WorldWideScience

Sample records for vicia faba leaves

  1. Vicia faba L.

    African Journals Online (AJOL)

    user

    2011-02-07

    Feb 7, 2011 ... Haciseferogullari H, Gezer I, Bahtiyarca Y, Menges HO (2003). Determination of some chemical and physical properties of sakis faba bean (Vicia faba L. var. major). J. Food .Eng. 60: 475-479. Hanelt P, Mettin D (1989). Biosystematics of the Genus vicia L. (Leguminosae). Annu. Rev. Ecol. Syst. 20: 199-223.

  2. Vicia Faba

    African Journals Online (AJOL)

    evaluate symbiotic characteristics between the crop and the rhizobia in major faba bean producing areas in Tigray ... Nodulation status of the field crops was poor except Ofla, D/Temben and Alaje districts. Though the ..... acknowledge Solomon Hishe and Biadglegn Desmisse for GIS data processing. 6. REFERENCE.

  3. vicia faba

    African Journals Online (AJOL)

    ABSTRACT: The failure of faba bean production in some regions of Semien. Shewa necessitated a research for a ... ppm) and potassium, a high concentration of calcium and magnesium, and a lower population density of .... Magnesium sulphate, 0.5g; Sodium chloride, 0.2g; Yeast extract, 0.1g;. Mannitol, 10g; Agar, 15.

  4. Vicia Faba

    African Journals Online (AJOL)

    the color of nodules (pink which is effective, white which is ineffective in nitrogen fixation). The variation in nodule number and color in turn induce variation in growth and yield of the host due to variation in fixed N (Lupwayi and Mkandawire, 1996; Amijee and Giller, 1998). Faba bean in association with rhizobia can fix up to ...

  5. Vicia faba L.

    African Journals Online (AJOL)

    Buzayehu

    Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of ..... of the isolates were utilized all amino acids sources.

  6. Improvement of faba bean ( Vicia faba L .) yield and quality through ...

    African Journals Online (AJOL)

    Improvement of faba bean ( Vicia faba L .) yield and quality through biotechnological approach: A review. ... yield and quality. This review work examines the role of various techniques with reference to faba bean improvement. Key words: Vicia faba, faba bean, grain quality, resistance breeding, nitrogen fixation, zero tannin.

  7. Words denoting faba bean (Vicia faba in European languages

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2011-01-01

    Full Text Available Faba bean (Vicia faba L took part in the 'agricultural revolution' of post-glacial Europe along with other grain legumes and cereals. In order to assess the diversity and the origin of the words denoting faba bean in the languages of Europe, a lexicological study was carried out with emphasis upon etymological dictionaries. The words in almost all modern Indo-European languages in Europe owe their origin to the Proto-Indo-European root *bhabh bhabhā, also denoting faba bean. The Proto-Altaic root *bŭkrV, denoting pea nut and cone, through the Proto-Turkic *burčak, denoting both pea and bean is responsible for the words in several modern Altaic languages of Europe while the others are borrowings from Arabic. The origin of the words in modern Caucasian languages is the Proto-Caucasian root *howł[ā], meaning both bean and lentil. The words in Uralic languages are either borrowings, mostly from Slavic, or derived from their own words denoting pea.

  8. Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals

    NARCIS (Netherlands)

    Jansman, A.J.M.

    1993-01-01

    Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid

  9. Early changes of the pH of the apoplast are different in leaves, stem and roots of Vicia faba L. under declining water availability.

    Science.gov (United States)

    Karuppanapandian, T; Geilfus, C-M; Mühling, K-H; Novák, O; Gloser, V

    2017-02-01

    Changes in pH of the apoplast have recently been discussed as an important factor in adjusting transpiration and water relations under conditions of drought via modulatory effect on abscisic acid (ABA) concentration. Using Vicia faba L., we investigated whether changes in the root, shoot and leaf apoplastic pH correlated with (1) a drought-induced reduction in transpiration and with (2) changes in ABA concentration. Transpiration, leaf water potential and ABA in leaves were measured and correlated with root and shoot xylem pH, determined by a pH microelectrode, and pH of leaf apoplast quantified by microscopy-based in vivo ratiometric analysis. Results revealed that a reduction in transpiration rate in the early phase of soil drying could not be linked with changes in the apoplastic pH via effects on the stomata-regulating hormone ABA. Moreover, drought-induced increase in pH of xylem or leaf apoplast was not the remote effect of an acropetal transport of alkaline sap from root, because root xylem acidified during progressive soil drying, whereas the shoot apoplast alkalized. We reason that other, yet unknown signalling mechanism was responsible for reduction of transpiration rate in the early phase of soil drying. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  10. Leaf traits associated with drought adaptation in faba bean (Vicia faba L.)

    OpenAIRE

    Khazaei, Hamid

    2014-01-01

    The potential for use of faba bean (Vicia faba L.) is increasing worldwide due to its positive environmental impact and nutritional interest, but there are many challenges for faba bean breeding and cultivation. These include its mixed breeding system, its unknown origin and wild progenitor, its large genome being the biggest diploid genome among field crops, and its relative sensitivity to biotic and abiotic stresses (e.g., drought). Little is known about the ecological adaptation of faba be...

  11. Construction of a comparative genetic map in faba bean (Vicia faba L.); conservation of genome structure with Lens culinaris

    National Research Council Canada - National Science Library

    Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P

    2008-01-01

    ... identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba...

  12. Characterization of Phosphate Solubilizing Faba Bean ( Vicia faba L ...

    African Journals Online (AJOL)

    Some species of rhizobial bacteria nodulating faba bean are characterized by phosphate solubilization. In order to study their in vitro and symbiotic characteristics, twelve rhizobial isolates nodulating faba bean were collected from acidic soil of Wollega, Ethiopia. Solubilization index of the isolates ranges from 1.25 to 2.10.

  13. Genetic diversity and population structure of faba bean (Vicia faba) from Turkey

    OpenAIRE

    Göl, Şurhan; DOĞANLAR, Sami; FRARY, Anne

    2016-01-01

    Faba bean (Vicia faba L.) is an important food and feed legume because of the nutritional value of its seed protein and starch content, good biomass, and high efficiency nitrogen fixation.This study analyzed the molecular genetic diversity and population structure of 101 Turkish faba bean accessions using simple sequence repeat (SSR) markers.A total of 32 SSR markers yielded 281 loci of which 277 (98.6%) were polymorphic.Mean dissimilarity between genotypes was 0.355, a relatively high value ...

  14. Large-Scale Transcriptome Analysis in Faba Bean (Vicia faba L. under Ascochyta fabae Infection.

    Directory of Open Access Journals (Sweden)

    Sara Ocaña

    Full Text Available Faba bean is an important food crop worldwide. However, progress in faba bean genomics lags far behind that of model systems due to limited availability of genetic and genomic information. Using the Illumina platform the faba bean transcriptome from leaves of two lines (29H and Vf136 subjected to Ascochyta fabae infection have been characterized. De novo transcriptome assembly provided a total of 39,185 different transcripts that were functionally annotated, and among these, 13,266 were assigned to gene ontology against Arabidopsis. Quality of the assembly was validated by RT-qPCR amplification of selected transcripts differentially expressed. Comparison of faba bean transcripts with those of better-characterized plant genomes such as Arabidopsis thaliana, Medicago truncatula and Cicer arietinum revealed a sequence similarity of 68.3%, 72.8% and 81.27%, respectively. Moreover, 39,060 single nucleotide polymorphism (SNP and 3,669 InDels were identified for genotyping applications. Mapping of the sequence reads generated onto the assembled transcripts showed that 393 and 457 transcripts were overexpressed in the resistant (29H and susceptible genotype (Vf136, respectively. Transcripts involved in plant-pathogen interactions such as leucine rich proteins (LRR or plant growth regulators involved in plant adaptation to abiotic and biotic stresses were found to be differently expressed in the resistant line. The results reported here represent the most comprehensive transcript database developed so far in faba bean, providing valuable information that could be used to gain insight into the pathways involved in the resistance mechanism against A. fabae and to identify potential resistance genes to be further used in marker assisted selection.

  15. Large-Scale Transcriptome Analysis in Faba Bean (Vicia faba L.) under Ascochyta fabae Infection

    Science.gov (United States)

    Ocaña, Sara; Seoane, Pedro; Bautista, Rocio; Palomino, Carmen; Claros, Gonzalo M.; Torres, Ana M.; Madrid, Eva

    2015-01-01

    Faba bean is an important food crop worldwide. However, progress in faba bean genomics lags far behind that of model systems due to limited availability of genetic and genomic information. Using the Illumina platform the faba bean transcriptome from leaves of two lines (29H and Vf136) subjected to Ascochyta fabae infection have been characterized. De novo transcriptome assembly provided a total of 39,185 different transcripts that were functionally annotated, and among these, 13,266 were assigned to gene ontology against Arabidopsis. Quality of the assembly was validated by RT-qPCR amplification of selected transcripts differentially expressed. Comparison of faba bean transcripts with those of better-characterized plant genomes such as Arabidopsis thaliana, Medicago truncatula and Cicer arietinum revealed a sequence similarity of 68.3%, 72.8% and 81.27%, respectively. Moreover, 39,060 single nucleotide polymorphism (SNP) and 3,669 InDels were identified for genotyping applications. Mapping of the sequence reads generated onto the assembled transcripts showed that 393 and 457 transcripts were overexpressed in the resistant (29H) and susceptible genotype (Vf136), respectively. Transcripts involved in plant-pathogen interactions such as leucine rich proteins (LRR) or plant growth regulators involved in plant adaptation to abiotic and biotic stresses were found to be differently expressed in the resistant line. The results reported here represent the most comprehensive transcript database developed so far in faba bean, providing valuable information that could be used to gain insight into the pathways involved in the resistance mechanism against A. fabae and to identify potential resistance genes to be further used in marker assisted selection. PMID:26267359

  16. Nutritional response of growing rats to faba beans (Vicia faba L., minor) and faba bean fractions.

    Science.gov (United States)

