST database (LIBEST_028448). A sequence analysis identified 35 potentially drought stress-related ESTs that regulate ion channels, kinases, and energy production and utilization and transcription factors. Quantitative PCR on Hassawi 2 genotype confirmed that more than 65% of selected drought-responsive genes were drought-related. Among these induced genes, the expression levels of eight highly up-regulated unigenes were further analyzed across 38 selected faba bean genotypes that differ in their drought tolerance levels. These unigenes included ribulose 1,5-bisphosphate carboxylase (rbcL) gene, non-LTR retroelement reverse related, probable cyclic nucleotide-gated ion channel, polyubiquitin, potassium channel, calcium-dependent protein kinase and putative respiratory burst oxidase-like protein C and a novel unigene. The expression patterns of these unigenes were variable across 38 genotypes however, it was found to be very high in tolerant genotype. The up-regulation of these unigenes in majority of tolerant genotypes suggests their possible role in drought tolerance. The identification of possible drought responsive candidate genes in Vicia faba reported here is an important step toward the development of drought-tolerant genotypes that can cope with arid environments.
Faba bean drought responsive gene identification and validation
Directory of Open Access Journals (Sweden)
Megahed H. Ammar
2017-01-01
Full Text Available This study was carried out to identify drought-responsive genes in a drought tolerant faba bean variety (Hassawi 2 using a suppressive subtraction hybridization approach (SSH. A total of 913 differentially expressed clones were sequenced from a differential cDNA library that resulted in a total of 225 differentially expressed ESTs. The genes of mitochondrial and chloroplast origin were removed, and the remaining 137 EST sequences were submitted to the gene bank EST database (LIBEST_028448. A sequence analysis identified 35 potentially drought stress-related ESTs that regulate ion channels, kinases, and energy production and utilization and transcription factors. Quantitative PCR on Hassawi 2 genotype confirmed that more than 65% of selected drought-responsive genes were drought-related. Among these induced genes, the expression levels of eight highly up-regulated unigenes were further analyzed across 38 selected faba bean genotypes that differ in their drought tolerance levels. These unigenes included ribulose 1,5-bisphosphate carboxylase (rbcL gene, non-LTR retroelement reverse related, probable cyclic nucleotide-gated ion channel, polyubiquitin, potassium channel, calcium-dependent protein kinase and putative respiratory burst oxidase-like protein C and a novel unigene. The expression patterns of these unigenes were variable across 38 genotypes however, it was found to be very high in tolerant genotype. The up-regulation of these unigenes in majority of tolerant genotypes suggests their possible role in drought tolerance. The identification of possible drought responsive candidate genes in Vicia faba reported here is an important step toward the development of drought-tolerant genotypes that can cope with arid environments.
Polyphenol content and glycemic load of pasta enriched with Faba bean flour
Directory of Open Access Journals (Sweden)
Imma Turco
2016-05-01
Full Text Available Background: Legumes contain elevated levels of health functional components. The objective of the present paper was to evaluate the nutritional properties and the post-prandial glycaemic responses of pasta obtained using 35% Vicia Faba (VF bean flour, which is an important source of fiber and phytochemical compounds. Results: Protein and fiber content were higher in VF pasta compared with durum wheat semolina (DWS pasta. The total phenol content in VF pasta was about two fold higher compared to that of DWS pasta. A higher total flavonoid content, higher antioxidant activity against peroxyl radicals evaluated by oxygen radical absorbance capacity (ORAC assay was also observed in VF pasta. The comparison of post-prandial increase of glucose after VF intake or DWS demonstrated significant differences and VF pasta exhibited a lower glycemic index value, a lower glycemic load and higher glycemic profile compared with DWS pasta. Conclusion: The results suggest that enrichment with 35% Vicia faba bean has potential health benefits and that VF flour can be used as an ingredient to prepare added-value products.
Khalil, M M
2001-08-01
Raw, soaked, germinated, autoclaved and cooked both of guar and faba bean were chemically and biologically evaluated. Crude protein, crude fiber and ash contents of guar and faba bean decreased as a result of all treatments with the exception of protein content in both germinated guar and faba bean. A slight decrease in lipid content was noticed during germination, while there were no changes in lipids after soaking, autoclaving and cooking. Protein content of guar was higher than of faba bean, and showed higher values for all amino acids than faba bean protein except for lysine and tryptophan. Germination caused a slight increase in total essential amino acids, while soaking caused a slight decrease in both of guar and faba bean. There was a slight decrease in the mineral contents by the heat processes with the exception of Mg and Mn for guar and Na, Mn for faba bean due to the cooking process. Germinated guar and faba bean showed noticeable decrease in Na, K, Cu, Mn and Mg and a slight increase in Fe and Zn than the raw materials. Germination was more effective in reducing phytic acid than heat treatment, and therefore it improves the nutritional quality of both guar and faba bean. Protein efficiency ratio (PER), true digestibility (DT) and biological value (BV) were estimated in all treatments under study using rat bioassay procedures. Data revealed pronounced improvements of the nutritive value as a result of all processes under study especially germination being the most effective.
DEFF Research Database (Denmark)
Engvild, Kjeld Christensen; Egsgaard, Helge; Larsen, Elfinn
1980-01-01
4-Chloroindole-3-acetic acid methyl ester was identified unequivocally in Lathyrus latifolius L., Vicia faba L. and Pisum sativum L. by thin layer chromatography, gas chromatography and mass spectrometry. The gas chromatographic system was able to separate underivatized chloroindole-3-acetic acid...... methyl ester isomers. The quantitative determination of 4-chloroindole-3-acetic acid methyl ester in immature seeds of these three species was performed by gas chromatography – mass spectrometry using deuterium labelled 4-chloro-indole-3-acetic acid methyl ester as an internal standard. P. sativum...
Xiao, Jing-Xiu; Zheng, Yi; Tang, Li
2014-06-01
Pot experiment of wheat and faba bean intercropping was conducted and exudates from wheat and faba bean roots were collected at different growth stages. Low molecular weight organic acids (OA) in root exudates were examined by HPLC. The results showed that wheat and faba bean intercropping significantly increased the total amounts of OA exuded by roots. At tillering (57 d), booting (120 d) and filling stages (142 d), intercropping increased the total amounts of OA in wheat root exudates by 155%, 35.6% and 92.6% respectively, in comparison with that of monoculture wheat (MW). At branching (57 d) and filling stages (142 d), intercropping increased the total amounts of OA in faba bean root exudates by 87.4% and 38.7%, respectively, in comparison with that of monoculture faba bean (MF). Wheat and faba bean intercropping changed the types of OA exuded by roots. At tillering stage, lactic acid was identified in root exudates of intercropping wheat (IW), but not in that of MW. At jointing stage (98 d), citric acid was identified in root exudates of IW, but not in that of MW, and acetic acid was vice versa. At branching stage, acetic acid was identified in root exudates of intercropping faba bean (IF), but not in that of MF, and lactic acid was vice versa. At filling stage, lactic acid was identified in root exudates of IF, but not in that of MF. Wheat and faba bean intercropping increased the OA exudation rate of wheat. At booting stage, the exudation rates of citric and fumaric acid from IW were 179 and 184-times as that of from MW, respectively. At filling stage, the exudation rate of lactic acid from IW was 2.53-times as that from MW. In conclusion, wheat and faba bean intercropping increased the rate and total amount, and changed the types of OA exuded by roots.
Tavakkoli, Ehsan; Rengasamy, Pichu; McDonald, Glenn K
2010-10-01
Despite the fact that most plants accumulate both sodium (Na(+)) and chloride (Cl(-)) ions to high concentration in their shoot tissues when grown in saline soils, most research on salt tolerance in annual plants has focused on the toxic effects of Na(+) accumulation. There have also been some recent concerns about the ability of hydroponic systems to predict the responses of plants to salinity in soil. To address these two issues, an experiment was conducted to compare the responses to Na(+) and to Cl(-) separately in comparison with the response to NaCl in a soil-based system using two varieties of faba bean (Vicia faba), that differed in salinity tolerance. The variety Nura is a salt-sensitive variety that accumulates Na(+) and Cl(-) to high concentrations while the line 1487/7 is salt tolerant which accumulates lower concentrations of Na(+) and Cl(-). Soils were prepared which were treated with Na(+) or Cl(-) by using a combination of different Na(+) salts and Cl(-) salts, respectively, or with NaCl. While this method produced Na(+)-dominant and Cl(-)-dominant soils, it unavoidably led to changes in the availability of other anions and cations, but tissue analysis of the plants did not indicate any nutritional deficiencies or toxicities other than those targeted by the salt treatments. The growth, water use, ionic composition, photosynthesis, and chlorophyll fluorescence were measured. Both high Na(+) and high Cl(-) reduced growth of faba bean but plants were more sensitive to Cl(-) than to Na(+). The reductions in growth and photosynthesis were greater under NaCl stress and the effect was mainly additive. An important difference to previous hydroponic studies was that increasing the concentrations of NaCl in the soil increased the concentration of Cl(-) more than the concentration of Na(+). The data showed that salinity caused by high concentrations of NaCl can reduce growth by the accumulation of high concentrations of both Na(+) and Cl(-) simultaneously, but
Faba bean in microspore culture
Hautsalo, Juho
2013-01-01
The objective of this study was to develop functional method for producing doupled-haploid plants for faba bean. Microspore culture is an advanced method to produce doubled-haploids and it is based on the totipotent nature of plant cells, since even a microspore, which is an immature pollen cell with haploid genome, can develop into a plant. This plant is either haploid or doupled haploid depending on whether there has been chromosome doubling or not and because the chromosomes either do not ...
Response of different genotypes of faba bean plant to drought stress.
Siddiqui, Manzer H; Al-Khaishany, Mutahhar Y; Al-Qutami, Mohammed A; Al-Whaibi, Mohamed H; Grover, Anil; Ali, Hayssam M; Al-Wahibi, Mona S; Bukhari, Najat A
2015-05-05
Drought stress is one of the major abiotic stresses that are a threat to crop production worldwide. Drought stress impairs the plants growth and yield. Therefore, the aim of the present experiment was to select the tolerant genotype/s on the basis of moprpho-physiological and biochemical characteristics of 10 Vicia faba genotypes (Zafar 1, Zafar 2, Shebam, Makamora, Espan, Giza Blanka, Giza 3, C4, C5 and G853) under drought stress. We studied the effect of different levels of drought stress i.e., (i) normal irrigation (ii) mild stress (iii) moderate stress, and (iv) severe stress on plant height (PH) plant-1, fresh weight (FW) and dry weight (DW) plant-1, area leaf-1, leaf relative water content (RWC), proline (Pro) content, total chlorophyll (Total Chl) content, electrolyte leakage (EL), malondialdehyde (MDA), hydrogen peroxide (H2O2) content, and activities of catalase (CAT), peroxidase (POD) and superoxide dismutase (SOD) of genotypes of faba bean. Drought stress reduced all growth parameters and Total Chl content of all genotypes. However, the deteriorating effect of drought stress on the growth performance of genotypes "C5" and "Zafar 1" were relatively low due to its better antioxidant enzymes activities (CAT, POD and SOD), and accumulation of Pro and Total Chl, and leaf RWC. In the study, genotype "C5" and "Zafar 1" were found to be relatively tolerant to drought stress and genotypes "G853" and "C4" were sensitive to drought stress.
Cotelle, Sylvie; Dhyèvre, Adrien; Muller, Serge; Chenon, Pascale; Manier, Nicolas; Pandard, Pascal; Echairi, Abdelwahad; Silvestre, Jérôme; Guiresse, Maritxu; Pinelli, Eric; Giorgetti, Lucia; Barbafieri, Meri; Silva, Valéria C; Engel, Fernanda; Radetski, Claudemir M
2015-01-01
The Vicia micronucleus assay was standardized in an international protocol, ISO 29200, "Assessment of genotoxic effects on higher plants-Vicia faba micronucleus test," for soil or soil materials (e.g., compost, sludge, sediment, waste, and fertilizing materials). The aim of this interlaboratory study on the Vicia micronucleus assay was to investigate the robustness of this in vivo assay in terms of its applicability in different countries where each participant were asked to use their own seeds and reference soil, in agreement with the ISO 29200 standard. The ISO 29200 standard protocol was adopted for this study, and seven laboratories from three countries (France, Italy, and Brazil) participated in the study. Negative and positive controls were correctly evaluated by 100 % of the participants. In the solid-phase test, the micronucleus frequency (number of micronuclei/1,000 cells) varied from 0.0 to 1.8 for the negative control (i.e., Hoagland's solution) and from 5.8 to 85.7 for the positive control (i.e., maleic hydrazide), while these values varied from 0.0 to 1.7 for the negative control and from 14.3 to 97.7 for the positive control in the case of liquid-phase test. The variability in the data obtained does not adversely affect the robustness of the protocol assessed, on the condition that the methodology described in the standard ISO 29200 is strictly respected. Thus, the Vicia micronucleus test (ISO 29200) is appropriate for complementing prokaryotic or in vitro tests cited in legislation related to risk assessment of genotoxicity potential.
Directory of Open Access Journals (Sweden)
Jean-Claude Audran
2014-01-01
Full Text Available A comparative study of mature sporoderms of sterile and fertile pollen grains was performed using electron microscopic techniques. In sterile pollen grains, intine is lacking; ectexine sculpture is reduced and tectum is overlaid by membranous systems. Infratectal texture is compact and a sporopollenin granulous mass is obturing the aperture central region. Endexine reacts with proteins and acidic carbohydrates tests.
ALLEVIATION OF SALINITY STRESS ON Vicia faba L. PLANTS VIA SEED PRIMING WITH MELATONIN
Directory of Open Access Journals (Sweden)
Mona Gergis DAWOOD
2015-01-01
Full Text Available La melatonina es una molécula ambientalmente amigable con una potente capacidad antioxidante y de trampa de radicales libres. Dos experimentos en materas fueron realizados en dos inviernos consecutivos (2011/2012 y 2012/2013 en instalaciones del Centro Nacional de Investigaciones, Dokki, Cairo, Egipto, para estudiar el potencial de la melatonina (100 mM and 500 mM para disminuir los efectos nocivos del agua de mar diluida a concentraciones relativamente bajas y altas (3,85 dS/m and 7,69 dS/m, respectivamente. Los resultados mostraron que la irrigación de plantas de haba con agua de mar diluida reduce los parámetros de crecimiento (altura de la planta, número de hojas/planta, peso fresco y seco de la planta, el contenido relativo de agua (RWC, los pigmentos fotosintéticos (clorofilas a, b y carotenoides, el ácido indo lacético, los carbohidratos totales, K+, Ca+2, al igual que las relaciones K+/Na+ y Ca2+/Na+. Esto fue acompañado por un incremento significativo en el contenido de fenoles, solutos compatibles (carbohidratos solubles totales, aminoácidos libres, prolina, Na+ y Cl- en comparación con las plantas control (plantas no tratadas. De otro lado, los tratamientos con melatonina mejoraron los parámetros de crecimiento, RWC, los pigmentos fotosintéticos, carbohidratos totales, contenido fenólico total, ácido indo acético, K+,Ca+2 al igual que las relaciones K+/Na+ y Ca+2/ Na+ , tanto en las plantas irrigadas con agua dulce de la llave como en las irrigadas con agua de mar diluida en comparación con los controles correspondientes. De otro lado, los tratamientos con melatonina redujeron los niveles de solutos compatibles, al igual que los contenidos de Na+ y Cl-, en comparación con los controles. El estrés por salinidad y/o los tratamientos con melatonina indujeron la producción de nuevas bandas de proteínas que no estuvieron presentes en las plantas control. El tratamiento de melatonina 500 mM tuvo un efecto más pronunciado que el tratamiento de 100 mM en disminuir los efectos adversos de los dos niveles de salinidad estudiados sobre el comportamiento de las plantas de haba.
Effect of salt stress on plant growth and metabolism of bean plant Vicia faba (L.
Directory of Open Access Journals (Sweden)
Amira M.S. Abdul Qados
2011-01-01
An increase was observed in the protein content in the two measurement periods due to the impact of salinity stress. A directly proportional relationship was found between protein content and the increase in salt concentrations in the first measurement period, while it was inversely proportional in the second.
Acumulación de arsénico en el cultivo de habas (Vicia Faba)
Francisco Prieto García; Judith Callejas Hernández; Alma D. Román Gutiérrez; Judith Prieto Méndez; Alberto J. Gordillo Martínez; María A. Méndez Marzo
2007-01-01
La presencia de arsénico en aguas y suelos de Zimapán, en el estado de Hidalgo, México, causa que los cultivos de haba presenten concentraciones apreciables de dicho elemento. Los suelos evaluados presentaron texturas, conductividad, contenidos de N y de arsénico diferentes, pero resultados similares en pH, potencial redox, y contenido de materia orgánica. La elevada bioacumulación de arsénico en estos suelos fue directamente proporcional al tiempo de exposición. Las concentraciones de arséni...
Asociacion Thysanoptera -Vicia faba en la Prepuna y Puna de Jujuy, Argentina
National Research Council Canada - National Science Library
Zamar, Maria Ines; Neder de Roman, Lilia Estela
2012-01-01
.... Los objetivos de este estudio fueron: identificar el complejo de tisanopteros antofilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecologicos y determinar el rol que cumplen en esta asociacion...
Acumulación de arsénico en el cultivo de habas (Vicia Faba
Directory of Open Access Journals (Sweden)
Francisco Prieto García
2007-01-01
Full Text Available La presencia de arsénico en aguas y suelos de Zimapán, en el estado de Hidalgo, México, causa que los cultivos de haba presenten concentraciones apreciables de dicho elemento. Los suelos evaluados presentaron texturas, conductividad, contenidos de N y de arsénico diferentes, pero resultados similares en pH, potencial redox, y contenido de materia orgánica. La elevada bioacumulación de arsénico en estos suelos fue directamente proporcional al tiempo de exposición. Las concentraciones de arsénico acumuladas más altas se obtuvieron en la raíz, el tallo, y las hojas, respectivamente. Concentraciones de 4 mg l-1, fueron letales para el cultivo; el fenómeno se apreció a partir de la etapa III de desarrollo, con la aparición de daños en las raíces y un fuerte efecto en la floración, que inhibió la formación de vainas.
Lessire, M; Gallo, V; Prato, M; Akide-Ndunge, O; Mandili, G; Marget, P; Arese, P; Duc, G
2017-08-01
The faba bean (Vicia faba L.) is a potential source of proteins for poultry, mainly for laying hens whose protein requirements are lower than those of other birds such as growing broilers and turkeys. However, this feedstuff contains anti-nutritional factors, that is, vicine (V) and convicine (C) that are already known to reduce laying hen performance. The aim of the experiment reported here was to evaluate the effects of a wide range of dietary V and C concentrations in laying hens. Two trials were performed with laying hens fed diets including 20% or 25% of faba bean genotypes highly contrasting in V+C content. In Trial 1, faba beans from two tannin-containing cultivars, but with high or low V+C content were dehulled in order to eliminate the tannin effect. In addition to the contrasting levels of V+C in the two cultivars, two intermediate levels of V+C were obtained by mixing the two cultivars (70/30 and 30/70). In Trial 2, two isogenic zero-tannin faba bean genotypes with high or low V+C content were used. In both trials, a classical corn-soybean diet was also offered to control hens. Each experimental diet was given to 48 laying hens for 140 (Trial 1) or 89 (Trial 2) days. Laying performance and egg quality were measured. The redox sensitivity of red blood cells (RBCs) was assessed by measuring hemolysis and reduced glutathione (GSH) concentration in these cells. Egg weight was significantly reduced by the diets containing the highest concentrations of V+C (Pbean genotypes with low concentrations of V+C can therefore be used in laying hen diets up to 25% without any detrimental effects on performance levels or egg characteristics, without any risk of hemolysis of RBCs.
Directory of Open Access Journals (Sweden)
Massucati, Luiz Felipe Perrone
2014-02-01
Full Text Available Under conditions of Organic Farming, we investigated whether direct seeding of faba bean (Vicia faba L. into straw mulch from residues of precrop oats used for weed control enables at least occasional/opportunistic direct seeding in Organic Agriculture. Eight field trials were carried out at different study sites in North Rhine-Westphalia, Germany, in 2008-2009 and 2009-2010. Direct seeding (DS was performed into mulch layers of 0,4 and 6 t ha-1 of straw residues applied to the remaining stubble, simulating different yield levels of the precrop oats. LBS was used as a reference treatment, where straw was harvested, stubble tillage performed and seedbed prepared in fall and oil radish (Raphanus sativus grown as winter cover crop. Mouldboard ploughing combined with conventional seedbed preparation was performed in early spring to V. faba. Compared with LBS, straw mulch with subsequent direct seeding suppressed especially dicotyledonous annuals significantly. DS treatments with straw reduced the abundance of this group by 81 and 85% compared with LBS. Straw mulch resulted in effective suppression of photosensitive weeds such as Matricaria spp. and late germinating Chenopodium album. Grasses and perennial species occurred independent of the amount of straw. Compared with DS, the abundance of these weeds was reduced by 64 and 82% in LBS treatment. The shoot dry matter production of faba bean was retarded by DS compared with LBS, but significant yield losses could be avoided with straw residues of at least 4 t ha-1. Sufficient amount of straw of from the previous crop is a key criterion to facilitate organic no-till farming of faba bean in a suitable crop sequence when pressure of perennials and grasses is low.
Occurrence of phytoplasma phyllody and witches' broom disease of faba bean in Bihar.
Singh, Anil K; Bhatt, B P; Manibhushan
2013-09-01
Faba bean (Vicio faba) plants showed symptoms of shoe stringed leaves, phyllody and flower abortion in experimental field. The first symptoms consisted of phyllody mild yellowing, vein clearing and slightly inward folding of newly formed leaves in the apical region of the plant. The disease was characterized by a series of floral abnormalities including virescence, phyllody and proliferation of sprouts together with other abnormalities, such as loss of apical dominance, vivipary and enhanced vegetative growth. Ambient temperature found to be contributing positively on disease development. Under climate change condition there may be every possible chance for speedy spread of this very economic important disease to the earlier not known regions.
[Studies on the chemical constitutens of Vicia amoena Fisch].
Wei, F; Yan, W M
1997-10-01
One new flavonoide was isolated from Vicia amoena Fisch. On the basis of spectral (UV, MS, NMR) and chemical reactions, it was elucidated to be kaempferol-3-O-beta-D-mannoside, named amoenin(A3). Moreover, five known compounds have been isolated and identified as quercetin, kaempferol, quercetin-3-O-alpha-L-rhamoside, quercetin-3-O-beta-D-glucoside, kaempferol-3, 7-O-alpha-L-dirhamoside. The total flavonoides showed significant effects on inducing hyperlipidemia and increasing micro-blood vessel elasticity.
Observaciones cariológicas en Vicia amphicarpa sensu lato
Directory of Open Access Journals (Sweden)
Tardío Pato, F. Javier
1998-12-01
Full Text Available Cytological studies were carried out on twenty four amphicarpic wild populations of Vicia sativa group from different sites (19 from Spain, 4 from Syria and 1 from Turkey. Morphologically, 19 accessions can be attributed to taxon Dorthes and 5 to V. angustifolia subsp. pseudoangustifolia (Rouy Tardío, comb. nov. In our studies, these two taxa show different chromosome numbers, V. amphicarpa Dorthes, has 14 chromosomes, while V. angustifolia subsp. pseudoangustifolia has only 12. Furthermore, the form of the chromosomes in the karyotypes of both taxa is quite different. The chromosome number and the morphology of the karyotype found in the first taxon agree with most of previous reports on V. amphicarpa, with a very characteristic short metacentric and six acrocentric chromosomes, one of them satellited. However, the second taxon has a very different karyotype with three large chromosomes, one of them submetacentric and another satellited, plus another three chromosomes which are significantly smaller. Therefore, we can conclude that within the genus Vicia, at least two amphicarpic taxa exist, clearly differentiated, both in morphological and karyotypical characteristics.Se estudian cariológicamente 24 poblaciones anficárpicas silvestres pertenecientes al grupo Vicia sativa, de distinta procedencia (19 españolas, cuatro de Siria y una de Turquía. Se encuentran diferencias en los números cromosomáticos y en los cariótipos. Diecinueve poblaciones presentan 14 cromosomas y cariotipo como el observado por otros autores, constituido por un pequeño cromosoma metacéntrico y seis acrocéntricos, uno de ellos con satélite. Éstas corresponden a V. amphicarpa Dorthes. Las otras cinco, con 2n = 12 y cariotipo con tres cromosomas grandes, uno de ellos submetacéntrico, otro con satélite, y otros tres mucho más pequeños, corresponden a V. angustifolia subsp. pseudoangustifolia (Rouy Tardío. Esta anterior se propone como combinación nueva. Por
Response of Different Genotypes of Faba Bean Plant to Drought Stress
Directory of Open Access Journals (Sweden)
Manzer H. Siddiqui
2015-05-01
Full Text Available Drought stress is one of the major abiotic stresses that are a threat to crop production worldwide. Drought stress impairs the plants growth and yield. Therefore, the aim of the present experiment was to select the tolerant genotype/s on the basis of moprpho-physiological and biochemical characteristics of 10 Vicia faba genotypes (Zafar 1, Zafar 2, Shebam, Makamora, Espan, Giza Blanka, Giza 3, C4, C5 and G853 under drought stress. We studied the effect of different levels of drought stress i.e., (i normal irrigation (ii mild stress (iii moderate stress, and (iv severe stress on plant height (PH plant−1, fresh weight (FW and dry weight (DW plant−1, area leaf−1, leaf relative water content (RWC, proline (Pro content, total chlorophyll (Total Chl content, electrolyte leakage (EL, malondialdehyde (MDA, hydrogen peroxide (H2O2 content, and activities of catalase (CAT, peroxidase (POD and superoxide dismutase (SOD of genotypes of faba bean. Drought stress reduced all growth parameters and Total Chl content of all genotypes. However, the deteriorating effect of drought stress on the growth performance of genotypes “C5” and “Zafar 1” were relatively low due to its better antioxidant enzymes activities (CAT, POD and SOD, and accumulation of Pro and Total Chl, and leaf RWC. In the study, genotype “C5” and “Zafar 1” were found to be relatively tolerant to drought stress and genotypes “G853” and “C4” were sensitive to drought stress.
Directory of Open Access Journals (Sweden)
Magdi T. Abdelhamid
2013-09-01
Full Text Available A possible survival strategy of plants under saline conditions is to use some compounds that could alleviate salt stress effect. One of these compounds is nicotinamide. The effect of exogenously application of nicotinamide with different concentrations (0, 200 and 400 mg/l on Vicia faba L. plant against different NaCl treatments (0, 50 and 100 mM NaCl was investigated at the wire house of the National Research Centre, Cairo, Egypt. Salinity stress reduced significantly plant height, dry weight of shoot, photosynthetic pigments, polysaccharides, total carbohydrates, total-N contents of shoot, seed yield, total carbohydrates & total crude protein of the yielded seeds compared with those of the control plants. In contrast, salinity induced marked increases in sucrose, total soluble sugars, total free amino acids, proline, lipid peroxidation product (MDA and some oxidative enzymes (polyphenol oxidase and peroxidase enzymes. Also, salinity stress increased Na+ contents with the decreases of other macro and micro elements contents (P, K+, Mg+, Ca2+, Fe2+, Mn2+, Zn2+ and Cu2+ of shoots and the yielded seeds of faba bean. Foliar spraying of nicotinamide alleviated the adverse effects of salinity stress through increased plant height, dry weight of shoot, photosynthetic pigments, polysaccharides, total carbohydrates, total-N contents of shoot and seed yield as well as, sucrose, total soluble sugars, total free amino acids and proline, compared with those of the corresponding salinity levels, while decreased lipid peroxidation product as MDA and the oxidative enzymes (polyphenol oxidase and peroxidase enzymes. Nicotinamide inhibited the uptake of Na+ and accelerated the accumulation of P, K+ , Mg+, Ca2+, Fe2+, Mn2+, Zn2+ and Cu2+ contents in the shoots of salt stressed plants and enhanced total carbohydrate and total crude protein percentage and solutes concentrations in seeds of salinity treated plants.
Exploring the Microbiota of Faba Bean: Functional Characterization of Lactic Acid Bacteria
Directory of Open Access Journals (Sweden)
Michela Verni
2017-12-01
Full Text Available This study investigated the metabolic traits of 27 lactic acid bacteria (LAB strains belonging to different species, previously isolated from faba bean. The activities assayed, related to technological and nutritional improvement of fermented faba bean, included peptidases, β-glucosidase, phytase, as well as exopolysaccharides synthesis and antimicrobial properties. In addition, the bacteria performance as starter cultures during faba bean fermentation on proteolysis, antioxidant potential, and degradation of condensed tannins were assessed. Fermentative profiling showed that only 7 out of 27 strains were able to metabolize D-raffinose, particularly Leuc. mesenteroides I01 and I57. All strains of Pediococcus pentosaceus exerted high PepN activity and exhibited β-glucosidase activity higher than the median value of 0.015 U, while phytase activity was largely distributed among the different strains. All the weissellas, and in lower amount leuconostocs, showed ability to produce EPS from sucrose. None of the strains did not survive the simulated gastrointestinal tract with the exception of P. pentosaceus I56, I76, 147, I214, having a viability of 8–9 log CFU/ml at the end of the treatment. None of the strains showed antimicrobial activity toward Staphylococcus aureus, while eight strains of P. pentosaceus exhibited a strong inhibitory activity toward Escherichia coli and Listeria monocytogenes. Generally, the doughs fermented with pediococci exhibited high amount of total free amino acids, antioxidant activity, and condensed tannins degradation. These results allowed the identification of LAB biotypes as potential starter cultures for faba bean bioprocessing, aiming at the enhancement of faba bean use in novel food applications.
( Vicia peregrina ) seed as protein source for mirror carp ( Cyprinus ...
African Journals Online (AJOL)
An 80-day feeding trial was conducted in a recirculation system aquarium operating at 26 ± 0.3 °C, to evaluate the nutritive value of Vicia peregrina seed as a possible protein source in the diet of mirror carp (Cyprinus carpio) fingerlings. Vicia peregrina seed was included in the diets at different levels, viz. 100, 200, 300 g ...
The Potential Use of Fermented Chickpea and Faba Bean Flour as Food Ingredients.
Chandra-Hioe, Maria V; Wong, Christina H M; Arcot, Jayashree
2016-03-01
Apart from being a rich and inexpensive protein source, legumes provide essential vitamins, minerals and dietary fibre. Considering the nutritional benefits, legumes flour can potentially be incorporated in the development of new products. The aim of this study was to investigate whether fermentation affects the protein content, in vitro protein digestibility, trypsin inhibitor activity and the functionality of proteins in faba bean, desi and kabuli chickpea. Australian grown chickpea and faba bean were selected and initially soaked, de-hulled, dried and milled into flour. This was fermented with lyophilised yoghurt cultures in a 30 °C orbital shaker for 16 h. While protein contents in fermented desi and kabuli flour were lower than their raw counterparts (p > 0.05), it was significantly higher in fermented faba bean. A significant increase (9.5%) in in vitro protein digestibility was found in fermented desi. Trypsin inhibitor activity in fermented desi, kabuli and faba bean reduced by 2.7, 1.1 and 4.7%, respectively (p > 0.05). Overall, the in vitro protein digestibility in flour samples increased, while simultaneously reducing the trypsin inhibitor activity. The water absorption capacity of the fermented kabuli flour significantly increased by 11.3%. All fermented flour samples had significantly higher oil absorption capacity than their corresponding raw flour that was likely due to increased insoluble hydrophobic protein. Although, the foaming capacity in all fermented flour samples was significantly lower than their respective raw samples, only fermented desi and faba bean flour showed lower foaming stability (p > 0.05). The present study suggests that fermented legume flour could fulfill the demand for innovative products of higher nutritional value.
Abd El-Baki, G K; Mostafa, Doaa
2014-12-01
The interaction between sodium chloride and Trichoderma harzianum (T24) on growth parameters, ion contents, MDA content, proline, soluble proteins as well as SDS page protein profile were studied in Vicia faba Giza 429. A sharp reduction was found in fresh and dry mass of shoots and roots with increasing salinity. Trichoderma treatments promoted the growth criteria as compared with corresponding salinized plants. The water content and leaf area exhibited a marked decrease with increasing salinity. Trichoderma treatments induced a progressive increase in both parameters. Both proline and MDA contents were increased progressively as the salinity rose in the soil. Trichoderma treatments considerably retarded the accumulation of both parameters in shoots and roots. Both Na+ and K+ concentration increased in both organs by enhancing salinity levels. The treatment with Trichoderma harzianum enhanced the accumulation of both ions. Exposure of plants to different concentrations of salinity, or others treated with Trichoderma harzianum produced marked changes in their protein pattern. Three types of alterations were observed: the synthesis of certain proteins declined significantly, specific synthesis of certain other proteins were markedly observed and synthesis of a set specific protein was induced de novo in plant treated with Trichoderma harzianum.
Interaction between faba bean cultivars and the Rhizobium ...
African Journals Online (AJOL)
The efficiency of eight Rhizobium leguminosarum strains isolated from root nodules of Faba bean plants which were collected from different Governorate in Egypt has been examined. After inoculation of faba bean seeds with each Rhizobium strain individually, we measured the growth promotion, nodule formation and plant ...
Elsheikh, E A; Elzidany, A A
1997-01-01
A field experiment was carried out to investigate the effect of Rhizobium inoculation, sulphur, nitrogen and chicken manure on yield, 100-seed weight, cookability, non-soakers, total defects and hydration coefficient of faba bean. The results showed that sulphur, nitrogen and chicken manure treatments significantly (p manure not only increased plant growth and yield, but also improved seed quality and nutritional value.
Effects of Intercropping (Canola-Faba Bean on Density and Diversity of Weeds
Directory of Open Access Journals (Sweden)
Mohamad Hossain GHARINEH
2010-03-01
Full Text Available In order to evaluate the biological effect and interference of crop and weed in canola-faba bean intercropping in comparison with mono culture, an experiment was conducted in randomize completely blocks design with three replication at Ramin Agriculture and Natural Resources, University. In this experiment treatments were different compositions of canola (Brassica napus L. var. haylo and faba bean (local cultivar. Plant densities (0, 20 and 40 plants per m2 for canola and four levels include (0, 20, 40 and 60 plants per m2 for faba bean in accordance with additive form mixed culture system respectively. Weed dry weight was affected by culture system and different levels of plant densities in mixed culture and there were significant difference 1%. Lowest weed dry weight was obtained in 20-60 and 40-60 plants m-2 canola-bean intercropping. In the intercropping parts only two species was observed while in the sole culture more than three species were exist. Results showed that with increasing in bean diversity, weed dry weight declines. According to our results, it is possible to control weed effectively by using intercropping system, but more studied is required. Diversity of weeds had been clearly affected. Results showed that only Beta and Malva species were existed in intercropping comparing to sole cultures that Brassica, Beta, Rumex and Malva were existed.
Variation in quantitative characters of faba bean after seed ...
African Journals Online (AJOL)
Variation in quantitative characters of faba bean after seed irradiation and associated molecular changes. Sonia Mejri, Yassine Mabrouk, Marie Voisin, Philippe Delavault, Philippe Simier, Mouldi Saidi, Omrane Belhadj ...
Implication du stress oxydatif dans la toxicité du plomb sur une plante modèle, Vicia faba
Pourrut, Bertrand
2008-01-01
Le plomb est un des métaux les plus utilisés par l'Homme mais c'est aussi l'un des plus toxiques. Dans les écosystèmes, la teneur en plomb d'origine anthropique n'a cessé d'augmenter depuis plusieurs siècles. Dans plusieurs régions en France, le plomb pose actuellement des problèmes importants en matière de contamination de l'environnement. Les plantes, du fait de leur immobilité, sont particulièrement exposées. De nombreuses études ont déjà évalué la toxicité de ce métal sur les végétaux, ma...
Utilización de harina de haba (vicia faba l.) en la elaboración de pan
Rocha Espinoza, Ma. Del Carmen; Vásquez Arreaga, María N.; Cornejo Zuñiga, Fabiola
2011-01-01
En nuestro país, se han venido desarrollando investigaciones que permiten reemplazar parcialmente la harina de trigo por harinas no tradicionales, con el fin de reducir costos. En el presente trabajo se pretende conocer la influencia del uso de harinas no tradicionales (harina de haba) en la retro degradación del pan. Se comenzó con una caracterización de los aspectos físicos y químicos más importantes de la materia prima; color, olor, estado de madurez, humedad, pH, acidez y actividad de ...
Preparación y determinación de propiedades funcionales de Concentrados proteicos de haba (Vicia faba
Directory of Open Access Journals (Sweden)
Lina Modercay
2010-07-01
Full Text Available Con cl propósito de obtener concentrados proteicos de haba, que eventualmente puedan ser empleados en la elaboración de alimentos para consumo humano, se establecieron a nivel de laboratorio, las condiciones para la extracción de las proteínas a partir de harina de haba baja en tegumento. Los resultados muestran que se obtiene un concentrado con más de 60% de proteína bruta en base seca, al suspender la harina de haba en agua en unarclaci'on I:6apH 8 manteniendo el sistema con agitación constante durante 0.5 hora a 40 °C y posteriormente acidificando el sobrenadante con HCl IN hasta pH 5.5. El método más aconsejable para el proceso de secado, es cl de rodillos de acuerdo con las características químicas, físicas y funcionales del producto.
PREPARACIÓN DE PELÍCULAS PARA ALIMENTOS A PARTIR DE CONCENTRADOS PROTEICOS DE HABA (Vicia faba
Directory of Open Access Journals (Sweden)
Ana Patricia Rozo
2008-02-01
Full Text Available El trabajo se planeó con el objeto de evaluar la factibilidad de utilizar concentrados proteicos de haba en la preparación de películas para recubrir alimentos, utilizando como patrón de comparación películas preparadas con albúmina fresca de huevo.Los resultados muestran que utilizando concentrados proteicos de haba sin deshidratar, en suspensiones que contengan 5 g de proteína por 100 g de agua, y adicionando glicerol como agente plastificante,se pueden obtener películas cuyas características de permeabilidad alvapor de agua, solubilidad y contenido de agua dependen de las condiciones de secado del material.