    Rubio, L A; Grant, G; Bardocz, S; Dewey, P; Pusztai, A

    1991-11-01

    The effects of raw faba bean (Vicia faba L., minor) meal (VFM) and its fractions on the growth and nitrogen utilization of rats have been determined in two experiments. Two commercial varieties of VFM were tested, local VFM (409-439 g/kg diet) and Troy VFM (439 g/kg diet). The bean fractions tested were V. faba lectin-depleted protein (VFDP), V. faba lectin (VFL) and V. faba cotyledon residue (VFCR). All diets were supplemented with amino acids to target requirements. Body-weight, body N and lipid contents of rats fed on VFM were reduced significantly in comparison with control rats fed on lactalbumin. This was due, in part, to the lower digestibility of the protein, lipid and dry matter (DM) of VFM diets. As a result, net protein utilization (NPU) and biological value (BV) of faba bean proteins were less than expected. Urine and urea-N outputs of the VFM-fed rats were also elevated in both experiments. Increasing the energy content of local VFM diets led to significantly higher dry body-weight, body N and lipid contents, with the result that the NPU and BV values of the protein also increased. However, the NPU values for VFM-fed rats were still significantly lower than those for the controls in both experiments. In contrast, true N, lipid and DM digestibilities in rats given local VFM were not significantly affected by the difference in the energy content of the diets. The replacement of two-thirds of the lactalbumin in the diet with VFDP (65 g/kg) reduced dry body-weight, N and lipid contents, NPU and BV compared with the control rats, even though N, lipid and DM digestibilities were not significantly different. The nutritional performance of rats fed on lactalbumin-based diets containing 7 g VFL/kg was similar to that of the controls. Similarly, the inclusion of the cotyledon residue (237 g VFCR/kg diet) had no appreciable effect on any of the variables studied. As VFL and VFCR had no antinutritional effects in these rats, it appears that the low nutritional

  17. ABA induces H2O2 production in guard cells, but does not close the stomata on Vicia faba leaves developed at high air humidity

    Science.gov (United States)

    Arve, Louise E; Carvalho, Dália RA; Olsen, Jorunn E; Torre, Sissel

    2014-01-01

    Plants developed under constant high (> 85%) relative air humidity (RH) have larger stomata that are unable to close completely. One of the hypotheses for the less responsive stomata is that the plants have reduced sensitivity to abscisic acid (ABA). Both ABA and darkness are signals for stomatal closure and induce the production of the secondary messenger hydrogen peroxide (H2O2). In this study, the ability of Vicia faba plants developed in moderate or high RH to close the stomata in response to darkness, ABA and H2O2 was investigated. Moreover, the ability of the plants to produce H2O2 when treated with ABA or transferred to darkness was also assessed. Our results show that the ABA concentration in moderate RH is not increased during darkness even though the stomata are closing. This indicates that stomatal closure in V. faba during darkness is independent of ABA production. ABA induced both H2O2 production and stomatal closure in stomata formed at moderate RH. H2O2 production, as a result of treatment with ABA, was also observed in stomata formed at high RH, though the closing response was considerably smaller as compared with moderate RH. In either RH, leaf ABA concentration was not affected by darkness. Similarly to ABA treatment, darkness elicited both H2O2 production and stomatal closure following plant cultivation at moderate RH. Contrary to this, neither H2O2 production nor stomatal closure took place when stomata were formed at high RH. These results suggest that the reduced stomatal response in plants developed in continuous high RH is caused by one or more factors downstream of H2O2 in the signaling pathway toward stomatal closure. PMID:25763494

  18. ABA induces H2O2 production in guard cells, but does not close the stomata on Vicia faba leaves developed at high air humidity.

    Science.gov (United States)

    Arve, Louise E; Carvalho, Dália R A; Olsen, Jorunn E; Torre, Sissel

    2014-01-01

    Plants developed under constant high (> 85%) relative air humidity (RH) have larger stomata that are unable to close completely. One of the hypotheses for the less responsive stomata is that the plants have reduced sensitivity to abscisic acid (ABA). Both ABA and darkness are signals for stomatal closure and induce the production of the secondary messenger hydrogen peroxide (H2O2). In this study, the ability of Vicia faba plants developed in moderate or high RH to close the stomata in response to darkness, ABA and H2O2 was investigated. Moreover, the ability of the plants to produce H2O2 when treated with ABA or transferred to darkness was also assessed. Our results show that the ABA concentration in moderate RH is not increased during darkness even though the stomata are closing. This indicates that stomatal closure in V. faba during darkness is independent of ABA production. ABA induced both H2O2 production and stomatal closure in stomata formed at moderate RH. H2O2 production, as a result of treatment with ABA, was also observed in stomata formed at high RH, though the closing response was considerably smaller as compared with moderate RH. In either RH, leaf ABA concentration was not affected by darkness. Similarly to ABA treatment, darkness elicited both H2O2 production and stomatal closure following plant cultivation at moderate RH. Contrary to this, neither H2O2 production nor stomatal closure took place when stomata were formed at high RH. These results suggest that the reduced stomatal response in plants developed in continuous high RH is caused by one or more factors downstream of H2O2 in the signaling pathway toward stomatal closure.

  19. Variability in yield of faba beans (Vicia faba L.)

    NARCIS (Netherlands)

    Grashoff, C.

    1992-01-01

    Yield variability is one of the major problems in growing faba beans. In this thesis, the effect of water supply pattern on yield variability of the crop is studied with experiments in the field and under controlled conditions, and with a simulation model. In a series of field experiments,

  20. Rhizobium laguerreae sp. nov. nodulates Vicia faba on several continents.

    Science.gov (United States)

    Saïdi, Sabrine; Ramírez-Bahena, Martha-Helena; Santillana, Nery; Zúñiga, Doris; Álvarez-Martínez, Estela; Peix, Alvaro; Mhamdi, Ridha; Velázquez, Encarna

    2014-01-01

    Several fast-growing strains nodulating Vicia faba in Peru, Spain and Tunisia formed a cluster related to Rhizobium leguminosarum. The 16S rRNA gene sequences were identical to that of R. leguminosarum USDA 2370(T), whereas rpoB, recA and atpD gene sequences were phylogenetically distant, with sequence similarities of less than 96 %, 97 % and 94 %, respectively. DNA-DNA hybridization analysis showed a mean relatedness value of 43 % between strain FB206(T) and R. leguminosarum USDA 2370(T). Phenotypic characteristics of the novel strains also differed from those of the closest related species of the genus Rhizobium. Therefore, based on genotypic and phenotypic data obtained in this study, we propose to classify this group of strains nodulating Vicia faba as a novel species of the genus Rhizobium named Rhizobium laguerreae sp. nov. The type strain is FB206(T) ( = LMG 27434(T) = CECT 8280(T)).

  1. Molecular tools for utilization of mitochondrial diversity in faba bean (Vicia faba

    Directory of Open Access Journals (Sweden)

    Aleksić Jelena M.

    2014-01-01

    Full Text Available We performed in silico PCR analyses utilizing complete mitochondrial (mtDNA genome sequences of faba bean (Vicia faba and two related species, Vigna angularis and Vigna radiata, currently available in GenBank, to infer whether 15 published universal primer pairs for amplification of all 14 cis-spliced introns in genes of NADH subunits (nad genes are suitable for V. faba and related species. Then, we tested via PCR reactions whether seven out of 15 primer pairs would generate PCR products suitable for further manipulation in 16 genotypes of V. faba representing all botanical varieties of this species (major, minor, equina and subsp. paucijuga of various levels of improvement (traditional and improved cultivars originating from Europe, Africa, Asia and south America. We provide new PCR primers for amplification of nad1 intron 2/3 in V. faba, and demonstrate intraspecific variability in primary nucleotide sequences at this locus. Based on outcomes of both in silico predictions and PCR amplification, we report a set of PCR primers for amplification of five introns in nad genes that are promising molecular tools for future phylogeographic and other studies in this species for which unambiguous data on wild ancestors, centre of origin and domestication are lacking. [Projekat Ministarstva nauke Republike Srbije, br. 173005

  2. Mathematical modeling of biological growth for some Vicia faba varieties

    Science.gov (United States)

    Ionel, Samfira; Andreea, Ghica; Marius, Boldea; Monica, Butnariu; Marius, Sendroni; Andrei, M.-Kiss

    2013-10-01

    Vicia faba is one of the legume species of importance for human and animal nutrition. Over the past decade, the areas cultivated with this species have significantly increased. Given that the levels of the yield and quality obtained from this species depend largely on the specific soil and climate conditions, the present paper focuses on the study of the morpho-productive features under the conditions in Banat Plain, in the west of Romania. A collection of varieties and genetic lines was studied, with focus on the interdependence between plant height, characteristics of the foliage and in the end the foliar surface of the leaf and of the entire plant. The observations led to the conclusion that variety Melodie has the best response of biological growth on the plain.

  3. Genetic diversity of Palestine landraces of faba bean (Vicia faba) based on RAPD markers.

    Science.gov (United States)

    Basheer-Salimia, R; Shtaya, M; Awad, M; Abdallah, J; Hamdan, Y

    2013-09-03

    Until now, neither phenotypic nor molecular approaches have been used to characterize the landraces of Palestine faba beans (Vicia faba). We used PCR-based RAPD markers to determine the genetic diversity and relatedness among 26 Palestinian faba bean landraces (traditional farmers' varieties) from 8 localities in the West Bank, Palestine. In tests with 37 primers, 14 generated no polymorphic bands, 12 exhibited weak and unclear products, and 11 primers produced good amplification products with high intensity and pattern stability. Ninety-four DNA fragments (loci) were detected, with an average of 8.54 loci per primer and size ranging from 160 to 1370 bp. A minimum of 4 and a maximum of 14 DNA fragments were obtained using (OPA-05 and OPA-09) and (BC-261) primers, respectively. The maximum percentage of polymorphic markers was 71.4 (BC-298) and the minimum was 50.0 (OPA-05, -09, -16). The 11 primers exhibited relatively high collective resolving power (Rp) values of 26.316, and varied from 0.154 for the OPA-09 primer to 5.236 for the BC-261, with an overall mean of 2.392. The primers BC-261, -322, and -298 were found to be the most useful RAPD primers to assess the genetic diversity of Palestinian faba beans, as they revealed relatively high Rp rates (5.236, 3.618, and 3.150, respectively). Based on the Jaccard coefficient, the genetic distance ranged from 0.358 to 0.069, with a mean of 0.213. We conclude that the RAPD technique is useful for determining genetic diversity and for developing suitable fingerprints for faba bean landraces grown in Palestine.

  4. Near-infrared spectroscopy (NIRS evaluation and regional analysis of Chinese faba bean (Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Jiaojiao Wang

    2014-02-01

    Full Text Available To analyze the nutritional composition of faba bean (Vicia faba L. seed, estimation models were developed for protein, starch, oil, and total polyphenol using near infrared spectroscopy (NIRS. Two hundred and forty-four samples from twelve producing regions were measured in both milled powder and intact seed forms. Partial least squares (PLS regression was applied for model development. The model based on ground seed powder was generally superior to that based on the intact seed. The optimal seed powder-based models for protein, starch, and total polyphenol had coefficients of correlation (r2 of 0.97, 0.93 and 0.89, respectively. The relationship between nutrient contents and twelve producing areas was determined by two-step cluster analysis. Three distinct groupings were obtained with region-constituent features, i.e., Group 1 of high oil, Group 2 of high protein, and Group 3 of high starch as well as total polyphenol. The clustering accuracy was 79.5%. Moreover, the nutrition contents were affected by seeding date, longitude, latitude, and altitude of plant location. Cluster analysis revealed that the differences in the seed were strongly influenced by geographical factors.

  5. The digestibility in piglets of faba bean (Vicia faba L.) as affected by breeding towards the absence of condensed tannins.

    Science.gov (United States)

    Van der Poel, A F; Dellaert, L M; Van Norel, A; Helsper, J P

    1992-11-01

    Seed samples from two near-isogenic faba bean (Vicia faba L.) lines were examined for the levels of so-called anti-nutritional factors (ANF). From the ANF known to be present in faba beans, trypsin inhibitor activity, functional lectins, condensed tannins and pyrimidine glycosides were analysed. It was concluded that the lines differed only in the content of condensed tannins being 0.05). A multienzyme technique was used to predict the in vitro protein digestibility (IVPD) of the two lines. The IVPD of the LT line was 0.965 and about 0.05 higher than the HT line, confirming the difference in digestibility as measured in vivo. The present study shows the positive effects on digestibility of removal of condensed tannins in faba beans which was achieved by plant breeding.

  6. Role of bioinoculants in development of salt-tolerance of Vicia faba ...

    African Journals Online (AJOL)

    Through biological inoculation technology, the bacterial-mycorrhizal-legume tripartite symbiosis in saline conditions was documented and the effects of dual inoculation with Azospirillum brasilense (NFB) and Arbuscular mycorrhizal (Am) fungus Glomus clarum on the host plants (Vicia faba) in pot cultures were investigated ...

  7. Meiotic changes in Vicia faba L. subsequent to treatments of hydrazine hydrate and maleic hydrazide

    Directory of Open Access Journals (Sweden)

    Shaheen Husain

    2013-01-01

    Full Text Available Assessing the impact of mutagens for creating variations in crops like faba bean (Vicia faba L. is an important criterion in the contemporary world where food insecurity and malnutrition is alarming at the doors of various nations. Impact of two chemical mutagens viz. hydrazine hydrate (HZ and maleic hydrazide (MH on the two varieties (NDF-1 and HB-405 of Vicia faba were analysed in terms of meiotic behavior and pollen sterility. Since there are not enough data about the effect of these mutagens on the chromosomal behaviors of Vicia faba, this study presents the role of hydrazine hydrate and maleic hydrazide as well as various types of chromosomal aberrations in crop improvement. The lower concentration of mutagens showed less pollen sterility compared to the higher concentrations. Manipulation of plant structural component to induce desirable alternations provides valuable material for the breeders and could be used favorably for increasing mutation rate and obtaining a desirable spectrum of mutation in faba beans based on preliminary studies of cell division.

  8. Dietary effects of faba-bean (Vicia faba L.) tannins on the morphology and function of the small-intestinal mucosa of weaned pigs

    NARCIS (Netherlands)

    Leeuwen, P. van; Jansman, A.J.M.; Wiebenga, J.; Koninkx, J.F.J.G.; Mouwen, J.M.V.M.

    1995-01-01

    The objective of the present study was to evaluate effects of condensed tannins in faba beans (Vicia faba L.) on morphological and functional variables of the small-intestinal mucosa of piglets. In an experiment with young piglets (8-17 kg body weight), fed on either a control diet or a diet

  9. Relationship between geographical origin, seed size and genetic diversity in faba bean (Vicia faba L.) as revealed by SSR markers.

    Science.gov (United States)

    Göl, Şurhan; Doğanlar, Sami; Frary, Anne

    2017-05-11

    Faba bean (Vicia faba L.) is an important legume species because of its high protein and starch content. Broad bean can be grown in different climatic conditions and is an ideal rotation crop because of the nitrogen fixing bacteria in its roots. In this work, 255 faba bean germplasm accessions were characterized using 32 SSR primers which yielded 302 polymorphic fragments. According to the results, faba bean individuals were divided into two main groups based on the neighbor-joining algorithm (r = 0.91) with some clustering based on geographical origin as well as seed size. Population structure was also determined and agreed with the dendrogram analysis in splitting the accessions into two subpopulations. Analysis of molecular variance (AMOVA) revealed high levels of within population genetic variation. Genetic similarity and geographical proximity were related with separation of European accessions from African and Asian ones. Interestingly, there was no significant difference between landrace (38%) and cultivar (40%) diversity indicating that genetic variability has not yet been lost due to breeding. A total of 44 genetically well-characterized faba bean individuals were selected for a core collection to be further examined for yield and nutritional traits.

  10. Flowering and characteristics of useful traits of some faba bean (Vicia faba L. var. major Harz cultivars and breeding lines

    Directory of Open Access Journals (Sweden)

    Helena Łabuda

    2012-12-01

    Full Text Available This study, conducted during the period 2008–2009, related to the growth, flowering, pod set, and yield of faba bean (Vicia faba L. var. major cultivars and breeding lines. Biometric measurements, made on 20 randomly selected plants, included the following traits: plant height, number of branches per plant, number of inflorescences per plant and number of flowers per inflorescence, number of pods per plant: large pods (marketable, small pods (undeveloped, and pods with disease symptoms. Moreover, the following characters were determined: pod and seed weight per plant in faba bean plants harvested once at processing maturity of fresh green seeds, pod length, width and weight as well as single seed weight. The evaluated cultivars and breeding lines of faba bean were characterized by large variations in the most important commercial traits. The abundance and duration of flowering as well as the number and weight of pods per plant were clearly modified by weather factors during the growth of plants. The new breeding lines R-366/1 and R-384 as well as the cultivars 'Bachus' and 'Jankiel Biały' were characterized by quite stable pod and seed yield per plant. Single harvesting of faba bean pods for green seeds at green maturity stage produced positive results in the case of all cultivars and breeding lines investigated; marketable pods per plant accounted for 75–80% of the total number of pods.

  11. Genetic Diversity Assessment of Portuguese Cultivated Vicia faba L. through IRAP Markers

    Directory of Open Access Journals (Sweden)

    Diana Tomás

    2016-03-01

    Full Text Available Faba bean have been grown in Portugal for a long time and locally adapted populations are still maintained on farm. The genetic diversity of four Portuguese faba bean populations that are still cultivated in some regions of the country was evaluated using the Inter Retrotransposons Amplified Polymorphism (IRAP technique. It was shown that molecular markers based on retrotransposons previously identified in other species can be efficiently used in the genetic variability assessment of Vicia faba. The IRAP experiment targeting Athila yielded the most informative banding patterns. Cluster analysis using the neighbor-joining algorithm generated a dendrogram that clearly shows the distribution pattern of V. faba samples. The four equina accessions are separated from each other and form two distinct clades while the two major faba bean accessions are not unequivocally separated by the IRAP. Fluorescent In Situ Hybridization (FISH analysis of sequences amplified by IRAP Athila revealed a wide distribution throughout V. faba chromosomes, confirming the whole-genome coverage of this molecular marker. Morphological characteristics were also assessed through cluster analysis of seed characters using the unweighted pair group method arithmetic average (UPGMA and principal component analysis (PCA, showing a clear discrimination between faba bean major and equina groups. It was also found that the seed character most relevant to distinguish accessions was 100 seed weight. Seed morphological traits and IRAP evaluation give similar results supporting the potential of IRAP analysis for genetic diversity studies.

  12. Synergistic interaction of Rhizobium leguminosarum bv. viciae and arbuscular mycorrhizal fungi as a plant growth promoting biofertilizers for faba bean (Vicia faba L.) in alkaline soil.

    Science.gov (United States)

    Abd-Alla, Mohamed Hemida; El-Enany, Abdel-Wahab Elsadek; Nafady, Nivien Allam; Khalaf, David Mamdouh; Morsy, Fatthy Mohamed

    2014-01-20

    Egyptian soils are generally characterized by slightly alkaline to alkaline pH values (7.5-8.7) which are mainly due to its dry environment. In arid and semi-arid regions, salts are less concentrated and sodium dominates in carbonate and bicarbonate forms, which enhance the formation of alkaline soils. Alkaline soils have fertility problems due to poor physical properties which adversely affect the growth and the yield of crops. Therefore, this study was devoted to investigating the synergistic interaction of Rhizobium and arbuscular mycorrhizal fungi for improving growth of faba bean grown in alkaline soil. A total of 20 rhizobial isolates and 4 species of arbuscular mycorrhizal fungi (AMF) were isolated. The rhizobial isolates were investigated for their ability to grow under alkaline stress. Out of 20 isolates 3 isolates were selected as tolerant isolates. These 3 rhizobial isolates were identified on the bases of the sequences of the gene encoding 16S rRNA and designated as Rhizobium sp. Egypt 16 (HM622137), Rhizobium sp. Egypt 27 (HM622138) and Rhizobium leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The best alkaline tolerant was R. leguminosarum bv. viciae STDF-Egypt 19 (HM587713). The effect of R. leguminosarum bv. viciae STDF-Egypt 19 and mixture of AMF (Acaulospora laevis, Glomus geosporum, Glomus mosseae and Scutellospora armeniaca) both individually and in combination on nodulation, nitrogen fixation and growth of Vicia faba under alkalinity stress were assessed. A significant increase over control in number and mass of nodules, nitrogenase activity, leghaemoglobin content of nodule, mycorrhizal colonization, dry mass of root and shoot was recorded in dual inoculated plants than plants with individual inoculation. The enhancement of nitrogen fixation of faba bean could be attributed to AMF facilitating the mobilization of certain elements such as P, Fe, K and other minerals that involve in synthesis of nitrogenase and leghaemoglobin. Thus it is

  13. Induction of sister-chromatid exchanges in Vicia faba by arsenic-contaminated drinking water.

    Science.gov (United States)

    Gómez-Arroyo, S; Hernández-García, A; Villalobos-Pietrini, R

    1988-07-01

    Arsenic-contaminated drinking water from various towns of Comarca Lagunera, Coahuila, Mexico, was tested for its ability to induce sister-chromatid exchanges (SCE) in Vicia faba. 3-h treatments were applied and the differential staining technique of Tempelaar et al. (1982) was used. Atomic absorption spectrophotometry showed that the arsenic concentration in drinking water was 0.11-0.695 ppm, well over the maximum limit of 0.05 ppm (EPA, 1984). In all cases the SCE frequencies were significantly different from the controls. Some concentrations (0.2, 0.3, 0.5 and 1.0 ppm) of sodium arsenate (V) and potassium arsenite (III) were also applied to Vicia faba and all produced significant SCE frequencies, except 0.2 ppm of sodium arsenate.