Occurrence of broad bean (Vicia faba L. diseases in Olsztyn-Elbąg and Bydgoszcz Provinces
Directory of Open Access Journals (Sweden)
Stanisław Sadowski
2013-12-01
Full Text Available During the years 1981-1985, there were conducted studies of the healthiness of broad bean,'Nadwiślański' variety, cultivated in different soil and climate conditions of the two regions: i.e. Bydgoszcz - comparatively warmer and drier, and Olsztyn-Elbląg - colder and moister. It was found that the main reason for a premature broad bean leaves dry in up in the Olsztyn-Elbląg Region was caused by the fungi Cercospora and Botrytis, and in the Bydgoszcz Region - the root rot which occurs here to a greater extent. Root gangrene was greater intensity in drier and lighter soils. Rotting broad bean roots were most frequently occupied by the fungi of the Fusarium family (ca. 70%. The prevailing species were Fusarium oxysporum, next F. solani and more rarely F. culmorum and F. avenaceum. Climate conditions and soil species affected considerably the species composition of the root fungi.
Laranjeira, Sara Silva
2017-01-01
Dissertação de Mestrado em Engenharia Agronómica As restrições económicas e ambientais de fertilizantes azotados minerais utilizados na produção de gramíneas conferem um papel de relevo ao cultivo de leguminosas com incorporação dos seus resíduos no solo como fonte de azoto para as culturas principais da rotação. A reduzida investigação em Portugal sobre a utilização de espécies leguminosas em condições mediterrânicas como fonte de azoto, conduziu-nos ao presente estudo realizado no campus...
Bakr, A A
1996-01-01
In order to study the effects of main technological pretreatments practised for preparing Egyptian faba bean products, i.e. decortication as well as soaking and germination followed by dehulling on the nutritional value, series of experiments were carried out. Such pretreatments had a significant effect on the changes in the chemical composition of faba beans. The proportion of the removed hulls reached generally about 14%. Data revealed also pronounced improvements on the nutritive value as a result of all studied pretreatments, especially germination being the most effective. Chemical scoring of all determined essential amino acids was > 60, except methionine and cystine showed the lowest score (content.
Desinfección de semilla de faba granja asturiana
González, A.J.
2009-01-01
Se evaluaron diferentes tratamientos desinfectantes sobre semillas de faba granja asturiana tanto en laboratorio como en campo, con el fin de seleccionar los más eficaces. Los resultados nos llevan a proponer el tratamiento con tiram, a la dosis de 1,5 gramos de producto por kilogramo de semilla, como el antifúngico más adecuado. Different disinfection treatments were assessed on Asturian white beans (faba de la granja variety) both in the laboratory and in the field with the aim of select...
In vitro plant regeneration from Turkish Narbon Vetch (Vicia ...
African Journals Online (AJOL)
STORAGESEVER
2009-02-18
Feb 18, 2009 ... containing peat moss and acclimatized in the greenhouse. Acclimatization was done by covering pots with polyethylene bags to maintain initial humidity for 1 .... Vicia L. In Davis PH (Ed.), Flora of Turkey and the East Aegean Islands. Edinburgh, Edinburgh University Press. 3: 274-325. Diallo MS, Ndiaye A, ...
In vitro plant regeneration from Narbon Vetch ( Vicia narbonensis L ...
African Journals Online (AJOL)
Narbon vetch (Vicia narbonensis L.) is an agriculturally important forage plant that widely grows in an area extending from Central Europe to various parts of Asia. The study reports axillary shoot regeneration from cotyledonary node explants obtained from, in vitro raised seeds of 4 - 5 and 14 - 15 days old seedlings on MS ...
Chemical composition and in vitro gas production of vetch ( Vicia ...
African Journals Online (AJOL)
Chemical composition and in vitro gas production of vetch (Vicia sativa) and some browse and grass species from northern Ethiopia were investigated. Vetch (fresh cut) was sampled in September and vetch hay samples were taken in October both during the early dry period. Samples of the browse and grass species were ...
In vitro plant regeneration from Turkish Narbon Vetch ( Vicia ...
African Journals Online (AJOL)
Narbon vetch (Vicia narbonensis L.) is an important forage species among vetches of central Europe, Mediterranean, Near East, Ethiopia, central Asia and India. The study reports in vitro micropropagation of narbon vetch using cotyledon node, shoot tip and zygotic embryo explants on MS medium containing 0.25, 0.50, ...
Grain Yield and Economic Benefit of Intercropping Barley and Faba ...
African Journals Online (AJOL)
Farmers in the highland areas of southern Ethiopia own less cultivable land. Barley and faba bean are important crops in the southern highlands of Ethiopia. However, rapid population growth in the region, which has led to scarcity of cultivable land, is threatening cultivation of these crops. Therefore, farmers often resort to ...
Directory of Open Access Journals (Sweden)
Lana Zoric
2015-06-01
Full Text Available The effect of intercropping on stem anatomy of both supporting (Lupinus albus and supported (Vicia narbonnensis and V. sativa annual forage legumes was investigated using stereological method. Intercropped plants showed minimal differences in volume densities (Vv of stem tissues and forage chemical composition compared to sole crops. The proportions of lignin and NDF (Neutral Detergent Fiber positively correlated with xylem Vv. The proportions of ADF (Acid Detergent Fiber, cellulose and ash in intercropped plants were increased or decreased mostly by less than 10% compared to those in pure stands. The Anatomical Equivalent Ratio (AER defined as the ratio based on anatomical quality-determining parameters, can assist in the evaluation of the benefits of specific intercropping systems. Intercropping of the legume species studied in this work, especially L. albus with V. sativa, showed encouraging results from anatomical perspective since it would not cause a decline of forage quality.
Gatta, Domenico; Russo, Claudia; Giuliotti, Lorella; Mannari, Claudio; Picciarelli, Piero; Lombardi, Lara; Giovannini, Luca; Ceccarelli, Nello; Mariotti, Lorenzo
2013-06-01
The study evaluated the partial substitution of soybean meal by faba beans (18%) or peas (20%) as additional protein sources in diets destined for typical Italian heavy pig production. It compared animal performances, meat quality, the presence of residual anti-nutritional factors (ANF) and phytoestrogens in plasma and meat and the possible effects on pig health, by evaluating oxidative, inflammatory and pro-atherogenic markers. The results showed that the productive performances, expressed as body weight and feed conversion ratio, of pigs fed with faba bean and pea diets were similar to those of pigs fed only the soybean meal. Meat quality of pigs fed with the three diets was similar in colour, water-holding capacity, tenderness and chemical composition. Despite the higher levels of phytoestrogen in the plasma of pigs fed only the soybean meal, phytoestrogen concentration in the muscle was equivalent to that of animals fed diets with faba beans, whereas pigs fed a diet with peas showed a lower concentration. Inflammation and pro-atherogenic parameters did not show significant differences among the three diets. Overall, the partial substitution of soybean meal by faba beans appears more interesting than with peas, particularly in relation to the higher amount of polyphenols in the diet and the highest concentration of phytoestrogens found in the plasma and muscle of animals, while the pyrimidine anti-nutritional compounds present in the diet did not appear to accumulate and had no effect on the growth performance of animals.
Amylolytic treatment on faba bean for producing emulsions and emulsion gels
Suryanarayanan, Tilak
2015-01-01
The objective of the thesis was to investigate the effect of carbohydrates on solubility, emulsifying, gelling and water holding properties of proteins. Faba bean is a readily available pulse crop with high protein content similar to soy bean and there is a lot of potential for a novel, high protein fermented gel product to be made from a pulse crop like faba bean. This is mainly due to its remarkable nutritional properties, functional properties and low cost, the demand for faba bean protein...
Wang, Jian-hong; Zhang, Xian; Cao, Kai; Hua, Jin-wei
2015-05-01
A field experiment was conducted on paddy soil derived from alluvial materials at Bihu Town, Lishui City, Zhejiang Province, China to explore the effects of combined application of faba bean fresh straw and different-rate chemical fertilizer on nutrient uptake, nutrient use efficiencies, and yields of single cropping late rice and to determine the optimal rate of chemical fertilizer under the condition of application of faba bean fresh straw at the rate of 15 t · hm(-2) (GM15) in 2012, April to December. The experiments consisted of 7 treatments: CK (no fertilizers) , CF (conventional chemical fertilizer rate) , and combined application of 15 t · hm(-2) of faba bean fresh straw and 0%, 20%, 40%, 60% and 80% of the conventional chemical fertilizer rate. The results showed that the highest total uptake amounts of N, P and K by the aboveground part were obtained from the treatments of GM15 + 60%CF and GM15 + 80% CF, but the highest nutrient agronomy use efficiencies of N, P and K in rice grains were obtained from the treatments of GM15 + 60% CF and GM15 + 40% CF. The agronomy use efficiencies and physiological use efficiencies of N, P, and K were significantly correlated with rice grain yields, thus they could be used for accurate comprehensive evaluation of fertilizer efficiencies of N, P, and K. Compared with no fertilizer treatment, the treatments of 100% CF and combined application of faba bean fresh straw and different-rate chemical fertilizer increased rice gain yields by 25.0% and 6.1%-29.2%, respectively. In the cropping system of faba bean-single cropping late rice, returning of 15 t · hm2 faba bean fresh straw to the paddy field did not result in the runt seedling of rice. From the point of improving fertilizer use efficiency and reducing environmental risk perspective, the optimum rate of chemical fertilizer was 60% of the conventional chemical fertilizer rate when 15 t · h(-2) of faba bean fresh straw was applied.
Vicia vulcanorum (Fabaceae a new species from the island of Lanzarote (Canary Islands
Directory of Open Access Journals (Sweden)
Morales-Mateos, J. B.
2012-12-01
Full Text Available Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, a new species of subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. is described and illustrated from the island of Lanzarote, Canary Islands, north-west of Africa. It is related to and compared with Vicia cirrhosa C. Sm. ex Webb & Berthel. and Vicia filicaulis Webb & Berthel., two endemic species from the western and central group of the Canary Islands, and Vicia ferreirensis Goyder, an endemic species from Porto Santo Island, Madeira Archipelago.Se describe e ilustra Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, una nueva especie y endemismo de la isla de Lanzarote, Islas Canarias, perteneciente al subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. Se encuentra relacionada y es comparada con Vicia cirrhosa C. Sm. ex Webb & Berthel. y Vicia filicaulis Webb & Berthel., especies endémicas de las islas centrales y occidentales del archipiélago canario, y con Vicia ferreirensis Goyder, especie endémica de la isla de Porto Santo, en el archipiélago de Madeira.
Mete, Aslı; Rogers, Krysta; Houston, Robin
2017-01-01
A hatch-year Common Raven ( Corvus corax ) with subcutaneous and internal pseudocysts, filled with fluid, containing a pair of adult trematodes and numerous eggs consistent with Collyriclum faba, died near a riverbank in California, US. While C. faba is incidental in many Passeriformes, this case was a fatal systemic infection.
Changes Germination, Growth and Anatomy Vicia ervilia in Response to Light Crude Oil Stress
Directory of Open Access Journals (Sweden)
Bahareh Lorestani
2014-05-01
Full Text Available Thepetroleum concentrations are contaminant important sources in the environment. Hydrocarbon’s contaminants depend on their type and concentration can cause variable toxicity in soils, on the other hand, different kinds of plants also response concentration of contaminant differently, because of the diversity of physiological and morphological characteristics. In this study the effect of different concentrations of light crude oil was investigated on stem length, germination and anatomical of Vicia ervilia. A factorial experiment was used with a randomized complete block design (RCBD with three replications. The results showed that the germination and stem lengths decreased significantly (p≤ 0.05 with increasing concentrations of petroleum. Anatomical studies the changes of parenchyma, vascular bundles, epidermal and increase crack showed.
Lyu, Yang; Tang, Hongliang; Li, Haigang; Zhang, Fusuo; Rengel, Zed; Whalley, William R.; Shen, Jianbo
2016-01-01
The relationship between root morphological and physiological responses to variable P supply in different plant species is poorly understood. We compared root morphological and physiological responses to P supply in seven crop species (Zea mays, Triticum aestivum, Brassica napus, Lupinus albus, Glycine max, Vicia faba, Cicer arietinum) treated with or without 100 mg P kg-1 in two soils (acidic and calcareous). Phosphorus deficiency decreased root length more in fibrous root species (Zea mays, Triticum aestivum, Brassica napus) than legumes. Zea mays and Triticum aestivum had higher root/shoot biomass ratio and Brassica napus had higher specific root length compared to legumes, whereas legumes (except soybean) had higher carboxylate exudation than fibrous root species. Lupinus albus exhibited the highest P-acquisition efficiency due to high exudation of carboxylates and acid phosphatases. Lupinus albus and Cicer arietinum depended mostly on root exudation (i.e., physiological response) to enhance P acquisition, whereas Zea mays, Triticum aestivum and Brassica napus had higher root morphology dependence, with Glycine max and Vicia faba in between. Principal component analysis using six morphological and six physiological responses identified root size and diameter as the most important morphological traits, whereas important physiological responses included carboxylate exudation, and P-acquisition and P-utilization efficiency followed by rhizosphere soil pH and acid phosphatase activity. In conclusion, plant species can be grouped on the basis of their response to soil P being primarily via root architectural or exudation plasticity, suggesting a potential benefit of crop-specific root-trait-based management to cope with variable soil P supply in sustainable grain production. PMID:28066491
Rizzello, Carlo G; Verni, Michela; Koivula, Hanna; Montemurro, Marco; Seppa, Laila; Kemell, Marianna; Katina, Kati; Coda, Rossana; Gobbetti, Marco
2017-02-22
Faba bean has gained increasing attention from the food industry and the consumers mainly due to the quality of its protein fraction. Fermentation has been recently recognized as the most efficient tool for improving its nutritional and organoleptic properties. In this study, faba bean flour fermented with Lactobacillus plantarum DPPMAB24W was used to fortify semolina pasta. Pasta samples including different percentages of fermented faba bean flour were produced at the pilot-plant level and characterized using an integrated approach for chemical, nutritional, technological, and sensory features. At a substitution level of 30%, pasta had a more homogeneous texture and lower cooking loss compared to 50% addition. The impact of faba bean flour addition on pasta technological functionality, particularly of the protein fraction, was also assessed by scanning electron microscopy and textural profile analysis. Compared to traditional (semolina) pasta and pasta containing unfermented faba bean flour, the nutritional profile (in vitro protein digestibility and nutritional indexes - chemical score (CS), sequence of limiting essential amino acids, Essential Amino Acid Index (EAAI), Biological Value (BV), Protein Efficiency Ratio (PER), and Nutritional Index (NI)) and the resistant starch content of pasta containing 30% fermented faba bean flour markedly improved, while the starch hydrolysis rate decreased, without negatively affecting technological and sensory features. The use of fermentation technology appears to be a promising tool to enhance the quality of pasta and to promote the use of faba bean flour.
DEFF Research Database (Denmark)
Vijn, I; Yang, W C; Pallisgård, N
1995-01-01
We isolated ENOD5, ENOD12 and ENOD40 homologues from Vicia sativa and studied their expression pattern during Rhizobium-induced nodule formation. Comparison of the VsENOD40 nucleotide sequence with the pea, soybean and alfalfa ENOD40 sequences showed that the sequences contain two conserved regions...... the expression pattern of VsENOD5, VsENOD12 and VsENOD40 during Rhizobium-induced nodule formation. Although the expression of these genes is largely similar to that of the pea counterparts, differences where found for the expression of VsENOD12 and VsENOD40 in Vicia. VsENOD12 is expressed in the whole...
Directory of Open Access Journals (Sweden)
TANG Yan-fen
2016-09-01
Full Text Available Soil microorganism is one of the key factors that affects soil ecological activity. It is an important symbol of soil health, and the soil nitrogen cycle is closely related to the microorganisms. The relationship between nitrogen and microorganisms under the intercropping is im-portant for the farmland ecosystem. In this paper, phospholipid fatty acids(PLFA analysis was used to determine soil microbial communi-ties, e.g., biomasses of anaerobic bacteria, aerobic bacteria, bacteria, fungi and actinobacteria. The abundance of nitrifying genes(AOB, AOA and three denitrifying genes (nirK, norB, nosZ were measured using real-time quantitative polymerase chain reaction. The enzymes, nitrate and ammonium concentrations were measured using conventional methods. The results showed that along with the growth period, the TPLFAs(total phospholipid fatty acids increased and the bacterias, fungus, actinomyces and aerobic bacterias significantly(P<0.05 dif-fered between intercropping and monoculture. The greater abundance of AOB than AOA and the variation range of 105~106 were observed in all samples. The gene copies of norB and nosZ were pronounced by intercropping in the rhizosphere of faba bean at elongation and heading stages, respectively. The abundance of nirK remarkably(P<0.05differed between intercropping and monoculture. In intercropping rhizo-sphere, the contents of NO3--N were lower than monoculture, while the NH4+-N contents were converse (P<0.05. Conclusively, wheat and fa-ba bean intercropping system could change rhizosphere microenvironment, and then the microbial community structure in the soils, which would facilitate the conservation and supplying of soil nitrogen and reduce the nitrogen loss and pollution under the intercropping conditions to some extent. This might be the nitrogen nutrition mechanism for the overyielding of wheat and faba bean intercropping system.
Directory of Open Access Journals (Sweden)
MAGDI T. ABDELHAMID
2013-01-01
Full Text Available Una posible estrategia de supervivencia para plantas que se desarrollan bajo condiciones de salinidad es emplear algunos compuestos que les permitan disminuir el estrés salino. Uno de estos compuestos es la nicotinamida (vitamina B3/ niacina. Se investigó el efecto de la aplicación exógena de nicotinamida en diferentes concentraciones (0, 200 o 400 mg l-1 sobre plantas de haba (Vicia faba L. creciendo a diferentes niveles de NaCl (0, 50 o 100 mM en los terrenos del National Research Centre, Cairo, Egipto. El estrés por salinidad reduce significativamente los contenidos de pigmentos fotosintéticos, polisacáridos, carbohidratos totales, nitrógeno total, peso de las plantas, número de hojas, pesos fresco y seco de tallos, rendimiento de semillas, y contenido de carbohidratos y proteina cruda total en semillas comparado con plantas control. En contraste, la salinidad induce incrementos marcados en sacarosa, azúcares solubles totales, aminoácidos libres totales, prolina, productos de peroxidación de lípidos como el malondialdehido (MDA y algunas enzimas oxidativas (polifenol oxidasa y peroxidasa. También, el estrés por salinidad incrementa el contenido de Na+ y genera disminución de otros macronutrientes y micronutrientes (P, K+, Mg2+, Ca2+, Fe2+, Mn2+, Zn2+ y Cu2+ de los tallos y el rendimiento de semillas en plantas de haba. La aspersión foliar de nicotinamida disminuye los efectos adversos del estrés salino incrementando los pigmentos fotosintéticos, polisacáridos, carbohidratos totales, concentración total de nitrógeno en tallos, peso de las plantas, número de hojas, pesos frescos y secos de tallos, y rendimiento de semillas; así como los niveles de sacarosa, azúcares solubles totales, aminoácidos libres totales y prolina, comparado con aquellos correspondientes al estrés por salinidad, mientras disminuyeron los productos de peroxidación de lípidos (MDA y las enzimas oxidativas (polifenol oxidasas y peroxidasas. La
Population Dynamics of Empoasca fabae (Hemiptera: Cicadellidae) in Central Iowa Alfalfa Fields.
Weiser Erlandson, L A; Obrycki, J J
2015-01-01
Adults and nymphs of Empoasca fabae Harris (Hemiptera: Cicadellidae) and adults of predatory species in the families Coccinellidae, Anthocoridae, Nabidae, Chrysopidae, and Hemerobiidae were sampled in Iowa alfalfa fields from June to September in 1999 and 2000. The relationship between each predatory taxa and E. fabae was examined using regression analysis. In 2000, all predators were found to be positively correlated with the presence of E. fabae during all periods sampled and most likely contributed to mortality. Orius insidiosus (Say) (Hemiptera: Anthoridae) was the most numerous insect predatory species; population numbers ranged from 0 to 1 and 0.1 to 3.7 adults per 0.25 m(2) in 1999 and 2000, respectively. Partial life tables were constructed for E. fabae nymphs for two alfalfa-growing periods. Nymphs were grouped into three age intervals: first and second, third and fourth, and fifth instars. For the first alfalfa growing period examined, E. fabae nymphal mortality was 70% in 1999 and 49% in 2000. During the last growing period of each season (August-September), total nymphal mortality was relatively low (<25%). Adult E. fabae density ranged from 5.4 to 25.6 and 1.4-9.2 per 0.25 m(2) in 1999 and 2000, respectively. E. fabae population peaks were similar for each age interval in all growing periods. This study provides further information on the population dynamics of E. fabae and its relationship with select predatory species in Iowa alfalfa fields. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
Poulsen, Hanne Damgaard; Blaabjerg, Karoline
2017-01-01
To increase self-supply of protein and phosphorus (P) in European pig and poultry diets and reduce nitrogen (N) and P excretion, attention is directed to approaches increasing protein and P digestibility of rapeseed, sunflower and faba beans. Wheat bran is rich in enzymes degrading and solubilizing protein and phytate. Herein, solubilization of protein, N and P was investigated when increasing ratios of wheat bran were fermented with rapeseed meal (RSM), sunflower meal (SFM), faba beans (FB) or a combination of these (RSM/SFM/FB). Protein, N and P solubility was greater, for all mixtures, the more wheat bran was included and the longer the mixtures were fermented. The increase in N (FB > RSM/SFM/FB > SFM > RSM) and protein solubility (RSM/SFM/FB > RSM > SFM > FB) was greatest from day 0 to day 3 and thereafter limited, whereas P solubility increased during the whole period (5 days; FB > RSM/SFM/FB > SFM > RSM). In general, FB showed the highest solubility and highest increase in N and P solubility, while RSM showed the highest protein solubility and RSM/SFM/FB the highest increase in protein solubility. Fermentation of RSM, SFM, FB and RSM/SFM/FB without or with wheat bran uncovers a potential for increased protein and P digestibility and thereby reduced N and P excretion from pigs and poultry. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Mitchell B Baker
Full Text Available Climate change can benefit individual species, but when pest species are enhanced by warmer temperatures agricultural productivity may be placed at greater risk. We analyzed the effects of temperature anomaly on arrival date and infestation severity of potato leafhopper, Empoasca fabae Harris, a classic new world long distance migrant, and a significant pest in several agricultural crops. We compiled E. fabae arrival dates and infestation severity data at different states in USA from existing literature reviews and agricultural extension records from 1951-2012, and examined the influence of temperature anomalies at each target state or overwintering range on the date of arrival and severity of infestation. Average E. fabae arrival date at different states reveal a clear trend along the south-north axis, with earliest arrival closest to the overwintering range. E. fabae arrival has advanced by 10 days over the last 62 years. E. fabae arrived earlier in warmer years in relation to each target state level temperature anomaly (3.0 days / °C increase in temperature anomaly. Increased temperature had a significant and positive effect on the severity of infestation, and arrival date had a marginal negative effect on severity. These relationships suggest that continued warming could advance the time of E. fabae colonization and increase their impact on affected crops.
Influence of conservation tillage and zero tillage on arable weeds in organic faba bean production
Directory of Open Access Journals (Sweden)
Jung, Rüdiger
2016-02-01
Full Text Available The field experiments were conducted in 2008, 2009 and 2010 on a Gleyic Cambisol near Goettingen, Lower Saxony, Germany. A crop sequence of summer barley, winter cover crops (intercropped oat and sunflower and summer faba bean was examined under organic farming conditions. Emphasis was given to the studying of arable weeds in faba beans. However, enhancing symbiotic nitrogen fixation of summer faba beans by accumulation of soil-nitrogen by winter cover crops was a second objective in these experiments. The faba bean field plots had been cultivated with three different tillage systems: 1. zero tillage, sowing with cross-slottechnique, 2. conservation tillage (wing share cultivator, rotary harrow sowing with cross-slot-technique and 3. conventional tillage with mouldboard plough followed by rotary harrow, sowing with precision monoseeder. In plots with zero tillage preceding cover crops were left as mulch on the soil surface. Cover crops accumulated adequate nitrogen amounts and following faba beans reacted with significant increase (up to 10% in symbiotic nitrogen fixation. Maximum of arable weed biomass was observed in zero tillage-plots at the end of May or early in June. The abundance of the predominant weed wild mustard (Sinapis arvensis increased with tillage intensity, whereas the abundance of creeping thistle (Cirsium arvense increased in 2010 with decreasing tillage intensity. Average grain yield of faba beans was low with only 3.0 and 2.4 t ha-1 in 2009 and 2010, respectively.
Çalışkantürk Karataş, Selen; Günay, Demet; Sayar, Sedat
2017-09-01
In vitro studies were conducted to evaluate the particular nutritional benefits of whole faba bean seed (WFB) and fava bean seed coat (FBSC). Total dietary fiber contents of WFB and FBSC were 27.5% and 82.3%, respectively. FBSC were contained much higher total phenolic substances, condensed tannins, and total antioxidant activity than WFB. Bile acid (BA)-binding capacities of in vitro digested samples and nutritionally important products produced by in vitro fermentation of digestion residues were also studied. The BA-binding capacities of WFB and FBSC were 1.94 and 37.50μmol/100mg, respectively. Total BA bound by FBSC was even higher than the positive standard cholestyramine. Lignin and other constituents of the Klason residue were found to influence BA-binding properties. Moreover, the extent of the in vitro fermentation process showed that, fermentability of FBSC residue was significantly lower than that of WFB residue. Overall, faba bean, especially its seed coat, has great potential as a functional food. Copyright © 2017 Elsevier Ltd. All rights reserved.
Gefrom, A; Ott, E M; Hoedtke, S; Zeyner, A
2013-12-01
Ensiling legume grain may be an inexpensive and ecologically interesting method to produce a high-protein feed of local origin. The typically patchy maturation recommends harvesting and ensiling the seeds in moist condition. Developing a method for preserving legume grains harvested before maturation by lactic acid fermentation would have several advantages. Under laboratory conditions, crushed legume seeds of beans, peas and lupines with high moisture content of 35 % were ensiled with different additives (molasses and lactic acid bacteria). To characterize the final silages, contents of proximate nutrients and antinutritional factors (alkaloids, oligosaccharides, tannins) were analysed. The addition of lactic acid bacteria ensured a fast and pronounced lactic acid production and decreased contents of undesired fermentation products like ethanol. An additional use of molasses for ensilage did not provide a remarkable additional benefit. Excluding sugar and starch, the contents of proximate nutrients were not remarkably altered after ensiling. As an overall effect, lactic acid fermentation reduced tannins and oligosaccharides. It can be supposed that the oligosaccharides after breakdown of the complex molecules acted as a source of fermentable carbohydrates. A relevant reduction of alkaloids did not occur. The lactic acid fermentation of legume grains can be recommended as an appropriate method for conservation. With respect to the economic advantages and compared with methods of chemical preservation, the lactic acid fermentation of legume grains under anaerobic conditions is an environmentally compliant procedure and therefore also an option for organic farming. © 2012 Blackwell Verlag GmbH.
Navarro, Y.; Pérez, G
2010-01-01
Para la determinación de las mejores condiciones de extracción de la lectina de raíz de haba (LRH), se utilizaron iniciaimente raíces enteras y paredes celulares de raíces. De acuerdo con los resultados, se establecieron las condiciones experimentales para la preparación de paredes celulares por tres métodos. Se encontró que el Método I, en el cual se usó Sarkosyl 0.5%, KH2PO4 0.01 M pH 6.0 para la obtención de paredes celulares y luego se extrajo la lectina con buffer de citrato de sodio 0.1...
Shahid, Muhammad
2010-01-01
Peu d'études concernent actuellement l'influence de la spéciation du plomb (polluant métallique toxique, persistant et très présent dans les écosystèmes) sur sa phyto-toxicité. Pourtant, l'absorption des métaux, leur translocation et les mécanismes impliqués dans leur phyto-toxicité peuvent être fortement modifiés par ce paramètre. Dans ce contexte, l'objectif de la thèse était d'étudier l'influence de la spéciation chimique du plomb (formation de divers complexes organométalliques) sur sa ph...
Abdulla, Jalil Mahmwd; Rose, Stephen Paul; Mackenzie, Alexander Mackay; Ivanova, Sonya Georgieva; Staykova, Genoveva Petrova; Pirgozliev, Vasil Radoslavov
2016-10-01
An experiment examined the effects of two field bean cultivar samples with different tannin contents, the effect of heat treatment (micronising) and the effect of dietary supplementation of a proprietary enzyme preparation containing tannase, pectinase, and xylanase activities on metabolisable energy (ME), total tract dry matter digestibility (DMD) and ether extract digestibility (EED), nitrogen retention (NR), tannin degradability, gastrointestinal tract (GIT) development, and endogenous mucin losses excretion in broiler chickens. The Control diet contained per kg 221 g crude protein and 12.83 MJ ME. Four additional diets contained 300 g/kg of each of the two untreated or micronised experimental field bean cultivar samples. Each diet was then split into two batches and one of them was supplemented with 3400 units tannase per kg diet resulting in 10 diets in total. Each diet was fed to seven pens with two randomly selected male broilers each. Birds fed the high tannin bean sample had a lower weight gain (p beans increased (p beans reduced the degradability of condensed tannins and increased endogenous mucin losses (p bean samples were not improved by heat treatment, but enzyme supplementation improved the feeding value of all diets regardless of the bean samples or heat treatment. Further research is warranted to study the effectiveness of tannase supplementation in poultry diet formulations by dose response trials with purified tannase preparations.
Abdulla, Jalil Mahmwd; Rose, Stephen Paul; Mackenzie, Alexander Mackay; Pirgozliev, Vasil Radoslavov
2017-04-01
Effects of field beans with various tannin content and exogenous enzyme mixture containing tannase, pectinase and xylanase activities on N-corrected dietary apparent metabolisable energy (AMEn), coefficients of dry matter (DMR) and nitrogen retention (NR), fat digestibility, gastrointestinal tract (GIT) development, jejunal villus morphometry, ileal digesta viscosity and sialic acid were examined. Birds' growth performance and energy conversion ratio (ECR) were also measured. Birds were fed one of eight mash diets. The Control diet contained as major ingredients wheat (400 g/kg) and soybean meal (SBM) (127 g/kg and 221 g crude protein/kg and 12.83 MJ AMEn/kg. To reduce nutrient density, the Control diet also contained washed sand at 119 g/kg. Another three diets containing 300 g/kg of each of three experimental field bean cultivar samples in replacement for SBM and sand were also mixed. Each diet was fed to nine pens with two male Ross 308 broilers. Diets high in tannin had low AMEn, ECR, DMR and NR (p beans increased (p beans with different tannin contents may vary when fed to broilers. The supplementation of the enzyme mixture improved the feeding value of diets for broilers. The beneficial effect of the addition of the enzyme mixture seems to be mediated through reduced ileal digesta viscosity and improved nutrient availability.
Czech Academy of Sciences Publication Activity Database
Karuppanapandian, T.; Geilfus, C.M.; Muehling, K.H.; Novák, Ondřej; Gloser, V.
2017-01-01
Roč. 255, FEB (2017), s. 51-58 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : xylem sap constituents * abscisic-acid * stomatal conductance * leaf apoplast * helianthus-annuus * plant-responses * intact plants * nacl stress * drying soil * guard-cells * Drought stress * Abscisic acid * Soil drying * Xylem sap * Osmolality * Water relations * Leaf water potential Subject RIV: EF - Botanics Impact factor: 3.437, year: 2016
Evaluación de cinco genotipos de haba (Vicia faba L. con seis niveles de fósforo en Tecámac, México
Directory of Open Access Journals (Sweden)
Edgar Jesús Morales Rosales
2002-01-01
Full Text Available Por medio de una investigación de campo, basada en el diseño de bloques al azar con 30 tratamientos y tres repeticiones con un arreglo factorial, se evaluó: altura a la primera vaina (APV, altura final (AF, número de tallos (NT, número de granos por vaina (NGV, número de vainas por planta (NVP, peso de 100 semillas P(100S y rendimiento de grano (REND. El análisis de varianza reveló efectos significativos e interesantes para los cinco genotipos de haba.
Abel, H j; Burghard, G
2002-02-01
A basal control mixture of barley, soy bean meal and soy bean oil was replaced by 25% of the new field bean-cultivar 'Divine' and the resulting two mixtures were supplemented with minerals, trace elements, vitamins and amino acids according to the ideal protein concept. The control diet was adjusted with DL-methionine (DL-Met), the field bean mixture either with DL-Met or DL-methionine-hydroxyanalogue (DL-MHA) assuming biological equivalence on a molar basis for both supplements. The three experimental diets were fed to growing pigs (35-40 kg bwt.). Spontaneous urine samples were analysed separately for determining parameters that characterize the acid-base status of the pigs. There were no significant differences between experimental groups in nutrient digestibilities. The level of bacterially fermentable substances was increased in the diets containing field beans. The field beans contained 14 mg ME/kg DM. There were no significant (p mixtures resulted from a higher electrolyte balance of the diet.
Directory of Open Access Journals (Sweden)
Elizabeth García-Gallegos
2011-01-01
Full Text Available Un experimento en invernadero se estableció para determinar la concentración de plomo (Pb en suelo, raíz y parte aérea de haba y avena; se calculó el factor de bioconcentración y traslocación en las dos especies. Se probaron 50, 100 y 150 mg·Pb·kg-1 de suelo, incluyendo un control. Las plantas se colectaron a los 60 días después de la siembra y se midieron altura de planta (AP, volumen radical (VR y biomasa seca total (BST, además del contenido de Pb en suelo, raíz y parte aérea. La cuantificación de Pb se realizó por espectrofotometría de absorción atómica. El suelo cultivado con haba presentó un 28.48 % de PbEDTA. Las variables AP, VR y BST no fueron afectadas de manera drástica por las concentraciones de Pb probadas. Las plantas de haba y avena absorbieron un total de 55 mg·kg-1 y 45.3 mg·kg-1, respectivamente, las cuales se consideran tóxicas para plantas cultivadas. Los resultados pueden servir de base para ampliar el conocimiento del contenido de Pb absorbido y traslocado en plantas de haba y avena, ya que la capacidad de tolerar y absorber Pb es específica de la especie, inclusive de la variedad de planta.
Abdulla, J.M.; Rose, S. P.; Mackenzie, A M; Ivanova, S.G.; Staykova, G.P.; Pirgozliev, V.
2016-01-01
An experiment examined the effects of two field bean cultivar samples with different tannin contents, the effect of heat treatment (micronising) and the effect of dietary supplementation of a proprietary enzyme preparation containing tannase, pectinase, and xylanase activities on metabolisable energy (ME), total tract dry matter digestibility (DMD) and ether extract digestibility (EED), nitrogen retention (NR), tannin degradability, gastrointestinal tract (GIT) development, and endogenous muc...
Directory of Open Access Journals (Sweden)
Y. De navarro
2010-07-01
Full Text Available Para la determinación de las mejores condiciones de extracción de la lectina de raíz de haba (LRH, se utilizaron iniciaimente raíces enteras y paredes celulares de raíces. De acuerdo con los resultados, se establecieron las condiciones experimentales para la preparación de paredes celulares por tres métodos. Se encontró que el Método I, en el cual se usó Sarkosyl 0.5%, KH2PO4 0.01 M pH 6.0 para la obtención de paredes celulares y luego se extrajo la lectina con buffer de citrato de sodio 0.1 M pH 4.2, es el más adecuado. El fraccionamiento se realizó por filtración por gel usando Sephadex G-25.
Directory of Open Access Journals (Sweden)
Bo-Fang Yan
Full Text Available BACKGROUND: The decline of photosynthesis in plants under low sink demand is well known. Previous studies focused on the relationship between stomatal conductance (gs and net photosynthetic rate (Pn. These studies investigated the effect of changes in Photosystem II (PSII function on the Pn decline under low sink demand. However, little is known about its effects on different limiting steps of electron transport chain in PSII under this condition. METHODOLOGY/PRINCIPAL FINDING: Two-month-old bean plants were processed by removing pods and flowers (low sink demand. On the 1(st day after low sink demand treatment, a decline of Pn was accompanied by a decrease in gs and internal-to-ambient CO2 concentration ratio (Ci/Ca. From the 3(rd to 9(th day, Pn and gs declined continuously while Ci/Ca ratio remained stable in the treatment. Moreover, these values were lower than that of control. Wk (a parameter reflecting the damage to oxygen evolving complex of the donor side of PSII values in the treatment were significantly higher than their corresponding control values. However, RCQA (a parameter reflecting the number of active RCs per excited cross-section of PSII values in the treatment were significantly lower than control from the 5(th day. From the 11(th to 21(st day, Pn and gs of the treatment continued to decline and were lower than control. This was accompanied by a decrease of RCQA, and an increase of Wk. Furthermore, the quantum yield parameters φPo, φEo and ψEo in the treatment were lower than in control; however, Ci/Ca values in the treatment gradually increased and were significantly higher than control on the 21(st day. CONCLUSIONS: Stomatal limitation during the early stage, whereas a combination of stomatal and non-stomatal limitation during the middle stage might be responsible for the reduction of Pn under low sink demand. Non-stomatal limitation during the late stages after the removal of the sink of roots and pods may also cause Pn reduction. The non-stomatal limitation was associated with the inhibition of PSII electron transport chain. Our data suggests that the donor side of PSII was the most sensitive to low sink demand followed by the reaction center of PSII. The acceptor side of PSII may be the least sensitive.
Directory of Open Access Journals (Sweden)
Elżbieta Pląskowska
2014-08-01
Full Text Available The species spectrum and abundance of the fungi communities were affected by the soil environment developed by wheat and its forecrops, and by atmospheric conditions. The fungi of the genus Fusarium were the greatest threat to winter wheat regardless of the forecrop. The field bean was the best forecrop to the wheat whereas spring barley was the worst.
Bakr, A A; Bayomy, M F
1997-01-01
To evaluate the dietary protein utilization and iron deficiency anemia as affected by the faba bean nutrient intake, a bioassay with rats was carried out with different experimental diets containing four faba bean products (stewed beans 'Medammis', deep fried dough 'Falafel', boiled germinated beans 'Nabet Soup' and poured paste 'Bissara') widely consumed in the Middle East. Amino acid composition of all faba bean products was determined and compared to raw beans. Severe heat-processing markedly decreased some essential amino acids, especially phenylalanine, cystine, methionine and tryptophan. Protein scores were 24.6, 19.5, 29.2, 28.2 and 35.6 for raw faba beans, 'Medammis', 'Falafel', 'Nabet Soup' and 'Bissara', respectively. 'Bissara' possessed the highest nutritional value, since it had the lowest GDR value [Grams consumed of product to cover the daily requirements for adult man in protein (63 g) and in energy (2900 kcal)] for the limiting amino acids (L A A). As indicated by P S/150 values [Satisfaction of the daily requirements of the adult man when 150 g (one can content) are consumed of product] for L A A, i.e. methionine+cystine (lowest P S/150 value), the above-mentioned faba bean products cover about 53, 77, 77 and 97% of the daily requirements of adult man in L A A, respectively. Fecal nitrogen excretion increased and true nitrogen digestibility decreased significantly (p < 0.01) with the inclusion of 'Medammis' in the diet. 'Nabet Soup' exhibited the highest true nitrogen digestibility. In contrast, the biological value of nitrogen was apparently unaffected. Highest blood hemoglobin level was found in rats fed diets containing 'Bissara', 'Falafel' and 'Nabet Soup', whereas the addition of 'Medammis' in the diet induced a significant (p < 0.05) reduction in blood hemoglobin level of fed rats.