  14. Single-bilayer graphene oxide sheet tolerance and glutathione redox system significance assessment in faba bean ( Vicia faba L.)

    Science.gov (United States)

    Anjum, Naser A.; Singh, Neetu; Singh, Manoj K.; Shah, Zahoor A.; Duarte, Armando C.; Pereira, Eduarda; Ahmad, Iqbal

    2013-07-01

    Adsorbents based on single-bilayer graphene oxide sheet (hereafter termed "graphene oxide") are widely used in contaminated environments cleanup which may easily open the avenues for their entry to different environmental compartments, exposure to organisms and their subsequent transfer to human/animal food chain. Considering a common food crop—faba bean ( Vicia faba L.) germinating seedlings as a model plant system, this study assesses the V. faba-tolerance to different concentrations (0, 100, 200, 400, 800, and 1600 mg L-1) of graphene oxide (0.5-5 μm) and evaluates glutathione (γ-glutamyl-cysteinyl-glycine) redox system significance in this context. The results showed significantly increased V. faba sensitivity under three graphene oxide concentrations (in order of impact: 1,600 > 200 > 100 mg graphene oxide L-1), which was accompanied by decreased glutathione redox (reduced glutathione-to-oxidized glutathione) ratio, reduced glutathione pool, as well as significant and equally elevated activities of glutathione-regenerating (glutathione reductase) and glutathione-metabolizing (glutathione peroxidase; glutathione sulfo-transferase) enzymes. Contrarily, the two graphene oxide concentrations (in order of impact: 800 > 400 graphene oxide mg L-1) yielded promising results; where, significant improvements in V. faba health status (measured as increased graphene oxide tolerance) were clearly perceptible with increased ratio of the reduced glutathione-to-oxidized glutathione, reduced glutathione pool and glutathione reductase activity but decreased activities of glutathione-metabolizing enzymes. It is inferred that V. faba seedlings-sensitivity and/or tolerance to graphene oxide concentrations depends on both the cellular redox state (reduced glutathione-to-oxidized glutathione ratio) and the reduced glutathione pool which in turn are controlled by a finely tuned modulation of the coordination between glutathione-regenerating and glutathione-metabolizing enzymes.

  15. Faba bean (Vicia faba minor and pea seeds (Pisum sativum as protein sources in lactating ewes’ diets.

    Directory of Open Access Journals (Sweden)

    D. Gatta

    2010-04-01

    Full Text Available 18 Massese lactating ewes, divided into 3 homogeneous groups for parity and milk yield, were used to evaluate the replacement effects of soybean meal by Faba bean (Vicia faba minor and Pea (Pisum sativum seeds. During a 70 days trial (beginning after weaning: 30±1.5 days after lambing animals were fed three isonitrogenous and isocaloric diets. Each diet was characterised by the presence of only one protein feed. The diets consisted of alfalfa hay (1.1 kg/head/d and a decreasing amount of mixed feed (from 1.1 to 0.7 kg/head/d to fit animals’ requirements. Milk yield, milk chemical composition, animals live weight and BCS, health state and hematochemical parameters were regularly monitored. No diets palatability problems were detected. No significant differences resulted for live weight, BCS, milk yield and milk chemical composition, except for milk protein: higher for faba bean (6.54% and soybean (6.39% respect pea (5.66% diets, P<0.05. No differences resulted for blood parameters too and no clinical signs of illness were observed. Therefore faba bean and pea seeds seem to be able to replace the soybean well.

  16. Evaluation of vegetable-faba bean (Vicia faba L.) intercropping under Latvian agro-ecological conditions.

    Science.gov (United States)

    Lepse, Līga; Dane, Sandra; Zeipiņa, Solvita; Domínguez-Perles, Raul; Rosa, Eduardo As

    2017-10-01

    Monoculture is used mostly in conventional agriculture, where a single crop is cultivated on the same land for a period of at least 12 months. In an organic and integrated growing approach, more attention is paid to plant-environment interactions and, as a result, diverse growing systems applying intercropping, catch crops, and green manure are being implemented. Thus, field experiments for evaluation of vegetable/faba bean full intercropping efficiency, in terms of vegetable and faba bean yield and protein content, were set up during two consecutive growing seasons (2014 and 2015). Data obtained showed that the most efficient intercropping variants were cabbage/faba bean (cabbage yield 1.27-2.91 kg m-2 , immature faba bean pods 0.20-0.43 kg m-2 ) and carrot/faba bean (carrot yield 1.67-2.28 kg m-2 , immature faba bean pods 0.10-0.52 kg m-2 ), whilst onion and faba bean intercrop is not recommended for vegetable growing since it induces a very low onion yield (0.66-1.09 kg m-2 ), although the highest immature faba bean pod yield was found in the onion/faba bean intercropping scheme (up to 0.56 kg m-2 ). Vegetable/faba bean intercropping can be used in practical horticulture for carrot and cabbage growing in order to ensure sustainable farming and environmentally friendly horticultural production. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  17. Evaluation of barley (Hordeum vulgare L. and faba bean (Vicia faba L. yield in different density and mixture intercropping via competition indices

    Directory of Open Access Journals (Sweden)

    F Eslami Khalili

    2016-05-01

    Full Text Available In order to study the intercropping of barley (Hordeum vulgare L. and faba bean (Vicia faba L. an experiment was conducted as factorial based on randomized complete block design with two factors and three replications at Sari Agricultural Science and Natural Resources University during 2009. The first factor was two seed ratios include D1: 75 and 150 kg.ha-1 of faba bean and barley, respectively (optimum seed ratio and D2: 100 and 200 kg.ha-1 of faba bean and barley, respectively (high seed ratio and the second factor consisted of different planting ratio, P1: sole cropping of faba bean, P2: 50% faba bean + 50 % barley, P3: 75% faba bean + 25% barley, P4: 25% faba bean + 75% barley, P5: sole cropping of barley. Land equivalent ratio (LER indicated that intercropping of 25% faba bean + 75% barley was better than 50% faba bean + 50% barley. According to significant interaction effects of density and intercropping ratio in terms of seed yield and some competitive indices for both crop species, the highest barley and faba bean yield (3306.66 and 4884.56 kg.ha-1, respectively were observed in sole cropping with high density. In this experiment, the 75 % faba bean + 25 % mixture with high density was recorded highest intercropping yield, barley aggressivity value and 27% yield increases of barley in mix-proportion compared to sole crops. Also, the most of faba bean aggressivity value and faba bean yield increases in mix-proportion compared to sole crop were obtained when 25% faba bean + 75% barley mixture with optimum density was used. Furthermore the 75% faba bean + 25% barley treatment plus optimum seed ratio had highest system productivity index.

  18. Rhizobium anhuiense sp. nov., isolated from effective nodules of Vicia faba and Pisum sativum.

    Science.gov (United States)

    Zhang, Yu Jing; Zheng, Wen Tao; Everall, Isobel; Young, J Peter W; Zhang, Xiao Xia; Tian, Chang Fu; Sui, Xin Hua; Wang, En Tao; Chen, Wen Xin

    2015-09-01

    Four rhizobia-like strains, isolated from root nodules of Pisum sativum and Vicia faba grown in Anhui and Jiangxi Provinces of China, were grouped into the genus Rhizobium but were distinct from all recognized species of the genus Rhizobium by phylogenetic analysis of 16S rRNA and housekeeping genes. The combined sequences of the housekeeping genes atpD, recA and glnII for strain CCBAU 23252(T) showed 86.9 to 95% similarity to those of known species of the genus Rhizobium. All four strains had nodC and nifH genes and could form effective nodules with Pisum sativum and Vicia faba, and ineffective nodules with Phaseolus vulgaris, but did not nodulate Glycine max, Arachis hypogaea, Medicago sativa, Trifolium repens or Lablab purpureus in cross-nodulation tests. Fatty acid composition, DNA-DNA relatedness and a series of phenotypic tests also separated these strains from members of closely related species. Based on all the evidence, we propose a novel species, Rhizobium anhuiense sp. nov., and designate CCBAU 23252(T) ( = CGMCC 1.12621(T) = LMG 27729(T)) as the type strain. This strain was isolated from a root nodule of Vicia faba and has a DNA G+C content of 61.1 mol% (Tm).

  19. Screening of faba bean (Vicia faba L.) accessions to acidity and aluminium stresses

    Science.gov (United States)

    Stoddard, Frederick L.

    2017-01-01

    Background Faba bean is an important starch-based protein crop produced worldwide. Soil acidity and aluminium toxicity are major abiotic stresses affecting its production, so in regions where soil acidity is a problem, there is a gap between the potential and actual productivity of the crop. Hence, we set out to evaluate acidity and aluminium tolerance in a range of faba bean germplasm using solution culture and pot experiments. Methods A set of 30 accessions was collected from regions where acidity and aluminium are or are not problems. The accessions were grown in solution culture and a subset of 10 was grown first in peat and later in perlite potting media. In solution culture, morphological parameters including taproot length, root regrowth and root tolerance index were measured, and in the pot experiments the key measurements were taproot length, plant biomass, chlorophyll concentration and stomatal conductance. Result Responses to acidity and aluminium were apparently independent. Accessions Dosha and NC 58 were tolerant to both stress. Kassa and GLA 1103 were tolerant to acidity showing less than 3% reduction in taproot length. Aurora and Messay were tolerant to aluminium. Babylon was sensitive to both, with up to 40% reduction in taproot length from acidity and no detectable recovery from Al3+ challenge. Discussion The apparent independence of the responses to acidity and aluminium is in agreement with the previous research findings, suggesting that crop accessions separately adapt to H+ and Al3+ toxicity as a result of the difference in the nature of soil parent materials where the accession originated. Differences in rankings between experiments were minor and attributable to heterogeneity of seed materials and the specific responses of accessions to the rooting media. Use of perlite as a potting medium offers an ideal combination of throughput, inertness of support medium, access to leaves for detection of their stress responses, and harvest of clean

  20. Screening of faba bean (Vicia faba L. accessions to acidity and aluminium stresses

    Directory of Open Access Journals (Sweden)

    Kiflemariam Y. Belachew

    2017-02-01

    Full Text Available Background Faba bean is an important starch-based protein crop produced worldwide. Soil acidity and aluminium toxicity are major abiotic stresses affecting its production, so in regions where soil acidity is a problem, there is a gap between the potential and actual productivity of the crop. Hence, we set out to evaluate acidity and aluminium tolerance in a range of faba bean germplasm using solution culture and pot experiments. Methods A set of 30 accessions was collected from regions where acidity and aluminium are or are not problems. The accessions were grown in solution culture and a subset of 10 was grown first in peat and later in perlite potting media. In solution culture, morphological parameters including taproot length, root regrowth and root tolerance index were measured, and in the pot experiments the key measurements were taproot length, plant biomass, chlorophyll concentration and stomatal conductance. Result Responses to acidity and aluminium were apparently independent. Accessions Dosha and NC 58 were tolerant to both stress. Kassa and GLA 1103 were tolerant to acidity showing less than 3% reduction in taproot length. Aurora and Messay were tolerant to aluminium. Babylon was sensitive to both, with up to 40% reduction in taproot length from acidity and no detectable recovery from Al3+ challenge. Discussion The apparent independence of the responses to acidity and aluminium is in agreement with the previous research findings, suggesting that crop accessions separately adapt to H+ and Al3+ toxicity as a result of the difference in the nature of soil parent materials where the accession originated. Differences in rankings between experiments were minor and attributable to heterogeneity of seed materials and the specific responses of accessions to the rooting media. Use of perlite as a potting medium offers an ideal combination of throughput, inertness of support medium, access to leaves for detection of their stress responses, and

  1. Physiological impacts of soil pollution and arsenic uptake in three plant species: Agrostis capillaris, Solanum nigrum and Vicia faba.

    Science.gov (United States)

    Austruy, A; Wanat, N; Moussard, C; Vernay, P; Joussein, E; Ledoigt, G; Hitmi, A

    2013-04-01

    In order to revegetate an industrial soil polluted by trace metals and metalloids (As, Pb, Cu, Cd, Sb), the impact of pollution on three plant species, Solanum nigrum and Agrostis capillaris, both native species in an industrial site, and Vicia faba, a plant model species, is studied. Following the study of soil pollution from the industrial wasteland of Auzon, it appears that the As is the principal pollutant. Particular attention is given to this metalloid, both in its content and its speciation in the soil that the level of its accumulation in plants. In V. faba and A. capillaris, the trace metals and metalloids inhibit the biomass production and involve a lipid peroxidation in the leaves. Furthermore, these pollutants cause a photosynthesis perturbation by stomatal limitations and a dysfunction of photosystem II. Whatever the plant, the As content is less than 0.1 percent of dry matter, the majority of As absorbed is stored in the roots which play the role of trap organ. In parallel, the culture of S. nigrum decreases significantly the exchangeable and weakly adsorbed fraction of As in rhizospheric soil. This study has highlighted the ability of tolerance to trace metals of S. nigrum and to a lesser extent A. capillaris. Our data indicate that V. faba is not tolerant to soil pollution and is not a metallophyte species. Copyright © 2012 Elsevier Inc. All rights reserved.

  2. Construction of a comparative genetic map in faba bean (Vicia faba L.); conservation of genome structure with Lens culinaris.

    Science.gov (United States)

    Ellwood, Simon R; Phan, Huyen T T; Jordan, Megan; Hane, James; Torres, Anna M; Avila, Carmen M; Cruz-Izquierdo, Serafín; Oliver, Richard P

    2008-08-09

    The development of genetic markers is complex and costly in species with little pre-existing genomic information. Faba bean possesses one of the largest and least studied genomes among cultivated crop plants and no gene-based genetic maps exist. Gene-based orthologous markers allow chromosomal regions and levels of synteny to be characterised between species, reveal phylogenetic relationships and chromosomal evolution, and enable targeted identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba), using an F6 population developed from a cross between the lines Vf6 (equina type) and Vf27 (paucijuga type). Of 796 intron-targeted amplified polymorphic (ITAP) markers screened, 151 markers could be used to construct a comparative genetic map. Linkage analysis revealed seven major and five small linkage groups (LGs), one pair and 12 unlinked markers. Each LG was comprised of three to 30 markers and varied in length from 23.6 cM to 324.8 cM. The map spanned a total length of 1685.8 cM. A simple and direct macrosyntenic relationship between faba bean and Medicago truncatula was evident, while faba bean and lentil shared a common rearrangement relative to M. truncatula. One hundred and four of the 127 mapped markers in the 12 LGs, which were previously assigned to M. truncatula genetic and physical maps, were found in regions syntenic between the faba bean and M. truncatula genomes. However chromosomal rearrangements were observed that could explain the difference in chromosome numbers between these three legume species. These rearrangements suggested high conservation of M. truncatula chromosomes 1, 5 and 8; moderate conservation of chromosomes 2, 3, 4 and 7 and no conservation with M. truncatula chromosome 6. Multiple PCR amplicons and comparative mapping were suggestive of small-scale duplication events in faba bean

  3. Construction of a comparative genetic map in faba bean (Vicia faba L.; conservation of genome structure with Lens culinaris

    Directory of Open Access Journals (Sweden)

    Avila Carmen M

    2008-08-01

    Full Text Available Abstract Background The development of genetic markers is complex and costly in species with little pre-existing genomic information. Faba bean possesses one of the largest and least studied genomes among cultivated crop plants and no gene-based genetic maps exist. Gene-based orthologous markers allow chromosomal regions and levels of synteny to be characterised between species, reveal phylogenetic relationships and chromosomal evolution, and enable targeted identification of markers for crop breeding. In this study orthologous codominant cross-species markers have been deployed to produce the first exclusively gene-based genetic linkage map of faba bean (Vicia faba, using an F6 population developed from a cross between the lines Vf6 (equina type and Vf27 (paucijuga type. Results Of 796 intron-targeted amplified polymorphic (ITAP markers screened, 151 markers could be used to construct a comparative genetic map. Linkage analysis revealed seven major and five small linkage groups (LGs, one pair and 12 unlinked markers. Each LG was comprised of three to 30 markers and varied in length from 23.6 cM to 324.8 cM. The map spanned a total length of 1685.8 cM. A simple and direct macrosyntenic relationship between faba bean and Medicago truncatula was evident, while faba bean and lentil shared a common rearrangement relative to M. truncatula. One hundred and four of the 127 mapped markers in the 12 LGs, which were previously assigned to M. truncatula genetic and physical maps, were found in regions syntenic between the faba bean and M. truncatula genomes. However chromosomal rearrangements were observed that could explain the difference in chromosome numbers between these three legume species. These rearrangements suggested high conservation of M. truncatula chromosomes 1, 5 and 8; moderate conservation of chromosomes 2, 3, 4 and 7 and no conservation with M. truncatula chromosome 6. Multiple PCR amplicons and comparative mapping were suggestive of

  4. Hypoxia treatment on germinating faba bean (Vicia faba L. seeds enhances GABA-related protection against salt stress

    Directory of Open Access Journals (Sweden)

    Runqiang Yang

    2015-06-01

    Full Text Available The γ-aminobutyric acid (GABA is a non-protein amino acid with some functional properties for human health. Its content is usually lower in plant seeds. Hypoxia or salt (NaCl stress is an effective way for accumulating GABA during seed germination. However, NaCl stress on GABA accumulation under hypoxia is currently infrequent. The effect of NaCl on GABA accumulation in germinating faba bean (Vicia faba L. under hypoxia was therefore investigated in this study. Faba bean seeds were steeped in citric acid buffer (pH 3.5 containing NaCl with a final O2 concentration of 5.5 mg L-1 and germinated for 5 d. Results showed that 60 mmol L-1 NaCl was the optimum concentration for GABA accumulation in germinating faba beans under hypoxia. Germination for 5 d under hypoxia-NaCl stress was less beneficial for GABA accumulation than only hypoxia (control. Polyamine degradation pathway played a more important role for accumulating GABA in germinating faba bean as an adaptive response to NaCl stress. Removing NaCl significantly increased GABA content, while it decreased glutamate decarboxylase (GAD activity. Simultaneously, polyamine was accumulated, which might be related to the enhancement of physiological activity after recovery. When treated with aminoguanidine (AG for 3 d, GABA content decreased by 29.82%. These results indicated that the tolerance ability of GABA shunt to NaCl stress was weaker than that of polyamine degradation pathway. The NaCl treatment for 3 d under hypoxia could raise the contribution ratio of polyamine degradation pathway for GABA accumulation. The contribution ratio of polyamine degradation pathway for GABA formation was 29.82% when treated for at least 3 d

  5. Tannins in faba beans (Vicia faba L.) : antinutritional properties in monogastric animals

    NARCIS (Netherlands)

    Jansman, A.J.M.