Faba bean in dairy cow diet: effect on milk production and quality
Rosanna Scipioni; Domenico Pietro Lo Fiego; Luisa Antonella Volpelli; Michele Comellini
2010-01-01
Two consecutive trials were carried out to test flaked faba beans as a partial substitute for soybean meal (SBM) in the diet of Reggiana breed dairy cows. In both trials a “Control” concentrate (12% dehulled SBM) was compared to a “Faba” concentrate (7.5% dehulled SBM; 10% flaked faba beans). Forages fed to animals included hay (mixed grass and alfalfa) plus green mixed grass in trial 1, hay only in trial 2. Concentrate intake, faecal scores, milk yield and quality wer...
Dorkina, E G
2010-04-01
Experiments on white female rats showed that chronic ethanol consumption leads to activation of the NADPH - GSH dependent system of the liver, which provides protection against ethanol-induced oxidative stress. Post-treatment administration of dry extract from Vicia truncatula Fish ex Bieb. (300 mg/kg body weight) on the background of 40% ethanol increased this adaptive reaction without depletion in the system, in contrast to what was observed in rats treated with carsil. These results suggest a significant hepatoprotective effect of the dry extract during the chronic alcohol-induced injury of the liver.
Directory of Open Access Journals (Sweden)
Shahera Zaitoun
2010-01-01
Full Text Available A field experiment was conducted during 2005/2006 at Jordan University of Science and Technology campus (32°30” N, 35°59” E, Irbid, Jordan, to study the role of bee visitors on seed set and production of Vicia villosa spp. dasycarpa grown under semiarid conditions. Two treatments were imposed on Vicia villosa plants before flowering: 1 Plants were covered in cages (control or 2 Plants were left uncovered to permit bee visiting. The results of this experiment showed that V. villosa flowers were very attractive to worker honeybees as well as to few numbers of wild bees. The most frequent visitor species were A. mellifera and Anthophora albigena of family Apidae. V. villosa flowers attracted most of the bee visitors in the early hours of the day. The duration of their visit on the flowers also peaked early in the day and decreased toward the end of the day. The percentage of pod set of the un-covered plants averaged 14% out of the total florets on the plants, which was significantly higher than the covered plants (2%. These results indicated that the percentage of flower abscission was high and averaged more than 86%. Plant covering significantly reduced seed yield by reducing seed and pod number per plant and seed number per pod, but had no effect on individual seed weight. In conclusion, preventing bees from visiting during flowering of V. villosa spp. dasycarpa decreased seed set, seed yield and yield components. Further studies are needed to understand the high flower abscission and failure of seed set in this species.
On the presence of Vicia vicioides in Alicante
Directory of Open Access Journals (Sweden)
Pérez-Haase, A.
2008-12-01
Full Text Available Please read the Spanish version of this Abstract.
En el presente trabajo se actualiza el conocimiento corológico de la leguminosa Vicia vicioides (Desf. Cout. en la provincia de Alicante, aportando información sobre cinco nuevas poblaciones, que se añaden a la única localidad conocida previamente.
Liu, Haitao; Tang, Caixian; Li, Chunjian
2016-01-01
Root morphological/physiological modifications are important for phosphorus (P) acquisition of plants under P deficiency, but strategies differ among plant species. Detailed studies on the response of maize roots to P deficiency are limited. Nitrogen (N) form influences root morphology/physiology, and thus may influence root responses to P deficiency. This work investigated adaptive mechanisms of maize roots to low P by comparison with white lupin and faba bean supplied with two N forms. Plants were grown for 7-16 days in hydroponics with sufficient (250 µmol L(-1)) and deficient P supply (1 µmol L(-1)) under supply of NH4NO3 or Ca(NO3)2 Plant growth and P uptake were measured, and release of protons and organic acid anions, and acid phosphatase activity in the root were monitored. The results showed that P deficiency significantly decreased shoot growth while increased root growth and total root length of maize and faba bean, but not white lupin. It enhanced the release of protons and organic acid anions, and acid phosphatase activity, from the roots of both legumes but not maize. Compared with Ca(NO3)2, NH4NO3 dramatically increased proton release by roots but did not alter root morphology or physiology of the three species in response to low P. It is concluded that the N form did not fundamentally change root morphological/physiological responses of the three species to P deficiency. Morphological variation in maize and morpho-physiological modifications in white lupin and faba bean were the main adaptive strategies to P deficiency. © The Authors 2016. Published by Oxford University Press on behalf of the Annals of Botany Company.
Effect of Debudding of Faba bean on the Soluble Nitrogen and ...
African Journals Online (AJOL)
Nitrogenase activity (measured as ARA) of debudded plants was ... Key words: Acetylene reduction activity, faba bean, feedbackcontrol, legume, nitrogenase activity, nitrogen ftxati on, nodules regulate .... Effect of debudding on nitrogenase activity (AR), soluble carbohydrate and nitrogen and ammonium content of nodules ...
Directory of Open Access Journals (Sweden)
Ann M. Hirsch
2013-09-01
Full Text Available Two strains, 30N-5 and 30VD-1, identified as Bacillus simplex and B. subtilis, were isolated from the rhizospheres of two different plants, a Podocarpus and a palm, respectively, growing in the University of California, Los Angeles (UCLA Mildred E. Mathias Botanical Garden. B. subtilis is a well-known plant-growth promoting bacterial species, but B. simplex is not. B. simplex 30N-5 was initially isolated on a nitrogen-free medium, but no evidence for nitrogen fixation was found. Nevertheless, pea plants inoculated with B. simplex showed a change in root architecture due to the emergence of more lateral roots. When Pisum sativum carrying a DR5::GUSA construct, an indicator for auxin response, was inoculated with either B. simplex 30N-5 or its symbiont Rhizobium leguminosarum bv. viciae 128C53, GUS expression in the roots was increased over the uninoculated controls. Moreover, when pea roots were coinoculated with either B. simplex 30N-5 or B. subtilis 30VD-1 and R. leguminosarum bv. viciae 128C53, the nodules were larger, clustered, and developed more highly branched vascular bundles. Besides producing siderophores and solubilizing phosphate, the two Bacillus spp., especially strain 30VD-1, exhibited anti-fungal activity towards Fusarium. Our data show that combining nodulating, nitrogen-fixing rhizobia with growth-promoting bacteria enhances plant development and strongly supports a coinoculation strategy to improve nitrogen fixation, increase biomass, and establish greater resistance to fungal disease.
National Research Council Canada - National Science Library
Güzel, Demet; Sayar, Sedat
2012-01-01
The effects of atmospheric pressure cooking (APC) and high-pressure cooking (HPC) on the physicochemical and nutritional properties of barlotto bean, chickpea, faba bean, and white kidney bean were investigated...
Villadas, Pablo J; Lasa, Ana V; Martínez-Hidalgo, Pilar; Flores-Félix, José David; Martínez-Molina, Eustoquio; Toro, Nicolás; Velázquez, Encarna; Fernández-López, Manuel
2017-03-01
Forest fires lead to the annual disappearance of many natural formations that require the creation of firewall areas. They can be maintained by enriching their pastures with attractive plants for grazing livestock, mainly legumes, which have a high protein content and low dependence on N fertilizers due to their ability to establish nitrogen-fixing symbiosis with rhizobia. In this study, the rhizobia isolated from the nodules of six legumes from the genera Vicia, Lathyrus and Trifolium were analysed in a firewall zone established in Lanjarón (Granada) close to the Sierra Nevada National Park (Spain). The results showed a high genetic diversity of the isolated strains that had 3, 16, 14 and 13 different types of rrs, recA, atpD and glnII genes, respectively. All strains were phylogenetically close to the species from the Rhizobium leguminosarum group, although they were not identified as any of them. The isolated strains belonged to the symbiovars viciae and trifolii but high phylogenetic diversity was found within both symbiovars, since there were 16 and 14 nodC gene types, respectively. Some of these strains clustered with strains isolated in other countries and continents, but others formed atpD, recA, glnII and nodC clusters and lineages only found to date in this study. Copyright © 2016 Elsevier GmbH. All rights reserved.
Combination of different methods for direct control of Vicia hirsuta in winter wheat
Lukashyk, P.; Köpke, U.
2005-01-01
Combinations of three different direct methods for controlling Vicia hirsuta (kainite application, flame weeding and harrowing) were investigated in field experiments. They were based on different strategies at early growth stages of V. hirsuta and standardised harrowing at late growth stages. The highest efficacy of kainite application and flame weeding was achieved at the one leaf stage of V. hirsuta. Winter wheat regeneration from damage caused by both kainite and thermal control was satis...
DEFF Research Database (Denmark)
Laursen, Kristian Holst; Schjørring, Jan Kofod; Olesen, Jørgen E
2011-01-01
between organic and conventional crops were found in the content of essential plant nutrients when statistically analyzed individually. However, chemometric analysis of multielemental fingerprints comprising up to 14 elements allowed discrimination. The discrimination power was further enhanced......The multielemental composition of organic and conventional winter wheat, spring barley, faba bean, and potato was analyzed with inductively coupled plasma−optical emission spectrometry (ICP-OES) and −mass spectrometry (ICP-MS). The crops were cultivated in two years at three geographically...... different field locations, each accommodating one conventional and two organic cropping systems. The conventional system produced the highest harvest yields for all crops except the nitrogen-fixing faba bean, whereas the dry matter content of each crop was similar across systems. No systematic differences...
Potential candidates for biological control of the black bean aphid Aphis fabae in Serbia
Directory of Open Access Journals (Sweden)
Stanković, S.S.
2015-09-01
Full Text Available The black bean aphid is widely spread aphid species in the Palaearctic, known to attack over 1150 plant species. Because some of the host plants are of great agricultural interest, Aphis fabae represent a very important pest. We assembled all data concerning the presence of this pest and connected it in tritrophic associations. In the period of 24 years investigation on the territory of Serbia it has been recorded in 107 trophic associations. In total there are 145 findings of A. fabae parasitized by 19 taxa of Aphidiinae (Brackonidae from seven genera. The most suitable biocontrol agents for the black bean aphid are Lysiphlebus fabarum, Binodoxys angelicae, Lipolesis gracilis and the introduced species Lysiphlebus testaceipes.
[Use of the HPLC method for determination of glucopiranosides during ripening of faba bean seeds].
Nestorowicz, J; Pierzynowska-Kornik, G; Zadernowski, R
1996-01-01
Uridine (C9H12N2O6) was applied as an internal standard for the determination of glucopiranosides in faba bean seeds by the HPLC method. The relative UV response factors of vaccine or convicine to uridine were determined (1.12 and 0.79, respectively). The changes in the content of vaccine and convicine during ripening of faba bean seeds were followed. It was observed that with the increase in the seed dry matter content from 0.18 kg/kg to 0.78 kg/kg, the dry matter based content of vaccine decreased from 26.225 g/kg to 0.243 g/kg, and that of convicine from 9.051 g/kg to 0.094 g/kg.
Energy Technology Data Exchange (ETDEWEB)
Petersson, Anneli; Thomsen, Mette H.; Hauggaard-Nielsen, Henrik; Thomsen, Anne-Belinda [Risoe National Laboratory, P.O. Box 49, DK-4000 Roskilde (Denmark)
2007-11-15
To meet the increasing need for bioenergy several raw materials have to be considered for the production of e.g. bioethanol and biogas. In this study, three lignocellulosic raw materials were studied, i.e. (1) winter rye straw (Secale cereale L), (2) oilseed rape straw (Brassica napus L.) and (3) faba bean straw (Viciafaba L.). Their composition with regard to cellulose, hemicellulose, lignin, extractives and ash was evaluated, as well as their potential as raw materials for ethanol and biogas production. The materials were pretreated by wet oxidation using parameters previously found to be optimal for pretreatment of corn stover (195 C, 15 min, 2 g l{sup -1} Na{sub 2}CO{sub 3} and 12 bar oxygen). It was shown that pretreatment was necessary for ethanol production from all raw materials and gave increased biogas yield from winter rye straw. Neither biogas productivity nor yield from oilseed rape straw or faba bean straw was significantly affected by pretreatment. Ethanol was produced by the yeast Saccharomyces cerevisiae during simultaneous enzymatic hydrolysis of the solid material after wet oxidation with yields of 66%, 70% and 52% of theoretical for winter rye, oilseed rape and faba bean straw, respectively. Methane was produced with yields of 0.36, 0.42 and 0.44 l g{sup -1} volatile solids for winter rye, oilseed rape and faba bean straw, respectively, without pretreatment of the materials. However, biogas productivity was low and it took over 50 days to reach the final yield. It could be concluded that all three materials are possible raw materials for either biogas or ethanol production; however, improvement of biogas productivity or ethanol yield is necessary before an economical process can be achieved. (author)
Mohamed M. EL FOULY; Zeinab M. MOBARAK; Zeinab A. SALAMA
2010-01-01
Salinity, either of soil or of irrigation water, causes disturbances in plant growth and nutrient balance. Previous work indicates that applying nutrients by foliar application increases tolerance to salinity. A pot experiment with three replicates was carried out in the green house of NRC, Cairo, Egypt, to study the effect of micronutrients foliar application on salt tolerance of faba bean. Two concentrations of a micronutrient compound (0.1% and 0.15%) were sprayed in two different treatmen...
Effect of extrusion, espansion and toasting on the nutritional value of peas, faba beans and lupins
Directory of Open Access Journals (Sweden)
Filippo Rossi
2010-01-01
Full Text Available An assessment was made of the effect that different treatments (toasting, expansion, extrusion have on the nutritionalvalue of protein plants (pea, faba bean, lupin. In a randomized block design, feeds were screened for enzymaticdigestibility of starch and protein, N solubility and in vitro protein degradability. Expansion and extrusion cause increasedstarch enzymatic degradability while toasting produced virtually no effects. In peas this value increased from 11.80% inmeal to 39.70% in the extruded product; 85.37% is the percentage for the expanded product, while 10.90% is the starchdigestibility value for toasted peas. In faba beans the extrusion process increased starch digestibility from 11.39% to85.05%, while in extruded lupins a complete starch hydrolysis was obtained, while in the meal the polysaccharide digestionwas 54.48%.The expansion and extrusion processes significantly decreased rumen degradability during the first 8 hours of incubation.Toasted peas had lower degradability if compared with controls but not with the other treatments. The onlypotentially alternative source to soybean is the extruded faba bean. In spite of its lower protein content, this feed ischaracterized by a considerably lower in vitro protein degradability than soybean. This implies that the digestible foodprotein content is comparable (124.90 g/kg DM to that of soybean (109.78 g/kg DM and definitely higher than thatof all other protein plants.
Faba bean in dairy cow diet: effect on milk production and quality
Directory of Open Access Journals (Sweden)
Rosanna Scipioni
2010-01-01
Full Text Available Two consecutive trials were carried out to test flaked faba beans as a partial substitute for soybean meal (SBM in the diet of Reggiana breed dairy cows. In both trials a “Control” concentrate (12% dehulled SBM was compared to a “Faba” concentrate (7.5% dehulled SBM; 10% flaked faba beans. Forages fed to animals included hay (mixed grass and alfalfa plus green mixed grass in trial 1, hay only in trial 2. Concentrate intake, faecal scores, milk yield and quality were similar between feeding groups. The milk urea content was lower in the “Faba” group (“Control” vs. “Faba”: 34.6 vs. 32.9mg/dl in trial 1, P<0.1; 27.4 vs. 23.4mg/dl in trial 2, P<0.01. The plasma urea was different only in trial 2 (“Control” vs. “Faba”: 3.9 vs. 3.0mmol/l, P<0.01. The inclusion of faba beans within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation could represent a feasible opportunity for a partial substitution of SBM.
Ruban, Yu.; Illienko, V.; Nesterova, N.; Pareniuk, O.; Shavanova, K.
2017-12-01
The presented research was aimed to determine the parameters of chlorophyll fluorescence (IChH) curve induction for Vicia sativa L. that were grown on radionuclide contaminated soils by using "Floratest" fluorometer. Plants were inoculated with 5 species of bacteria that might potentially block radionuclide uptake (Agrobacterium radiobacter IMBB-7246, Azotobacter chroococcum UKMB-6082, A. chroococcum UKMB-6003, Bacillus megaterium UKMB-5724, Rhizobium leguminosarum bv. viceae) and grown in sod-podzolic, chernozem and peat-bog soils, contaminated with 137Cs (4000±340 Bq/kg). As a result of research, it was determined that the most stressful factors for vetch plants are combination of soil radionuclide and presence of Bacillus megaterium UKM B-5724, as the number of inactive chlorophyll increased. In addition, the vetch plants significantly increased fixed level of fluorescence (Fst) under the influence of radioactive contamination in presence of Bacillus megaterium UKM B-5724, indicating inhibition of photosynthetic reactions. Other bacteria showed radioprotective properties in almost all types of soil.
Rui, Haiyun; Chen, Chen; Zhang, Xingxing; Shen, Zhenguo; Zhang, Fenqin
2016-01-15
We examined the effects of Cd on growth, lipid peroxidation, reactive oxygen species (ROS) accumulation, antioxidant enzymatic activity, and lignin content in the roots of two varieties of Vicia sativa. Treatment with Cd decreased plant growth and increased ROS and lipid peroxidation levels to a greater extent in the Cd-sensitive variety ZM than in the Cd-tolerant variety L3. Most hydrogen peroxide (H2O2) and superoxide anion (O2(•-)) were accumulated in the cell walls and extracellular spaces in response to Cd treatments. Chemical assays and experiments using inhibitors showed that larger increases in H2O2 and O2(•-) production in ZM than in L3 were probably attributed to elevated Cd-induced nicotinamide adenine dinucleotide-peroxidase (NADH-POD) activity. Cd treatment increased the accumulation of lignin and the guaiacol peroxidase (GPOD) activities in the apoplast more significantly in ZM root than in L3. Howerver, root laccase activity was higher in L3 than in ZM. Thus Cd toxicity induced significant lignification in the roots of V. sativa, and increases in H2O2 accumulation and apoplastic GPOD activity were likely responsible for this effect. Copyright © 2015 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Andres, A.; Millan, R.; Esteban, E.
2010-03-08
This study is framed in the project Recuperation de suelos contaminados por mercurio: recomendaciones de uso de suelos y plantas en la comarca minera de Almaden (REUSA), funded by Spanish Ministry of Education and Science. Moreover, this article is the result of the work carried out by Andres Andres for his Bachelors dissertation. Soils from the Almaden mining district are contaminated with high mercury concentrations, due to the extraction activities of that metal through the years. After the end of mining exploitation, which was the main source of wealth in the region, alternative uses of soils are needed in order to promote the socio-economic development of the studied area. The project here intends to evaluate the viability of the common vetch (Vicia sativa L.) crop in a substrate under similar conditions to the ones observed in the Almaden soils, by studying the mercury absorption capacity of the above mentioned species. (Author) 20 refs.
Directory of Open Access Journals (Sweden)
Krehenbrink Martin
2008-01-01
Full Text Available Abstract Background Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Results Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP, a twin-arginine translocase (TAT secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP were generated, but only mutations affecting the PrsDE (Type I and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. Conclusion None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V is required for establishing the symbiosis with legumes. The PrsDE (Type I system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to
Krehenbrink, Martin; Downie, J Allan
2008-01-29
Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP), a twin-arginine translocase (TAT) secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP) were generated, but only mutations affecting the PrsDE (Type I) and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V) is required for establishing the symbiosis with legumes. The PrsDE (Type I) system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to the genes encoding the secretion system itself.
DmeRF system is required for nickel and cobalt resistance in Rhizobium leguminosarum bv. viciae.
Rubio Sanz, Laura; Prieto Carbajo, Rosa Isabel; Palacios Alberti, Jose Manuel; Brito Lopez, Maria Belen
2013-01-01
A member of the Cation Diffusion Facilitator (CDF) family with high sequence similarity to DmeF (Divalent metal efflux) from Cupridavirus metallidurans was identified in Rhizobium leguminosarum bv. viciae UPM1137. The R. leguminosarum dmeF mutant strain was highly sensitive to Co2+ and moderately sensitive to Ni2+, but its tolerance to other metals such as Zn2+, Cu2+ or Mn2+ was unaffected. An open reading frame located upstream of R. leguminosarum dmeF, designated dmeR, encodes a protein hom...
Stefan Martyniuk; Monika Kozieł; Anna Gałązka
2015-01-01
The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv) in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv) i...
DEFF Research Database (Denmark)
Poulsen, Hanne Damgaard; Blaabjerg, Karoline
2017-01-01
BACKGROUND To increase self-supply of protein and phosphorus (P) in European pig and poultry diets and reduce nitrogen (N) and P excretion, attention is directed to approaches increasing protein and P digestibility of rapeseed, sunflower and faba beans. Wheat bran is rich in enzymes degrading...... and solubilizing protein and phytate. Herein, solubilization of protein, N and P was investigated when increasing ratios of wheat bran were fermented with rapeseed meal (RSM), sunflower meal (SFM), faba beans (FB) or a combination of these (RSM/SFM/FB). RESULTS Protein, N and P solubility was greater, for all...
A novel beta-glucosidase in Uromyces fabae : feast or fight?
Haerter, Ariane C.; Voegele, Ralf T.
2004-01-01
Efficient nutrient mobilization is a key element for biotrophic plant parasites such as the rust fungi. In the course of a cDNA library screen for elements involved in sugar utilization in Uromyces fabae, we identified a sequence with homology to beta-glucosidases. Full-length genomic and cDNA clones of the gene, termed BGL1, were isolated and sequenced. The BGL1 gene comprises 3,372 nucleotides, including nine introns. The open reading frame encompasses 2,532 bases and codes for a polypeptid...
Laboratory invesitgations of variability of Ascochyta fabae Speg. isolates obtained from horse bean
Directory of Open Access Journals (Sweden)
Antoni Józef Filipowicz
2014-08-01
Full Text Available Fifty five isolates of Ascochyta fabae Speg. were investigated. They were selected from 1650 isolates of this fungus obtained from horse bean seeds in 1974-1976. All the isolates grew and sporulated on Potato Dextrose Agar, Malt Agar and Horse Bean Agar. The rate of their growth amounted to 1-4 mm per 24 hours. The variability of isolates in size of pycnidia and conidia and number of sepia was noticed. A few spores with untypical shapes were observed as well.
Mapping of quantitative trait loci controlling Orobanche foetida Poir ...
African Journals Online (AJOL)
Mapping of quantitative trait loci controlling Orobanche foetida Poir. resistance in faba bean (Vicia faba L.) R Díaz-Ruiz, A Torres, MV Gutierrez, D Rubiales, JI Cubero, M Kharrat, Z Satovic, B Román ...
National Research Council Canada - National Science Library
Abdelhamid, Magdi T; Sadak, Mervat Sh; Schmidhalter, Urs; Saady, Abdel-Kareem M. El
2013-01-01
.... One of these compounds is nicotinamide (vitamin B3/niacin). The effect of exogenous application of nicotinamide with different concentrations (0, 200 or 400 mg [l.sup.-1]) on faba bean (Vicia faba L...
Szechynska-Hebda, M.; Skrzypek, E.; Dabrowska, G.; Wedzony, M.; Lammeren, van A.A.M.
2012-01-01
We propose that oxidative stress resulting from an imbalance between generation and scavenging hydrogen peroxide contributes to tissue regeneration efficiency during somatic embryogenesis of hexaploid winter wheat (Triticum aestivum cv. Kamila) and organogenesis of faba bean (Vicia faba ssp. minor
Granular formulation of Fusarium oxysporum for biological control of faba bean and tomato Orobanche.
Nemat Alla, Mamdouh M; Shabana, Yasser M; Serag, Mamdouh M; Hassan, Nemat M; El-Hawary, Mohamed M
2008-12-01
Orobanche spp. represent a serious threat to a wide range of crops. They are difficult targets for herbicides, and biological control could provide a possible solution. This work therefore aimed to formulate mycoherbicides of Fusarium with adequate shelf life and virulence against Orobanche but safe to faba bean and tomato. Only two isolates of Fusarium oxysporum Schlecht. (Foxy I and Foxy II) obtained from diseased Orobanche shoots were found to be pathogenic to Orobanche crenata Forsk. and Orobanche ramosa L. Conidial suspension of both isolates significantly decreased germination, attachments and tubercles of Orobanche. Microconidia and chlamydospores of both isolates were formulated as mycoherbicides encapsulated in a wheat flour-kaolin matrix (four different formulations). All formulations greatly diminished Orobanche emerged shoots, total shoot number, shoot height, attachment of emerged shoots, the germinated seeds that succeeded in emerging above the soil surface and dry weight. Meanwhile, disease incidence and disease severity of emerged shoots were enhanced. The shelf life was adequate, particularly for coarse, freshly prepared, low-temperature-stored, microconidia-rich formulations. The induced growth reduction of Orobanche-infected host plants seemed to be nullified by formulations, particularly at the highest dose. These formulations seemed to destroy Orobanche but appeared harmless to host plants. Hence, they could be efficiently used as mycoherbicides for biological control of Orobanche in faba bean and tomato.
An increase in renal dopamine does not stimulate natriuresis after fava bean ingestion123
Garland, Emily M; Cesar, Tericka S; Lonce, Suzanna; Ferguson, Marcus C; Robertson, David
2013-01-01
Background: Fava beans (Vicia faba) contain dihydroxyphenylalanine (dopa), and their ingestion may increase dopamine stores. Renal dopamine regulates blood pressure and blood volume via a natriuretic effect.
Influence of faba bean and peas combination on performance parameters of broilers
Directory of Open Access Journals (Sweden)
Pavla Kratochvílová
2009-01-01
Full Text Available Influence of two varieties of peas and faba bean on performance was observed in grow experiment. Varieties of legumes were different in antinutritive factors levels. ZEKON (peas and MISTRAL (faba bean are low tannin varieties, GOTIK (peas and MERKUR (faba bean are traditional varieties with high level of antinutritive substances. Experiment was finished in 40 days of age. There were used 900 broilers allotted to 9 groups (100 animals in group. Peas and faba bean was dose to feed mixture on level adequate to 30 g of crude protein per kilogram of feed mixture, the rest of crude protein needed in feed mixture was covered by soya bean meal. The best results in final weight achieved group with GOTIK (2476.7 ± 270.8 g, the second was group ZEKON (2456.7 ± 247.2 g, than MISTRAL in combination with peas (2454.7 ± 268.5 g, MERKUR (2416.9 ± 266.1 g, ZEKON in combination with faba bean (2410,7 ± 297.8 g and MISTRAL group achieved 2405.6 ± 336.4 g of final weight. The rest of groups was belong 2400 g of body weight: control group 2370.1 ± 249.2 g, GOTIK in combination with peas 2302.9 ± 253.1 g and the worst result had group MERKUR in combination with peas (2258.8 ± 259.4 g. The differences were significant.
McAnulla, Craig; Edwards, Anne; Sanchez-Contreras, Maria; Sawers, R Gary; Downie, J Allan
2007-07-01
Transfer of the Rhizobium leguminosarum biovar viciae symbiosis plasmid pRL1JI is regulated by a cascade of gene induction involving three LuxR-type quorum-sensing regulators, TraR, BisR and CinR. TraR induces the plasmid transfer traI-trb operon in a population-density-dependent manner in response to N-acylhomoserine lactones (AHLs) made by TraI. Expression of the traR gene is primarily induced by BisR in response to AHLs made by CinI, and expression of cinI is induced by CinR and repressed by BisR. Analysis of transcription initiation of cinI, traR and traI identified potential regulatory domains recognized by the CinR, BisR and TraR regulators. Deletion and mutation of the cinI promoter identified potential recognition motifs for activation by CinR and repression by BisR. Analysis of the DNA sequence upstream of traI and expression of transcriptional gene fusions revealed a predicted TraR-binding (tra-box) domain. Two transcript initiation sites were identified upstream of the plasmid replication gene repA, which is divergently transcribed from traI; one of these repA transcripts requires the quorum-sensing cascade mediated via BisR and TraR, showing that the pRL1JI plasmid replication genes are co-regulated with the plasmid transfer genes.
Directory of Open Access Journals (Sweden)
Zhipeng Liu
Full Text Available BACKGROUND: Vicia sativa (the common vetch possesses a predominant zygomorphic flower and belongs to the subfamily Papilionoideae, which is related to Arabidopsis thaliana in the eurosid II clade of the core eudicots. Each vetch flower consists of 21 concentrically arranged organs: the outermost five sepals, then five petals and ten stamens, and a single carpel in the center. METHODOLOGY/PRINCIPAL FINDINGS: We explored the floral transcriptome to examine a genome-scale genetic model of the zygomorphic flower of vetch. mRNA was obtained from an equal mixture of six floral organs, leaves and roots. De novo assembly of the vetch transcriptome using Illumina paired-end technology produced 71,553 unigenes with an average length of 511 bp. We then compared the expression changes in the 71,553 unigenes in the eight independent organs through RNA-Seq Quantification analysis. We predominantly analyzed gene expression patterns specific to each floral organ and combinations of floral organs that corresponded to the traditional ABC model domains. Comparative analyses were performed in the floral transcriptomes of vetch and Arabidopsis, and genomes of vetch and Medicago truncatula. CONCLUSIONS/SIGNIFICANCE: Our comparative analysis of vetch and Arabidopsis showed that the vetch flowers conform to a strict ABC model. We analyzed the evolution and expression of the TCP gene family in vetch at a whole-genome level, and several unigenes specific to three different vetch petals, which might offer some clues toward elucidating the molecular mechanisms underlying floral zygomorphy. Our results provide the first insights into the genome-scale molecular regulatory network that controls the evolution and development of the zygomorphic flower in Papilionoideae.
Directory of Open Access Journals (Sweden)
R. Heinrichs
1999-01-01
Full Text Available Em um Podzólico Vermelho Amarelo e sob preparo convencional, foi avaliada a influência de proporções de sementes de ervilhaca (Vicia sativa L. e de aveia preta (Avena strigosa Schieb. cultivadas em consórcio, na produção de fitomassa e no aporte de nitrogênio no sistema. O experimento foi implantado em solo podzolico vermelho amarelo, de Santa Maria, RS. Os tratamentos foram casualizados em quatro blocos, constituindo-se de: 1- 100% Ervilhaca comum (E; 2- 90% E + 10% Aveia preta (A; 3- 75% E + 25% A; 4- 50% E + 50% A; 5- 25% E + 75% A; 6- 100% A; 7- pousio de inverno. A amostragem da fitomassa das coberturas verdes foi efetuada na ocasião do pleno florescimento em área de 0,8m2 por parcela. Os resultados evidenciaram que a aveia preta e a ervilhaca comum podem ser consorciadas, beneficiando assim, a produção de fitomassa e acúmulo de nitrogênio.The effect of intercropping common vetch (Vicia sativa L. with naked oat (Avena strigosa Schieb. at different seed proportions was evaluated. The trial was set up on a Red Yellow Podzolic soil of Santa Maria, RS, Brazil. The treatments were the following: 1- 100% E (common vetch; 2- 90% E + 10% A (naked oat; 3- 75% E + 25% A; 4- 50% E + 50% A; 5- 25% E + 75% A; 6- 100% A; 7- fall tillage organized in four randomized blocks. Biomass production was evaluated at the flowering stage in an area of 0.8 m2 per plot. Data show that both species can be intercropped which is beneficial to biomass production and nitrogen accumulation.
Aphid Parasitoid Mothers Don't Always Know Best through the Whole Host Selection Process
Chesnais, Quentin; Ameline, Arnaud; Doury, Géraldine; Le Roux, Vincent; Couty, Aude
2015-01-01
Parasitoid host selection behaviour has been extensively studied in experimentally simplified tritrophic systems formed by one single food chain (one plant, one herbivore and one parasitoid species). The "Mother knows best" hypothesis predicts that the preference for a plant-host complex should be positively correlated with plant quality for offspring performance. We studied the host selection behaviour of the generalist endoparasitoid Aphidius matricariae towards the black bean aphid Aphis fabae in the intercrop system including Vicia faba as a focal plant and its companion plant Camelina sativa. Dual-choice laboratory bioassays revealed that parasitoid females preferred to orientate towards (1) the plant-aphid complex over the non-infested plant whatever the complex (2) the C. sativa-A. fabae complex over the V. faba-A. fabae complex. In dual choice attack rate bioassays, parasitoid females showed more interest towards the aphids on C. sativa but paradoxically chose to oviposit more in aphids on V. faba. Ultimately, parasitoids that had developed on the V. faba-A. fabae complex exhibited better fitness parameters. By demonstrating that parasitoid females were able to discriminate the aphid host that offered the highest fitness to their offspring but selected beforehand the least suitable plant-aphid complex, we provide key insight into the disruption in their host selection behaviour potentially triggered by diverse habitats. This suggests that the "Mother knows best" hypothesis could be thwarted by increasing the complexity of the studied systems. PMID:26270046
Aphid Parasitoid Mothers Don't Always Know Best through the Whole Host Selection Process.
Directory of Open Access Journals (Sweden)
Quentin Chesnais
Full Text Available Parasitoid host selection behaviour has been extensively studied in experimentally simplified tritrophic systems formed by one single food chain (one plant, one herbivore and one parasitoid species. The "Mother knows best" hypothesis predicts that the preference for a plant-host complex should be positively correlated with plant quality for offspring performance. We studied the host selection behaviour of the generalist endoparasitoid Aphidius matricariae towards the black bean aphid Aphis fabae in the intercrop system including Vicia faba as a focal plant and its companion plant Camelina sativa. Dual-choice laboratory bioassays revealed that parasitoid females preferred to orientate towards (1 the plant-aphid complex over the non-infested plant whatever the complex (2 the C. sativa-A. fabae complex over the V. faba-A. fabae complex. In dual choice attack rate bioassays, parasitoid females showed more interest towards the aphids on C. sativa but paradoxically chose to oviposit more in aphids on V. faba. Ultimately, parasitoids that had developed on the V. faba-A. fabae complex exhibited better fitness parameters. By demonstrating that parasitoid females were able to discriminate the aphid host that offered the highest fitness to their offspring but selected beforehand the least suitable plant-aphid complex, we provide key insight into the disruption in their host selection behaviour potentially triggered by diverse habitats. This suggests that the "Mother knows best" hypothesis could be thwarted by increasing the complexity of the studied systems.
Aphid Parasitoid Mothers Don't Always Know Best through the Whole Host Selection Process.
Chesnais, Quentin; Ameline, Arnaud; Doury, Géraldine; Le Roux, Vincent; Couty, Aude
2015-01-01
Parasitoid host selection behaviour has been extensively studied in experimentally simplified tritrophic systems formed by one single food chain (one plant, one herbivore and one parasitoid species). The "Mother knows best" hypothesis predicts that the preference for a plant-host complex should be positively correlated with plant quality for offspring performance. We studied the host selection behaviour of the generalist endoparasitoid Aphidius matricariae towards the black bean aphid Aphis fabae in the intercrop system including Vicia faba as a focal plant and its companion plant Camelina sativa. Dual-choice laboratory bioassays revealed that parasitoid females preferred to orientate towards (1) the plant-aphid complex over the non-infested plant whatever the complex (2) the C. sativa-A. fabae complex over the V. faba-A. fabae complex. In dual choice attack rate bioassays, parasitoid females showed more interest towards the aphids on C. sativa but paradoxically chose to oviposit more in aphids on V. faba. Ultimately, parasitoids that had developed on the V. faba-A. fabae complex exhibited better fitness parameters. By demonstrating that parasitoid females were able to discriminate the aphid host that offered the highest fitness to their offspring but selected beforehand the least suitable plant-aphid complex, we provide key insight into the disruption in their host selection behaviour potentially triggered by diverse habitats. This suggests that the "Mother knows best" hypothesis could be thwarted by increasing the complexity of the studied systems.
Directory of Open Access Journals (Sweden)
Mohamed M. EL FOULY
2010-06-01
Full Text Available Salinity, either of soil or of irrigation water, causes disturbances in plant growth and nutrient balance. Previous work indicates that applying nutrients by foliar application increases tolerance to salinity. A pot experiment with three replicates was carried out in the green house of NRC, Cairo, Egypt, to study the effect of micronutrients foliar application on salt tolerance of faba bean. Two concentrations of a micronutrient compound (0.1% and 0.15% were sprayed in two different treatments prior to or after the salinity treatments. Levels of NaCl (0.00-1000-2000-5000 ppm were supplied to irrigation water. Results indicated that 2000 and 5000 ppm NaCl inhibited growth and nutrient uptake. Spraying micronutrients could restore the negative effect of salinity on dry weight and nutrients uptake, when sprayed either before or after the salinity treatments. It is suggested that micronutrient foliar sprays could be used to improve plant tolerance to salinity.
Cheng, Rui-Xia; Meng, Ling; Mills, Nickolas J; Li, Baoping
2011-01-01
Few empirical studies have directly explored the association between Buchnera aphidicola (Enterobacteriales: Enterobacteriaceae), the primary endosymbiont of aphids, and the life history strategies of aphid parasitoids. A series of paired-choice experiments were conducted to explore the preference of the parasitoid Lysiphlebus ambiguus Halliday (Hymenoptera: Aphididae) for symbiotic and aposymbiotic Aphis fabae Scopoli (Hemiptera: Aphididae) and the suitability of these hosts for parasitoid development. When given a choice between symbiotic and aposymbiotic aphids of the same instar, the parasitoid significantly preferred symbiotic over aposymbiotic aphids only during the later instars (L(4) and adult). The suitability of aposymbiotic aphids for parasitoid development was equal to that of symbiotic aphids in terms of survivorship and sex ratio, but was significantly lower than that of symbiotic aphids for L(4) and adult instars in development rate and/or female adult size. When given a choice between similar-sized symbiotic L(2) and aposymbiotic L(4) aphids, the parasitoid preferred the former. No significant differences in preference or host suitability were demonstrated when the parasitoid was given a choice between different instars of aposymbiotic aphids. While parasitoid lifetime fecundity increased with aphid instar at the time of oviposition, there was no significant influence of previous development from symbiotic versus aposymbiotic aphids. These results suggest that while L. ambiguus can discriminate between symbiotic and aposymbiotic A. fabae during later instars and when the aphids are of a similar size, the primary endosymbiont is not needed for successful parasitoid development; and its absence only compromises parasitoid growth reared from later instar aposymbiotic host.