    1993-01-01

    Condensed tannins are found in coloured-flowering varieties of faba beans ( Viciafaba L.). They are considered as antinutritional factors for nonruminant species. High-tannin hulls of faba beans and isolated tannins were shown to induce a rapid hypertrophy of the parotid glands in rats and increase

  6. CAPs markers to assist selection for low vicine and convicine contents in faba bean (Vicia faba L.).

    Science.gov (United States)

    Gutierrez, N; Avila, C M; Duc, G; Marget, P; Suso, M J; Moreno, M T; Torres, A M

    2006-12-01

    The antinutritional factors (ANFs) present in Vicia spp. seeds are a major constraint to the wider utilization of these crops as grain legumes. In the case of faba bean (Vicia faba L.), a breeding priority is the absence vicine and convicine (v-c); responsible for favism in humans and for the reduced animal performance or low egg production in laying hens. The discovery of a spontaneous mutant allele named vc-, which induces a 10-20 fold reduction of v-c contents, may facilitate the process. However, the high cost and difficulty of the chemical detection of v-c seriously restricts the advances in breeding-selection. To identify random amplified polymorphic DNA (RAPD) markers linked to this gene, we have analysed an F(2 )population derived from a cross between a line with high v-c content (Vf6) and the vc- genotype (line 1268). Quantification of v-c was done by spectrophotometry on the parents and the F(2 )population (n = 136). By using bulked segregant analysis (BSA), two RAPD markers linked in coupling and repulsion phase to the allele vc- were identified and further converted into sequence characterized amplified regions (SCARs). Amplification of SCARS was more consistent, although the initial polymorphism between pools was lost. To recover the polymorphisms several approaches were explored. Restriction digestion with HhaI (for SCAR SCH01(620)) and RsaI (for SCAR SCAB12(850)) revealed clear differences between the parental lines. The simultaneous use of the two cleavage amplified polymorphism (CAP) markers will allow the correct fingerprinting of faba bean plants and can be efficiently used in breeding selection to track the introgression of the vc- allele to develop cultivars with low v-c content and improved nutritional value.

  7. Molecular Diversity Assessment Using Sequence Related Amplified Polymorphism (SRAP Markers in Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Salem S. Alghamdi

    2012-12-01

    Full Text Available Sequence-related amplified polymorphism (SRAP markers were used to assess the genetic diversity and relationship among 58 faba bean (Vicia faba L. genotypes. Fourteen SRAP primer combinations amplified a total of 1036 differently sized well-resolved peaks (fragments, of which all were polymorphic with a 0.96 PIC value and discriminated all of the 58 faba bean genotypes. An average pairwise similarity of 21% was revealed among the genotypes ranging from 2% to 65%. At a similarity of 28%, UPGMA clustered the genotypes into three main groups comprising 78% of the genotypes. The local landraces and most of the Egyptian genotypes in addition to the Sudan genotypes were grouped in the first main cluster. The advanced breeding lines were scattered in the second and third main clusters with breeding lines from the ICARDA and genotypes introduced from Egypt. At a similarity of 47%, all the genotypes formed separated clusters with the exceptions of Hassawi 1 and Hassawi 2. Group analysis of the genotypes according to their geographic origin and type showed that the landraces were grouped according to their origin, while others were grouped according to their seed type. To our knowledge, this is the first application of SRAP markers for the assessment of genetic diversity in faba bean. Such information will be useful to determine optimal breeding strategies to allow continued progress in faba bean breeding.

  8. Structure and function of seed storage proteins in faba bean (Vicia faba L.).

    Science.gov (United States)

    Liu, Yujiao; Wu, Xuexia; Hou, Wanwei; Li, Ping; Sha, Weichao; Tian, Yingying

    2017-05-01

    The protein subunit is the most important basic unit of protein, and its study can unravel the structure and function of seed storage proteins in faba bean. In this study, we identified six specific protein subunits in Faba bean (cv. Qinghai 13) combining liquid chromatography (LC), liquid chromatography-electronic spray ionization mass (LC-ESI-MS/MS) and bio-information technology. The results suggested a diversity of seed storage proteins in faba bean, and a total of 16 proteins (four GroEL molecular chaperones and 12 plant-specific proteins) were identified from 97-, 96-, 64-, 47-, 42-, and 38-kD-specific protein subunits in faba bean based on the peptide sequence. We also analyzed the composition and abundance of the amino acids, the physicochemical characteristics, secondary structure, three-dimensional structure, transmembrane domain, and possible subcellular localization of these identified proteins in faba bean seed, and finally predicted function and structure. The three-dimensional structures were generated based on homologous modeling, and the protein function was analyzed based on the annotation from the non-redundant protein database (NR database, NCBI) and function analysis of optimal modeling. The objective of this study was to identify the seed storage proteins in faba bean and confirm the structure and function of these proteins. Our results can be useful for the study of protein nutrition and achieve breeding goals for optimal protein quality in faba bean.

  9. Weed control under integrated nutrient management systems in faba bean (Vicia faba) production in Egypt

    National Research Council Canada - National Science Library

    I.M. El-Metwally; M.T. Abdelhamid

    2008-01-01

    Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential...

  10. Growth of broiler chicks fed diets containing tannin-free and tannin-containing near-isogenic lines of Faba bean (Vicia Faba L.).

    NARCIS (Netherlands)

    Helsper, J.P.F.G.; Loon, van Y.P.J.; Kwakkel, R.P.; Norel, van A.; Poel, van der A.F.B.

    1996-01-01

    Seeds from six pairs of near-isogenic lines of Vicia faba L., each pair consisting of a tannin-free (TF) and a tannin-containing (TC) partner line, were used to study the effect of breeding for the absence of condensed tannins on the seed content of dry matter (DM), crude protein (CP), and starch

  11. Effect of fulvic acids on lead-induced oxidative stress to metal sensitive Vicia faba L. plant

    OpenAIRE

    Shahid, Muhammad; Dumat, Camille; Silvestre, Jérôme; Pinelli, Eric

    2012-01-01

    International audience; Lead (Pb) is a ubiquitous environmental pollutant capable to induce various morphological, physiological, and biochemical functions in plants. Only few publications focus on the influence of Pb speciation both on its phytoavailability and phytotoxicity. Therefore, Pb toxicity (in terms of lipid peroxidation, hydrogen peroxide induction, and photosynthetic pigments contents) was studied in Vicia faba plants in relation with Pb uptake and speciation. V. faba seedlings we...

  12. Oxidative stress and DNA damage in broad bean (Vicia faba L.) seedlings induced by thallium.

    Science.gov (United States)

    Radić, Sandra; Cvjetko, Petra; Glavas, Katarina; Roje, Vibor; Pevalek-Kozlina, Branka; Pavlica, Mirjana

    2009-01-01

    Thallium (Tl) is a metal of great toxicological concern because it is highly toxic to all living organisms through mechanisms that are yet poorly understood. Since Tl is accumulated by important crops, the present study aimed to analyze the biological effects induced by bioaccumulation of Tl in broad bean (Vicia faba L.) as well as the plant's antioxidative defense mechanisms usually activated by heavy metals. Thallium toxicity was related to production of reactive oxygen species in leaves and roots of broad bean seedlings following short-term (72 h) exposure to thallium (I) acetate (0, 0.5, 1, 5, and 10 mg/L) by evaluating DNA damage and oxidative stress parameters as well as antioxidative response. The possible antagonistic effect of potassium (K) was tested by combined treatment with 5 mg/L of Tl (Tl+) and 10 mg/L of potassium (K+) acetate. Accumulation of Tl+ in roots was 50 to 250 times higher than in broad bean shoots and was accompanied by increase in dry weight and proline. Despite responsive antioxidative defense (increased activities of superoxide dismutase, ascorbate peroxidase, and pyrogallol peroxidase), Tl+ caused oxidative damage to lipids and proteins as evaluated by malondialdehyde and carbonyl group levels, and induced DNA strand breaks. Combined treatment caused no oxidative alternations to lipids and proteins though it induced DNA damage. The difference in Tl-induced genotoxicity following both acellular and cellular exposure implies indirect DNA damage. Results obtained indicate that oxidative stress is involved in the mechanism of Tl toxicity and that the tolerance of broad bean to Tl is achieved, at least in part, through the increased activity of antioxidant enzymes.

  13. Vicia faba Hypersensitivity and ASA Intolerance in a Farmer: A Case Report

    Directory of Open Access Journals (Sweden)

    Elisabetta Damiani

    2011-01-01

    Full Text Available The IgE-mediated allergic reactions to food are caused, generally, by ingestion. However, they can be rarely induced by exposure to airborne food particles through the handling or the cooking. Vicia faba is a vegetable which belongs to Legumes or Fabaceae family, Fabales order. Allergic reactions after ingestion of legumes and cases of asthma after exposure to the cooking vapors have been reported in the literature. A paper assessed the volatile substances (insect repellents released by V. faba. The authors demonstrated that this plant produces several chemical substances, such as small quantities of methyl salicylate. We describe a case of occupational allergy, induced by handling during picking up of fresh broad beans, in a farmer with history of adverse reaction after eating the cooked and raw vegetable.

  14. Isolation and biological activity of a new plant growth regulator of Vicia faba L

    Energy Technology Data Exchange (ETDEWEB)

    Sembdner, G.; Dathe, W.; Bergner, C.; Roensch, H. (Akademie der Wissenschaften der DDR, Halle/Saale. Inst. fuer Biochemie der Pflanzen)

    1983-01-01

    Jasmonic acid was identified as a plant growth inhibitor of the pericarp of Vicia faba by means of gas-liquid chromatography, high resolution mass spectrometry as well as /sup 1/H and /sup 13/C NMR. The highest level of jasmonic acid was reached during intensive pericarp growth. Jasmonic acid is a plant growth inhibitor possessing a relative activity in the wheat seedling bioassay of 1-2.5 % compared to ABA (=100%). Contrary to ABA, jasmonic acid does not cause retardation of leaf emergence. In the dwarf rice gibberellin bioassay relative low concentrations of jasmonic acid inhibit both autonomous and GA/sub 3/-stimulated growth. Jasmonic acid does not influence seed germination of Amaranthus caudatus. The possible physiological role of jasmonic acid in the Vicia pericarp and the distribution in plants of this new plant growth regulator type are discussed.

  15. Influence of salicylic acid on seed germination of Vicia faba L. under salt stress

    OpenAIRE

    Fatima Anaya; Rachid Fghire; Said Wahbi; Kenza Loutfi

    2018-01-01

    Seed germination is the critical stage for species survival. Salinity affects germination and seedling growth and yield of several crop species, such as broad bean. That is why this study was carried to evaluate the effects of NaCl on seed germination and influence of salicylic acid on seed in order to improving salt tolerant on broad bean. Vicia faba L. is an important pulse crop in the Mediterranean region. In many cases broad bean is grown on saline soils where growth and yield are limited...