Efficiency of propolis extract on faba bean plants and its role against nematode infection.
Noweer, E M A; Dawood, Mona G
2009-01-01
Propolis is a resinous substances collected by honey bees, It cannot be used as a raw material, so it must be purified by extraction with solvent. This work aimed to study the physiological influence of propolis extract as foliar application or soil drench on faba bean plants and its role against nematode infection. Propolis samples were extracted by using three different solvents (distilled water or 70% ethanol or acetone) (750 and 1000 mg/l). Qualitative tests of the propolis extracts proved that these extracts contain sterols, flavonoids and phenolic compounds. Moreover, few numbers of phenolic acids (coumaric, ferulic, salicylic and benzoic acid) were also detected on TLC plates. All treatments of propolis extract (as foliar application or soil drench) increased total chlorophyll and carotenoid and the magnitude of increase was more pronounced by applying the higher concentration (1000 mg/l). Moreover, alll propolis extracts increased shoot height; root dry weight; number of branches and pods/plant; number of seeds/pod as well as seed index. Acetonic extract was the most effective particularly at higher concentration. Applying propolis extracts as foliar application or soil drench caused an increase in carbohydrate content of the yielded seeds accompanied by a decrease in phytic acid and vicine content. In addition, foliar application of all propolis extracts caused an increasing in protein content and phenolic compounds of the yielded seeds, whereas, soil drench with ethanolic or acetonic extract only at 1000 mg/L increased protein content. The data revealed that the propolis extract as soil drench reduced the juvenile-Meloidogyne sp.-population density per one kg soil and number of root-galls per one gm roots specially at the higher concentration (1000 mg/l). It is worthy to mention that faba bean plants treated with propolis extract either as foliar application or soil drench could overcome the inhibitory influence of nematode infection.
Directory of Open Access Journals (Sweden)
Mikić Aleksandar
2015-01-01
Full Text Available The words denoting lentil (Lens culinaris Medik., pea (Pisum sativum L. and faba bean (Vicia faba L. in the modern Indo-European languages show a high level of uniformity in morphology and semantics and reveal the traces of mutual borrowings among the languages of different Indo-European branches and the exchanges with the neighbouring non-Indo-European languages. Nearly all modern Indo-European languages derived their words denoting lentil and faba bean from the Proto-Indo-European roots *lent- and *bhabh-, with the same primeval meaning. Among the Proto-Indo-European roots related to pea are *erəgw[h]-, *g'er[a]n-, *ghArs-, *kek- and *pis-. The collected results offer another testimony how important grain legumes such as lentil, pea or faba bean were in the everyday life of the forefathers of the modern Indo-European nations of Europe and their non-Indo-European neighbours.
Directory of Open Access Journals (Sweden)
Abdelaziz HIRICH
2014-07-01
Full Text Available Several experiments were conducted in the south of Morocco (IAV-CHA, Agadir during two seasons 2010 and 2011 in order to evaluate the effect of deficit irrigation with treated wastewater on several crops (quinoa, sweet corn, faba bean and chickpeas. During the first season (2010 three crops were tested, quinoa, chickpeas and sweet corn applying 6 deficit irrigation treatments during all crop stages alternating 100% of full irrigation as non-stress condition and 50% of full irrigation as water deficit condition applied during vegetative growth, flowering and grain filling stage. For all crops, the highest water productivity and yield were obtained when deficit irrigation was applied during the vegetative growth stage. During the second season (2011 two cultivars of quinoa, faba bean and sweet corn have been cultivated applying 6 deficit irrigation treatments (rainfed, 0, 25, 50, 75 and 100% of full irrigation only during the vegetative growth stage, while in the rest of crop cycle full irrigation was provided except for rainfed treatment. For quinoa and faba bean, treatment receiving 50% of full irrigation during vegetative growth stage recorded the highest yield and water productivity, while for sweet corn applying 75% of full irrigation was the optimal treatment in terms of yield and water productivity.
Directory of Open Access Journals (Sweden)
Kadry Nabeh Abdel Khalik
2013-07-01
Full Text Available The seed morphology and seed proteins of 11 Vicia taxa from Egypt were studied. Macro- and micro-morphological characters, including seed shape, color, size, hilum shape and seed sculpture were described and analyzed. The secondary sculpture of the cell wall varies from papillose in nearly all Vicia species to lophate in V. hirsuta. Further, the seed proteins of studied taxa were investigated by SDS-PAGE and 39 different bands were scored. The similarity analysis based on the SDS-PAGE profile and seed morphology was found to be a useful characteristic for the discrimination of Vicia species both on the subgeneric and the sectional levels. The present study did not acknowledge V. tetrasperma and V. hirsuta as subgenus Ervum. As a result, division of Vicia into two subgenera i.e. Vicia and Cracca, is supported.
Safronova, Vera I; Kuznetsova, Irina G; Sazanova, Anna L; Belimov, Andrey A; Andronov, Evgeny E; Chirak, Elizaveta R; Osledkin, Yuri S; Onishchuk, Olga P; Kurchak, Oksana N; Shaposhnikov, Alexander I; Willems, Anne; Tikhonovich, Igor A
2017-01-01
Gram-stain-negative strains V5/3MT, V5/5K, V5/5M and V5/13 were isolated from root nodules of Vicia alpestris plants growing in the North Ossetia region (Caucasus). Sequencing of the partial 16S rRNA gene (rrs) and four housekeeping genes (dnaK, gyrB, recA and rpoB) showed that the isolates from V. alpestris were most closely related to the species Microvirga zambiensis (order Rhizobiales, family Methylobacteriaceae) which was described for the single isolate from root nodule of Listia angolensis growing in Zambia. Sequence similarities between the Microvirga-related isolates and M. zambiensis WSM3693T ranged from 98.5 to 98.7 % for rrs and from 79.7 to 95.8 % for housekeeping genes. Cellular fatty acids of the isolates V5/3MT, V5/5K, V5/5M and V5/13 included important amounts of C18 : 1ω7c (54.0-67.2 %), C16 : 0 (6.0-7.8 %), C19 : 0 cyclo ω8c (3.1-10.2 %), summed feature 2 (comprising one or more of iso-C16 : 1 I, C14 : 0 3-OH and unknown ECL 10.938, 5.8-22.5 %) and summed feature 3 (comprising C16 : 1ω7c and/or iso-C15 : 02-OH, 2.9-4.0 %). DNA-DNA hybridization between the isolate V5/3MT and M. zambiensis WSM3693T revealed DNA-DNA relatedness of 35.3 %. Analysis of morphological and physiological features of the novel isolates demonstrated their unique phenotypic profile in comparison with reference strains from closely related species of the genus Microvirga. On the basis of genotypic and phenotypic analysis, a novel species named Microvirga ossetica sp. nov. is proposed. The type strain is V5/3MT (=LMG 29787T=RCAM 02728T). Three additional strains of the species are V5/5K, V5/5M and V5/13.
García-Garijo, A; Tejera, N A; Lluch, C; Palma, F
2014-05-01
Alterations on growth, amino acids metabolism and some antioxidant enzyme activities as result of imazamox treatment were examined in determinate and indeterminate nodules, formed by Phaseolus vulgaris and Vicia sativa, respectively. Young seedlings of both legumes were inoculated with their respective microsymbionts and grown under controlled conditions. At vegetative growth, plants were treated with imazamox (250μM) in the nutrient solution and harvested 7days after. Imazamox was mainly accumulated in V. sativa where concentrations were more than six fold higher than those detected in P. vulgaris. Nodule dry weight and total nitrogen content were reduced by the herbicide treatment: the highest decrease of nodule biomass (50%) and nitrogen content (40%) were registered in V. sativa and P. vulgaris, respectively. The concentration of branched-chain amino acids (BCAA) did not change in neither determinate nor indeterminate nodules even though the acetohydroxyacid synthase activity decreased in root and nodules of both symbioses with the herbicide application. Based on this last result and taking into account that total free amino acids increased in roots but not in nodules of common vetch, a possible BCAA translocation from root to nodule could occur. Our results suggest that the maintenance of BCAA balance in nodule become a priority for the plant in such conditions. The involvement of activities glutathione-S-transferase, guaiacol peroxidase and superoxide dismutase in the response of the symbioses to imazamox are also discussed. Copyright © 2014 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Stefan Martyniuk
2015-09-01
Full Text Available The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv in the solid-carrier inoculant. In a pot experiment the highest number of nodules was detected on roots of pea plants inoculated with the dual-culture inoculant containing Rlv and A. chroococcum, slightly lower numbers on pea roots inoculated with the mono-culture inoculum of Rlv and almost no nodules were found on the roots of pea un-inoculated (control treatment with the bacteria. In the micro-plot experiment conducted in the years 2011–2012 pre-sowing inoculation of pea seeds with the mono-culture inoculant of Rlv or with the mixed inoculant of Rlv and A. chroococcum slightly increased nodule numbers/plant, pod numbers/plant and seed numbers/pod, as compared to the un-inoculated control, but these differences were not reflected in pea seed yields/m2, which were similar in all treatments.
Génard, Thaïs; Etienne, Philippe; Laîné, Philippe; Yvin, Jean-Claude; Diquélou, Sylvain
2016-09-01
Nitrogen (N) transfer is well documented in legume-cereal intercropping but this is less often reported for legume-Brassica intercrops even though Brassica crops require higher levels of N fertilizers. The present study was carried out to quantify N transfer from legumes (Lupinus albus L., Trifolium incarnatum L. or Vicia sativa L.) to rapeseed (Brassica napus L.) using the split-root (15)N-labelling method. After three months we observed that legumes did not alter the growth of rapeseed. Vetch showed the lowest growth and demonstrated low (15)N shoot to root translocation and no significant N transfer to rapeseed. In contrast, significant (15)N enrichment was found in lupine and clover and (15)N was transferred to the associated rapeseed plants (around 6 and 4 mg N plant(-1), respectively), which contributed 2 to 3% of the rapeseed total N. Additionally, the data revealed that N2 fixation dominated the N nutrition in lupine despite the high N level provided in the donor compartment, suggesting a greater niche segregation between companion plants. Based on the results of this study we suggest that intercropping can be a relevant contributor to rapeseed N nutrition. Among the three legumes tested, clover and lupine seemed to be the best intercropping candidates.
Directory of Open Access Journals (Sweden)
Thaïs Génard
2016-09-01
Full Text Available Nitrogen (N transfer is well documented in legume-cereal intercropping but this is less often reported for legume-Brassica intercrops even though Brassica crops require higher levels of N fertilizers. The present study was carried out to quantify N transfer from legumes (Lupinus albus L., Trifolium incarnatum L. or Vicia sativa L. to rapeseed (Brassica napus L. using the split-root 15N-labelling method. After three months we observed that legumes did not alter the growth of rapeseed. Vetch showed the lowest growth and demonstrated low 15N shoot to root translocation and no significant N transfer to rapeseed. In contrast, significant 15N enrichment was found in lupine and clover and 15N was transferred to the associated rapeseed plants (around 6 and 4 mg N plant−1, respectively, which contributed 2 to 3% of the rapeseed total N. Additionally, the data revealed that N2 fixation dominated the N nutrition in lupine despite the high N level provided in the donor compartment, suggesting a greater niche segregation between companion plants. Based on the results of this study we suggest that intercropping can be a relevant contributor to rapeseed N nutrition. Among the three legumes tested, clover and lupine seemed to be the best intercropping candidates.
Energy Technology Data Exchange (ETDEWEB)
Ruffini Castiglione, Monica, E-mail: mruffini@biologia.unipi.it [University of Pisa, Department of Biology (Italy); Giorgetti, Lucia; Geri, Chiara [Institute of Agricultural Biology and Biotechnology (IBBA/CNR), UOS Pisa (Italy); Cremonini, Roberto [University of Pisa, Department of Biology (Italy)
2011-06-15
This study aimed to provide new information about phyto-toxicology of nano-TiO{sub 2} on plant systems. To contribute to the evaluation of the potential harmful effects of the nanoparticles on monocots and dicots we considered their effects on seed germination and root elongation applying a concentration range from 0.2 to 4.0 Per-Mille-Sign in the plants Zea mays L. and Vicia narbonensis L. Moreover, we achieved a genotoxicity study at cytological level in root meristems by means of traditional cytogenetic approach, to evidence possible alterations in mitotic activity, chromosomal aberrations, and micronuclei release. From these analyses it comes out that nano-TiO{sub 2} particles, after short-term exposure and under our experimental conditions, delayed germination progression for the first 24 h in both materials. Root elongation was affected only after treatment with the higher nano-TiO{sub 2} concentration. Further significant effects were detected showing mitotic index reduction and concentration-dependent increase in the aberration emergence that evidenced a nano-TiO{sub 2}-induced genotoxic effect for both species.
Hahn, M; Neef, U; Struck, C; Göttfert, M; Mendgen, K
1997-05-01
A cDNA library constructed from haustoria of the rust fungus Uromyces fabae was screened for clones that are differentially expressed in haustoria. One family of cDNAs (in planta-induced gene 2 [PIG2] was isolated and found to encode a protein with high homologies to fungal amino acid transporters. A cDNA clone containing the complete coding region of PIG2 and the corresponding genomic clone were isolated and sequenced, revealing the presence of 17 introns in the PIG2 gene. Expression of PIG2 mRNA appeared to be restricted to haustoria. With antibodies raised against synthetic peptides, the PIG2-encoded protein was found in membranes fractions of isolated haustoria but not of germinated rust spores. With immunofluorescence microscopy, the putative amino acid transporter was localized to plasma membranes of the haustorial bodies, but not detected in the haustorial neck, haustorial mother cells, or intercellular fungal hyphae growing within infected leaf tissue. These data present for the first time molecular evidence that the rust haustorium plays a special role in the uptake of nutrients from an infected host cell.
Barros, Claudio S.L.; Rafael A. Fighera; Daniela B. Rozza; Raquel R. Rech; Simone V. Sallis; Langohr, Ingeborg M.
2001-01-01
Dois surtos de uma doença associada ao pastoreio de duas espécies de ervilhaca (predominantemente Vicia villosa e, em menor grau, V. sativa) foram observados em agosto-setembro de 2001, em vacas Holandesas adultas de duas propriedades rurais do Rio Grande do Sul. Foram afetadas, em uma das propriedades, quatro de 42 vacas (9,5%) e, na outra, uma de oito vacas (12,5%). Os sinais clínicos incluíam, embora não em todos os casos, febre, prurido, espessamento e enrugamento da pele com placas multi...
Struck, Christine; Ernst, Michael; Hahn, Matthias
2002-01-01
In the rust fungus Uromyces fabae, invasion of the host plant and haustorium formation are accompanied by the activation of many genes (PIGs = in planta induced genes). In addition to the previously described AAT2 (PIG2), AAT1 (PIG27) was found to encode a protein with a high similarity to fungal amino acid permeases. AAT1 transcripts are present in germinated hyphae and throughout the mycelium later in the infection process, but occur at the highest levels in haustoria. Expression of AAT1p i...
Hogg, B.; Davies, A.E.; Wilson, K.E.; Bisseling, T.; Downie, J.A.
2002-01-01
Cultivar Afghanistan peas are resistant to nodulation by many strains of Rhizobium leguminosarum bv. viciae but are nodulated by strain TOM, which carries the host specificity gene nodX. Some strains that lack nodX can inhibit nodulation of cv. Afghanistan by strain TOM. We present evidence that
potential antagonistic fungal species from ethiopia for biological ...
African Journals Online (AJOL)
Prof. Adipala Ekwamu
Chocolate spot disease (Botrytis fabae Sard) is one of most yield limiting constraints of faba bean (Vicia faba). There is promise in using biological control agents to control chocolate spot diseases, nevertheless, this strategy has not been fully exploited. The objective of this study was to assess the prevalence of different ...
Publications | Page 493 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 4921 - 4930 of 6364 ... Estimation genetic variation in faba bean (Vicia faba L.) landraces in Yemen : a thesis (restricted access). The study investigates genetic variations between and within Yemeni faba bean landraces, estimates correlations and coefficients for the most important traits, and characterizes phenotypic ...
Engel, V.; Fischer, M.D.; Wäckers, F.L.; Volkl, W.
2001-01-01
Broad bean (Vicia faba), an annual plant bearing extrafloral nectaries (EFN) at the base of the upper leaves, is regularly infested by two aphid species, Aphis fabae and Acyrthosiphon pisum. EFN and A. fabae are commonly attended by the ant, Lasius niger, while Ac. pisum usually remains uninfested.
Potential antagonistic fungal species from Ethiopia for biological ...
African Journals Online (AJOL)
Chocolate spot disease (Botrytis fabae Sard) is one of most yield limiting constraints of faba bean (Vicia faba). There is promise in using biological control agents to control chocolate spot diseas`es, nevertheless, this strategy has not been fully exploited. The objective of this study was to assess the prevalence of different ...
East African Journal of Sciences - Vol 10, No 2 (2016)
African Journals Online (AJOL)
Efficacy of Pepper Tree (Schinus molle) Extracts to Suppress Growth of Botrytis fabae and Manage Chocolate Spot Severity on Faba Bean (Vicia faba) at Sinana, Bale Zone, Southeastern Ethiopia · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Addisu Tegegn, Meseret ...
African Journals Online (AJOL)
Egigu, Meseret Chimdessa. Vol 10, No 2 (2016) - Articles Efficacy of Pepper Tree (Schinus molle) Extracts to Suppress Growth of Botrytis fabae and Manage Chocolate Spot Severity on Faba Bean (Vicia faba) at Sinana, Bale Zone, Southeastern Ethiopia Abstract. ISSN: 1992-0407. AJOL African Journals Online. HOW TO ...
Salminen, S O; Streeter, J G
1992-10-01
The aim of the work reported here was to ascertain that the patterns of labeling seen in isolated bacteroids also occurred in bacteroids in intact nodules and to observe early metabolic events following exposure of intact nodules to (14)CO(2). Intact nodules of soybean (Glycine max L. Merr. cv Ripley) inoculated with Bradyrhizobium japonicum USDA 110 and pea (Pisum sativum L. cv Progress 9) inoculated with Rhizobium leguminosarum bv viciae isolate 128C53 were detached and immediately fed (14)CO(2) for 1 to 6 min. Bacteroids were purified from these nodules in 5 to 7 min after the feeding period. In the cytosol from both soybean and pea nodules, malate had the highest radioactivity, followed by citrate and aspartate. In peas, asparagine labeling equaled that of aspartate. In B. japonicum bacteroids, malate was the most rapidly labeled compound, and the rate of glutamate labeling was 67% of the rate of malate labeling. Aspartate and alanine were the next most rapidly labeled compounds. R. leguminosarum bacteroids had very low amounts of (14)C and, after a 1-min feeding, malate contained 90% of the radioactivity in the organic acid fraction. Only a trace of activity was found in aspartate, whereas the rate of glutamate and alanine labeling approached that of malate after 6 min of feeding. Under the conditions studied, malate was the major form of labeled carbon supplied to both types of bacteroids. These results with intact nodules confirm our earlier results with isolated bacteroids, which showed that a significant proportion of provided labeled substrate, such as malate, is diverted to glutamate. This supports the conclusion that microaerobic conditions in nodules influence carbon metabolism in bacteroids.
Directory of Open Access Journals (Sweden)
Luciana Sonne
2010-08-01
Full Text Available An unusual case of spontaneous Vicia villosa poisoning affected a 6-year-old Holstein cow. Although the most striking findings included a generalized hemorrhagic condition associated with granulomatous myelitis, histological lesions typically seen with the vetch-associated systemic granulomatous syndrome were also present. Prominent gross findings were bloody nasal and oral discharges, disseminated hemorrhages, and bloody feces. Generalized hemorrhages associated with infiltration of numerous organs by lymphocytes, plasma cells, macrophages, multinucleated giants cells, and eosinophils were the main microscopic findings. Anti-CD68 immunostaining confirmed the presence of moderate histiocytic infiltrate and multinucleated giant cells in the bone marrow. These changes in the bone marrow probably caused the generalized hemorrhagic changes described here.Um bovino Holandês de seis anos naturalmente intoxicado pela Vicia villosa apresentou lesões não comumente encontradas nessa intoxicação. Embora a lesão mais evidente fosse hemorragia generalizada associada à mielite granulomatosa, as lesões granulomatosas típicas da intoxicação pela ervilhaca também estavam presentes histologicamente. Os principais achados macroscópicos foram hemorragias nasal e oral, hemorragias generalizadas e fezes com sangue. Lesões hemorrágicas generalizadas associadas com infiltrado inflamatório de linfócitos, plasmócitos, macrófagos, células gigantes multinucleadas e eosinófilos foram os principais achados microscópicos encontrados. O teste imuno-histoquímico anti-CD68 confirmou a presença de infiltrado moderado de macrófagos e de células gigantes multinucleadas na medula óssea. As alterações na medula óssea provavelmente constituem a causa da hemorragia generalizada descrita nesse caso.
Bechkri, Sakina; Medoukali, Imane; Khelifi, Douadi
2017-12-01
Genetic variability was studied in 78 populations of locally collected Vicia L. taxa for seed albumins, globulins and prolamins patterns by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) along with an ecogeographic characterization of sites investigated. 131, 119 and 98 bands were respectively used for albumin, globulin and prolamin cluster analysis. Dendrograms based on the Jaccard index and the UPGMA method were generated and the degree of genetic diversity between and within taxa was evaluated. Five clusters were generated from albumins, six from globulins and four from prolamins patterns. The results reflect the great diversity of storage proteins and a high correlation was obtained between the three studied fractions. Several accessions present specific bands which could be used as a discriminatory marker both on intra and interspecific levels. No clear relationships were seen between the groups according to their geographical origin. Data obtained from ecogeographic investigation can be used for future collecting missions.
De Santis, Christian; Crampton, Viv O; Bicskei, Beatrix; Tocher, Douglas R
2015-12-01
The production of carnivorous fish such as Atlantic salmon (Salmo salar) is dependent on the availability of high quality proteins for feed formulations. For a number of nutritional, strategic and economic reasons, the use of plant proteins has steadily increased over the years, however a major limitation is associated with the presence of anti-nutritional factors and the nutritional profile of the protein concentrate. Investigating novel raw materials involves understanding the physiological consequences associated with the dietary inclusion of protein concentrates. The primary aim of the present study was to assess the metabolic response of salmon to increasing inclusion of air-classified faba bean protein concentrate (BPC) in feeds as a replacement for soy protein concentrate (SPC). Specifically, we tested treatments with identical contents of fishmeal (222.4gkg(-1)) and progressively higher inclusion of BPC (0gkg(-1), 111.8gkg(-1), 223.6gkg(-1), 335.4gkg(-1), 447.2gkg(-1)) substituting SPC. This study demonstrated a dose-dependent metabolic response to a plant ingredient and was the first to compare the nutrigenomic transcriptional responses after substitution of terrestrial feed ingredients such as BPC and SPC without withdrawal of marine ingredients. It was found that after eight weeks a major physiological response in liver was only evident above 335.4gkg(-1) BPC and included decreased expression of metabolic pathways, and increased expression of genes regulating transcription and translation processes and the innate immune response. Furthermore, we showed that the nutritional stress caused by BPC resembled, at least at hepatic transcriptional level, that caused by soybean meal (included as a positive control in our experimental design). The outcomes of the present study suggested that Atlantic salmon parr might efficiently utilize moderate substitution of dietary SPC with BPC, with the optimum inclusion level being around 120gkg(-1)in the type of feeds
Mazur, Andrzej; De Meyer, Sofie E; Tian, Rui; Wielbo, Jerzy; Zebracki, Kamil; Seshadri, Rekha; Reddy, Tbk; Markowitz, Victor; Ivanova, Natalia N; Pati, Amrita; Woyke, Tanja; Kyrpides, Nikos C; Reeve, Wayne
2015-01-01
Rhizobium leguminosarum bv. viciae GB30 is an aerobic, motile, Gram-negative, non-spore-forming rod that can exist as a soil saprophyte or as a legume microsymbiont of Pisum sativum. GB30 was isolated in Poland from a nodule recovered from the roots of Pisum sativum growing at Janow. GB30 is also an effective microsymbiont of the annual forage legumes vetch and pea. Here we describe the features of R. leguminosarum bv. viciae strain GB30, together with sequence and annotation. The 7,468,464 bp high-quality permanent draft genome is arranged in 78 scaffolds of 78 contigs containing 7,227 protein-coding genes and 75 RNA-only encoding genes, and is part of the GEBA-RNB project proposal.
Farming legumes in the pre-pottery Neolithic: New discoveries from the site of Ahihud (Israel).
Caracuta, Valentina; Vardi, Jacob; Paz, Ytzhak; Boaretto, Elisabetta
2017-01-01
New discoveries of legumes in the lower Galilee at the prehistoric site of Ahihud in Israel shed light on early farming systems in the southern Levant. Radiocarbon dating of twelve legumes from pits and floors indicate that the farming of legumes was practiced in southern Levant as early as 10.240-10.200 (1σ) ago. The legumes were collected from pits and other domestic contexts dated to the Early Pre-Pottery Neolithic B. The legumes identified include Vicia faba L. (faba bean), V. ervilia (bitter vetch), V. narbonensis (narbon vetch), Lens sp. (lentil), Pisum sp. (pea), Lathyrus inconspicuus (inconspicuous pea) and L. hirosolymitanus (jerusalem vetchling). Comparison with coeval sites in the region show how the presence of peas, narbon vetches, inconspicuous peas, jerusalem vetchlings and bitter vetches together with faba bean and lentils is unique to the Pre-Pottery Neolithic, and might indicate specific patterns in farming or storing at the onset of agriculture.
Farming legumes in the pre-pottery Neolithic: New discoveries from the site of Ahihud (Israel.
Directory of Open Access Journals (Sweden)
Valentina Caracuta
Full Text Available New discoveries of legumes in the lower Galilee at the prehistoric site of Ahihud in Israel shed light on early farming systems in the southern Levant. Radiocarbon dating of twelve legumes from pits and floors indicate that the farming of legumes was practiced in southern Levant as early as 10.240-10.200 (1σ ago. The legumes were collected from pits and other domestic contexts dated to the Early Pre-Pottery Neolithic B. The legumes identified include Vicia faba L. (faba bean, V. ervilia (bitter vetch, V. narbonensis (narbon vetch, Lens sp. (lentil, Pisum sp. (pea, Lathyrus inconspicuus (inconspicuous pea and L. hirosolymitanus (jerusalem vetchling. Comparison with coeval sites in the region show how the presence of peas, narbon vetches, inconspicuous peas, jerusalem vetchlings and bitter vetches together with faba bean and lentils is unique to the Pre-Pottery Neolithic, and might indicate specific patterns in farming or storing at the onset of agriculture.
Kamo, Tsunashi; Takemura, Tomoko; Wasano, Naoya; Fujii, Yoshiharu; Hiradate, Syuntaro
2012-01-01
We quantified the cyanamide content of young leaves of nine Vicia species, Lens culinaris, and Robinia pseudo-acacia using a modified analytical procedure that made it possible to measure the cyanamide content of a single leaf. Recent molecular phylogenetic analysis suggests that cyanamide is present in V. benghalensis, which is placed in a monophyletic group with cyanamide-biosynthesizing plants, V. villosa and V. cracca; this suggestion was verified.
BAĞCI, Muhittin; Mutlu, Hüseyin
2014-01-01
This study covers M2 generation of the mutation breeding Project with practice of gamma irradiation on Hungarian vetch (Vicia pannonica Crantz.). The study was counducted, with the purpose of determine and contrast control dose have effects on some properties of vegetational. In the study, M1 plant seeds of three Hungarian vetch cultivars (Tarmbeyazı-98, Anadolupembesi-2002 and Oğuz-2002) were planted. It was examined that morphological, biological and agricultural characteristics obtained M2...
Directory of Open Access Journals (Sweden)
Magdi T. ABDELHAMID
2014-05-01
Full Text Available Salinity decreases yield in arid and semi-arid areas. With increasing demand for irrigation water, alternative sources are being sought. Seawater salinity was previously considered unusable for irrigation. However, this water can be used successfully to grow crops under certain conditions. Amino acids is well known biostimulant which has positive effects on plant growth and yield, and significantly mitigates the injuries caused by abiotic stresses Therefore, in the present study, the effect of exogenously treatment amino acid on faba bean plant growing under sea water salt stress was investigated. Reduction of salinity damage in faba bean by using a mixture of amino acids to improve morphological and biochemical parameters, and thus raising the level of plant yield was tested. A pot experiment was conducted to alleviate the harmful effects of seawater salinity on faba bean cv. Giza 843 by foliar spraying of an amino acid mixture with different concentrations (0.0, 500, 1000 or 1500 mg L-1. Irrigation of faba bean plants with seawater levels of 3.13 and 6.25 dS m-1 led to significant reductions in plant height, number of leaves plant, fresh and dry weight of shoots, photosynthetic pigments, total carbohydrates, polysaccharides, nucleic acid DNA and RNA contents of faba bean leaves. Seawater salinity induced higher contents of Na+ and Cl- and decreased contents of K+, K+:Na+, Ca2+, Mg2+ and P3+. Irrigation of faba bean plant with different levels of seawater decreased seed yield and total dry weight per plant compared with those irrigated with tap water. Also, total carbohydrates and total protein contents in seeds were reduced by increased seawater salinity levels. Amino acid application as foliar spray significantly improved all the reduced parameters due to seawater stress. However, the highest level of amino acid of 1500 mg L-1 exerted the strongest effect in alleviating the harmful effect of seawater salinity stress. Efecto de la aplicaci
Raupp, Dr Joachim; Oltmanns, Meike
2006-01-01
Whereas the positive effects of farmyard manure on soil biological properties have been shown in several long-term experiments, no comparable information was available for plant based organic fertilizers. Since 1996 such materials were applied with the same amount of total nitrogen as farmyard manure (100 (kg ha-1) on a poor sandy soil. In 2005 it was found that faba bean meal application caused the same potato yield, and tubers with the same phosphorus content, but lower potassium and sligh...
Gunawardena, C K; Zijlstra, R T; Beltranena, E
2010-02-01
Most pulse (nonoilseed legume) seed flours can be fractionated rapidly and economically by air classification into protein and starch concentrates. The nutritional value of air-classified field pea and faba bean concentrates requires characterization to assess the feeding opportunity for pigs. Thus, the objectives were to characterize the apparent total tract digestibility (ATTD) of DM, OM, energy, starch, CP, fat, and ash; apparent ileal digestibility of CP and starch; standardized ileal digestibility (SID) of AA; and the SID AA, DE, and NE content of air-classified zero-tannin faba bean and field pea protein and starch concentrates in grower pigs. Pulse protein and starch concentrates were compared with soy protein concentrate and corn starch, respectively, as corresponding standards. The corn starch diet served as an N-free diet to correct for basal endogenous AA losses. In a Youden square design, 8 ileal-cannulated barrows (24.9 +/- 2.3 kg of BW) were fed 6 diets over 7 periods at 3 times the maintenance DE requirement. Periods encompassed a 5-d diet acclimation, 3-d feces collection, and 3-d ileal digesta collection. The ATTD of GE was 2% greater (P bean than soy and was intermediate for field pea protein (95.6, 93.7, and 94.9%, respectively). The ATTD of GE was 3.6% greater (P bean starch (96.2, 95.1, and 92.3%, respectively). The DE content of faba bean was 5.0% greater (P content of faba bean and field pea was 1.7% greater (P content was 5% greater (P bean than field pea and soy protein (3.08, 2.94, and 2.92 Mcal/kg, respectively). The NE content for field pea starch was 2.0% greater (P bean starch (2.68, 2.63, and 2.61 Mcal/kg, respectively). Protein concentrates had a 14 and 11% greater (P content, respectively, than starch concentrates. The SID of Lys was 6.0% greater (P bean and field pea protein than soy protein (95.5, 92.6, and 88.7%, respectively). The SID of Lys was 6.0% greater (P bean than field pea starch. Nutrient digestibility and digestible
Thavarajah, Pushparajah; Thavarajah, Dil; Premakumara, G A S; Vandenberg, Albert
2012-12-15
Detection of adulteration of split red lentil (Lens culinaris L.) seeds with low level addition of split common vetch (Vicia sativa L.) is hampered by a lack of reliable detection methods. An analytical method was developed using high performance liquid chromatography with diode array detection (HPLC-DAD) based on two unique chemical markers found in common vetch: ß-cyanoalanine (BCA) and γ-glutamyl-ß-cyanoalanine (GCA). These two markers were present in samples of common vetch seed grown in Canada and Serbia. Authentic lentil samples grown in Canada, Australia, USA, Turkey, Syria, and Morocco had no detectable levels of these chemical markers. Commercial lentil samples for export from lentil processing plants in Saskatchewan, Canada, also had no detectable levels of GCA and BCA. The presence of vetch in intentionally adulterated lentil samples could be determined via chemical markers with a detection limit of 5% (w/w). The proposed method is a simple sample extraction and rapid HPLC analysis that could be widely used to detect intentional adulteration of lentils with common vetch. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Mikić Aleksandar
2015-01-01
Full Text Available Bitter vetch (Vicia ervilia (L. Willd. was a part of the everyday diet of the Eurasian Neanderthal population and the modern human Palaeolithic hunter-gatherers at the end of the last Ice Age. The major criteria to determine the domestication in bitter vetch and other ancient grain legumes are non-dehiscent pods, larger seed size and smooth seed testa. Bitter vetch seeds were found among the earliest findings of cultivated crops at the site of Tell El-Kerkh, Syria, from 10th millennium BP. Along with cereals, pea and lentil, bitter vetch has become definitely associated with the start of the 'agricultural revolution' in the Old World. Bitter vetch entered Europe in its south-east regions and progressed into its interior via Danube. Its distribution was rapid, since the available evidence reveals its presence in remote places at similar periods. Recently the first success has been obtained in the extraction of ancient DNA from charred bitter vetch seeds. The linguistic evidence supports the fact that most of Eurasian peoples have their own words denoting bitter vetch, meaning that its cultivation preceded the diversification of their own proto-languages. [Projekat Ministarstva nauke Republike Srbije, br. TR-31024 i br. 173005
Directory of Open Access Journals (Sweden)
Lesław B. Lahuta
2011-01-01
Full Text Available Beside RFOs, which are commonly present in legume seeds, seeds of some species contain galactosyl pinitols (GPs. These carbohydrates, like RFOs, have been hypothesized to constitute an important energy and carbon skeletal source during germination. To test this hypothesis we have applied a specific α-galactosidase inhibitor (1-deoxygalactonojirimycin, DGJ to germinating winter vetch (Vicia villosa Roth. seeds, containing more galactosyl pinitols than RFOs. The breakdown of RFOs but not that of GPs was completely blocked in both embryonic axes and cotyledons tissues, during the first 18 h of imbibition in DGJ. The inhibitor only decreased the rate of GPs degradation. The inhibitory effect of DGJ on GPs degradation was partially alleviated by addition of sucrose or galactose to DGJ solutions. After three days of germination in water, RFOs and GPs disappeared in axial tissues of seeds imbibed in water, galactose or sucrose. Eighteen-hour imbibition of seeds in DGJ drastically reduced germination, by ca 50%, during the first three days. The inhibitory effect of DGJ decreased during the next seven days of germination. The presence of galactose or sucrose in imbibition solution initially stimulated seed germination, but later this effect was not statistically significant. Our study provides clear evidence that galactosyl pinitols play an important role in early winter vetch seeds germination. Additionally, we suggest that galactosyl pinitols can replace RFOs as reserve material necessary for early germination.
Directory of Open Access Journals (Sweden)
Adrian J Tett
Full Text Available Salicylic acid is an important signalling molecule in plant-microbe defence and symbiosis. We analysed the transcriptional responses of the nitrogen fixing plant symbiont, Rhizobium leguminosarum bv viciae 3841 to salicylic acid. Two MFS-type multicomponent efflux systems were induced in response to salicylic acid, rmrAB and the hitherto undescribed system salRAB. Based on sequence similarity salA and salB encode a membrane fusion and inner membrane protein respectively. salAB are positively regulated by the LysR regulator SalR. Disruption of salA significantly increased the sensitivity of the mutant to salicylic acid, while disruption of rmrA did not. A salA/rmrA double mutation did not have increased sensitivity relative to the salA mutant. Pea plants nodulated by salA or rmrA strains did not have altered nodule number or nitrogen fixation rates, consistent with weak expression of salA in the rhizosphere and in nodule bacteria. However, BLAST analysis revealed seventeen putative efflux systems in Rlv3841 and several of these were highly differentially expressed during rhizosphere colonisation, host infection and bacteroid differentiation. This suggests they have an integral role in symbiosis with host plants.
Kiarie, E; Lopez, P; Furedi, C; Nyachoti, C M
2013-04-01
Application of alternative feedstuffs in swine diets will be dependent on characterization of their nutritive value. In 2 experiments, we determined the AA and energy utilization of Manitoba-grown zero-tannin faba beans (ZTFB) and co-fermented wheat and corn dried distillers grains with solubles (wcDDGS). Corn dried distillers grains with solubles (cDDGS) was also included for comparison. In Exp. 1, 6 ileal cannulated barrows (29.3 ± 1.3 kg) were fed 3 diets in a replicated 3 × 3 Latin square design to determine the apparent (AID) and standardized (SID) ileal digestibility of AA. The 3 diets contained ZTFB, wcDDGS, or cDDGS as the sole source of AA. The SID of N and AA were calculated using published values for ileal endogenous N and AA losses from our laboratory. In Exp. 2, 12 intact barrows (22.5 ± 1.1 kg) were fed 4 diets in a two 15-d period crossover design to determine DE and ME contents of the test ingredients by difference method. The diets were a basal corn-based diet or the basal diet with corn replaced by 46% ZTFB, wcDDGS, or cDDGS. The concentrations (DM basis) of GE (kcal/kg), CP (%), and Lys (%) in ZTFB were 4,144, 27, and 1.6, respectively, and corresponding values for wcDDGS were 5,112, 31, and 0.8. The ZTFB had greater (P content (g/kg DM) of Lys in ZTFB (13.5) was greater (P contents of sulfur AA (Met and Cys) compared with ZTFB. The ME content (kcal/kg DM) of ZTFB (3,548) was less (P content of wcDDGS (3,669) was similar to that of ZTFB or cDDGS. The results showed that ZTFB has greater digestible Lys whereas wcDDGS has greater digestible sulfur AA but both ingredients have comparable ME content. Therefore, a blend of these 2 ingredients can serve as an excellent source of AA and energy for swine.
Struck, Christine; Ernst, Michael; Hahn, Matthias
2002-01-01
summary In the rust fungus Uromyces fabae, invasion of the host plant and haustorium formation are accompanied by the activation of many genes (PIGs =in planta induced genes). In addition to the previously described AAT2 (PIG2), AAT1 (PIG27) was found to encode a protein with a high similarity to fungal amino acid permeases. AAT1 transcripts are present in germinated hyphae and throughout the mycelium later in the infection process, but occur at the highest levels in haustoria. Expression of AAT1p in a histidine uptake-defective yeast mutant revealed energy-dependent transport of (14)C-histidine, with a K(M) value of 25.8 microm. In addition, complementation analysis revealed AAT1-dependent transport for lysine. Using Xenopus oocytes as expression system, AAT1p-dependent symport of protons with a broad spectrum of amino acids was observed, with the highest activities obtained with histidine and lysine. These results confirm that in rust fungi, the expression of amino acid transporters is developmentally regulated and occurs preferentially in the parasitic phase of development.
Directory of Open Access Journals (Sweden)
Rafael Almeida Fighera
2005-04-01
Full Text Available Descrevem-se as lesões cutâneas macroscópicas em 10 e histológicas em 8 vacas afetadas por doença granulomatosa sistêmica associada ao pastoreio de ervilhaca (Vicia spp.. Em todos os casos, as lesões cutâneas eram caracterizadas por múltiplas áreas coalescentes de alopecia, liquenificação e descamação. Os locais mais atingidos pela lesão de pele foram: cabeça e pescoço (10/10, tronco (4/10, períneo (3/10 e mama (2/10. Em todos os 8 casos avaliados histologicamente, as lesões se caracterizavam por dermatite perivascular superficial granulomatosa de intensidade variável. Outros achados histológicos incluíram dermatite perivascular profunda (1/8, perifoliculite (2/8, foliculite mural (3/8, hiperqueratose ortoqueratótica compacta (6/8, erosões (1/8, úlceras (2/8, microabscessos de Munro (8/8, crostas serocelulares (1/8, espongiose (4/8, degeneração hidrópica (5/8, acantólise (1/8, corpúsculos de Civatte (2/8, exocitose linfoplasmocitária (6/8, edema superficial (6/8, incontinência pigmentar (2/8, basofilia (6/8 e mineralização distrófica do colágeno (2/8, tumefação do núcleo das células endoteliais (8/8 e ectasia de glândulas sudoríparas (8/8.Gross and histopathological lesions in the skin of respectively 10 and 8 cows affected with systemic granulomatous disease associated with pasturing vetch (Vicia spp. are described. In all cases, the cutaneous lesions were characterized by multiple coalescent areas of alopecia, lichenification and desquamation. More frequently affected sites were the skin covering the head and neck (10/10, trunk (4/10, escutcheon (3/10 and mammary gland (2/10. In all 8 histologically examined cases the lesions were characterized by superficial perivascular granulomatous dermatitis of varying intensity. Other histological findings included deep perivascular dermatitis (1/8, perifoliculitis (2/8, mural foliculitis (3/8, compact orthokeratotic hyperkeratosis (6/8, erosions (1/8, ulcers (2
Peet-Schwering, van der C.M.C.; Binnendijk, G.P.; Diepen, van J.T.M.
2011-01-01
At the Experimental Farm Raalte, the nutrient composition, digestibiltiy and energy value of canola protein concentrate, pea protein concentrate, wheat gluten meal and vicia faba protein concentrate were investigated in organically housed piglets. The results are described in this report.
DEFF Research Database (Denmark)
Yánez-Ruiz, David R; Martin-Garcia, Antonio I; Weisbjerg, Martin Riis
2009-01-01
The potential of different legume seeds species, including recently new developed varieties (Vicia faba: a commercial variety and varieties Alameda, Palacio and Baraka; Lupinus angustifolius; Pisum sativum and Cicer arietinum: varieties Fardon and Zegr ) as protein supplements to low quality...
African Journals Online (AJOL)
Uromyces viciae-fabae) with Environmental Factors and Cultural Practices in the Hararghe Highlands, Eastern Ethiopia Abstract. ISSN: 1992-0407. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...
DEFF Research Database (Denmark)
2014-01-01
The anti-reenactment 'Show-Bix &' consists of 5 dias projectors, a dial phone, quintophonic sound, and interactive elements. A responsive interface will enable the Dias projectors to show copies of original dias slides from the Show-Bix piece ”March på Stedet”, 265 images in total. The copies...... are made from digital scans of the original dias slides located in the collection of the Museum of Contemporary Art in Roskilde. In front of the audience entering the space and placed on it’s own stand, is an original 60s style telephone with turning dial. Action begins when the audience lift the phone...... and dial a number. Any number will make the Dias change. All numbers are also assigned to specific sound documents: clips form rare interviews and the complete sound-re-enactment of the Show-Bix piece ‘Omringning’ (‘Surrounding’) in five channels (a quintophonie). This was originally produced...
DEFF Research Database (Denmark)
2013-01-01
Fredag d. 1 november blev Kunsthal Charlottenborg indtaget af performanceprogrammet Show & Tell med et bredspektret program af danske og internationale kunstnere indenfor performance-, lyd- og installationskunst. Programmet præsenterer værker, der undersøger kroppens stadig mere symbiotiske forhold...... og studienævnet på Performance-design. Show & Tell - Performance program: kl. 16.30-19 Adresse: Kunsthal Charlottenborg, Nyhavn 2, 1051 København K...
Directory of Open Access Journals (Sweden)
Tambalo Dinah D
2010-08-01
Full Text Available Abstract Background Rhizobium leguminosarum bv. viciae establishes symbiotic nitrogen fixing partnerships with plant species belonging to the Tribe Vicieae, which includes the genera Vicia, Lathyrus, Pisum and Lens. Motility and chemotaxis are important in the ecology of R. leguminosarum to provide a competitive advantage during the early steps of nodulation, but the mechanisms of motility and flagellar assembly remain poorly studied. This paper addresses the role of the seven flagellin genes in producing a functional flagellum. Results R. leguminosarum strains 3841 and VF39SM have seven flagellin genes (flaA, flaB, flaC, flaD, flaE, flaH, and flaG, which are transcribed separately. The predicted flagellins of 3841 are highly similar or identical to the corresponding flagellins in VF39SM. flaA, flaB, flaC, and flaD are in tandem array and are located in the main flagellar gene cluster. flaH and flaG are located outside of the flagellar/motility region while flaE is plasmid-borne. Five flagellin subunits (FlaA, FlaB, FlaC, FlaE, and FlaG are highly similar to each other, whereas FlaD and FlaH are more distantly related. All flagellins exhibit conserved amino acid residues at the N- and C-terminal ends and are variable in the central regions. Strain 3841 has 1-3 plain subpolar flagella while strain VF39SM exhibits 4-7 plain peritrichous flagella. Three flagellins (FlaA/B/C and five flagellins (FlaA/B/C/E/G were detected by mass spectrometry in the flagellar filaments of strains 3841 and VF39SM, respectively. Mutation of flaA resulted in non-motile VF39SM and extremely reduced motility in 3841. Individual mutations of flaB and flaC resulted in shorter flagellar filaments and consequently reduced swimming and swarming motility for both strains. Mutant VF39SM strains carrying individual mutations in flaD, flaE, flaH, and flaG were not significantly affected in motility and filament morphology. The flagellar filament and the motility of 3841 strains
Struck, Christine; Siebels, Claudia; Rommel, Oliver; Wernitz, Marcus; Hahn, Matthias
1998-01-01
To study the molecular basis of biotrophic nutrient uptake by plant parasitic rust fungi, the gene (Uf-PMA1) encoding the plasma membrane H+-ATPase from Uromyces fabae was isolated. Uf-PMA1 exists probably as a single gene. However, two nearly identical sequences were identified; the similarity apparently is due to two Uf-PMA1 alleles in the dikaryotic hyphae. Multiple Uf-PMA1 transcripts were observed during early rust development, and reduced amounts of a single Uf-PMA1 mRNA were observed i...
Directory of Open Access Journals (Sweden)
Wanda Wojciechowska
2014-01-01
Full Text Available Each of the examined species of the tribe Vicieae (Vicia faba, V. sativa, V, villosa, Lathyrus silvester, L. pratensis and Pisum sativum has its peculiar characteristic development rhythm of the bud. A similarity has been demonstrated between the development rhythms of flower buds of Vicia faba and Pisum sativum. It was found that mature flowers of autogamous species had long calyces, whereas those of the allogamous species were short as compared with the petals of the corolla.
DEFF Research Database (Denmark)
Sandvik, Kjetil; Laursen, Ditte
2014-01-01
User interaction with radio and television programmes is not a new thing. However, with new cross-media production concepts such as X Factor and Voice, this is changing dramatically. The second-screen logic of these productions encourages viewers, along with TV’s traditional one-way communication...... mode, to communicate on interactive (dialogue-enabling) devices such as laptops, smartphones and tablets. Using the TV show Voice as our example, this article shows how the technological and situational set-up of the production invites viewers to engage in new ways of interaction and communication....... More specifically, the article demonstrates how online comments posted on the day of Voice’s 2012 season finale can be grouped into four basic action types: (1) Invitation to consume content, (2) Request for participation, (3) Request for collaboration and (4) Online commenting. These action types...
Rezende, José Francisco; UNIGRANRIO / PPGA; Mello, Simone; UNIGRANRIO
2016-01-01
O caso de ensino apresenta a trajetória de Alexandre Tadeu da Costa e da chocolateria Cacau Show. Seu objetivo é levar os estudantes a identificar alternativas e tomar decisões sobre posicionamento para continuidade do desenvolvimento de vantagens competitivas, sustentação de competência logística e possíveis abordagens ao mercado externo.
Boden, Timothy W
2016-01-01
Many medical practices have cut back on education and staff development expenses, especially those costs associated with conventions and conferences. But there are hard-to-value returns on your investment in these live events--beyond the obvious benefits of acquired knowledge and skills. Major vendors still exhibit their services and wares at many events, and the exhibit hall is a treasure-house of information and resources for the savvy physician or administrator. Make and stick to a purposeful plan to exploit the trade show. You can compare products, gain new insights and ideas, and even negotiate better deals with representatives anxious to realize returns on their exhibition investments.
Energy Technology Data Exchange (ETDEWEB)
Kafel, Alina, E-mail: akafel@us.edu.pl [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland); Nadgorska-Socha, Aleksandra [University of Silesia, Department of Ecology, Bankowa 9, PL 40-007, Katowice (Poland); Gospodarek, Janina [Agricultural University of Krakow, Department of Agricultural Environment Protection, Mickiewicza 21, PL 31-120, Krakow (Poland); Babczynska, Agnieszka; Skowronek, Magda [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland); Kandziora, Marta [University of Silesia, Department of Ecology, Bankowa 9, PL 40-007, Katowice (Poland); Rozpedek, Katarzyna [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland)
2010-02-01
The purpose of this study was to explore a possible relationship between the soil availability of metals and their concentrations in various parts of Philadelphuscoronarius plants. Moreover, the possible impact of an aphid infestation on the contamination and antioxidant response of plants from the urban environment of Krakow and the reference rural area of Zagaje Stradowskie (southern Poland) was analyzed. The contents of the glutathione, proline, non-protein - SH groups, antioxidants, and phosphorous and the levels of guaiacol peroxidase and catalase activity in leaves and shoots either infested or not by the aphid Aphis fabae Scop., were measured. The potential bioavailability of metals (Cd; Cu; Ni; Pb; Zn) in the soil and their concentrations in P. coronarius plants originating from both sites were compared. The antioxidant responses were generally elevated in the plants in the polluted area. Such reactions were additionally changed by aphid infestation. Generally, the concentrations of metals in the HNO{sub 3} and CaCl{sub 2} extractants of the soils from two layers at the 0-20 and 20-40 cm depths from the polluted area were higher than in those from the reference area. Such differences were found for nickel and lead (in all examined extractants), zinc (in soil extractants from the layer at 20-40 cm) and cadmium (in HNO{sub 3} extractants). Significant positive relationships between the lead concentrations in the soil and in the plants were found. In the parts of plants from the polluted area, higher concentrations of Pb and Zn (leaves and shoots) and Cd (shoots) were recorded. The shoots and leaves of plants infested with aphids had higher concentrations of Zn but lower Pb. Moreover, their leaves had higher contaminations of Cu and Ni. In conclusion, aphids affected not only the antioxidant response of the plants but also their contamination with metals, especially contamination of the leaves.
Directory of Open Access Journals (Sweden)
Denise Koufogiannakis
2009-06-01
Full Text Available When Su Cleyle and I first decided to start Evidence Based Library and Information Practice, one of the things we agreed upon immediately was that the journal be open access. We knew that a major obstacle to librarians using the research literature was that they did not have access to the research literature. Although Su and I are both academic librarians who can access a wide variety of library and information literature from our institutions, we belong to a profession where not everyone has equal access to the research in our field. Without such access to our own body of literature, how can we ever hope for practitioners to use research evidence in their decision making? It would have been contradictory to the principles of evidence based library and information practice to do otherwise.One of the specific groups we thought could use such an open access venue for discovering research literature was school librarians. School librarians are often isolated and lacking access to the research literature that may help them prove to stakeholders the importance of their libraries and their role within schools. Certainly, school libraries have been in decline and the use of evidence to show value is needed. As Ken Haycock noted in his 2003 report, The Crisis in Canada’s School Libraries: The Case for Reform and Reinvestment, “Across the country, teacher-librarians are losing their jobs or being reassigned. Collections are becoming depleted owing to budget cuts. Some principals believe that in the age of the Internet and the classroom workstation, the school library is an artifact” (9. Within this context, school librarians are looking to our research literature for evidence of the impact that school library programs have on learning outcomes and student success. They are integrating that evidence into their practice, and reflecting upon what can be improved locally. They are focusing on students and showing the impact of school libraries and
Directory of Open Access Journals (Sweden)
Verheggen F.
2009-01-01
Full Text Available Aphid – ant mutualism: an outdoor study of the benefits for Aphis fabae. Aphid – ant relationships are common examples of mutualism. Aphids are indeed submitted to predation and therefore require protection, while ants are continuously looking for new sugar sources. The present work aimed to study the benefits that a mutualistic relationship with Lasius niger (Hymenoptera, Formicidae could bring to the black bean aphid Aphis fabae (Homoptera, Aphididae. Several parameters were observed in the field, on broad bean plants infested with an initial amount of 100 A. fabae and in presence or not of a L. niger colony. More aphids were observed on plants being visited by ants as well as a higher proportion of winged individuals. One explanation is that fewer predators were observed on plants being visited by ants, demonstrating their protective role. However, the number of parasitized aphids was not reduced in presence of L. niger. On the other hand, fewer different aphid species were present on plants foraged by ants, what suggests that they could exert a predation on unattended aphids. Our observations do not allow to conclude on any impact of L. niger on the fitness of the aphid host plant, although fewer exuvia and honeydew spots were observed when they were present. All these results confirm that L. niger increase the fitness of A. fabae colonies mainly by decreasing the number of predators and by reducing competition from aphid species unattended by ants.
Ensiling on chemical composition and in vitro fermentation in rabbits of different forages
Directory of Open Access Journals (Sweden)
Juan Carlos Angeles Hernandez
Full Text Available ABSTRACT: The effect of chemical composition of silages on in vitro gas fermentation profiles in rabbits was examined. The study was performed using 7 silages: beans (Phaseolus vulgaris, faba bean (FB, Vicia faba, common vetch (CV, Vicia sativa, ryegrass (Lolium perenne, barley (B, Hordeum vulgare, barley with common vetch (BCV and barley with faba bean (BFB. We used 3 New Zealand White (NZW rabbits as donors of caecal content in each incubation run (n=3. Data were analyzed in a completely randomized experimental design. The CV silage showed higher values of crude protein (CP, followed by FB and bean silages (P<0.001. Barley silage had the lowest CP content (96g kg-1 DM (P=0.001. The NDF and ADF content were lower (P<0.001 for beans and CV compared with the rest of the forage silages. Ryegrass silage had higher values of dry matter degradation, organic matter degradation, relative GP and SCFA (P<0.001. The highest values of digestible energy were for CV and bean silages (P<0.001. Ryegrass and CV silages showed higher levels in GP parameters, which could be associated with their better chemical composition characteristics, mainly protein and fiber content.
Greffeuille, Valérie; Marsset-Baglieri, Agnès; Molinari, Nicolas; Cassan, Denis; Sutra, Thibault; Avignon, Antoine; Micard, Valérie
2015-09-01
Enrichment of durum wheat pasta with legume flour enhances their protein and essential amino acid content, especially lysine content. However, despite its nutritional potential, the addition of a legume alters the rheological properties of pasta. High temperature drying of pasta reduces this negative effect by strengthening its protein network. The aim of our study was to determine if these changes in the pasta structure alter its in vitro carbohydrate digestibility, in vivo glycemic, insulin and satiety responses. We also investigated if high temperature drying of pasta can reduce the well-known digestive discomfort associated with the consumption of legume grains. Fifteen healthy volunteers consumed three test meals: durum wheat pasta dried at a low temperature (control), and pasta enriched with 35% faba bean dried at a low and at a very high temperature. When enriched with 35% legume flour, pasta maintained its nutritionally valuable low glycemic and insulin index, despite its weaker protein network. Drying 35% faba bean pasta at a high temperature strengthened its protein network, and decreased its in vitro carbohydrate digestion with no further decrease in its in vivo glycemic or insulin index. Drying pasta at a very high temperature reduced digestive discomfort and enhanced self-reported satiety, and was not associated with a modification of energy intake in the following meal.
Isabella, Vincent M; Clark, Virginia L
2011-10-01
Transcriptome analysis of the facultative anaerobe, Neisseria gonorrhoeae, revealed that many genes of unknown function were induced under anaerobic conditions. Mutation of one such gene, NGO1024, encoding a protein belonging to the 2-nitropropane dioxygenase-like superfamily of proteins, was found to result in an inability of gonococci to grow anaerobically. Anaerobic growth of an NG1024 mutant was restored upon supplementation with unsaturated fatty acids (UFA), but not with the saturated fatty acid palmitate. Gonococcal fatty acid profiles confirmed that NGO1024 was involved in UFA synthesis anaerobically, but not aerobically, demonstrating that gonococci contain two distinct pathways for the production of UFAs, with a yet unidentified aerobic mechanism, and an anaerobic mechanism involving NGO1024. Expression of genes involved in classical anaerobic UFA synthesis, fabA, fabM and fabB, was toxic in gonococci and unable to complement a NGO1024 mutation, suggesting that the chemistry involved in gonococcal anaerobic UFA synthesis is distinct from that of the classical pathway. NGO1024 homologues, which we suggest naming UfaA, form a distinct lineage within the 2-nitropropane dioxygenase-like superfamily, and are found in many facultative and obligate anaerobes that produce UFAs but lack fabA, suggesting that UfaA is part of a widespread pathway involved in UFA synthesis. © 2011 Blackwell Publishing Ltd.
African Journals Online (AJOL)
ACSS
as a percentage of the mean (GAM) and heritability were estimated using variance components. Phenotypic. Coefficient of Variation ... exhibited moderate GCV values. Broad and narrow sense heritability estimates for GRD disease score ..... in some faba bean genotypes (Vicia faba L.) grown in Northwestern Ethiopia.
Santé et diversité alimentaire au Yémen | IDRC - International ...
International Development Research Centre (IDRC) Digital Library (Canada)
Review report : health and dietary diversity in Yemen; traditional Yemeni rural diets and local food systems: enhancing contributions to health and environment. Studies. Estimation genetic variation in faba bean (Vicia faba L.) landraces in Yemen : a thesis. Reports. Health and dietary diversity in Yemen : traditional Yemeni ...
Effect of Environment on Protein, Mineral and Fat Composition of ...
African Journals Online (AJOL)
BACKGROUND: Faba bean (Vicia faba L.) is one of the most important high land pulse crops of Ethiopia. It is an excellent source of protein supplement for the majority of the population, used in various popular Ethiopian dishes. It also contains fat and appreciable amount of minerals. Data on the effect of environment on the ...
South African Journal of Animal Science - Vol 25, No 2 (1995)
African Journals Online (AJOL)
Evaluation of faba beans (Vicia faba cv. Fiord) and sweet lupins (Lupizus albus cv. Kiev) as protein sources for growing pigs · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.S Brand, R.C. Olckers, J.P. van der Merwe, 31-35 ...
African Journals Online (AJOL)
Items 101 - 106 of 106 ... Vol 27, No 2 (2017), Vermicompost application as affected by Rhizobium inoculation on nodulation and yield of Faba bean (Vicia Faba L.) Abstract PDF. Anteneh Argaw, Abere Mnalku. Vol 27, No 2 (2017), Vulnerability of smallholder farmers to climate change in the central rift valley of Ethiopia: a ...
African Journals Online (AJOL)
sunflower genotypes (Helianthus annuus L.) to different concentrations of sodium chloride, Helia,. Vol. 22 (30) ... Ion uptake, osmoregulation and plant-water relations in faba beans (Vicia faba L.) under salt stress, Die ... assimilates by wheat as affected by nitrogen source and salinity, Agronomy Journal, Vol. 85, 1044-1049.
The use of reproductive vigor descriptors in studying genetic ...
African Journals Online (AJOL)
A collection of nine Tunisian faba bean (Vicia faba) populations belonging to three botanical classes (Var. minor, var. equina and var. major) was evaluated using twenty seven agro-morphological traits. Analysis of variance, correlation coefficients and principal components analysis (PCA) were performed based on MVSP ...
Nutritional, eco-physiological and symbiotic characteristics of ...
African Journals Online (AJOL)
Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of Ethiopia. A total of hundred rhizobial isolates were ...
Stomata prioritize their responses to multiple biotic and abiotic signal inputs.
Directory of Open Access Journals (Sweden)
Xiaobin Ou
Full Text Available Stomata are microscopic pores in leaf epidermis that regulate gas exchange between plants and the environment. Being natural openings on the leaf surface, stomata also serve as ports for the invasion of foliar pathogenic bacteria. Each stomatal pore is enclosed by a pair of guard cells that are able to sense a wide spectrum of biotic and abiotic stresses and respond by precisely adjusting the pore width. However, it is not clear whether stomatal responses to simultaneously imposed biotic and abiotic signals are mutually dependent on each other. Here we show that a genetically engineered Escherichia coli strain DH5α could trigger stomatal closure in Vicia faba, an innate immune response that might depend on NADPH oxidase-mediated ROS burst. DH5α-induced stomatal closure could be abolished or disguised under certain environmental conditions like low [CO2], darkness, and drought, etc. Foliar spraying of high concentrations of ABA could reduce stomatal aperture in high humidity-treated faba bean plants. Consistently, the aggressive multiplication of DH5α bacteria in Vicia faba leaves under high humidity could be alleviated by exogenous application of ABA. Our data suggest that a successful colonization of bacteria on the leaf surface is correlated with stomatal aperture regulation by a specific set of environmental factors.
evaluation of pathogenic isolates in ethiopia for the control of ...
African Journals Online (AJOL)
Administrator
Key Words: Bacillus spp., Biocontrol, Botrytis fabae, Ethiopia. RÉSUMÉ. Le haricot faba (Vicia faba L.) est l'un des premiers domestiqués légumineuses alimentaires en Ethiopie et en est maintenant cultivé sur de grandes superficies dans de nombreux pays. La production de plant est toutefois limitée par des infections de ...
Directory of Open Access Journals (Sweden)
Žvagiņa Signe
2015-11-01
Full Text Available Rhizobium leguminosarum biovar viciae ir augsnes baktērija, kas spēj veidot gumiņus uz zirņu, pupu, lēcu un vīķu saknēm un saistīt atmosfēras slāpekli simbiozē ar augiem. Gumiņbaktērijas izmanto lauksaimniecībā kā bioloģiskus mēslošanas līdzekļus augu augšanas veicināšanai. Komerciālos gumiņbaktēriju preparātus var iegādāties sausā, šķidrā vai liofilizētā formā. Parasti izmanto sausos sagatavotos mēslošanas līdzekļus uz kūdras bāzes. Šī pētījuma mērķis bija imobilizēt R. leguminosarum un noteikt tās dzīvotspēju šķidrumā un dažādos nesējmateriālos, lai izstrādātu uzlabotus gumiņbaktēriju preparātus. Imobilizēšanai izmantoja piecus sterilizētus materiālus: kūdru, māla pulveri, divu veidu ovālus šūnainās keramikas agregātus un cilindriskas keramikas granulas, kas izgatavotas no Planču depozīta Devona perioda māla. Imobilizāciju veica 2,5 stundu laikā 20 °C temperatūrā. Vēlāk kūdru, pulveri un granulas noberza un sasmalcināja ūdenī ar sterilu piestiņu, lai atdalītu pielipušās baktērijas. Baktēriju kolonijas veidojošo vienību skaitu noteica, izsējot iegūto suspensiju atšķaidījumus Petri traukos ar agarizētu barotni. Dzīvotspēju noteica arī ar LIVE/DEAD epifluorescences metodi. Iegūtie rezultāti parādīja, ka nesējmateriāls ietekmē imobilizācijas sekmes un ka uzglabāšanas temperatūra ietekmē R. leguminosarum dzīvotspēju. Vislabākos rezultātus ieguva, uzglabājot baktērijas suspensijā vai imobilizējot uz kūdras. Rekomendējam uzglabāt R. leguminosarum produktus −18 °C vai 4 °C temperatūrā.
African Journals Online (AJOL)
STORAGESEVER
2009-10-19
Oct 19, 2009 ... This study was carried to determine the best seed mixture of vetch and triticale for East Mediterranean rainfed conditions of Turkey. The experiments were conducted in two locations, Adana and Kozan, during the years of 2003 - 2005. The field trials were arranged in a randomised block design with three.
Singh, Ashima; Pandey, Jitendra
2012-08-01
Pot-culture experiments showed that organically grown Vicia faba, influenced by atmospheric deposition, accumulated (μg g(-1)) 0.088-3.246 Cadmium, 0.19-42.48 Chromium, 0.0124-30.43 Copper, 0.075-4.28 Lead and 0.63-67.68 Zinc. Similar trends appeared for Abelmoschus esculentus. At high deposition sites, Cadmium, Lead and Zinc exceeded the safe limits of Prevention of Food Adulteration standards. Health risk index for Cadmium, Copper and Lead exceeded the safe limits of United States Environmental Protection Agency. The study suggests that atmospheric deposition could substantially elevate metal levels in organically grown vegetables in 2011.
Cantoral, R; Fernández-Quintela, A; Martínez, J A; Macarulla, M T
1995-09-01
The nutritional properties of three legumes: pea (Pisum sativum), faba bean (Vicia faba) and soya (Glycine max) have been characterized. From these seeds, protein concentrates were elaborated by wet processing and two different procedures of drying were followed (freeze-drying and alcohol washing). The composition and content of several antinutritional factors (phytates, tannins, trypsin inhibitors and lectins) were assessed in all of them. Also some functional properties regarding their potential use in food technology were evaluated, such as protein solubility at different pH, as well as water and oil absorption capacities. All the obtained concentrates showed high protein contents, nevertheless protein extraction efficiency was smaller in alcohol-washed concentrates than in the lyophilized ones. In the other hand, the concentrates obtained from pea and faba bean showed higher yields than those obtained from soya. The content of antinutritional factors were markedly reduced after the concentration process. Furthermore, the functional properties of pea and faba bean protein concentrates point out their suitability for food preparation as previously reported for soya.
Oliveira, Maria Cristina Ornelas
2016-01-01
Tese de mestrado, Microbiologia Aplicada, Universidade de Lisboa, Faculdade de Ciências, 2016 O Filo Glomeromycota compreende um grupo de fungos que se considera no geral serem biotróficos obrigatórios e que se associam a cerca de 80% das plantas. O fungo e a planta formam uma associação simbiótica conhecida como micorriza arbuscular. Desta associação, o fungo absorve entre 5 a 20% do carbono fotossintetizado pela planta e por outro lado a planta pode beneficiar do aumento da absorção de n...
Granzow, Sandra; Kaiser, Kristin; Wemheuer, Bernd; Pfeiffer, Birgit; Daniel, Rolf; Vidal, Stefan; Wemheuer, Franziska
2017-01-01
Many bacteria and fungi in the plant rhizosphere and endosphere are beneficial to plant nutrient acquisition, health, and growth. Although playing essential roles in ecosystem functioning, our knowledge about the effects of multiple cropping regimes on the plant microbiome and their interactions is still limited. Here, we designed a pot experiment simulating different cropping regimes. For this purpose, wheat and faba bean plants were grown under controlled greenhouse conditions in monocultures and in two intercropping regimes: row and mixed intercropping. Bacterial and fungal communities in bulk and rhizosphere soils as well as in the roots and aerial plant parts were analyzed using large-scale metabarcoding. We detected differences in microbial richness and diversity between the cropping regimes. Generally, observed effects were attributed to differences between mixed and row intercropping or mixed intercropping and monoculture. Bacterial and fungal diversity were significantly higher in bulk soil samples of wheat and faba bean grown in mixed compared to row intercropping. Moreover, microbial communities varied between crop species and plant compartments resulting in different responses of these communities toward cropping regimes. Leaf endophytes were not affected by cropping regime but bacterial and fungal community structures in bulk and rhizosphere soil as well as fungal community structures in roots. We further recorded highly complex changes in microbial interactions. The number of negative inter-domain correlations between fungi and bacteria decreased in bulk and rhizosphere soil in intercropping regimes compared to monocultures due to beneficial effects. In addition, we observed plant species-dependent differences indicating that intra- and interspecific competition between plants had different effects on the plant species and thus on their associated microbial communities. To our knowledge, this is the first study investigating microbial communities in
Directory of Open Access Journals (Sweden)
Sandra Granzow
2017-05-01
Full Text Available Many bacteria and fungi in the plant rhizosphere and endosphere are beneficial to plant nutrient acquisition, health, and growth. Although playing essential roles in ecosystem functioning, our knowledge about the effects of multiple cropping regimes on the plant microbiome and their interactions is still limited. Here, we designed a pot experiment simulating different cropping regimes. For this purpose, wheat and faba bean plants were grown under controlled greenhouse conditions in monocultures and in two intercropping regimes: row and mixed intercropping. Bacterial and fungal communities in bulk and rhizosphere soils as well as in the roots and aerial plant parts were analyzed using large-scale metabarcoding. We detected differences in microbial richness and diversity between the cropping regimes. Generally, observed effects were attributed to differences between mixed and row intercropping or mixed intercropping and monoculture. Bacterial and fungal diversity were significantly higher in bulk soil samples of wheat and faba bean grown in mixed compared to row intercropping. Moreover, microbial communities varied between crop species and plant compartments resulting in different responses of these communities toward cropping regimes. Leaf endophytes were not affected by cropping regime but bacterial and fungal community structures in bulk and rhizosphere soil as well as fungal community structures in roots. We further recorded highly complex changes in microbial interactions. The number of negative inter-domain correlations between fungi and bacteria decreased in bulk and rhizosphere soil in intercropping regimes compared to monocultures due to beneficial effects. In addition, we observed plant species-dependent differences indicating that intra- and interspecific competition between plants had different effects on the plant species and thus on their associated microbial communities. To our knowledge, this is the first study investigating
Directory of Open Access Journals (Sweden)
Zhipeng Liu
2014-05-01
Full Text Available The common vetch (Vicia sativa subsp. sativa, a self-pollinating and diploid species, is one of the most important annual legumes in the world due to its short growth period, high nutritional value, and multiple usages as hay, grain, silage, and green manure. The available simple sequence repeat (SSR markers for common vetch, however, are insufficient to meet the developing demand for genetic and molecular research on this important species. Here, we aimed to develop and characterise several polymorphic EST-SSR markers from the vetch Illumina transcriptome. A total number of 1,071 potential EST-SSR markers were identified from 1025 unigenes whose lengths were greater than 1,000 bp, and 450 primer pairs were then designed and synthesized. Finally, 95 polymorphic primer pairs were developed for the 10 common vetch accessions, which included 50 individuals. Among the 95 EST-SSR markers, the number of alleles ranged from three to 13, and the polymorphism information content values ranged from 0.09 to 0.98. The observed heterozygosity values ranged from 0.00 to 1.00, and the expected heterozygosity values ranged from 0.11 to 0.98. These 95 EST-SSR markers developed from the vetch Illumina transcriptome could greatly promote the development of genetic and molecular breeding studies pertaining to in this species.
Benveniste, Irène; Bronner, Roberte; Wang, Yong; Compagnon, Vincent; Michler, Pierre; Schreiber, Lukas; Salaün, Jean-Pierre; Durst, Francis; Pinot, Franck
2005-08-01
CYP94A1 is a cytochrome P450 (P450) catalyzing fatty acid (FA) omega-hydroxylation in Vicia sativa seedlings. To study the physiological role of this FA monooxygenase, we report here on its regulation at the transcriptional level (Northern blot). Transcripts of CYP94A1, as those of two other P450-dependent FA hydroxylases (CYP94A2 and CYP94A3) from V. sativa, are barely detectable during the early development of the seedlings. CYP94A1 transcripts, in contrast to those of the two other isoforms, are rapidly (less than 20 min) and strongly (more than 100 times) enhanced after treatment by clofibrate, an hypolipidemic drug in animals and an antiauxin (p-chlorophenoxyisobutyric acid) in plants, by auxins (2,4-dichlorophenoxyacetic acid and indole-3-acetic acid), by an inactive auxin analog (2,3-dichlorophenoxyacetic acid), and also by salicylic acid. All these compounds activate CYP94A1 transcription only at high concentrations (50-500 microM range). In parallel, these high levels of clofibrate and auxins modify seedling growth and development. Therefore, the expression of CYP94A1 under these conditions and the concomitant morphological and cytological modifications would suggest the implication of this P450 in a process of plant defense against chemical injury.
Long, Benedict M; Bahar, Nur H A; Atkin, Owen K
2015-11-01
In intact leaves, mitochondrial populations are highly heterogeneous among contrasting cell types; how such contrasting populations respond to sustained changes in the environment remains, however, unclear. Here, we examined respiratory rates, mitochondrial protein composition and response to growth temperature in photosynthetic (mesophyll) and non-photosynthetic (epidermal) cells from fully expanded leaves of warm-developed (WD) and cold-developed (CD) broad bean (Vicia faba L.). Rates of respiration were significantly higher in mesophyll cell protoplasts (MCPs) than epidermal cell protoplasts (ECPs), with both protoplast types exhibiting capacity for cytochrome and alternative oxidase activity. Compared with ECPs, MCPs contained greater relative quantities of porin, suggesting higher mitochondrial surface area in mesophyll cells. Nevertheless, the relative quantities of respiratory proteins (normalized to porin) were similar in MCPs and ECPs, suggesting that ECPs have lower numbers of mitochondria yet similar protein complement to MCP mitochondria (albeit with lower abundance serine hydroxymethyltransferase). Several mitochondrial proteins (both non-photorespiratory and photorespiratory) exhibited an increased abundance in response to cold in both protoplast types. Based on estimates of individual protoplast respiration rates, combined with leaf cell abundance data, epidermal cells make a small but significant (2%) contribution to overall leaf respiration which increases twofold in the cold. Taken together, our data highlight the heterogeneous nature of mitochondrial populations in leaves, both among contrasting cell types and in how those populations respond to growth temperature. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
M.E. Abd El-Hack
2017-02-01
Full Text Available An experiment was conducted with 160 Hisex Brown laying hens to evaluate the effect of different inclusion levels of faba bean (FB and enzyme supplementation on productive performance and egg quality parameters. The experimental diets consisted of five levels of FB: 0% (control, 25%, 50%, 75% and 100%, substituting soybean meal (SBM, and two levels of enzyme supplementation (0 or 250 mg/kg. Each dietary treatment was assigned to four replicate groups and the experiment lasted 22 weeks. A positive relationship (P 0.05. The main effect of FB levels replacing for SBM affected (P < 0.05 yolk and shell percentages, yolk index, yolk to albumen ratio, shell thickness and egg shape index. It can be concluded that FB and enzyme supplementation could be included in hens diet at less than 50% instead of SBM to support egg productive performance, however higher raw FB levels negatively affected egg production indices and quality.
Hey Teacher, Your Personality's Showing!
Paulsen, James R.
1977-01-01
A study of 30 fourth, fifth, and sixth grade teachers and 300 of their students showed that a teacher's age, sex, and years of experience did not relate to students' mathematics achievement, but that more effective teachers showed greater "freedom from defensive behavior" than did less effective teachers. (DT)
Planning a Successful Tech Show
Nikirk, Martin
2011-01-01
Tech shows are a great way to introduce prospective students, parents, and local business and industry to a technology and engineering or career and technical education program. In addition to showcasing instructional programs, a tech show allows students to demonstrate their professionalism and skills, practice public presentations, and interact…
DEFF Research Database (Denmark)
Andersen, Steffen; Harrison, Glenn W.; Lau, Morten I.
2008-01-01
We review the use of behavior from television game shows to infer risk attitudes. These shows provide evidence when contestants are making decisions over very large stakes, and in a replicated, structured way. Inferences are generally confounded by the subjective assessment of skill in some games......, and the dynamic nature of the task in most games. We consider the game shows Card Sharks, Jeopardy!, Lingo, and finally Deal Or No Deal. We provide a detailed case study of the analyses of Deal Or No Deal, since it is suitable for inference about risk attitudes and has attracted considerable attention....