  16. Photosynthesis by Guard Cell Chloroplasts of Vicia faba L. : Effects of Factors Associated with Stomatal Movement

    OpenAIRE

    Weihua, WU; Sarah M., ASSMANN; The Biological Laboratories, Harvard University:(Current)Biology Department, Pennsylvania State University

    1993-01-01

    The properties of photosynthetic O_2 evolution by mesophyll cell chloroplasts (MCC) and guard cell chloroplasts (GCC) isolated from protoplasts of Vicia faba L. have been studied and effects on O_2 evolution of factors known to regulate stomatal movements have been compared. The O_2 evolution of GCC was CO_2-dependent. The saturating light intensity for O_2 evolution was between 150 and 200 μmol m^ s^ for MCC and was between 400 and 1,000μmol m^ s^ for GCC. Light quality (red vs. blue) had no...

  17. Faba beans (Vicia faba) in dairy cow diet: effect on milk production and quality

    OpenAIRE

    Rosanna Scipioni; Maurizio Moschini; Domenico Pietro Lo Fiego; Francesco Masoero; Michele Comellini; Luisa Antonella Volpelli

    2010-01-01

    The use of alternative plant proteins in place of the soybean meal protein in diets for farmed animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among the possible alternatives, the heat-processed (flaked) faba beans appears interesting for dairy cow diet. Two consecutive experiments were carried out to test flaked faba beans as a partial substitute for soybean meal in the diet of Reggiana breed dairy cows producing milk for Parmigiano-Regg...

  18. LC-MSdetermination of L-DOPA concentration in the leaf and flower tissues of six faba bean (Vicia fabaL. lines with common and rare flowercolors

    Directory of Open Access Journals (Sweden)

    Jinguo Hu

    2015-07-01

    Full Text Available Background: Parkinson’s disease (PD is the second most common neurodegenerative disorder characterized by the loss of muscle control, which causes trembling of the limbs and head as well as impaired balance. L-DOPA (L-3,4-dihydroxy phenylalanine is the major ingredient of several prescription drugs used to treat PD. Faba bean (Vicia faba L. is one of the few plant species that is known to produce L-DOPA and has the potential to be developed as a functional food crop for people suffering with PD. Objective: Aimed to provide needed information for people who want to use faba bean as a natural remedy or functional food to relieve PD symptoms, this study analyzed the variation of L-DOPA concentration in the leaf and flower tissues of six faba bean lines with common and rare flower colors. Methods: Leaf and flower samples were taken from field grown plants with different flower colors, namely, pink with purple lines and black dots, pure white, brown, and crimson. Samples were freeze-dried and L-DOPA was quantified by a LC-MS system consisting of an ACQUITY UPLC in line with a Synapt G2 HDMS quadrupole time-of-flight mass spectrometer. This experiment was carried out in two consecutive years (2012 and 2013 and the plants used in the second year were grown from the seeds harvested from the plants used in the first year. Results and Discussion: Our two-year study revealed a high level of variation in L-DOPA concentration for leaf and flower tissues among the six faba bean lines studied. The average L-DOPA concentration based on dry weight (DW in flowers ranged from 27.8 to 63.5 mg/g and 18.2 to 48.7 mg/g for leaf tissues. There was no significant correlation between L-DOPA concentrations in flowers and leaves. The L-DOPA concentration in flowers and in leaves of the same line varied but were not statistically significant between the two years. Ideally, the genotype with the highest average L-DOPA concentration in both flowers and leaves would be grown

  19. Evaluation of dehulled faba bean ( Vicia faba cv. Fiord) as a protein ...

    African Journals Online (AJOL)

    Fiord) as a protein source for laying hens. ... South African Journal of Animal Science ... Although food intake increased linearly with faba bean inclusion, reflecting a need by the hens to consume more in an attempt to obtain sufficient of some unidentified limiting nutrient, laying performance was the same on all feeds in the ...

  20. Evaluation of dehulled faba bean (Vicia faba cv. Fiord) as a protein ...

    African Journals Online (AJOL)

    p2492989

    Abstract. Dehulled faba beans were evaluated as an alternative to soybeans as a protein source for laying hens using 240 ... industry that is being forced to exclude animal protein sources in animal feeds. ... Wilson &. Teague (1974) reported that this latter rate of inclusion had no effect on laying performance or food intake,.

  1. Evaluation of faba bean (Vicia faba cv. Fiord) as a protein source for ...

    African Journals Online (AJOL)

    p2492989

    linearly, and food intake increased linearly, with increasing faba bean content, but when the feeds were ... higher proanthocyanidin (condensed tannin) content of the hulls of these varieties compared with the ..... qualitative treatments such as sex, vaccine, strain or growth promoter and are inappropriate for response.

  2. Faba beans (Vicia faba in dairy cow diet: effect on milk production and quality

    Directory of Open Access Journals (Sweden)

    Rosanna Scipioni

    2010-02-01

    Full Text Available The use of alternative plant proteins in place of the soybean meal protein in diets for farmed animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among the possible alternatives, the heat-processed (flaked faba beans appears interesting for dairy cow diet. Two consecutive experiments were carried out to test flaked faba beans as a partial substitute for soybean meal in the diet of Reggiana breed dairy cows producing milk for Parmigiano-Reggiano cheese-making. In both experiments a “Control” concentrate (12% soybean meal, no faba beans was compared with a “Faba” concentrate (7.5% soybean meal and 10% flaked faba beans. Forages fed to animals were hay (mixed grass and alfalfa plus mixed grass in experiment 1, hay only in experiment 2. Milk yield and quality and the characteristics of grab faecal samples as empirical indicators of digestibility, were similar between feeding groups. The milk urea content was slightly lower in the “Faba” group, particularly in experiment 2 (“Control” vs “Faba”: 34.6 vs 32.9 mg/dL in experiment 1, P<0.1; 27.4 vs 23.4 mg/dL in experiment 2, P<0.01; the plasma urea content in experiment 2 confirmed the trend observed in milk (3.9 vs 3.0 mmol/L, P<0.01. The inclusion of faba beans, within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation, could represent a feasible opportunity for a partial substitution of soybean meal.

  3. Survey the Effect of Oil Pollution on Morphological Characteristics in Faba Vulgaris and Vicia Ervilia

    Directory of Open Access Journals (Sweden)

    B. Lorestani

    2012-11-01

    Full Text Available Pollution results when a change in the environment harmfully affects the quality of human life including effect on animals, microorganisms and plants. Among the broad range of organic pollutants contaminating soil-water environment, polycyclic aromatic hydrocarbons are of great environment concern. Oil contaminated soil will affect germination, plant height, leaf area and biomass production. The aim of this research was to elucidate effects of oil pollution on morphological characteristics in Fabaceae family. For this purpose species of Faba vulgaris and Vicia ervilia were planted in different concentrations of oil in soil. For morphological studies, studied species were removed from polluted and non polluted soils separately and some morphological characters were studied in these species, then these characters were compared in plants, collected from polluted and non polluted soil. Finally, the level of significance of these differences was elucidated by using of SPSS. Obtained results showed that oil pollution can cause some abnormalities in structure of vegetative parts in plants grown on polluted soils. Decreasing of plant length and stem diameter and changing the leaf shape was among the most important effects of oil on morphological characteristics in Faba vulgaris and Vicia ervilia.

  4. [Effect of soil compaction on Vicia faba of growth in the Loess Plateau].

    Science.gov (United States)

    Nan, Zhibiao; Zhao, Hongyang; Nie, Bin

    2002-08-01

    The effect of soil compaction on the growth of Vicia faba was studied by pot experiment, field plot experiment, and farmers' field production during two consecutive years. The results showed that increasing soil bulk density at 0-7 cm depth significantly decreased the root and shoot dry weight per plant, increased plant mortality caused by Fusarium species, and decreased seed yields. Field experiments indicated that compared to the plants grown on the plots with soil bulk density of 1.55 and 1.64 g.cm-3, the root and shoot dry weight of plants grown on the plots with soil bulk density of 1.84 g.cm-3 decreased by 30.8% and 27.9%, respectively, while the plant mortality rate increased by 21.0-48.7%, and seed yields decreased by 19.8%. The trials conducted on eight farmers' land illustrated that there existed significant negative correlations between soil bulk density in Spring and root and shoot dry weight of Vicia faba seedlings, and between soil bulk density in Autumn and seed yields. The causes of high soil compaction were discussed, and suggestions for improving soil quality were presented.

  5. Antioxidant Activities of Phenolic Compounds in Green and White Faba Bean (Vicia faba L.)

    OpenAIRE

    Yu-wei Luo; Wei-hua Xie; Xiao-xiao Jin; Qian (Janice) Wang; Zhen-ping Hao; Bei-bei Tao

    2014-01-01

    Polyphenols and tannins have implications for health and nutrition because of their antioxidant activities. Foods with high content of phenolics, such as fruits, vegetables, grains and legumes, show decreasing incidence of several diseases upon their consumption. However, there are limited reports on ant oxidative properties of tannins present in legumes. Faba bean seed has been known for high content of condensed tannin which is attributed as one of the ant nutritional factors in this highly...

  6. Lead-induced DNA damage in Vicia faba root cells: potential involvement of oxidative stress.

    Science.gov (United States)

    Pourrut, Bertrand; Jean, Séverine; Silvestre, Jérôme; Pinelli, Eric

    2011-12-24

    Genotoxic effects of lead (0-20μM) were investigated in whole-plant roots of Vicia faba L., grown hydroponically under controlled conditions. Lead-induced DNA damage in V. faba roots was evaluated by use of the comet assay, which allowed the detection of DNA strand-breakage and with the V. faba micronucleus test, which revealed chromosome aberrations. The results clearly indicate that lead induced DNA fragmentation in a dose-dependant manner with a maximum effect at 10μM. In addition, at this concentration, DNA damage time-dependently increased until 12h. Then, a decrease in DNA damages was recorded. The significant induction of micronucleus formation also reinforced the genotoxic character of this metal. Direct interaction of lead with DNA was also evaluated with the a-cellular comet assay. The data showed that DNA breakages were not associated with a direct effect of lead on DNA. In order to investigate the relationship between lead genotoxicity and oxidative stress, V. faba were exposed to lead in the presence or absence of the antioxidant Vitamin E, or the NADPH-oxidase inhibitor dephenylene iodonium (DPI). The total inhibition of the genotoxic effects of lead (DNA breakage and micronucleus formation) by these compounds reveals the major role of reactive oxygen species (ROS) in the genotoxicity of lead. These results highlight, for the first time in vivo and in whole-plant roots, the relationship between ROS, DNA strand-breaks and chromosome aberrations induced by lead. Copyright © 2011 Elsevier B.V. All rights reserved.