Ojima, H
1993-04-01
In order to characterize the dendritic field of a number of interneurons in the cerebral cortex, the labeling of extracellular sugar chains which define a subset of interneurons was combined with the subsequent intracellular filling of dyes in aldehyde-fixed tissue. Neurons whose cell body had been outlined by a lectin, Vicia villosa (VVA), which recognizes terminal N-acetylgalactosamine, were intracellularly injected with a fluorescent tracer, Lucifer yellow (LY), in the rat parietal cortex under direct visualization. After immunohistochemical detection of LY, somal morphology and the dendritic fields of injected neurons were reconstructed from serial sections and characterized in each of the layers II/III, IV, V and VI. Multipolar, flask-shaped and bitufted somata were VVA-positive. Multipolar neurons with round soma and spherical dendritic field were found in layers II/III, IV and V, while those with vertically elongated dendritic fields were found in layer VI. Cell bodies were located roughly in the center of the spherical or cylindrical dendritic fields. Neurons with apparently multipolar but flask- or pear-shaped soma were found frequently in layer IV, and much less frequently in layer II/III and VI. The majority of the dendrites originated from the neck portion of flask and formed a roughly spherical dendritic field with the cell body located more or less eccentrically. Some neurons in layer IV had an oval, somewhat vertically elongated soma and displayed a typical bitufted dendritic arborization pattern with vertically elongated dendritic fields. The overall dendritic field sizes of the cells gradually increased at deeper layers of the cortex.(ABSTRACT TRUNCATED AT 250 WORDS)
Measuring performance at trade shows
DEFF Research Database (Denmark)
Hansen, Kåre
2004-01-01
Trade shows is an increasingly important marketing activity to many companies, but current measures of trade show performance do not adequately capture dimensions important to exhibitors. Based on the marketing literature's outcome and behavior-based control system taxonomy, a model is built...... that captures a outcome-based sales dimension and four behavior-based dimensions (i.e. information-gathering, relationship building, image building, and motivation activities). A 16-item instrument is developed for assessing exhibitors perceptions of their trade show performance. The paper presents evidence...... of the scale's reliability, factor structure, and validity on the basis of analyzing data from independent samples of exhibitors at the international trade shows SIAL (Paris) and ANUGA (Cologne); and it concludes with a discussion of potential managerial applications and implications for future research. New...
Tokyo Motor Show 2003; Tokyo Motor Show 2003
Energy Technology Data Exchange (ETDEWEB)
Joly, E.
2004-01-01
The text which follows present the different techniques exposed during the 37. Tokyo Motor Show. The report points out the great tendencies of developments of the Japanese automobile industry. The hybrid electric-powered vehicles or those equipped with fuel cells have been highlighted by the Japanese manufacturers which allow considerable budgets in the research of less polluting vehicles. The exposed models, although being all different according to the manufacturer, use always a hybrid system: fuel cell/battery. The manufacturers have stressed too on the intelligent systems for navigation and safety as well as on the design and comfort. (O.M.)
Directory of Open Access Journals (Sweden)
Mauro Mecozzi
2017-02-01
Full Text Available We present a computer assisted method for the examination of the structural changes present in the probe organism Vicia faba exposed to inorganic arsenic, detected by means of Fourier transform infrared (FTIR and Fourier transform near infrared (FTNIR spectroscopy. Like the common ecotoxicological tests, the method is based on the comparison among control and exposed sample spectra of the organisms to detect structural changes caused by pollutants. Using FTIR spectroscopy, we measured and plotted the spectral changes related to the unsaturated to saturated lipid ratio changes (USL, the lipid to protein ratio changes (LPR, fatty and ester fatty acid content changes (FA, protein oxidation (PO and denaturation, and DNA and RNA changes (DNA-RNA. Using FTNIR spectroscopy, we measured two spectral ranges that belonged to hydrogen bond interactions and aliphatic lipid chains called IntHCONH and Met1overt, respectively. The FTIR results showed that As modified the DNA-RNA ratio and also caused partial protein denaturation in the Vicia faba samples. The FTNIR results supported the FTIR results. The main advantage of the proposed computational method is that it does not require a skilled infrared or near infrared operator, lending support to conventional studies performed by toxicological testing.
Unveiling common responses of Medicago truncatula to appropriate and inappropriate rust species
Directory of Open Access Journals (Sweden)
Maria Carlota eVaz Patto
2014-11-01
Full Text Available Little is known about the nature of effective defense mechanisms in legumes to pathogens of remotely related plant species. Some rust species are among pathogens with broad host range causing dramatic losses in various crop plants. To understand and compare the different host and nonhost resistance responses of legume species against rusts, we characterized the reaction of the model legume Medicago truncatula to one appropriate (Uromyces striatus and two inappropriate (U. viciae-fabae and U. lupinicolus rusts. We found that similar pre and post-haustorial mechanisms of resistance appear to be operative in M. truncatula against appropriate and inappropriate rust fungus. The appropriate U. striatus germinated better on M. truncatula accessions then the inappropriate U. viciae-fabae and U. lupinicolus, but once germinated, germ tubes of the three rusts had a similar level of success in finding stomata and forming an appressoria over a stoma. However responses to different inappropriate rust species also showed some specificity, suggesting a combination of non specific and specific responses underlying this legume nonhost resistance to rust fungi. Further genetic and expression analysis studies will contribute to the development of the necessary molecular tools to use the present information on host and nonhost resistance mechanisms to breed for broad-spectrum resistance to rust in legume species.
Reality show: um paradoxo nietzschiano
Directory of Open Access Journals (Sweden)
Ilana Feldman
2011-01-01
Full Text Available
O fenômeno dos reality shows - e a subseqüente relação entre imagem e verdade - assenta-se sobre uma série de paradoxos. Tais paradoxos podem ser compreendidos à luz do pensamento do filósofo alemão Friedrich Nietzsche, que, através dos usos de formulações paradoxais, concebia a realidade como um mundo de pura aparência e a verdade como um acréscimo ficcional, como um efeito. A ficção é então tomada, na filosofia de Nietzsche, não em seu aspecto falsificante e desrealizador - como sempre pleiteou nossa tradição metafísica -, mas como condição necessária para que certa espécie de invenção possa operar como verdade. Sendo assim, a própria expressão reality show, através de sua formulação paradoxal, engendra explicitamente um mundo de pura aparência, em que a verdade, a parte reality da proposição, é da ordem do suplemento, daquilo que se acrescenta ficcionalmente - como um adjetivo - a show. O ornamento, nesse caso, passa a ocupar o lugar central, apontando para o efeito produzido: o efeito-de-verdade. Seguindo, então, o pensamento nietzschiano e sua atualização na contemporaneidade, investigaremos de que forma os televisivos “shows de realidade” operam paradoxalmente, em consonância com nossas paradoxais práticas culturais.
Mikulski, D; Juskiewicz, J; Przybylska-Gornowicz, B; Sosnowska, E; Slominski, B A; Jankowski, J; Zdunczyk, Z
2017-12-01
The aim of this study was to investigate the effect of dietary replacement of soya bean meal (SBM) with faba bean (FB) and a blend of non-starch polysaccharide (NSP) degrading enzymes on the gastrointestinal function, growth performance and welfare of young turkeys (1 to 56 days of age). An experiment with a 2×2 factorial design was performed to compare the efficacy of four diets: a SBM-based diet and a diet containing FB, with and without enzyme supplementation (C, FB, CE and FBE, respectively). In comparison with groups C, higher dry matter content and lower viscosity of the small intestinal digesta were noted in groups FB. The content of short-chain fatty acids (SCFAs) in the small intestinal digesta was higher in groups FB, but SCFA concentrations in the caecal digesta were comparable in groups C and FB. In comparison with control groups, similar BW gains, higher feed conversion ratio (FCR), higher dry matter content of excreta and milder symptoms of footpad dermatitis (FPD) were noted in groups FB. Enzyme supplementation increased the concentrations of acetate, butyrate and total SCFAs, but it did not increase the SCFA pool in the caecal digesta. The enzymatic preparation significantly improved FCR, reduced excreta hydration and the severity of FPD in turkeys. It can be concluded that in comparison with the SBM-based diet, the diet containing 30% of FB enables to achieve comparable BW gains accompanied by lower feed efficiency during the first 8 weeks of rearing. Non-starch polysaccharide-degrading enzymes can be used to improve the nutritional value of diets for young turkeys, but more desirable results of enzyme supplementation were noted in the SBM-based diet than in the FB-based diet.
Gumus, Cansu Ekin; Decker, Eric Andrew; McClements, David Julian
2017-10-01
Emulsion-based delivery systems are being developed to incorporate ω-3 fatty acids into functional foods and beverages. There is interest in formulating these delivery systems from more sustainable and label-friendly ingredients. The aim of this study was therefore to examine the impact of plant-protein emulsifiers on the oxidative stability of 1wt% fish oil-in-water emulsions. Fish oil emulsions stabilized by three types of legume protein (lentil, pea, and faba bean) were produced using a high-pressure microfluidizer. The formation of primary (peroxides) and secondary (TBARS) lipid oxidation products was measured when the emulsions were stored at 37°C under accelerated (+100μM iron sulfate) or non-accelerated (no added iron) conditions for 21 or 33days, respectively. The particle size, charge and microstructure of the emulsions were monitored during storage using light scattering and microscopy to detect changes in physical stability. Emulsions stabilized by whey protein isolate, a commonly used animal-based protein, were utilized as a control. The emulsions formed using whey protein had smaller initial particle sizes, better physical stability, and slightly better stability to lipid oxidation than the ones formed using plant-based proteins. The impact of protein location (adsorbed versus non-adsorbed) on the oxidative stability of the emulsions was also investigated. The presence of non-adsorbed proteins inhibited lipid oxidation, presumably by binding transition metals and reducing their ability to interact with ω-3 fatty acids in the lipid droplets. Overall, these results have important implications for fabricating emulsion-based delivery systems for bioactive lipids, e.g., they indicate that including high levels of non-adsorbed proteins could improve oxidative stability. Copyright © 2017. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Heather Ray
2015-03-01
Full Text Available Faba bean ( L. has been little examined from a genetic or genomic perspective despite its status as an established food and forage crop with some key pharmaceutical factors such as vicine and convicine (VC, which provoke severe haemolysis in genetically susceptible humans. We developed next-generation sequencing libraries to maximize information to elucidate the VC pathway or relevant markers as well as other genes of interest for the species. One selected cultivar, A01155, lacks synthesis of the favism-provoking factors, VC, and is low in tannin, while two cultivars, SSNS-1 and CDC Fatima, are wild-type for these factors. Tissues (5- to 6-d-old root and etiolated shoot and developing seed coat were selected to maximize the utility and breadth of the gene expression profile. Approximately 1.2 × 10 expressed transcripts were sequenced and assembled into contigs. The synthetic pathways for phosphatidylinositol or phytate, the raffinose family oligosaccharides, and proanthocyanidin were examined and found to contain nearly a full complement of the synthetic genes for these pathways. A severe deficiency in anthocyanidin reductase expression was found in the low-tannin cultivar A01155. Approximately 5300 variants, including 234 variants specific to one of the three cultivars, were identified. Differences in expression and variants potentially related to VC synthesis were analyzed using strategies exploiting differences in expression between cultivars and tissues. These sequences should be of high utility for marker-assisted selection for the key traits vicine, convicine, and proanthocyanidin, and should contribute to the scant genetic maps available for this species.
Directory of Open Access Journals (Sweden)
Fernando Castilho
2010-03-01
enabled to identify that sweet lupin flour is able to absorb 172 to 186% of its weight in water, and ~62% in oil, while faba bean flour absorbs ~100% of its weight in water, and ~50% in oil. The emulsions obtained with both flours showed good activity and stability, suggesting a good application potential in the production of sausages. In the present work, some functional properties of the sweet lupin and faba bean flours were analyzed, including use in the production of cooked ham. The cooked ham was elaborated in the Quality Control Laboratory of foods in the Pharmaceutical Sciences Faculty in the University of São Paulo State (UNESP in Araraquara (SP, Brazil, offering an enriched food nutritionally. When compared to cooked hams prepared with the addition of soy protein, the experimental hams presented no significant sensorial differences, such as appearance, color, flavor, texture and overall impression, however they had had little sensorial acceptability.
Directory of Open Access Journals (Sweden)
Mary C. Politi PhD
2016-11-01
Full Text Available Introduction: Since the Affordable Care Act was passed, more than 12 million individuals have enrolled in the health insurance marketplace. Without support, many struggle to make an informed plan choice that meets their health and financial needs. Methods: We designed and evaluated a decision aid, Show Me My Health Plans (SMHP, that provides education, preference assessment, and an annual out-of-pocket cost calculator with plan recommendations produced by a tailored, risk-adjusted algorithm incorporating age, gender, and health status. We evaluated whether SMHP compared to HealthCare.gov improved health insurance decision quality and the match between plan choice, needs, and preferences among 328 Missourians enrolling in the marketplace. Results: Participants who used SMHP had higher health insurance knowledge (LS-Mean = 78 vs. 62; P < 0.001, decision self-efficacy (LS-Mean = 83 vs. 75; P < 0.002, confidence in their choice (LS-Mean = 3.5 vs. 2.9; P < 0.001, and improved health insurance literacy (odds ratio = 2.52, P < 0.001 compared to participants using HealthCare.gov . Those using SMHP were 10.3 times more likely to select a silver- or gold-tier plan (P < 0.0001. Discussion: SMHP can improve health insurance decision quality and the odds that consumers select an insurance plan with coverage likely needed to meet their health needs. This study represents a unique context through which to apply principles of decision support to improve health insurance choices.
Danino, Vittoria E; Wilkinson, Adam; Edwards, Anne; Downie, J Allan
2003-10-01
Analysis of the regulation of plasmid transfer genes on the symbiotic plasmid pRL1JI in Rhizobium leguminosarum bv. viciae has revealed a novel regulatory relay that is specifically poised to detect an N-acyl-homoserine lactone (AHL) made by different cells (potential recipients of pRL1JI). Adjacent to the traI-trbBCDEJKLFGHI plasmid transfer operon on pRL1JI are two regulatory genes, bisR and traR, which encode LuxR-type quorum-sensing regulators required for conjugation. Potential recipients of pRL1JI induce the traI-trb operon and plasmid transfer via a quorum-sensing relay involving BisR, TraR and the traI-trb operon in donor cells. BisR induces expression of traR in response to N-(3-hydroxy-7-cis-tetradecenoyl)-l-homoserine lactone (3-OH-C14:1-HSL), which is produced by CinI in potential recipient strains. In donor strains (carrying pRL1JI), BisR represses the expression of the chromosomal gene cinI; this repression results in a very low level of formation of 3-OH-C14:1-HSL and hence relatively low levels of expression of traR and the traI-trb operon in strains carrying pRL1JI. However, if 3-OH-C14:1-HSL from potential recipients is present, then traR and plasmid transfer are induced. The induction of traR occurs at very low concentrations of 3-OH-C14:1-HSL (around 1 nm). TraR then induces the traI-trb operon in a quorum-sensing dependent manner in re-sponse to the TraI-made AHLs, N-(3-oxo-octanoyl)-l-homoserine lactone and N-(octanoyl)-l-homoserine lactone. The resulting autoinduction results in high levels of expression of the traI-trb operon. Premature expression of the traI-trb operon is reduced by TraM, which probably titres out TraR preventing expression of traI when there are low levels of traR expression. Expression of traR in stationary phase cells is limited by feedback inhibition mediated by TraI-made AHLs.
Directory of Open Access Journals (Sweden)
İlyas Bolat
2016-01-01
Full Text Available Legume forage crops have the ability of retaining free nitrogen in the air through symbiotic Rhizobium bacteria found in their roots. Additionally, microbial biomass (MB–an essential living component of soil and a significant factor influencing plant nutrient dynamics–is considered to be accurate indicator of soil’s biological condition. Given the aforementioned aspects, soil MB C (Cmic and MB N (Nmic of different legume forage crops were investigated in this study. Soil samples were taken in order to identify certain physical and chemical characteristics of the soil using volume cylinders (0 – 6.5 cm depth from Vicia sativa L. (VSP and Medicago sativa L. planted (MSP areas. To determine the Cmic and Nmic contents, topsoil samples were also taken from 0 – 6.5 cm depth. Cmic and Nmic contents were identified using chloroform – fumigation – extraction method. There was no statistical significance for particle density, bulk density, electrical conductivity, CaCO3 %, and decomposition ratio (Corg/Ntotal of the VSP and MSP soil (P > 0.05. However, some other soil characteristics such as temperature, porosity, sand, silt and clay contents, pH, organic C and total N differed significantly (P < 0.05. Compared to VSP soil, the Cmic contents were determined to be 27 % higher (P < 0.05 in MSP soil. In VSP soil, the soil Nmic content ranged from 83.38 µg g-1 to 124.67 µg g-1, while it ranged from 91.62 µg g-1 to 187.07 µg g-1 in MSP soil. The Nmic content of the MSP soil was observed to be approximately 35 % higher than VSP soil, and a statistically significant difference (P < 0.05 was noticed between the two. Moreover, a significant positive correlation was found not only between the Cmic and organic C contents (r = 0.667; P < 0.05 but also between the Nmic and total N contents of MSP and VSP soil (r = 0.881; P < 0.01. The results of the study revealed that soil Cmic and Nmic values differ as the types of planted legume forage crops
Akkerman, M.; Franssen-Verheijen, M.A.W.; Immerzeel, P.; Hollander, den L.; Schel, J.H.N.; Emons, A.M.C.
2012-01-01
Cellulose is the most abundant biopolymer on earth, and has qualities that make it suitable for biofuel. There are new tools for the visualisation of the cellulose synthase complexes in living cells, but those do not show their product, the cellulose microfibrils (CMFs). In this study we report the
Clarification on host range of Didymella pinodes the causal agent of pea ascochyta blight
Directory of Open Access Journals (Sweden)
Eleonora eBarilli
2016-05-01
Full Text Available Didymella pinodes is the principal causal agent of ascochyta blight, one of the most important fungal diseases of pea (Pisum sativum worldwide. Understanding its host specificity has crucial implications in epidemiology and management; however, this has not been clearly delineated yet. In this study we attempt to clarify the host range of D. pinodes and to compare it with that of other close Didymella spp. D. pinodes was very virulent on pea accessions, although differences in virulence were identified among isolates. On the contrary, studied isolates D. fabae, D. rabiei and D. lentil showed a reduced ability to infect pea not causing macroscopically visible symptoms on any of the pea accessions tested.D. pinodes isolates were also infective to some extend on almost all species tested including species such as Hedysarum coronarium, Lathyrus sativus, Lupinus albus, Medicago spp., Trifolium spp., Trigonella foenum-graecum and Vicia articulata which were not mentioned before as hosts of D. pinodes. On the contrary, D. lentil and D. rabiei were more specific, infecting only lentil and chickpea, respectively. D. fabae was intermediate, infecting mainly faba bean, but also slightly other species such as Glycine max, Phaseolus vulgaris, Trifolium spp., Vicia sativa and V. articulata.DNA sequence analysis of the nuclear ribosomal internal transcribed spacer region (ITS was performed to confirm identity of the isolates studies and to determine phylogenetic relationship among the Didymella species, revealing the presence of two clearly distinct clades. Clade one was represented by two supported subclusters including D. fabae isolates as well as D. rabiei with D. lentil isolates. Clade two was the largest and included all the D. pinodes isolates as well as Phoma medicaginis var. pinodella. Genetic distance between D. pinodes and the other Didymella spp. isolates was not correlated with overall differences in pathogenicity. Based on evidences presented here
Anbautelegramm Saatwicke (Vicia sativa L.)
Böhm, Herwart; Weissmann, Elmar
2013-01-01
Für den Anbau von Saatwicken werden in einem kurzgefassten Anbautelegramm die Stärken und Schwächen sowie grundlegende Kennwerte zu Standortansprüchen, Aussaat, Unkrautregulierung, Nährstoffbedarf und Schaderregern beschrieben.
Identification of markers associated with genes for rust resistance in lens culinaris medik
Lentil rust caused by Uromyces vicia-fabae (Pers.) Schroet is one of the most important diseases of lentil in South Asia, North Africa and East Africa. This disease is usually observed during late flowering and early podding stages. Early infection accompanied by favorable environmental conditions c...
1973-01-01
At the end of March , sixty mice were irradiated at the synchro-cyclotron in the course of an experimental programme studying radiation effects on mice and plants (Vicia faba bean roots) being carried out by the CERN Health Physics Group.
African Journals Online (AJOL)
aestivum) horse beans (Vicia faba), peas (Pisum sativum), potato (Solanum tubersoum,), teff. (Eragrostis tef), and maize (Zea mays) crops grown under rain fed ...... He, Z.L., Alva, A.K., Calvert, D.V., Li Y.C and Banks, D.J (1999). Effects of nitrogen fertilization of grapefruit trees on soil acidification and nutrient availability in.
Nieuwe eiwitgewassen voor de voeding van varkens in de biologische houderij
Balkema, A.
2004-01-01
Voor biologische veehouders geldt vanaf 2005 de eis dat alle voeders van biologische oorsprong dienen te zijn. In deze deskstudie worden de eigenschappen en potentie van alternatieve eiwitgewassen beschreven. Zaden van in ons land passendeleguminosen (erwt ( Pisum sativum), veldboon ( Vicia faba),
Arabidopsis CDS blastp result: AK103075 [KOME
Lifescience Database Archive (English)
Full Text Available AK103075 J033118C16 At3g17020.1 universal stress protein (USP) family protein simil...ar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 2e-42 ...
Arabidopsis CDS blastp result: AK063611 [KOME
Lifescience Database Archive (English)
Full Text Available AK063611 001-118-D04 At3g17020.1 universal stress protein (USP) family protein simi...lar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 6e-38 ...
Arabidopsis CDS blastp result: AK108499 [KOME
Lifescience Database Archive (English)
Full Text Available AK108499 002-143-H02 At3g03270.2 universal stress protein (USP) family protein / ea...rly nodulin ENOD18 family protein contains Pfam profile PF00582: universal stress protein family; similar to early nodulin ENOD18 (GI:11602747) [Vicia faba] 2e-52 ...
Arabidopsis CDS blastp result: AK065771 [KOME
Lifescience Database Archive (English)
Full Text Available AK065771 J013041K03 At3g17020.1 universal stress protein (USP) family protein simil...ar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 2e-42 ...
Environmental, genetic and cellular toxicity of tenuazonic acid ...
African Journals Online (AJOL)
Alternaria alternata, an important pathogen of many plants, produces tenuazonic acid (TeA) with bioactivity to microbes, plants and animals. TeA is one of the main mycotoxin to humans and other organisms. Using Chlamydomonas reinhardtii, Vicia faba root tip and three mammalian normal cell lines as target materials, ...
Resistance source to cowpea aphid (Aphis craccivora Koch) in ...
African Journals Online (AJOL)
The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854. These landraces from the region of Biskra (in the south of Algeria) were selected in an initial field trial and subjected to further testing in the greenhouse. Landrace V51 proved to be the ...
Lifescience Database Archive (English)
Full Text Available its) Value sp|P42653|1433A_VICFA 14-3-3-like protein A OS=Vicia faba PE=2 SV=1 31 3.6 sp|Q6C443|OXR1_YARLI Oxidation... 158 YKSAQDIANTELPPTHP-IRLGLALNFSVFYYEILNSPDRAC 198 >sp|Q6C443|OXR1_YARLI Oxidation resistance protein 1 OS=
Environmental, genetic and cellular toxicity of tenuazonic acid ...
African Journals Online (AJOL)
SERVER
2008-04-17
Apr 17, 2008 ... Alternaria alternata, an important pathogen of many plants, produces tenuazonic acid (TeA) with bioactivity to microbes, plants and animals. TeA is one of the main mycotoxin to humans and other organisms. Using Chlamydomonas reinhardtii, Vicia faba root tip and three mammalian normal cell lines.
DEFF Research Database (Denmark)
Hansen, J E; Nielsen, C M; Nielsen, C
1989-01-01
The binding of 13 different lectins to gp120 partially purified from two HIV-1 isolates and one HIV-2 isolate was studied by in situ staining on electrophoretically separated and electroblotted HIV antigens. The lectins concanavalin A, wheat germ agglutinin, Lens culinaris agglutinin, Vicia faba...
Municipal landfill leachates induced chromosome aberrations in rat ...
African Journals Online (AJOL)
user
2006-11-16
Nov 16, 2006 ... leachate induced chromosome aberration in rat. Other reports on leachate induced genotoxicity in Allium cepa. (Cabrera and Rodriguez, 1999; Bakare and Wale-. Adeyemo, 2004; Chandra et al., 2005.), Vicia faba. (Radetski et al., 2004; Sang and Li, 2004), Drosophila melanogaster (Siddique et al., 2005) ...
Effect of municipal sewage effluent on soil and crops cultivated on a ...
African Journals Online (AJOL)
The effects of sewage effluent from Sebha Municipal Area in the Fezzan region of Libya on certain physicochemical properties of a hyper-arid zone sandy soil and growth of two plants were studied. The soil had been treated daily with 25, 50, 75 and 100% effluent; and barley (Hordeum vulgare) and broad beans (Vicia faba) ...
Formulation of a complementary food fortified with broad beans ...
African Journals Online (AJOL)
Sixty percent of mothers did not provide bean-based food for their children, with the most frequently reported reason being lack of knowledge of its nutrient value for young children. To a typical complementary food of barley-maize porridge, 10, 20 and 30% of cereal was replaced by processed broad beans (Vicia faba), ...
Resistance source to cowpea aphid (Aphis craccivora Koch) in ...
African Journals Online (AJOL)
STORAGESEVER
2008-07-18
Jul 18, 2008 ... ²INRA Centre de Biologie et de Gestion des Populations (CBGP), Campus International de Baillarguet, 34988,. Montferrier / Lez cedex, France. Accepted 3 June, 2008. The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854.
South African Journal of Animal Science - Vol 22, No 5 (1992)
African Journals Online (AJOL)
An evaluation of fababean (Vicia faba) and lupin (Lupinus albus) stubble and seed for sheep · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.S. Brand, F Franck, A.A. Brand, A Durand, J Coetzee, 170-174 ...
Pulse diversity for polyphenolic secondary metabolites
The pulse species including guar (Cyamopsis tetragonoloba L. Taub.), Lablab purpureus L. Sweet, Macrotyloma uniflorum (Lam.) Verdc., Teramnus labialis (L.f.) Spreng, alfalfa (Medicago sativa ssp. sativa), green beans (Phaseolus vulgaris L.), fava beans (Vicia faba L.), blackeye pea (Vigna unguiculat...
Belghith-Fendri, Lilia; Chaari, Fatma; Kallel, Fatma; Zouari-Ellouzi, Soumaya; Ghorbel, Raoudha; Besbes, Souhail; Ellouz-Chaabouni, Semia; Ghribi-Aydi, Dhouha
2016-10-01
Attention has focused on bakery products such as cake which is one of the most common bakery products consumed by people in the world. Legume by-products, pea pods (PPs) (Pisum sativum L.) and broad bean pods (BBPs) (Vicia faba L.) mediterranean (Tunisian), has been studied for its high dietary fiber content (PP: 43.87 g/100 g; BBP: 53.01 g/100 g). Protein content was also a considerable component for both by-products. We investigated the effect of substituted of 5%, 10%, 15%, 20%, 25%, and 30% of PP and BBP flours on the sensory and technological properties in cake. Cakes hardness increased whereas L* and a* color values decreased. The overall acceptability rate showed that a maximum of 15% of PP and BBP flours can be added to prepare acceptable quality cakes. © 2016 Institute of Food Technologists®.
The Physics of Equestrian Show Jumping
Stinner, Art
2014-01-01
This article discusses the kinematics and dynamics of equestrian show jumping. For some time I have attended a series of show jumping events at Spruce Meadows, an international equestrian center near Calgary, Alberta, often referred to as the "Wimbledon of equestrian jumping." I have always had a desire to write an article such as this…
First report of occurrence of two viruses on pea field in Iran.
Esfandiari, N; Kohi Habibi, M; Mosahebi, G H; Mozafari, J
2005-01-01
An intensive survey was conducted to identify virus diseases affecting pea crops in Tehran province of Iran. A total of 270 pea samples were collected randomly from pea fields. samples were tested by Double Antibody Sandwich Enzyme Linked Immunosorbent Assay (DAS-ELISA) using polyclonal antisera prepared against PSBMV (AS-0129, DSMZ, Braunschweig, Germany) and TSWV (AS-0580, DSMZ, Braunschweig, Germany). Virus disease incidence in pea samples was followed by PSBMV (33%) TSWV (24.4%) and PSBMV+TSWV (17.77). The positive samples with PSBMV were extracted in 0.05M phosphate buffer pH 6.5-7 containing 2% pvp and inoculated on Pisum sativum, Vicia faba, Chenopodium quinoa, Chenopodium amaranticolor. That produced in Pisum sativum; leaflets roll downwards, shoots curl, internodes shorten and plants are rosetted. Early infections reduce flower and fruit formation or eliminate their development. Broad bean has symptoms accompanied by a certain margin rolling and leaflet distortion. In Chenopodium amaranticolor necrotic local lesions and Chenopodium quinoa chlorotic local lesions had produced. The positive samples with TSWV were extracted in 0.01 M phosphate buffer containing 1% Na2 SO3 and inoculated on Petunia hybrida, Pisum sativum. TSWV causes several symptoms in infected peas, including brown leaf petiole and stem coloration, leaflet spotting, vein necrosis. In petunia hybrida after approximately 5 days showed local necrotic lesion. Biological purification in TSWV with chlorotic local lesions in Petunia hybrida and in PSBMV; chlorotic local lesions in Chenopodium quinoa were done. In PSBMV, back inoculated on Pisum sativum and Vicia faba also tested with DAS-ELISA. RT-PCR confirmed the results. This is the first report of PSBMV and TSWV naturally infecting pea in Iran.
Characterization of non-host resistance in broad bean to the wheat stripe rust pathogen
Directory of Open Access Journals (Sweden)
Cheng Yulin
2012-06-01
Full Text Available Abstract Background Non-host resistance (NHR confers plant species immunity against the majority of microbial pathogens and represents the most robust and durable form of plant resistance in nature. As one of the main genera of rust fungi with economic and biological importance, Puccinia infects almost all cereals but is unable to cause diseases on legumes. Little is known about the mechanism of this kind of effective defense in legumes to these non-host pathogens. Results In this study, the basis of NHR in broad bean (Vicia faba L. against the wheat stripe rust pathogen, Puccinia striiformis f. sp. tritici (Pst, was characterized. No visible symptoms were observed on broad bean leaves inoculated with Pst. Microscopic observations showed that successful location of stomata and haustoria formation were significantly reduced in Pst infection of broad bean. Attempted infection induced the formation of papillae, cell wall thickening, production of reactive oxygen species, callose deposition and accumulation of phenolic compounds in plant cell walls. The few Pst haustoria that did form in broad bean cells were encased in reactive oxygen and callose materials and those cells elicited cell death. Furthermore, a total of seven defense-related genes were identified and found to be up-regulated during the Pst infection. Conclusions The results indicate that NHR in broad bean against Pst results from a continuum of layered defenses, including basic incompatibility, structural and chemical strengthening of cell wall, posthaustorial hypersensitive response and induction of several defense-related genes, demonstrating the multi-layered feature of NHR. This work also provides useful information for further determination of resistance mechanisms in broad bean to rust fungi, especially the adapted important broad bean rust pathogen, Uromyces viciae-fabae, because of strong similarity and association between NHR of plants to unadapted pathogens and basal
Yáñez-Ruiz, David R; Martín-García, Antonio I; Weisbjerg, Martin R; Hvelplund, Torben; Molina-Alcaide, Eduarda
2009-02-01
The potential of different legume seeds species, including recently new developed varieties (Vicia faba: a commercial variety and varieties Alameda, Palacio and Baraka; Lupinus angustifolius; Pisum sativum and Cicer arietinum: varieties Fardon and Zegri) as protein supplements to low quality forages was evaluated. First, the chemical composition, in vitro digestibility, in situ degradability and in vitro/in situ intestinal digestibility of legume seeds were determined. The chemical composition was rather similar within genus. Vicia faba beans contained more condensed tannins (35.8-56.4 g/kg DM) and less ether extract (12.8-9.5 g/kg DM) than the other legumes. The rumen degradability and intestinal digestibility of the undegraded protein in the rumen was very similar among the seeds, with exception of lupins, having a much higher degradation rate than the rest. Second, the fermentation characteristics of diets, which were based on two low quality forages (olive leaves and barley straw) and feed blocks without or with supplementation of legume seeds or soybean meal, were investigated by using single-flow continuous culture fermenters. In this trial, the fermentation parameters (ammonia, pH and volatile fatty acids), the microbial protein synthesis and the degradation of olive leaves and barley straw promoted by the different diets were studied. Compared to soybean meal, beans and peas showed similar suitability as protein supplements for sustaining in vitro fermentation of low-quality forages. However, our results suggest a significant interaction between the type of legume used as supplement and the type of forage used, which need to be further studied in vivo.
Voyeurismo Televisivo, Reality Shows e Brasilidade Televisiva
Directory of Open Access Journals (Sweden)
Suzana Kilpp
2008-12-01
Full Text Available In the last years we watched a boom of reality shows in the media and also in the academic production specialized in this subject. It remains, however, a epistemological gap related to the aesthetic and techniques (which are related to the televisions grammars that TV uses in these programs to enunciate ethics directions to its own voyeurism, that goes far beyond reality shows, having repercussions on social imaginary of transparency and surveillance, and the redesign of public and private spaces. In this gap, the article points out the debate of Brazilian reality shows in the perspective of the televisions grammars.
Diabetes Drug Shows Promise Against Parkinson's
... fullstory_167612.html Diabetes Drug Shows Promise Against Parkinson's Byetta improved symptoms of motor disease in small, ... may do double duty as a treatment for Parkinson's disease, a new study suggests. "This is a ...
UV Photography Shows Hidden Sun Damage
... mcat1=de12", ]; for (var c = 0; c UV photography shows hidden sun damage A UV photograph gives ... developing skin cancer and prematurely aged skin. Normal photography UV photography 18 months of age: This boy's ...
Career development at London Vet Show.
2016-09-03
Are you considering a career change? Perhaps you want help to develop within your current role? Either way, you will find a relevant session in the BVA Career Development stream at the London Vet Show in November. British Veterinary Association.
Laser Therapy Shows Promise Against Eye 'Floaters'
... page: https://medlineplus.gov/news/fullstory_167324.html Laser Therapy Shows Promise Against Eye 'Floaters' These spots ... 2017 THURSDAY, July 20, 2017 (HealthDay News) -- A laser treatment can reduce spots in people's vision known ...
Lawson, Tracy; Oxborough, Kevin; Morison, James I L; Baker, Neil R
2003-07-01
High resolution chlorophyll a fluorescence imaging was used to compare the photosynthetic efficiency of PSII electron transport (estimated by Fq'/Fm') in guard cell chloroplasts and the underlying mesophyll in intact leaves of six different species: Commelina communis, Vicia faba, Amaranthus caudatus, Polypodium vulgare, Nicotiana tabacum, and Tradescantia albifora. While photosynthetic efficiency varied between the species, the efficiencies of guard cells and mesophyll cells were always closely matched. As measurement light intensity was increased, guard cells from the lower leaf surfaces of C. communis and V. faba showed larger reductions in photosynthetic efficiency than those from the upper surfaces. In these two species, guard cell photosynthetic efficiency responded similarly to that of the mesophyll when either light intensity or CO2 concentration during either measurement or growth was changed. In all six species, reducing the O2 concentration from 21% to 2% reduced guard cell photosynthetic efficiency, even for the C4 species A. caudatus, although the mesophyll of the C4 species did not show any O2 modulation of photosynthetic efficiency. This suggests that Rubisco activity is significant in the guard cells of these six species. When C. communis plants were water-stressed, the guard cell photosynthetic efficiency declined in parallel with that of the mesophyll. It was concluded that the photosynthetic efficiency in guard cells is determined by the same factors that determine it in the mesophyll.
Online Italian fandoms of American TV shows
Directory of Open Access Journals (Sweden)
Eleonora Benecchi
2015-06-01
Full Text Available The Internet has changed media fandom in two main ways: it helps fans connect with each other despite physical distance, leading to the formation of international fan communities; and it helps fans connect with the creators of the TV show, deepening the relationship between TV producers and international fandoms. To assess whether Italian fan communities active online are indeed part of transnational online communities and whether the Internet has actually altered their relationship with the creators of the original text they are devoted to, qualitative analysis and narrative interviews of 26 Italian fans of American TV shows were conducted to explore the fan-producer relationship. Results indicated that the online Italian fans surveyed preferred to stay local, rather than using geography-leveling online tools. Further, the sampled Italian fans' relationships with the show runners were mediated or even absent.
2008 LHC Open Days Physics: the show
2008-01-01
A host of events and activities await visitors to the LHC Open Days on 5 and 6 April. A highlight will be the physics shows funded by the European Physical Society (EPS), which are set to surprise and challenge children and adults alike! School children use their experience of riding a bicycle to understand how planets move around the sun (Copyright : Circus Naturally) Participating in the Circus Naturally show could leave a strange taste in your mouth! (Copyright : Circus Naturally) The Rino Foundation’s experiments with liquid nitrogen can be pretty exciting! (Copyright: The Rino Foundation)What does a bicycle have in common with the solar system? Have you ever tried to weigh air or visualise sound? Ever heard of a vacuum bazooka? If you want to discover the answers to these questions and more then come to the Physics Shows taking place at the CERN O...
Satire og diskurs i The Daily Show
Rygaard, Alexander Leicht; Dall, Christoffer; Jakobsen, Sebastian Rasch; Duvander, Søren; Knøster, Morten; Kirkegaard, Elissa Valles; Wallin, Dea
2014-01-01
This project examines how The Daily Show and its host Jon Stewart takes part in the American political debate. Furthermore, the term satire is explained by linguist Paul Simpson who reckons that satire is not as much a genre as it is a practice of discourse. By the use of detailed statistics by Gallup and Pew Research Center, a picture of the American media and its consumers is provided to explain why The Daily Show has gained more viewership through the years. Throughout a critical discourse...
TV-Show Retrieval and Classification
Musto, C.; Narducci, F.; Lops, P.; Semeraro G.; Gemmis, M. de; Barbieri, M.; Korst, J.H.M.; Pronk, S.P.P.; Clout, R.A.W.
2012-01-01
Recommender systems are becoming popular tools to aid users in finding interesting and relevant TV-shows and other digital video assets,based on implicitly learned user preferences. In this context, a common assumption is that user preferences can be specified by program types (movie, sports, ...)
The Last Great American Picture Show
Elsaesser, Thomas; King, Noel; Horwath, Alexander
2004-01-01
The Last Great American Picture Show brings together essays by scholars and writers who chart the changing evaluations of the American cinema of the 1970s, sometimes referred to as the decade of the lost generation, but now more and more recognized as the first New Hollywood, without which the
Mike Pentz showing visitors around CESAR
CERN PhotoLab
1964-01-01
Mike Pentz, leader of the CESAR Group, shows visitors around the 2 MeV electron storage ring. Here they are in the vault of the injector (a 2 MV van de Graaff generator), next to the 2 beam lines, one leading to the ring, the other to the spectrometer.
Show Them You Really Want the Job
Perlmutter, David D.
2012-01-01
Showing that one really "wants" the job entails more than just really wanting the job. An interview is part Broadway casting call, part intellectual dating game, part personality test, and part, well, job interview. When there are 300 applicants for a position, many of them will "fit" the required (and even the preferred) skills listed in the job…
Laser entertainment and light shows in education
Sabaratnam, Andrew T.; Symons, Charles
2002-05-01
Laser shows and beam effects have been a source of entertainment since its first public performance May 9, 1969, at Mills College in Oakland, California. Since 1997, the Photonics Center, NgeeAnn Polytechnic, Singapore, has been using laser shows as a teaching tool. Students are able to exhibit their creative skills and learn at the same time how lasers are used in the entertainment industry. Students will acquire a number of skills including handling three- phase power supply, operation of cooling system, and laser alignment. Students also acquire an appreciation of the arts, learning about shapes and contours as they develop graphics for the shows. After holography, laser show animation provides a combination of the arts and technology. This paper aims to briefly describe how a krypton-argon laser, galvanometer scanners, a polychromatic acousto-optic modulator and related electronics are put together to develop a laser projector. The paper also describes how students are trained to make their own laser animation and beam effects with music, and at the same time have an appreciation of the operation of a Class IV laser and the handling of optical components.
2016-11-05
London Vet Show is fast approaching: it takes place from November 17 to 18 and is being held at ExCeL London for the first time. Zoe Davies, marketing manager, highlights some of what BVA is offering at the event. British Veterinary Association.
UV Photography Shows Hidden Sun Damage
... var c = 0; c UV photography shows hidden sun damage A UV photograph gives us a safe way to see how the sun damages our skin. In the UV photos that ... on the right, you can see what hidden sun damage looks like. Compare these UV photos with ...
Identification of genes showing differential expression profile ...
Indian Academy of Sciences (India)
Suppression subtractive hybridization was used to identify genes showing differential expression profile associated withgrowth rate in skeletal muscle tissue of Landrace weanling pig. Two subtracted cDNA populations were generated from mus-culus longissimus muscle tissues of selected pigs with extreme expected ...
Molecular and cytogenetic assessment of Dipterygium glaucum genotoxicity
Directory of Open Access Journals (Sweden)
NADA H. ALTWATY
2016-01-01
Full Text Available ABSTRACT The aim of the present study is to assess the genotoxicity of Dipterygium glaucum grows widely in Saudi Arabia desert to produce safety herbal products. This work is considered the first and pioneer report so far due to the lack and poor evaluated reports of the plant species for their mutagensity, genotoxicity and cytogenetics effects. Cytogenetic effects of D. glaucum on mitotic in roots of Vicia faba showed reduction in mitotic activity using three extracts; water, ethanol and ethyl acetate. Chromosomal abnormalities were recorded that included stickiness of chromosomes, chromatin bridge, fragments, lagging chromosome and micronuclei. Protein bands and RAPD analyses of V. faba treated with three D. glaucum extracts revealed some newly induced proteins and DNA fragments and other disappeared. Chemical constitution of the plant species should be identified with their biological activities against human and animal cells like HeLa cancer cell line. We are recommending using additional genotoxicity tests and other toxicity tests on animal culture with different concentrations and also utilizing several drought and heat tolerant genes of the plant species in gene cloning to develop and improve other economical crop plants instead of using the species as oral herbal remedy
Identification of rhizobial strains nodulating Egyptian grain legumes.
Zahran, Hamdi H; Chahboune, Rajaa; Moreno, Silvia; Bedmar, Eulogio J; Abdel-Fattah, Medhat; Yasser, Manal M; Mahmoud, Ahmed M
2013-09-01
Fifty four bacterial strains were isolated from root nodules of the grain legumes Cicer arietinum, Lens esculentus, Phaseolus vulgaris, Pisum sativum, and Vicia faba grown in cultivated lands of Beni-Suef Governorate (Egypt). Repetitive extragenic palindromic (REP)-polymerase chain reaction (PCR) clustered the strains into 15 REP-PCR groups. The nearly complete sequence of the 16S rRNA gene from a representative strain of each REP-PCR pattern showed that the strains were closely related to members of the family Rhizobiaceae of the Alphaproteobacteria. Pairwise alignments between globally aligned sequences indicated that the strains from V. faba had 99.6% identity with Rhizobium leguminosarum, and those from P. vulgaris 99.76% and 100% with sequences from R. leguminosarum and R. mesosinicum, respectively. Strains from P. sativum had 99.76%, 99.84%, and 99.92% sequence identity with R. leguminosarum, R. etli, and R. pisi, respectively, and those from L. esculentus had 99.61% identity with sequences from R. leguminosarum. Sequences of the strains from C. arietinum had 100% identity with those of Mesorhizobium amorphae and M. robiniae, respectively. Nitrogenase activity, determined as acetylene-dependent ethylene production, was detected in nodules formed after inoculation of the corresponding host plant with the representative rhizobial species.
Directory of Open Access Journals (Sweden)
Sara Mareković
2015-07-01
Full Text Available This paper presents the results of the first extensive archaeobotanical research into a Bronze Age site in Croatia. The aim of the study was to reveal what plants were consumed (grown at Kalnik-Igrišče (NW Croatia in the Bronze Age and to realize if the plant diet of the local population differed from that of the inhabitants in neighboring countries. The results show that all plant macrofossils found at Kalnik-Igrišče can be classified into one of four functional groups: cereals, cultivated legumes, useful trees and weeds. As much as 98% of the findings are of cereals and legumes. The most abundant species found are Panicum miliaceum (millet, Hordeum vulgare (barley, Vicia faba (faba bean, Triticum aestivum ssp. aestivum (bread wheat, Triticum turgidum ssp. dicoccon (emmer wheat and Lens culinaris (lentils. The findings from Kalnik-Igrišče do not differ from the findings of neighboring countries, indicating that there were similar diets and agricultural/plant-collecting activities throughout the whole of the studied area (Bosnia and Herzegovina, Slovenia, Serbia, Italy, Austria and Hungary.
Biodegradable PBAT/PLA Blend with Bioactive MCPA-PHBV Conjugate Suppresses Weed Growth.
Kwiecien, Iwona; Adamus, Grazyna; Jiang, Guozhan; Radecka, Iza; Baldwin, Timothy C; Khan, Habib R; Johnston, Brian; Pennetta, Valentina; Hill, David; Bretz, Inna; Kowalczuk, Marek
2018-01-09
The herbicide 2-methyl-4-chlorophenoxyacetic acid (MCPA) conjugated with poly(3-hydroxybutyrate-co-3-hydroxyvalerate) (PHBV) was prepared via a melt transesterification route. The resultant bioactive oligomer was then mixed with a blend of polylactide (PLA) and poly(butylene adipate-co-terephthalate) (PBAT) with different loadings to manufacture films to be used as a bioactive, biodegradable mulch to deliver the herbicide to target broadleaf weed species. The biological targeting of the MCPA-PHBV conjugate in the mulch film was investigated under glasshouse conditions using faba bean (Vicia faba) as a selective (nontarget) model crop species having broadleaf morphology. The presence of the MCPA-PHBV conjugate in the biodegradable PBTA/PLA blend was shown to completely suppress the growth of broadleaf weed species while displaying only a mild effect on the growth of the model crop. The degradation of the mulch film under glasshouse conditions was quite slow. The release of the MCPA-PHBV during this process was detected using NMR, GPC, EDS, and DSC analyses, indicating that the majority of the MCPA diffused out after MCPA-PHBV conjugate bond scission. These data provide a strong "proof of concept" and show that this biodegradable, bioactive film is a good candidate for future field applications and may be of wide agricultural applicability.
Efficacy of selected Pseudomonas strains for biocontrol of Rhizoctonia solani in potato
Directory of Open Access Journals (Sweden)
Moncef MRABET
2014-01-01
Full Text Available Thirty seven bacterial isolates from faba bean (Vicia faba L. root-nodules were screened for their antagonistic activity against eight Rhizoctonia solani strains isolated from infected potato (Solanum tuberosum L. tubers. Two bacterial strains (designated as Kl.Fb14 and S8.Fb11 gave 50% in vitro inhibition of R. solani mycelial growth. 16S rDNA sequence analysis indicated that strain Kl.Fb14 exhibited 99.5% identity with Pseudomonas moraviensis, and that S8.Fb11 exhibited 99.8% identity with Pseudomonas reinekei. Greenhouse trials in soil showed that strain S8.Fb11 reduced the percentage of sclerotia on potato tubers and amounts of tuber infection for the potato cultivars Spunta and Nicola. In a field trial conducted in South Tunisia, infection with R. solani reduced potato yield by approximately 40% for ‘Spunta’ and 17% for ‘Nicola’; about 20% of the total tuber production was severely infected. However, when potato tubers were treated with strain S8.Fb11 prior to sowing, disease incidence was reduced to 6% of total production with low infection levels; potato yield was enhanced by about 6 kg per 10 m row in comparison to R. solani infected plants. The second selected Pseudomonas sp. (strain Kl.Fb14 did not affect either the levels of sclerotia on tubers or potato yield.
Chiochetta, Claudete G; Cotelle, Sylvie; Masfaraud, Jean-François; Toumi, Hela; Quaranta, Gaetana; Adani, Fabrizio; Radetski, Claudemir M
2016-02-01
Soil degraded by coal mining activities can be remediated by amendment with agro-industrial organic sludge. However, the environmental impacts associated with this management practice must be properly addressed. In this context, the objective of this study was to evaluate the eco(geno)toxicity of a fresh and a stabilized sludge before use in a laboratory soil remediation test. Chemical analysis of the complex mixtures (degraded soil, fresh sludge, and stabilized sludge) was carried out, as well as a battery of eco(geno)toxicity tests on microbiological enzymes (fluorescein hydrolysis), earthworms, and higher plants (including Vicia faba genotoxicity test), according to published methodologies. The results of these tests showed that fresh sludge was more toxic than sludge stabilized over 6 months toward earthworms and higher plants (lettuce, corn, and wild cabbage), while phyto(geno)toxicity tests with V. faba indicated the same genotoxicity levels for the two types of sludge. In the soil remediation simulation using different mixtures of degraded soil and stabilized sludge, the proportions of 50:50% (dry weight basis) provided the lowest phyto(geno)toxicity effects and this mixture can be used for the revegetation of the contaminated site.
Attachment ability of the southern green stink bug Nezara viridula (Heteroptera: Pentatomidae).
Salerno, Gianandrea; Rebora, Manuela; Gorb, Elena; Kovalev, Alexander; Gorb, Stanislav
2017-08-01
The present paper characterizes the attachment ability of males and females of Nezara viridula (Heteroptera: Pentatomidae) on artificial surfaces (smooth hydrophilic, smooth hydrophobic, different surface roughness) and on both leaf surfaces of the typical host plant species Vicia faba, using a centrifugal force tester and a traction force experiments set up. N. viridula is a serious crop pest in the world and shows attachment devices different from the so far investigated Heteroptera, with a tarsus characterized by distal smooth flexible pulvilli combined with claws and proximal ventral hairy pad. Notwithstanding the different body mass between the sexes, no difference was found between friction forces generated by females and males. Friction force was higher on hydrophilic surfaces than on hydrophobic ones and was lower on both sides of V. faba leaf compared with both hydrophilic and hydrophobic artificial smooth surfaces. On the surfaces with different roughness, the friction force values varied significantly, with the higher attachment ability on the surface with very high asperity size followed by the smooth surface. The lowest attachment was on the surfaces with intermediate asperity sizes. These results could be related to the specific combination of attachment devices of N. viridula.
Directory of Open Access Journals (Sweden)
Rosario Paolo Mauro
2015-06-01
Full Text Available Cover crops can offer significant advantages in the agronomic management of citrus orchards in Mediterranean environments. Therefore, a three-year research was conducted in eastern Sicily aimed at studying the effects of four cover crop sequences (Sinapis arvensis-Trigonella foenum-graecum-T. foenum-graecum; Medicago scutellata-Avena sativa-Lolium perenne; Vicia faba minor-A. sativa-A. sativa; A. sativa-V. faba. minor-L. perenne on weeds, major soil chemical properties and nutritional status of an organically grown orange orchard. The results highlighted that, among the studied cover crop sequences, Vicia faba-Avena-Avena was the most beneficial for weeds control within the orchard (92%, of cover crop cover, and 586 and 89 g DW m–2 of cover crop aboveground biomass and weeds aboveground biomass, respectively. Overall, the chemical fertility of the soil was positively influenced. In particular, it was observed an increase of the content of total nitrogen and available phosphorus in the soil by both Sinapis-Trigonella-Trigonella (0.75 g kg–1 and 59.0 mg kg–1, respectively and Vicia faba-Avena-Avena (0.70 g kg–1 and 56.0 mg kg–1, respectively cover crop sequences. Medicago-Avena-Lolium sequence seemed to be the most useful to ensure a better nutritional status of the orange orchard.
Project Listen Compute Show (LCS) - Marine
2004-02-01
TECHNICAL REPORT NATICK/TR-04/010 APA ^QO^U PROJECT LISTEN, COMPUTE, SHOW (LCS) - MARINE by Victor Zue* John Wroclawski* and Michael Bolotski...Voice Communication Strategy 37 6.3 Adaptive Channel Multiplexing 38 6.4 Web Performance and the Cache Information Protocol 41 7. Handheld Device...view of the BB-4 stack. The digital board is at the top. Most of the area is the large FPGA and the two frame buffer memories 61 Figure 14
Trematode Hemoglobins Show Exceptionally High Oxygen Affinity
Kiger, Laurent; Rashid, Aftab K.; Griffon, Nathalie; Haque, Masoodul; Moens, Luc; Gibson, Quentin H.; Poyart, Claude; Marden, Michael C.
1998-01-01
Ligand binding studies were made with hemoglobin (Hb) isolated from trematode species Gastrothylax crumenifer (Gc), Paramphistomum epiclitum (Pe), Explanatum explanatum (Ee), parasitic worms of water buffalo Bubalus bubalis, and Isoparorchis hypselobagri (Ih) parasitic in the catfish Wallago attu. The kinetics of oxygen and carbon monoxide binding show very fast association rates. Whereas oxygen can be displaced on a millisecond time scale from human Hb at 25 degrees C, the dissociation of ox...
Directory of Open Access Journals (Sweden)
Sandra Ruíz Moreno
2002-01-01
Full Text Available Para tener un punto de vista claro y objetivo frente a la polémica establecida en torno al programa Protagonistas de novela y la tendiente proliferación de los reality show en las parrillas de programación de la televisión colombiana, se realizó un análisis de texto y contenido de dicho programa, intentando definirlo desde sus posibilidades de realidad, ficción y show. Las unidades de análisis y el estudio de su tratamiento arrojaron un alto contenido que gira en torno a las emociones del ser humano relacionadas con la convivencia, tratadas a manera de show y con algunos aportes textuales de ficción, pero sin su elemento mediador básico, el actor, quitándole toda la posibilidad de tener un tratamiento con la profundidad, distancia y ética que requieren los temas de esta índole. El resultado es un formato que sólo busca altos índices de sintonía y que pertenece más a la denominada televisión trash, que a una búsqueda de realidad del hombre y mucho menos de sociedad.
Directory of Open Access Journals (Sweden)
Pietro Pennisi
2011-04-01
Full Text Available The aim of the experiment was to study the effect of concentrates including legume seeds (Vicia faba var. minor or Pisum sativum on lamb performances and on meat quality, with an emphasis on intramuscular fatty acid composition. Thirty lambs (14.5 ± 3.45 kg live weight were randomly assigned to three dietary treatments: PEA group (concentrate including 400 g/kg of peas; FB group (concentrate including 380 g/kg of faba bean; SBM group (concentrate including 180 g/kg of soybean meal. Growth and slaughter performances were not affected by treatments as well as physical and proximate chemical meat characteristics. FB and SBM meat showed higher (P<0.001 vaccenic acid levels compared to PEA meat. Oleic acid was higher (P<0.05 in PEA meat compared to SBM meat while its level in FB meat was similar to counterparts. Linoleic acid levels tended to increase (P<0.10 in SBM lambs compared to PEA animals. PEA group showed higher (P<0.001 α-linolenic acid proportions compared to FB and SBM groups and a tendentially higher (P<0.10 eicosapentaenoic acid content compared to SBM meat. As a result, total n-3 fatty acids were higher (P<0.05 in PEA meat compared to SBM one while the proportions in FB meat were at intermediate level. These findings accounted for a lower and more favourable (P<0.001 n-6/n-3 ratio in PEA group compared to counterparts. Peas based-concentrate seemed to be more effective than faba bean- or soybean meal-included concentrates to improve the acidic profile of meat leading to higher α-linolenic acid levels and a lower n-6/n-3 ratio.
Software for portable laser light show system
Buruchin, Dmitrey J.; Leonov, Alexander F.
1995-04-01
Portable laser light show system LS-3500-10M is connected to the parallel port of IBM PC/AT compatible computer. Computer performs output of digital control data describing images. Specially designed control device is used to convert digital data coming from parallel port to the analog signal driving scanner. Capabilities of even cost nothing 286 computer are quite enough for laser graphics control. Technology of scanning used in laser graphics system LS-3500-10M essentially differs from widely spread systems based on galvanometers with mobile core or with mobile magnet. Such devices are based on the same principle of work as electrically driven servo-mechanism. As scanner we use elastic system with hydraulic dampen oscillations and opened loop. For most of applications of laser graphics such system provides satisfactory precision and speed of scanning. LS-3500-10M software gives user ability to create on PC and play his own laser graphics demonstrations. It is possible to render recognizable text and pictures using different styles, 3D and abstract animation. All types of demonstrations can be mixed in slide-show. Time synchronization is supported. Software has the following features: (1) Different types of text output. Built-in text editor for typing and editing of textural information. Different fonts can be used to display text. User can create his own fonts using specially developed font editor. (2) Editor of 3D animation with library of predefined shapes. (3) Abstract animation provided by software routines. (4) Support of different graphics files formats (PCX or DXF). Original algorithm of raster image tracing was implemented. (5) Built-in slide-show editor.
Asteroid Ida - 6 Views Showing Rotation
1994-01-01
This composite image shows the asteroid 243 Ida as seen from the Galileo spacecraft during its approach on August 28, 1993. The six views were shuttered through the camera's green filter and show Ida's rotation over a period of about 3 hours 18 minutes. The asteroid makes a complete rotation every 4 hours 38 minutes; therefore, this set of images spans about 3/4 of Ida's rotation period and shows most of Ida's surface. By combining the information in these views with that from the highest resolution images returned from the spacecraft in September 1993, the size and shape of this irregular body can now be determined accurately The asteroid appears to be about 58 kilometers (36 miles) long and about 23 kilometers wide, with a very irregular shape and volume of some 16,000 cubic kilometers. The images are arranged in chronological order from a time 3 hours 51 minutes before closest approach (upper left), through upper right, middle left, middle right lower left and lower right (33 minutes before closest approach). The six images show Ida at the same scale throughout. Ida's rotation axis is roughly vertical in these images, and the rotation causes the right-hand end of Ida to move toward the viewer as time progresses. The first image was taken from a range of about 171,000 km (106,000 miles) and provides an image resolution of about 1,700 meters per pixel (the highest resolution achieved for Ida is about 25 meters per pixel). The second, taken 70 minutes later, is from 119,000 kilometers, followed by 102,000 kilometers, 85,000 kilometers, 50,000 kilometers, and 25,000 kilometers. The features on Ida are less sharp in the earlier views because of the greater distances. Prominent in the middle three views is a deep depression across the short axis of the Asteroid. This feature tends to support the idea that Ida may have originally been formed from two or more separate large objects that collided softly and stuck together. Also visible in the lower left view is an
Trematode hemoglobins show exceptionally high oxygen affinity.
Kiger, L; Rashid, A K; Griffon, N; Haque, M; Moens, L; Gibson, Q H; Poyart, C; Marden, M C
1998-08-01
Ligand binding studies were made with hemoglobin (Hb) isolated from trematode species Gastrothylax crumenifer (Gc), Paramphistomum epiclitum (Pe), Explanatum explanatum (Ee), parasitic worms of water buffalo Bubalus bubalis, and Isoparorchis hypselobagri (Ih) parasitic in the catfish Wallago attu. The kinetics of oxygen and carbon monoxide binding show very fast association rates. Whereas oxygen can be displaced on a millisecond time scale from human Hb at 25 degrees C, the dissociation of oxygen from trematode Hb may require a few seconds to over 20 s (for Hb Pe). Carbon monoxide dissociation is faster, however, than for other monomeric hemoglobins or myoglobins. Trematode hemoglobins also show a reduced rate of autoxidation; the oxy form is not readily oxidized by potassium ferricyanide, indicating that only the deoxy form reacts rapidly with this oxidizing agent. Unlike most vertebrate Hbs, the trematodes have a tyrosine residue at position E7 instead of the usual distal histidine. As for Hb Ascaris, which also displays a high oxygen affinity, the trematodes have a tyrosine in position B10; two H-bonds to the oxygen molecule are thought to be responsible for the very high oxygen affinity. The trematode hemoglobins display a combination of high association rates and very low dissociation rates, resulting in some of the highest oxygen affinities ever observed.
Microbiological and environmental issues in show caves.
Saiz-Jimenez, Cesareo
2012-07-01
Cultural tourism expanded in the last half of the twentieth century, and the interest of visitors has come to include caves containing archaeological remains. Some show caves attracted mass tourism, and economical interests prevailed over conservation, which led to a deterioration of the subterranean environment and the rock art. The presence and the role of microorganisms in caves is a topic that is often ignored in cave management. Knowledge of the colonisation patterns, the dispersion mechanisms, and the effect on human health and, when present, over rock art paintings of these microorganisms is of the utmost importance. In this review the most recent advances in the study of microorganisms in caves are presented, together with the environmental implications of the findings.
Genotypically defined lissencephalies show distinct pathologies.
Forman, Mark S; Squier, Waney; Dobyns, William B; Golden, Jeffrey A
2005-10-01
Lissencephaly is traditionally divided into 2 distinct pathologic forms: classic (type I) and cobblestone (type II). To date, mutations in 4 genes, LIS1, DCX, RELN, and ARX, have been associated with distinct type I lissencephaly syndromes. Each of these genes has been shown to play a role in normal cell migration, consistent with the presumed pathogenesis of type I lissencephaly. Based on these data, we hypothesized that all forms of radiographically defined type I lissencephaly independent of genotype would be pathologically similar. To test this hypothesis, we examined brains from 16 patients, including 15 lissencephalic patients and one patient with subcortical band heterotopia. Of these 16 patients, 6 had LIS1 deletions, 2 had DCX mutations, and 2 had ARX mutations. In addition, 6 patients had no defined genetic defect, although the patient with subcortical band heterotopia exhibited the same pattern of malformation expected with an XLIS mutation. In all cases, the cortex was thickened; however, the topographic distribution of the cortical pathology varied, ranging from frontal- to occipital-biased pathology to diffuse involvement of the neocortex. Although brains with LIS1 deletions exhibited the classic 4-layer lissencephalic architecture, patients with DCX and ARX mutations each had unique cytoarchitectural findings distinct from LIS1. Furthermore, 2 of the 5 patients with no known genetic defect showed a fourth type of histopathology characterized by a 2-layered cortex. Interestingly, the 2 brains with the fourth type of lissencephaly showed profound brainstem and cerebellar abnormalities. In summary, we identified at least 4 distinct histopathologic subtypes of lissencephaly that stratify with the underlying genetic defect. Based on these data, a new classification for lissencephaly is proposed that incorporates both pathologic and genetic findings.
Directory of Open Access Journals (Sweden)
Rihem eMoujahed
2014-11-01
Full Text Available Plants respond to insect oviposition by emission of oviposition-induced plant volatiles (OIPVs which can recruit egg parasitoids of the attacking herbivore. To date, studies demonstrating egg parasitoid attraction to OIPVs have been carried out in tritrophic systems consisting of one species each of plant, herbivore host, and the associated egg parasitoid. Less attention has been given to plants experiencing multiple attacks by host and non-host herbivores that potentially could interfere with the recruitment of egg parasitoids as a result of modifications to the OIPV blend. Egg parasitoid attraction could also be influenced by the temporal dynamics of multiple infestations, when the same non-host herbivore damages different organs of the same plant species. In this scenario we investigated the responses of egg parasitoids to feeding and oviposition damage using a model system consisting of Vicia faba, the above-ground insect herbivore Nezara viridula, the above- and below-ground insect herbivore Sitona lineatus, and Trissolcus basalis, a natural enemy of N. viridula. We demonstrated that the non-host S. lineatus disrupts wasp attraction toward plant volatiles induced by the host N. viridula. Interestingly, V. faba damage inflicted by either adults (i.e. leaf-feeding or larvae (i.e. root-feeding of S. lineatus, had a similar disruptive effect on T. basalis host location, suggesting that a common interference mechanism might be involved. Neither naïve wasps or wasps with previous oviposition experience were attracted to plant volatiles induced by N. viridula when V. faba plants were concurrently infested with S. lineatus adults or larvae. Analysis of the volatile blends among healthy plants and above-ground treatments show significant differences in terms of whole volatile emissions. Our results demonstrate that induced plant responses caused by a non-host herbivore can disrupt the attraction of an egg parasitoid to a plant that is also infested
Directory of Open Access Journals (Sweden)
Antonio Gabriel Filho
2000-12-01
properties. The use of plants for green cover manure and the use of minimum tillage may contribute to reduction of soil erosion and to facilitate manual harvest. An experiment in eutrophic Oxisol, located in Marechal Cândido Rondon country state of Paraná, Brazil, was carried out to collect information on the physical soil properties, harvest effort strength and cassava productivity. Experimental design was composed by eight treatments with four repetitions on a 2x4 factorial. Were used two soil tillage (conventional and minimum and four soil cover types: common vetch (Vicia sativa, black oat (Avena strigosa, common vetch plus black oat and bare soil. The results showed that soil density and resistance to penetration in the 0-10cm layer were higher under conventional than under minimum tillage. There were no differences for cassava harvest effort and cassava productivity between soil tillage treatments as well as among types of soil cover. No significant interaction was detected also. It is hypotesized that the results obtained are due to the fact that soil used did not have compaction, the soil had a high degree of natural fertility and there was no water stress during the experiment. Consequenthy, minimum tillage may substitute conventional tillage and reduce costs for cassava cropping.
Individual ant workers show self-control.
Wendt, Stephanie; Czaczkes, Tomer J
2017-10-01
Often, the first option is not the best. Self-control can allow humans and animals to improve resource intake under such conditions. Self-control in animals is often investigated using intertemporal choice tasks-choosing a smaller reward immediately or a larger reward after a delay. However, intertemporal choice tasks may underestimate self-control, as test subjects may not fully understand the task. Vertebrates show much greater apparent self-control in more natural foraging contexts and spatial discounting tasks than in intertemporal choice tasks. However, little is still known about self-control in invertebrates. Here, we investigate self-control in the black garden ant Lasius niger We confront individual workers with a spatial discounting task, offering a high-quality reward far from the nest and a poor-quality reward closer to the nest. Most ants (69%) successfully ignored the closer, poorer reward in favour of the further, better one. However, when both the far and the close rewards were of the same quality, most ants (83%) chose the closer feeder, indicating that the ants were indeed exercising self-control, as opposed to a fixation on an already known food source. © 2017 The Author(s).
Offshore technology stresses substance over show
Energy Technology Data Exchange (ETDEWEB)
Wright, T.R. Jr.; Abraham, K.S.
1988-07-01
Emphasis these days continues to be on practical, cost-effective solutions to real problems. With a couple of exceptions, gone are the glitz and glamour of big-ticket items developed on speculation for projects and situations that don't yet exist. Manufacturers are cautiously spending money on R and D for more down-to-earth items. There seems to be a motto that ''less can be more,'' if researchers focus their limited resources on developing items that are more efficient, easier to install and operate, and save money. Items reviewed on this and other pages by WORLD OIL this year are certainly reflective of such attitudes. Short on show, but long on substance, they provide practical answers to everyday, routine problems encountered by offshore operators. They range from a subsea wireline lubricator developed by BP and Schlumberger, to a new ''armoring'' system that coats platform risers and saves them from the ravages of Mother Nature. There are also an electric safety valve and assorted other goodies. In addition, engineers have completed a fascinating study, which determined why some drilling vessels really sank during blowouts. It is incorrect to assume that large-sized innovations have disappeared completely. For instance, Conoco and others have designed a single-leg, tension-leg platform for Gulf of Mexico duty, which is featured below. Keep in mind, however, the primary motivation for this design was to improve logistics, shorten the timeframe, and save money.
The Comparison Between Chinese Puppet Show and Chinese-Javanese Blend Puppet Show in Indonesia
Directory of Open Access Journals (Sweden)
Agustinus Sufianto
2011-04-01
Full Text Available Since some centuries ago, Indonesia has been one of the destinations for immigrating Chinese. When the Chinese came to Indonesia, they also brought their cultures and customs. Some of them have a cultural-cross marriage with local Indonesian and brought their cultures to be introduced to local Indonesian. When the relationship between Chinese and Indonesian became stronger in some fields such as trade, education and politic, some of Chinese cultures has been adapted by local Indonesian or has been assimilated with local cultures. This adaption process was hindered when the New Order of Soeharto government had banned all Chinese culture, including anything closely related. So, the Chinese-Javanese blend puppet show that also brings Chinese culture couldn’t get any supports and its development faces difficulties. The writer using a qualitative methodology interviewed some of Chinese-Javanese puppet show artist and observation of the puppet show performance to make a comparison between Chinese puppet show and Chinese-Javanese blend puppet show in Indonesia. Chinese-Javanese puppet show or usually can be determined as Indonesian potehi puppet Show has some differences from Chinese puppet show. The differences can be found in the making of puppet, puppet profiles, performance way and stories.
Directory of Open Access Journals (Sweden)
abdolreza ahmadi
2017-01-01
significant 1% and 5%. Results and discussion There was significant difference between minimum and maximum dry weight of weeds, the results showed that barley have important role in weed control wild safflower. Therefore, weed control efficiency in 15 plant in m2 was higher than two 10 and 20 plant in m2. The lowest WCE (161.27% was found at 15-35-65 treatment, but, the highest WCE (51.99 was obtained from 15-65-35 (Wild safflower-common vetch-barley treatment. Computes showed that WCE, in 15 plants of wild safflower/m2, was more than 10 and 20 p/m2. The reduction in weed population and biomass in intercropping systems with barley may be attributed to shading effect and competition stress created by the canopy. Thus, result showed that reduction rate of common vetch in intercropping, with bearing compatibility power to weeds reduced LER. CR for common vetch intercropping component in comparison with barley in total treatments was>1. The highest CR, for vetch obtained from treatment 45-55-control (2.64 and for barley from seed ratio 65-35-control (1.83. Conclusion The results in this study showed various seed rate had noticeable effect on forage yield, LER and weed control. In this experiment changing seed rate in two tested plants (barly- commen vetch changed the number and weed species, as a result noticeable changing was created in their competitive power. Result showed that seed rate (35% barley-65% common vetch was better than other treatment, not only in use efficiency of environment, but also it had more dry forage yield. Also, former seed rate had effective role in decreasing the weed biomass. This important result was related to reduced light penetrate at the bottom of cover crop and probably lack of competition in access to environmental resources was also affected. So using this seed density for mentioned area is recommended for reducing weed competition and improving the quality and quantity of dry forage. Acknowledgments The authors gratefully acknowledge the
Directory of Open Access Journals (Sweden)
Jadwiga ANDRZEJEWSKA
2006-12-01
Full Text Available In the years 2001 and 2002, the study was conducted in six experiments in order to examine the conditioning of the length of stem variability and its impact on cropping features of determinate and indeterminate cultivars of common vetch. Rainfall in June and July as well as during the whole growing season was positively correlated with length of stem, but negatively correlated with seed yield, to a larger extent in the group of indeterminate cultivars than in the determinate one. Duration of blooming stage, length of stem, and seed yield showed the largest variability in both groups. Increase in length of stem of plants of indeterminate cultivars led to the delay in maturation, to less even maturation, and to the decrease in the thousand seed weight and seed yield. Increase in length of stem of plants of determinate cultivars delayed reaching the phase of technical maturation and decreased evenness of plant maturation. Determinate growth of common vetch did not lead to the reduction of lodging.
Garduño-Castro, Y; Espinoza-Ortega, A; González-Esquivel, C E; Mateo-Salazar, B; Arriaga-Jordán, C M
2009-06-01
Small-scale dairy systems in the highlands of central Mexico require feeding strategies based on quality home-grown forage that may reduce high concentrate costs. Eight Holstein cows paired by parity and date of calving were used in a split-plot experiment to evaluate supplementing 6 kg DM/cow/d of oat-vetch silage (OVS) in comparison to maize silage (MS) as dry season feeding, for a more intensive use of the land through an oat-vetch catch crop. Cows had 9 h/d access to continuous grazing of perennial ryegrass - white clover pasture and 4 kg/d of commercial concentrate. The 9 week experiment, recorded weekly milk yield and composition, and body condition score and live-weight every fortnight. Milk yield was 20.1 kg/cow/d for OVS and 15.4 for MS (SEM +/-2.9, P > 0.05), with no differences for fat or protein content, body condition score, or live-weight (P > 0.05). The economic analysis showed that although feeding costs were higher for OVS, margins were greater than for MS, with feeding cost per litre of $0.21 for MS and $0.16 for OVS. OVS is a viable catch crop after the MS harvest that can substitute MS in the dry season enabling a more intensive use of the land.
Nissan at 33rd Tokyo Motor Show; Dai 33 kai Tokyo Motor show
Energy Technology Data Exchange (ETDEWEB)
Sekiguchi, M. [Nissan Motor Co. Ltd., Tokyo (Japan)
2000-01-01
The Tokyo Motor Show is one of the leading exhibition opportunities for automobile companies world wide in terms of both scale and features, including the number of visitors as well as the devotion of each participant. For many years, we have worked hard to excell at each session of this show, (through the display of concept cars and Nissan Motor's technological developments), the show has played an increasing role in enhancing Nissan's brand image. At the 33rd Tokyo Motor Show in October 1999 was held at a time when Nissan had drawn the attention of the market because of its tic-up with Renault. Nissan demonstrated a revolutionary change through the introduction of concept cars, environmental technology, safety technology, new models, and so on. (author)
Best in show but not best shape: a photographic assessment of show dog body condition.
Such, Z R; German, A J
2015-08-01
Previous studies suggest that owners often wrongly perceive overweight dogs to be in normal condition. The body shape of dogs attending shows might influence owners' perceptions, with online images of overweight show winners having a negative effect. This was an observational in silico study of canine body condition. 14 obese-prone breeds and 14 matched non-obese-probe breeds were first selected, and one operator then used an online search engine to identify 40 images, per breed, of dogs that had appeared at a major national UK show (Crufts). After images were anonymised and coded, a second observer subjectively assessed body condition, in a single sitting, using a previously validated method. Of 1120 photographs initially identified, 960 were suitable for assessing body condition, with all unsuitable images being from longhaired breeds. None of the dogs (0 per cent) were underweight, 708 (74 per cent) were in ideal condition and 252 (26 per cent) were overweight. Pugs, basset hounds and Labrador retrievers were most likely to be overweight, while standard poodles, Rhodesian ridgebacks, Hungarian vizslas and Dobermanns were least likely to be overweight. Given the proportion of show dogs from some breeds that are overweight, breed standards should be redefined to be consistent with a dog in optimal body condition. British Veterinary Association.
Materiales carpológicos del yacimiento de Peñalosa (Baños de la Encina, Jaén
Directory of Open Access Journals (Sweden)
Arnanz Carrero, Ana
1991-12-01
Full Text Available In this paper the results of fruits and seeds remains analysed from Peñalosa are presented. Cultivated products such as wheat (Triticum aestivum, L., barley (Hordeum vulgare, L., fieldpeas (Pisum sativum L. and horsebeans (Vicia faba, L. have been found almost exclusively.
En el artículo se presentan los resultados de los análisis paleucarpológicus efectuados en el yacimiento de Peñalosa. Se documenta una presencia casi exclusiva de productos cultivares que se reducen a cariópsides dl' trigo (Triticun aestivun L. y cebada (Hordeun vulgare L. junto a legumbres como el guisante (Pisum sativun L. y las habas (Vicia faba L., fundamentalmente.
SUPPLEMENTARY VALUE OF VETCH (VICIA DASYCARPA) HAY ...
African Journals Online (AJOL)
Personal
(Boran x Friesian) cows fed with a basal diet of urea-molasses-treated wheat straw. ... wheat straw. INTRODUCTION. Wheat straw is one of the major cereal crop residues produced in the world. As an example, around 2.5 million tons of wheat straw are produced annually .... temperature in sealed plastic bags until required.
SUPPLEMENTARY VALUE OF VETCH (VICIA DASYCARPA) HAY ...
African Journals Online (AJOL)
Personal
on feed intake and digestibility as well as milk production and composition in lactating F1 crossbred. (Boran x Friesian) cows ... cows of similar milk yield (8–10 kg d-1), body weight (BW) and stage of lactation (early lactation), but differing in parities were ... vetch in the daily ration of lactating cows can only be justified when ...
Tomato Fruits Show Wide Phenomic Diversity but Fruit Developmental Genes Show Low Genomic Diversity.
Directory of Open Access Journals (Sweden)
Vijee Mohan
Full Text Available Domestication of tomato has resulted in large diversity in fruit phenotypes. An intensive phenotyping of 127 tomato accessions from 20 countries revealed extensive morphological diversity in fruit traits. The diversity in fruit traits clustered the accessions into nine classes and identified certain promising lines having desirable traits pertaining to total soluble salts (TSS, carotenoids, ripening index, weight and shape. Factor analysis of the morphometric data from Tomato Analyzer showed that the fruit shape is a complex trait shared by several factors. The 100% variance between round and flat fruit shapes was explained by one discriminant function having a canonical correlation of 0.874 by stepwise discriminant analysis. A set of 10 genes (ACS2, COP1, CYC-B, RIN, MSH2, NAC-NOR, PHOT1, PHYA, PHYB and PSY1 involved in various plant developmental processes were screened for SNP polymorphism by EcoTILLING. The genetic diversity in these genes revealed a total of 36 non-synonymous and 18 synonymous changes leading to the identification of 28 haplotypes. The average frequency of polymorphism across the genes was 0.038/Kb. Significant negative Tajima'D statistic in two of the genes, ACS2 and PHOT1 indicated the presence of rare alleles in low frequency. Our study indicates that while there is low polymorphic diversity in the genes regulating plant development, the population shows wider phenotype diversity. Nonetheless, morphological and genetic diversity of the present collection can be further exploited as potential resources in future.
Génomique végétale : partenariats public- privé visant à assurer la ...
International Development Research Centre (IDRC) Digital Library (Canada)
Kayje Booker
http://dx.doi.org/10.1038/nbt.2022. Luzerne. Medicago truncatula. Légume modèle. Formation de nodules et fixation de l'azote. Nature. 2011. 22 décembre. DOI : 10.1038/nature10625. Gourgane. Pois. Vicia faba. Pisum sativum. Vivrière et fourragère. BMC Genomics. 2012. 20 mars. DOI : 10.1186/1471-2164-13-104.
Analysis of the Variation Potential Induced by Wounding in Plants
G., Roblin; Universite de Poitiers, Station Biologique de Beau-Site
1985-01-01
Following burning of a leaf portion, a bioelectrical wave called "variation potential" spread throughout the whole plant. Bioelectrical variations are recorded by two types of electrodes (platinum wires and Ag/AgCl nonpolarizable electrodes) in the stem of Vicia faba and in the petiole of Lycopersicon esculentum and Mimosa pudica. The time course of the variation potential thus recorded can be divided into two components respectrvely called components "A" and "B". Component A looks like a neg...
Directory of Open Access Journals (Sweden)
Schaefer Hanno
2012-12-01
Full Text Available Abstract Background Tribe Fabeae comprises about 380 legume species, including some of the most ancient and important crops like lentil, pea, and broad bean. Breeding efforts in legume crops rely on a detailed knowledge of closest wild relatives and geographic origin. Relationships within the tribe, however, are incompletely known and previous molecular results conflicted with the traditional morphology-based classification. Here we analyse the systematics, biogeography, and character evolution in the tribe based on plastid and nuclear DNA sequences. Results Phylogenetic analyses including c. 70% of the species in the tribe show that the genera Vicia and Lathyrus in their current circumscription are not monophyletic: Pisum and Vavilovia are nested in Lathyrus, the genus Lens is nested in Vicia. A small, well-supported clade including Vicia hirsuta, V. sylvatica, and some Mediterranean endemics, is the sister group to all remaining species in the tribe. Fabeae originated in the East Mediterranean region in the Miocene (23–16 million years ago (Ma and spread at least 39 times into Eurasia, seven times to the Americas, twice to tropical Africa and four times to Macaronesia. Broad bean (V. faba and its sister V. paucijuga originated in Asia and might be sister to V. oroboides. Lentil (Lens culinaris ssp. culinaris is of Mediterranean origin and together with eight very close relatives forms a clade that is nested in the core Vicia, where it evolved c. 14 Ma. The Pisum clade is nested in Lathyrus in a grade with the Mediterranean L. gloeosperma, L. neurolobus, and L. nissolia. The extinct Azorean endemic V. dennesiana belongs in section Cracca and is nested among Mediterranean species. According to our ancestral character state reconstruction results, ancestors of Fabeae had a basic chromosome number of 2n=14, an annual life form, and evenly hairy, dorsiventrally compressed styles. Conclusions Fabeae evolved in the Eastern Mediterranean in the
DEFF Research Database (Denmark)
Mayer, J.; Buegger, F.; Jensen, E.S.
2004-01-01
The turnover of N derived from rhizodeposition of faba bean (Vicia faba L.), pea (Pisum sativum L.) and white lupin (Lupinus albus L.) and the effects of the rhizodeposition on the subsequent C and N turnover of its crop residues were investigated in an incubation experiment (168 days, 15 degrees....... In the experiment the turnover of C and N was compared in soils with and without previous growth of three legumes and with and without incorporation of crop residues. After 168 days, 21% (lupin), 26% (faba bean) and 27% (pea) of rhizodeposition N was mineralised in the treatments without crop residues. A smaller......C). A sandy loam soil for the experiment was either stored at 6 degreesC or planted with the respective grain legume in pots. Legumes were in situ N-15 stem labelled during growth and visible roots were removed at maturity. The remaining plant-derived N in soil was defined as N rhizodeposition...
BAĞCI, Muhittin; Mutlu, Hüseyin
2015-01-01
Bu çalışma, “Macar fiği (Vicia pannonica Crantz.) Bitkisinde Gama Işını Uygulaması ile Mutasyon Islahı” projesinin M2 generasyonunu kapsamaktadır. Araştırma, üç Macar fiği çeşidinde, gama ışını dozlarının M2 generasyonunda, bazı bitkisel özellikler üzerine etkilerini belirlemek ve kontrol doz (0 Gy) uygulaması ile karşılaştırmak amacıyla yürütülmüştür. Araştırmada, üç Macar fiği çeşidinin (Tarmbeyazı-98, Anadolupembesi-2002 ve Oğuz-2002) M1 bitkilerinin tohumları ekilmiştir. Elde edilen M2 bi...
Jones, Louise; Milne, Jennifer L; Ashford, David; McCann, Maureen C; McQueen-Mason, Simon J
2005-05-01
Guard cell walls combine exceptional strength and flexibility in order to accommodate the turgor pressure-driven changes in size and shape that underlie the opening and closing of stomatal pores. To investigate the molecular basis of these exceptional qualities, we have used a combination of compositional and functional analyses in three different plant species. We show that comparisons of FTIR spectra from stomatal guard cells and those of other epidermal cells indicate a number of clear differences in cell-wall composition. The most obvious characteristics are that stomatal guard cells are enriched in phenolic esters of pectins. This enrichment is apparent in guard cells from Vicia faba (possessing a type I cell wall) and Commelina communis and Zea mays (having a type II wall). We further show that these common defining elements of guard cell walls have conserved functional roles. As previously reported in C. communis, we show that enzymatic modification of the pectin network in guard cell walls in both V. faba and Z. mays has profound effects on stomatal function. In all three species, incubation of epidermal strips with a combination of pectin methyl esterase and endopolygalacturonase (EPG) caused an increase in stomatal aperture on opening. This effect was not seen when strips were incubated with EPG alone indicating that the methyl-esterified fraction of homogalacturonan is key to this effect. In contrast, arabinanase treatment, and incubation with feruloyl esterase both impeded stomatal opening. It therefore appears that pectins and phenolic esters have a conserved functional role in guard cell walls even in grass species with type II walls, which characteristically are composed of low levels of pectins.
A Temperature-Dependent Phenology Model for Liriomyza huidobrensis (Diptera: Agromyzidae)
Sporleder, Marc; Carhuapoma, Pablo; Kroschel, Jürgen
2017-01-01
Abstract Liriomyza huidobrensis (Blanchard) is an economically important and highly polyphagous worldwide pest. To establish a temperature-dependent phenology model, essential for understanding the development and growth of the pest population under a variety of climates and as part of a pest risk analysis, L. huidobrensis life-table data were collected under laboratory conditions at seven constant temperatures on its host faba bean (Vicia faba L.). Several nonlinear equations were fitted to each life stage to model the temperature-dependent population growth and species life history and finally compile an overall temperature-dependent pest phenology model using the Insect Life Cycle Modeling (ILCYM) software. Liriomyza huidobrensis completed development from egg to adult in all temperatures evaluated, except at 32 °C, which was lethal to pupae. Eggs did not develop at 35 °C. Mean development time of all immature stages decreased with increasing temperature. Nonlinear models predicted optimal temperature for immature survival between 20–25 °C (32–38% mortality of all immature stages). Life-table parameters simulated at constant temperatures indicated that L. huidobrensis develops within the range of 12–28 °C. Simulated life-table for predicting the population dynamics of L. huidobrensis under two contrasting environments showed that lowland temperatures at the coast of Peru (250 m.a.s.l.) presented better conditions for a potential population increase than highland (3,400 m.a.s.l.) conditions. The presented model linked with Geographic Information Systems will allow pest risk assessments in different environmental regions to support the regulation of pest movement to prevent pest entry into not-yet invaded regions as well as to implement effective management strategies. PMID:28334271
If You Show Up, They'll Surprise You
Snow, Carrie C.
2017-01-01
One essential way to support students with autism is to "show up" for them. Showing up means connecting and building relationships with learners and trusting students to show us what they most need to boost their learning and social growth. Snow shares scenarios from her years as a special educator that showcase ways educators can…
Effects of TV Crime Shows on Behavioural Development of Children
Abdullah Mudassar; Abd Rahman Nik Adzrieman B.
2017-01-01
Television crime dramas and shows are very popular all over the world. This popularity is not bound to a certain age group, rather all the TV viewers like these shows very much. Like other countries, dozens of TV channels are telecasting these crime shows in Pakistan. Furthermore, few of the channels telecast crime shows at prime time which attests the popularity of such genre. Some of the media contents behave in morally disputed ways. The crime depictions as re-enactments of TV crime shows ...
Uudised : Otsman taas Riias show'l. Rokkstaarist ministriks
2007-01-01
Drag-kabareeartist Erkki Otsman esineb detsembris Riias "Sapnu Fabrikas" toimuval jõulu-show'l. Austraalia rokkansambli Midnight Oil endine laulja Peter Garrett nimetati valitsuse keskkonnaministriks
47 CFR 73.24 - Broadcast facilities; showing required.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Broadcast facilities; showing required. 73.24 Section 73.24 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES AM Broadcast Stations § 73.24 Broadcast facilities; showing required. An...
"The Daily Show with Jon Stewart": Part 1
Trier, James
2008-01-01
Comedy Central's popular program "The Daily Show With Jon Stewart" is the best critical media literacy program on television, and it can be used in valuable ways in the classroom as part of a media literacy pedagogy. This Media Literacy column provides an overview of the show and its accompanying website and considers ways it might be used in the…
Effects of TV Crime Shows on Behavioural Development of Children
Directory of Open Access Journals (Sweden)
Abdullah Mudassar
2017-01-01
Full Text Available Television crime dramas and shows are very popular all over the world. This popularity is not bound to a certain age group, rather all the TV viewers like these shows very much. Like other countries, dozens of TV channels are telecasting these crime shows in Pakistan. Furthermore, few of the channels telecast crime shows at prime time which attests the popularity of such genre. Some of the media contents behave in morally disputed ways. The crime depictions as re-enactments of TV crime shows are questionable in the field of research signifying diverse cultural contexts. A large number of people are habitual to watch these shows, which may probably come out with negative behavioural outcomes. Especially the children who are at their behavioural developmental phase; are more susceptible to adopt negative behavioural leanings. In this research effort, introduction and detail of TV crime shows in Pakistan are provided, the literature concerning “media as risk factor“ in children development is discussed, and relevant theories inferences are deliberated.it was found that media has powerful role in behaviour formulating of children and violence media portrayal (TV crime shows may appear with grave concerns. Previous scientific literature was reviewed to find and discuss the problem in hand. In the research effort, the literature review provides research propositions to explore further dimensions to TV crime shows’ effects and possible negative or positive behavioural outcomes in children behaviour.
TV shows on Light Pollution Education for the Public
Grigore, Valentin
2015-03-01
TV shows have the biggest impact for the public, so we can use them to inform and educate the public about light pollution and the importance of the dark sky for humanity and for the contemporary society. Some examples used in the TV show Us and the Sky at Columna TV, Romania, are presented.
Pedagogical Techniques Employed by the Television Show "MythBusters"
Zavrel, Erik
2016-01-01
"MythBusters," the long-running though recently discontinued Discovery Channel science entertainment television program, has proven itself to be far more than just a highly rated show. While its focus is on entertainment, the show employs an array of pedagogical techniques to communicate scientific concepts to its audience. These…
36 CFR 14.24 - Showing as to citizenship required.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Showing as to citizenship... INTERIOR RIGHTS-OF-WAY Procedures § 14.24 Showing as to citizenship required. (a) Individuals. An... citizenship is claimed by virtue of naturalization of the father, evidence of his naturalization, and that the...
Television Judge Shows: Nordic and U.S. Perspectives
DEFF Research Database (Denmark)
Porsdam, Helle
2017-01-01
with reality courtroom television. There have been a few judge shows, but these have been completely overshadowed by the success of reality courtroom television. The first reality courtroom show was The People’s Court, and its history and early success are discussed in the opening section of this article......Legal discourse is language that people use in a globalizing and multicultural society to negotiate acceptable behaviors and values. We see this played out in popular cultural forums such as judicial television dramas. In the American context, television judge shows are virtually synonymous....... The next section looks at the television judge show landscape after the first incarnation of The People’s Court up to the present day in the United States. The third section is dedicated to a discussion of television judge shows outside the United States, chiefly in Europe. The focus is on German and Dutch...
ShowFlow: A practical interface for groundwater modeling
Energy Technology Data Exchange (ETDEWEB)
Tauxe, J.D.
1990-12-01
ShowFlow was created to provide a user-friendly, intuitive environment for researchers and students who use computer modeling software. What traditionally has been a workplace available only to those familiar with command-line based computer systems is now within reach of almost anyone interested in the subject of modeling. In the case of this edition of ShowFlow, the user can easily experiment with simulations using the steady state gaussian plume groundwater pollutant transport model SSGPLUME, though ShowFlow can be rewritten to provide a similar interface for any computer model. Included in this thesis is all the source code for both the ShowFlow application for Microsoft{reg sign} Windows{trademark} and the SSGPLUME model, a User's Guide, and a Developer's Guide for converting ShowFlow to run other model programs. 18 refs., 13 figs.
Reki-Show Authoring Tools : Risk, Space and History
Directory of Open Access Journals (Sweden)
Makoto Hanashima
2005-12-01
Full Text Available In social sciences, most events occur in specific time and space. We call such events here "Spatiotemporal Events". It is obvious that events, having always a beginning and an end, appear at a specific place or in particular space. Suppose there exists an conceptual data model regulating some rules to describe those factors, it enables us to store various spatiotemporal events as data and to refer with one another. We, therefore, define a simple spatiotemporal data model, calling "Reki-Show". We also call the information system, consisting of Reki-Show data model, "Reki-Show System", and consider Reki-Show System as the basic information system to deal with the various events in human society. Accordingly, we have recognized that it is indispensable in the future social sciences to have the database and tool for both the temporal and spatial attributes, and have been developing Reki-Show Authoring Tools based on the conceptual framework in Reki-Show System. At present, the fundamental component has been developed already through some steps, and the system is now applied to the empirical research. We would like to make a report of the outline at this stage. This paper explains the basic concept in Reki-Show (Conseptual Data Modeling, followed by the outline of the implemented system.
U.S. Civil Air Show Crashes, 1993 to 2013
Ballard, Sarah-Blythe; Osorio, Victor B.
2016-01-01
This study provides new public health data about U.S. civil air shows. Risk factors for fatalities in civil air show crashes were analyzed. The value of the FIA score in predicting fatal outcomes was evaluated. With the use of the FAA’s General Aviation and Air Taxi Survey and the National Transportation Safety Board’s data, the incidence of civil air show crashes from 1993 to 2013 was calculated. Fatality risk factors for crashes were analyzed by means of regression methods. The FIA index was validated to predict fatal outcomes by using the factors of fire, instrument conditions, and away-from-airport location, and was evaluated through receiver operating characteristic (ROC) curves. The civil air show crash rate was 31 crashes per 1,000 civil air events. Of the 174 civil air show crashes that occurred during the study period, 91 (52%) involved at least one fatality; on average, 1.1 people died per fatal crash. Fatalities were associated with four major risk factors: fire [adjusted odds ratio (AOR) = 7.1, 95% confidence interval (CI) = 2.4 to 20.6, P score’s ROC curve was 0.71 (95% CI = 0.64 to 0.78). Civil air show crashes were marked by a high risk of fatal outcomes to pilots in aerobatic performances but rare mass casualties. The FIA score was not a valid measurement of fatal risk in civil air show crashes. PMID:27773963
QLab 3 show control projects for live performances & installations
Hopgood, Jeromy
2013-01-01
Used from Broadway to Britain's West End, QLab software is the tool of choice for many of the world's most prominent sound, projection, and integrated media designers. QLab 3 Show Control: Projects for Live Performances & Installations is a project-based book on QLab software covering sound, video, and show control. With information on both sound and video system basics and the more advanced functions of QLab such as MIDI show control, new OSC capabilities, networking, video effects, and microphone integration, each chapter's specific projects will allow you to learn the software's capabilitie
Chiochetta, Claudete G; Goetten, Luís C; Almeida, Sônia M; Quaranta, Gaetana; Cotelle, Sylvie; Radetski, Claudemir M
2014-01-01
The chemical and ecotoxicological characteristics of fresh and stabilized industrial organic sludge leachates were compared to obtain information regarding how the stabilization process can influence the ecotoxic potential of this industrial waste, which could be used for the amendment of degraded soil. Physicochemical analysis of the sludge leachates, as well as a battery of eco(geno)toxicity tests on bacteria, algae, daphnids, and higher plants (including Vicia faba genotoxicity test) and the determination of hydrolytic enzyme activity, was performed according to standard methods. The chemical comparison of the two types of leachate showed that the samples obtained from stabilized sludge had a lower organic content and higher metal content than leachates of the fresh sludge. The eco(geno)toxicological results obtained with aquatic organisms showed that the stabilized sludge leachate was more toxic than the fresh sludge leachate, both originating from the same industrial organic sludge sample. Nevertheless, phytotoxicity tests carried out with a reference peat soil irrigated with stabilized sludge leachate showed the same toxicity as the fresh sludge leachate. In the case of the industrial solid organic sludge studied, stabilization through a biodegradation process promoted a higher metal mobility/bioavailability/eco(geno)toxicity in the stabilized sludge leachate compared to the fresh sludge leachate.
Instagram Shows How Diabetics Really Wear a Glucose Monitor
... page: https://medlineplus.gov/news/fullstory_167648.html Instagram Shows How Diabetics Really Wear a Glucose Monitor ... and her colleagues searched the social media site Instagram. They found 353 posts featuring people wearing Dexcom ...
Medicine's moment of misrule: the medical student show.
Hayter, Charles R R
2006-01-01
Medical student shows are a prominent feature of medical student life around the world. Following a traditional vaudeville format of skits and songs, the shows are notorious for their exuberance, bawdiness, and lack of political correctness. Despite their widespread prevalence and sometimes hostile reactions, there has been no previous study of these shows. Based on research of scripts, programs, reviews, and oral history, this article explores their history and content and argues that, far from being irrelevant frivolities, these shows serve several important functions. These include the fostering of communal spirit, the development of skills in teamwork, and the collective ventilation of emotional reactions to the process of becoming a doctor. They are one offshoot of the ancient and important tradition of misrule in Western society.
Type VII secretion-mycobacteria show the way.
Abdallah, A.M.; Gey van Pittius, N.C.; Champion, P.A.; Cox, J.; Luirink, S.; Vandenbroucke-Grauls, C.M.J.E.; Appelmelk, B.J.; Bitter, W.
2007-01-01
Recent evidence shows that mycobacteria have developed novel and specialized secretion systems for the transport of extracellular proteins across their hydrophobic, and highly impermeable, cell wall. Strikingly, mycobacterial genomes encode up to five of these transport systems. Two of these
TOPOLOGICAL AGGREGATION, THE TWIN PARADOX AND THE NO SHOW PARADOX
Chèze, Guillaume
2016-01-01
Consider the framework of topological aggregation introduced by Chichilnisky (1980). We prove that in this framework the Twin Paradox and the No Show Paradox cannot be avoided. Anonymity and unanimity are not needed to obtain these results.
Do men and women show love differently in marriage?
Schoenfeld, Elizabeth A; Bredow, Carrie A; Huston, Ted L
2012-11-01
In Western societies, women are considered more adept than men at expressing love in romantic relationships. Although scholars have argued that this view of love gives short shrift to men's ways of showing love (e.g., Cancian, 1986; Noller, 1996), the widely embraced premise that men and women "love differently" has rarely been examined empirically. Using data collected at four time points over 13 years of marriage, the authors examined whether love is associated with different behaviors for husbands and wives. Multilevel analyses revealed that, counter to theoretical expectations, both genders were equally likely to show love through affection. But whereas wives expressed love by enacting fewer negative or antagonistic behaviors, husbands showed love by initiating sex, sharing leisure activities, and doing household work together with their wives. Overall, the findings indicate that men and women show their love in more nuanced ways than cultural stereotypes suggest.
Self Presentation as Subjective Stancetaking in Celebrity Interview Show
Kyrychuk, Laryssa; Киричук, Лариса
2014-01-01
The paper explores the issues of self-presentation in celebrity interview show from the viewpoint of stancetaking theory. The research is focused on the analysis of self-presentational motivations, the ways of public image reinforcement / modification and communicative characteristics of the celebrity interview show. It specifies the factors that affect celebrity‟s subjective stancetaking as a verbal act of self-presentation in this type of social interaction. It is claimed that the tactics o...
Cutaway artist concept of Gamma Ray Observatory (GRO) showing instruments
1990-01-01
Cutaway artist concept drawing shows Gamma Ray Observatory (GRO) and its instrument locations. The high gain antenna (HGA) and solar array (SA) panels are deployed. The four complement instruments are the Burst and Transient Source Experiment (BATSE) (at the four corners of the satellite), the Oriented Scintillation Spectrometer Experiment (OSSE) (left), the Imaging Compton Telescope (COMPTEL) (center), and the Energetic Gamma Ray Experiment Telescope (EGRET) (right). The exterior covering of each of the four instruments is cutaway showing various components.
Cantilever Resin-Bonded Fixed Dental Prostheses Show Clinical Success
2018-03-26
FROM: 59 MDW/SGVU SUBJECT: Professional Presentation Approval 16 MAR 2017 1. Your paper, entitled Cantilever Resin-Bonded Fixed Dental Prosthesis ...Show Clinical Success presented at/published to Texas Dental Journal in accordance with MDWI 41- 108, has been approved and assigned local file #17147...resin-bonded lixed dental prostheses show clinical success 7. FUNDING RECEIVED FOR THIS STUDY? 0 YES [gj NO FUNDING SOURCE: 8. DO YOU NEED FUNDING
Dolphin shows and interaction programs: benefits for conservation education?
Miller, L J; Zeigler-Hill, V; Mellen, J; Koeppel, J; Greer, T; Kuczaj, S
2013-01-01
Dolphin shows and dolphin interaction programs are two types of education programs within zoological institutions used to educate visitors about dolphins and the marine environment. The current study examined the short- and long-term effects of these programs on visitors' conservation-related knowledge, attitude, and behavior. Participants of both dolphin shows and interaction programs demonstrated a significant short-term increase in knowledge, attitudes, and behavioral intentions. Three months following the experience, participants of both dolphin shows and interaction programs retained the knowledge learned during their experience and reported engaging in more conservation-related behaviors. Additionally, the number of dolphin shows attended in the past was a significant predictor of recent conservation-related behavior suggesting that repetition of these types of experiences may be important in inspiring people to conservation action. These results suggest that both dolphin shows and dolphin interaction programs can be an important part of a conservation education program for visitors of zoological facilities. © 2012 Wiley Periodicals, Inc.
Representasi Pembawa Acara Program Talk Show di Televisi Indonesia
Directory of Open Access Journals (Sweden)
Rahmat Edi Irawan
2013-10-01
Full Text Available Presentation of talk show host program has been known to be intelligent, smart, and is able to direct the conversation in the program well. The presentation is in line with the view of talk show programs packed seriously as a journalistic genre program with emphasis on the truth of the facts or information conveyed. However, in recent years there are different representations associated with the talk show host of the program. The representation shows that a talk show host is not such intelligent and smart, and is not able to direct the conversation in the program properly. The existence of this representation is consistent with the theory of social construction assuming that mass media play a major role in shaping the social reality in the society. As of this writing, the audience receives social reality as a representation. Like the previous presentation, as the television has broadcasted for a long time, people feel that the reality is normative and ideal conditions for them. Public realize that the social reality was only the reconstruction of the television when TV presents a representation of another social reality. Nevertheless, whatever the social reality that is deliberately made or reconstructed by the media, including television, in fact everything is a reality that is deliberately created just for the sake of the manager or owner of the television station.
Uni Dufour | Ig Nobel Show with Marc Abrahams | 7 May
2013-01-01
On 7 May, Marc Abrahams, founder of the Ig Nobel Prize, will give an "Ig Nobel show", in English at Uni Dufour. The Ig Nobel Prizes are an American parody of the Nobel Prizes. In early October of each year, they are awarded to ten unusual or trivial achievements in scientific research. The stated aim of the prizes is to "first make people laugh, and then make them think". Marc Abrahams will introduce this funny and dynamic evening with a short presentation before handing over to a selection of recipients. The show is free and open to all. Tuesday 7 May Ig Nobel Show 6:30 p.m. - Room U600 Uni Dufour
Modulation of Legume Defense Signaling Pathways by Native and Non-native Pea Aphid Clones
Sanchez-Arcos, Carlos; Reichelt, Michael; Gershenzon, Jonathan; Kunert, Grit
2016-01-01
The pea aphid (Acyrthosiphon pisum) is a complex of at least 15 genetically different host races that are native to specific legume plants, but can all develop on the universal host plant Vicia faba. Despite much research, it is still unclear why pea aphid host races (biotypes) are able to colonize their native hosts while other host races are not. All aphids penetrate the plant and salivate into plant cells when they test plant suitability. Thus plants might react differently to the various pea aphid host races. To find out whether legume species vary in their defense responses to different pea aphid host races, we measured the amounts of salicylic acid (SA), the jasmonic acid-isoleucine conjugate (JA-Ile), other jasmonate precursors and derivatives, and abscisic acid (ABA) in four different species (Medicago sativa, Trifolium pratense, Pisum sativum, V. faba) after infestation by native and non-native pea aphid clones of various host races. Additionally, we assessed the performance of the clones on the four plant species. On M. sativa and T. pratense, non-native clones that were barely able to survive or reproduce, triggered a strong SA and JA-Ile response, whereas infestation with native clones led to lower levels of both phytohormones. On P. sativum, non-native clones, which survived or reproduced to a certain extent, induced fluctuating SA and JA-Ile levels, whereas the native clone triggered only a weak SA and JA-Ile response. On the universal host V. faba all aphid clones triggered only low SA levels initially, but induced clone-specific patterns of SA and JA-Ile later on. The levels of the active JA-Ile conjugate and of the other JA-pathway metabolites measured showed in many cases similar patterns, suggesting that the reduction in JA signaling was due to an effect upstream of OPDA. ABA levels were downregulated in all aphid clone-plant combinations and were therefore probably not decisive factors for aphid-plant compatibility. Our results suggest that A
Modulation of Legume Defense Signaling Pathways by Native and Non-native Pea Aphid Clones.
Sanchez-Arcos, Carlos; Reichelt, Michael; Gershenzon, Jonathan; Kunert, Grit
2016-01-01
The pea aphid (Acyrthosiphon pisum) is a complex of at least 15 genetically different host races that are native to specific legume plants, but can all develop on the universal host plant Vicia faba. Despite much research, it is still unclear why pea aphid host races (biotypes) are able to colonize their native hosts while other host races are not. All aphids penetrate the plant and salivate into plant cells when they test plant suitability. Thus plants might react differently to the various pea aphid host races. To find out whether legume species vary in their defense responses to different pea aphid host races, we measured the amounts of salicylic acid (SA), the jasmonic acid-isoleucine conjugate (JA-Ile), other jasmonate precursors and derivatives, and abscisic acid (ABA) in four different species (Medicago sativa, Trifolium pratense, Pisum sativum, V. faba) after infestation by native and non-native pea aphid clones of various host races. Additionally, we assessed the performance of the clones on the four plant species. On M. sativa and T. pratense, non-native clones that were barely able to survive or reproduce, triggered a strong SA and JA-Ile response, whereas infestation with native clones led to lower levels of both phytohormones. On P. sativum, non-native clones, which survived or reproduced to a certain extent, induced fluctuating SA and JA-Ile levels, whereas the native clone triggered only a weak SA and JA-Ile response. On the universal host V. faba all aphid clones triggered only low SA levels initially, but induced clone-specific patterns of SA and JA-Ile later on. The levels of the active JA-Ile conjugate and of the other JA-pathway metabolites measured showed in many cases similar patterns, suggesting that the reduction in JA signaling was due to an effect upstream of OPDA. ABA levels were downregulated in all aphid clone-plant combinations and were therefore probably not decisive factors for aphid-plant compatibility. Our results suggest that A
Modulation of legume defense signaling pathways by native and non-native pea aphid clones
Directory of Open Access Journals (Sweden)
Carlos Sanchez-Arcos
2016-12-01
Full Text Available The pea aphid (Acyrthosiphon pisum is a complex of at least 15 genetically different host races that are native to specific legume plants, but can all develop on the universal host plant Vicia faba. Despite much research it is still unclear why pea aphid host races (biotypes are able to colonize their native hosts while other host races are not. All aphids penetrate the plant and salivate into plant cells when they test plant suitability. Thus plants might react differently to the various pea aphid host races. To find out whether legume species vary in their defense responses to different pea aphid host races, we measured the amounts of salicylic acid (SA, the jasmonic acid-isoleucine conjugate (JA-Ile, other jasmonate precursors and derivatives, and abscisic acid (ABA in four different species (Medicago sativa, Trifolium pratense, Pisum sativum, V. faba after infestation by native and non-native pea aphid clones of various host races. Additionally, we assessed the performance of the clones on the four plant species. On M. sativa and T. pratense, non-native clones that were barely able to survive or reproduce, triggered a strong SA and JA-Ile response, whereas infestation with native clones led to lower levels of both phytohormones. On P. sativum, non-native clones, which survived or reproduced to a certain extent, induced fluctuating SA and JA-Ile levels, whereas the native clone triggered only a weak SA and JA-Ile response. On the universal host V. faba all aphid clones triggered only low SA levels initially, but induced clone-specific patterns of SA and JA-Ile later on. The levels of the active JA-Ile conjugate and of the other JA-pathway metabolites measured showed in many cases similar patterns, suggesting that the reduction in JA signaling was due to an effect upstream of OPDA. ABA levels were downregulated in all aphid clone-plant combinations and were therefore probably not decisive factors for aphid-plant compatibility. Our results
Fusarium spp. suppress germination and parasitic establishment of bean and hemp broomrapes
Directory of Open Access Journals (Sweden)
Mohamed A. Abouzeid
2010-05-01
Full Text Available Thirty-nine Fusarium isolates were obtained from newly emerged infected bean broomrape (Orobanche crenata and hemp broomrape (O. ramosa collected from infested fields of faba bean (Vicia faba and tomato (Lycopersicon esculentum respectively, in two governorates located south of Giza, Egypt. All Fusarium isolates were identified to species level and the effect of their culture filtrates on the germination of seeds from the two Orobanche species was tested in vitro. The inhibition of seed germination differed between the tested Fusarium isolates, depending on the plant part from which they were isolated, with isolates from the shoots of Orobanche inhibiting seed germination more than isolates from the inflorescences. The culture filtrates of Fusarium species from O. crenata were more toxic to the seeds of both Orobanche species than the Fusarium filtrates from O. ramosa. Seeds of O. crenata were more resistant to Fusarium culture filtrates than seeds of O. ramosa. The highest inhibition of Orobanche seed germination was achieved by six Fusarium isolates, one of which was identified as F. oxysporum, one as F. equiseti, whilst the other four were all F. compactum. Aqueous mixtures of mycelia and conidia of all the Fusarium isolates were directly sprayed on O. ramosa tubercles attached to the roots of tomato plants grown in transparent plastic bags, and were also used to infest soil in pots seeded with both faba bean and O. crenata. Two of the four F. compactum isolates (22 and 29 were significantly more pathogenic against O. crenata and O. ramosa, respectively, than the other Fusarium isolates tested in the pots and plastic bags. The study clearly shows the potential of biocontrol agents originating in one Orobanche sp. (e.g. O. crenata to control another Orobanche sp. (e.g. O. ramosa, as many Fusarium isolates deriving from O. crenata were found to be more pathogenic to O. ramosa seeds than the isolates from O. ramosa themselves. This may widen the
CERN cars drive by the Geneva Motor Show
CERN Bulletin
2011-01-01
One of CERN's new gas-fuelled cars was a special guest at the press days of the Geneva motor show this year. The car enjoyed a prominent position on the Gazmobil stand, right next to the latest Mazeratis and Ferraris. Journalists previewing the motor show could discover CERN's support for green technologies and also find out more about the lab - home to the fastest racetrack on the planet, with protons in the LHC running at 99.9999991% of the speed of light.
The Biochemistry Show: a new and fun tool for learning
Directory of Open Access Journals (Sweden)
A.H Ono
2006-07-01
Full Text Available The traditional methods to teach biochemistry in most universities are based on the memorization of chemical structures, biochemical pathways and reagent names, which is many times dismotivating for the students. We presently describe an innovative, interactive and alternative method for teaching biochemistry to medical and nutrition undergraduate students, called the Biochemistry Show (BioBio Show.The Biobio show is based on active participation of the students. They are divided in groups and the groups face each other. One group faces another one group at a time, in a game based on true or false questions that involve subjects of applied biochemistry (exercise, obesity, diabetes, cholesterol, free radicals, among others. The questions of the Show are previously elaborated by senior students. The Biobio Show has four phases, the first one is a selection exam, and from the second to the fourth phase, eliminatory confrontations happen. On a confrontation, the first group must select a certain quantity of questions for the opponent to answer. The group who choses the questions must know how to answer and justify the selected questions. This procedure is repeated on all phases of the show. On the last phase, the questions used are taken from an exam previously performed by the students: either the 9-hour biochemistry exam (Sé et al. A 9-hour biochemistry exam. An iron man competition or a good way of evaluating undergraduate students? SBBq 2005, abstract K-6 or the True-or-False exam (TFE (Sé et al. Are tutor-students capable of writing good biochemistry exams? SBBq 2004, abstract K-18. The winner group receives an extra 0,5 point on the final grade. Over 70% of the students informed on a questionnaire that the Biobio Show is a valuable tool for learning biochemistry. That is a new way to enrich the discussion of biochemistry in the classroom without the students getting bored. Moreover, learning
Modelli televisivi e apprendimento. Il talk show “Gladiattori”
Directory of Open Access Journals (Sweden)
Lorenzo Denicolai
2015-09-01
Full Text Available L’articolo presenta il talk show “Gladiattori”, format per web tv ideato e sviluppato dal centro interdipartimentale di ricerca Cinedumedia, Dipartimento di Filosofia e Scienze dell’Educazione, Università degli Studi di Torino. Lo scopo del progetto è sperimentare una metodologia didattica innovativa con il video e i linguaggi multimediali. Partendo dalla teoria del dialogo platonico e da alcuni studi di pragmatica, comunicazione, antropologia della performance e televisione, l’articolo analizza come il talk show (e, in genere, il video possa essere utilizzato nella didattica e nella formazione per acquisire competenze e conoscenza e applicare un nuovo interattivo, collaborativo e collettivo metodo di studio.
Grant, G; More, L J; McKenzie, N H; Stewart, J C; Pusztai, A
1983-09-01
Eighty-five samples from fifteen different legume seed lines generally available in the UK were examined by measurements of their net protein utilization by rats and by haemagglutination tests with erythrocytes from a number of different animal species. From these results the seeds were classified into four broad groups. Group a seeds from most varieties of kidney (Phaseolus vulgaris), runner (Phaseolus coccineus) and tepary (Phaseolus acutifolius) beans showed high reactivity with all cell types and were also highly toxic. Group b, which contained seeds from lima or butter beans (Phaseolus lunatus) and winged bean (Psophocarpus tetragonolobus), agglutinated only human and pronase-treated rat erythrocytes. These seeds did not support proper growth of the rats although the animals survived the 10 d experimental period. Group c consisted of seeds from lentils (Lens culinaris), peas (Pisum sativum), chick-peas (Cicer arietinum), blackeyed peas (Vigna sinensis), pigeon peas (Cajanus cajan), mung beans (Phaseolus aureus), field or broad beans (Vicia faba) and aduki beans (Phaseolus angularis). These generally had low reactivity with all cells and were non-toxic. Group d, represented by soya (Glycine max) and pinto (Phaseolus vulgaris) beans, generally had low reactivity with all cells but caused growth depression at certain dietary concentrations. This growth depression was probably mainly due to antinutritional factors other than lectins. Lectins from group a seeds showed many structural and immunological similarities. However the subunit composition of the lectin from the tepary bean samples was different from that of the other bean lectins in this or any other groups.
Angiotensin-converting enzymes modulate aphid-plant interactions.
Wang, Wei; Luo, Lan; Lu, Hong; Chen, Shaoliang; Kang, Le; Cui, Feng
2015-03-06
Angiotensin-converting enzymes (ACEs) are key components of the renin-angiotensin system in mammals. However, the function of ACE homologs in insect saliva is unclear. Aphids presumably deliver effector proteins via saliva into plant cells to maintain a compatible insect-plant interaction. In this study, we showed that ACE modulates aphid-plant interactions by affecting feeding behavior and survival of aphids on host plants. Three ACE genes were identified from the pea aphid Acyrthosiphon pisum genome. ACE1 and ACE2 were highly expressed in the salivary glands and are predicted to function as secretory proteins. The ACE2 transcript level decreased in aphids fed on artificial diet compared with aphids fed on Vicia faba. The knockdown of the expression of each ACE by RNAi failed to affect aphid survival. When ACE1 and ACE2 were simultaneously knocked down, aphid feeding was enhanced. Aphids required less time to find the phloem sap and showed longer passive ingestion. However, the simultaneous knockdown of ACE1 and ACE2 resulted in a higher mortality rate than the control group when aphids were fed on plants. These results indicated that ACE1 and ACE2 function together to modulate A. pisum feeding and survival on plants.
Biological and Molecular Variability of Alfalfa mosaic virus Affecting Alfalfa Crop in Riyadh Region
Directory of Open Access Journals (Sweden)
Mohammed A. AL-Saleh
2013-12-01
Full Text Available In 2011–2012, sixty nine samples were collected from alfalfa plants showing viral infection symptoms in Riyadh region. Mechanical inoculation with sap prepared from two collected samples out of twenty five possitive for Alfalfa mosaic virus (AMV by ELISA were produced systemic mosaic on Vigna unguiculata and Nicotiana tabacum, local lesion on Chenopodium amaranticolor and C. quinoa. Vicia faba indicator plants that induce mosaic and mottle with AMV-Sagir isolate and no infection with AMV-Wadi aldawasser isolate. Approximately 700-bp was formed by RT-PCR using AMV coat protein specific primer. Samples from infected alfalfa gave positive results, while healthy plant gave negative result using dot blot hybridization assay. The nucleotide sequences of the Saudi isolates were compared with corresponding viral nucleotide sequences reported in GenBank. The obtained results showed that the AMV from Australia, Brazil, Puglia and China had the highest similarity with AMV-Sajer isolate. While, the AMV from Spain and New Zealaland had the lowest similarity with AMV-Sajer and Wadi aldawasser isolates. The data obtained in this study has been deposited in the GenBank under the accession numbers KC434083 and KC434084 for AMV-Sajer and AMV- Wadialdawasser respectively. This is the first report regarding the gnetic make up of AMV in Saudi Arabia.