  7. Gema and Šarac: The first Serbian cultivars of spring feed faba bean (Vicia Faba

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2009-01-01

    Full Text Available In 2007 and 2008, the trials of the Department of Variety Protection and Registration of the Ministry of Agriculture, Forestry and Water Management of the Republic of Serbia were carried out on four locations, including two new Novi Sad spring feed faba bean lines, B-412 and B-413, and the control cultivar Uran. In average, the highest grain yield was in the cultivar Gema (2905 kg ha-1, although there were no significant differences between three tested cultivars. In comparison to the control, Gema and Šarac had significantly higher crude protein content in grain dry matter, with 341.4 g kg-1 and 341.1 g kg-1. .

  8. Seed Filling Trend of Faba bean (Vicia faba L. as Affected by Planting Date and Density

    Directory of Open Access Journals (Sweden)

    Ali Rahemi Karizaki

    2016-03-01

    Full Text Available To investigate the effect of planting date and plant density on phenology, seed yield, its components, seed filling rate and grain filling period of faba bean, a factorial experiment based on randomized complete block design with four replications was conducted at Research Farm of Agricultural Sciences and Natural Resources of Gonbad University, Iran, during growing season of 2012-2013. The factors were three planting dates (4th of November, 4th of December 2013 and 3th of January 2014 and four planting densities (8, 12, 16 and 18 plant/m2. The results showed that planting dates significantly affected on phenology, yield and its components, seed filling rate and periods while the effect of plant density on seed filling period was not significant. Comparison of sigmoid equation coefficients showed that seed filling rates in three planting dates were different. The highest seed filling rate was obtained in 3th of January and the lowest at November 4, planting dates. The effect of planting date on seed filling duration was also significant, but it was not on plant density. Regression analysis showed that increasing 0.01g seed growth rate in seed unit, resulted in seed weight increase by 45.11, 32.43 and 26.66 g for November 4, December 4 and January 3 planting dates respectively. Delaying planting dates decreased seed filling period by 8.53 days and seed weight by 0.27 g. due to its effect on day length and temperature changes. Delayed planting dates were more effective on the rate and period of seed filling and phenology of faba bean. Delaying in planting date increased time to emergence, while decreased seed filling period and seed yield because of coincidence of this period with high temperatures.

  9. N-(jasmonoyl)tyrosine-derived compounds from flowers of broad beans (Vicia faba).

    Science.gov (United States)

    Kramell, Robert; Schmidt, Jürgen; Herrmann, Gabriele; Schliemann, Willibald

    2005-09-01

    Two new amide-linked conjugates of jasmonic acid, N-[(3R,7R)-(-)-jasmonoyl]-(S)-dopa (3) and N-[(3R,7R)-(-)-jasmonoyl]-dopamine (5), were isolated in addition to the known compound N-[(3R,7R)-(-)-jasmonoyl]-(S)-tyrosine (2) from the methanolic extract of flowers of broad bean (Vicia faba). Their structures were proposed on the basis of spectroscopic data (LC-MS/MS) and chromatographic properties on reversed and chiral phases and confirmed by partial syntheses. Furthermore, tyrosine conjugates of two cucurbic acid isomers (7, 8) were detected and characterized by LC-MS. Crude enzyme preparations from flowers of V. faba hydroxylated both (+/-)-2 and N-[(3R,7R/3S,7S)-(-)-jasmonoyl]tyramine [(+/-)-4] to (+/-)-3 and (+/-)-5, respectively, suggesting a possible biosynthetic relationship. In addition, a commercial tyrosinase (mushroom) and a tyrosinase-containing extract from hairy roots of red beet exhibited the same catalytic properties, but with different substrate specificities. The conjugates (+/-)-2, (+/-)-3, (+/-)-4, and (+/-)-5 exhibited in a bioassay low activity to elicit alkaloid formation in comparison to free (+/-)-jasmonic acid [(+/-)-1].

  10. Chlorella induces stomatal closure via NADPH oxidase-dependent ROS production and its effects on instantaneous water use efficiency in Vicia faba.

    Science.gov (United States)

    Li, Yan; Xu, Shan-Shan; Gao, Jing; Pan, Sha; Wang, Gen-Xuan

    2014-01-01

    Reactive oxygen species (ROS) have been established to participate in stomatal closure induced by live microbes and microbe-associated molecular patterns (MAMPs). Chlorella as a beneficial microorganism can be expected to trigger stomatal closure via ROS production. Here, we reported that Chlorella induced stomatal closure in a dose-and time-dependent manner in epidermal peels of Vicia faba. Using pharmacological methods in this work, we found that the Chlorella-induced stomatal closure was almost completely abolished by a hydrogen peroxide (H2O2) scavenger, catalase (CAT), significantly suppressed by an NADPH oxidase inhibitor, diphenylene iodonium chloride (DPI), and slightly affected by a peroxidase inhibitor, salicylhydroxamic acid (SHAM), suggesting that ROS production involved in Chlorella-induced stomatal closure is mainly mediated by DPI-sensitive NADPH oxidase. Additionally, Exogenous application of optimal concentrations of Chlorella suspension improved instantaneous water use efficiency (WUEi) in Vicia faba via a reduction in leaf transpiration rate (E) without a parallel reduction in net photosynthetic rate (Pn) assessed by gas-exchange measurements. The chlorophyll fluorescence and content analysis further demonstrated that short-term use of Chlorella did not influence plant photosynthetic reactions center. These results preliminarily reveal that Chlorella can trigger stomatal closure via NADPH oxidase-dependent ROS production in epidermal strips and improve WUEi in leave levels.

  11. The dynamics of faba bean (Vicia faba L. parasitism by Orobanche foetida

    Directory of Open Access Journals (Sweden)

    Zouhaier ABBES

    2010-09-01

    Full Text Available Normal 0 14 false false false MicrosoftInternetExplorer4 The dynamics of Orobanche foetida parasitizing faba bean are examined using Petri dish experiments. Rates of broomrape seed germination and seedling attachment to the host roots were quantified on three resistant genotypes (the Egyptian line Giza 429, the Spanish cultivar Baraca, and the Tunisian cultivar Najeh [XBJ90.03-16-1-1-1] and the susceptible cv. Bachaar. The percentage of O. foetida seed germination (11 to 38% was lower near the roots of resistant host plants than it was near the roots of ‘Bachaar’ (67%. O. foetida parasitism was followed using three parametric logistic functions. In this way some major parameters of the infection process were quantified: the maximal number (Nmax and the maximal rate (Rmax of broomrape attachments to the host roots, the median time required for attachment (T50, the maximal percentage of established tubercles reaching the final growth stage at 70 days after inoculation (DAI (%max, and the maximal rate of established tubercle growth (R’max. Broomrape attachment was lower and slower in resistant plants, as indicated by low Nmax and Rmax values combined with high T50 values. Furthermore the precocity of the resistant genotypes was correlated with low attachment. The parameters %max and R’max did not discriminate the susceptible cultivar Bachaar from Giza 429 or Baraca. On the other hand, the %max and the R’max were lower in the ‘Najeh’ plants. The findings indicated that both low attachment and limited growth of established tubercles contributed to resistance in the Najeh cultivar.

  12. Impact of dual inoculation with Rhizobium and PGPR on growth and antioxidant status of Vicia faba L. under copper stress.

    Science.gov (United States)

    Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli

    2015-04-01

    Plant-growth-promoting bacteria (PGPR) may help reduce the toxicity of heavy metals in plants in polluted environments. In this work, the effects of dual inoculation with Rhizobium and PGPR strains on the growth of Vicia faba grown under copper stress were assessed during hydroponic culture. Growth parameters, copper (Cu) accumulation and antioxidant enzyme activities were studied. Copper concentrations above 1mM damaged plant growth, but co-inoculation reduced its harmful effect. Co-inoculation of plants treated with 1mM Cu and 2mM Cu increased the dry weights as compared with Cu-treated and uninoculated plants. However, it decreased copper uptake up to 80% in the roots of 1-mM-Cu-treated plants as compared to non-inoculated control. Copper tolerance in Vicia faba is linked to the activity of antioxidant systems that are modulated by metal concentrations: both superoxide dismutase (SOD) and catalase (CAT) were higher in the presence of Cu; a lower Cu dose of 0.5mM stimulated ascorbate peroxidase (APX) and/or peroxidase (POX) activities in shoots and roots; however in nodules CAT appeared to be the main peroxidase in H2O2 scavenging. The 1mM Cu treatment enhanced SOD, CAT and APX activities in roots and only SOD and POX were activated in shoots. All enzyme activities were inhibited by inoculation of 2mM Cu. The effect of inoculation with copper-accumulating PGPRs and the status of the antioxidant enzyme system were linked to changes in the copper tolerance status of Vicia faba. Our results suggested that Vicia faba inoculation with Rhizobium and PGPR Enterobacter clocae and Pseudomonas sp. could help to alleviate copper stress under hydroponic conditions. This result should be tested under field conditions for soil fertilization and phytostabilisation purposes. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  13. The Kok effect in Vicia faba cannot be explained solely by changes in chloroplastic CO2 concentration.

    Science.gov (United States)

    Buckley, Thomas N; Vice, Heather; Adams, Mark A

    2017-08-31

    The Kok effect - an abrupt decline in quantum yield (QY) of net CO2 assimilation at low photosynthetic photon flux density (PPFD) - is widely used to estimate respiration in the light (R), which assumes the effect is caused by light suppression of R. A recent report suggested much of the Kok effect can be explained by declining chloroplastic CO2 concentration (cc ) at low PPFD. Several predictions arise from the hypothesis that the Kok effect is caused by declining cc , and we tested these predictions in Vicia faba. We measured CO2 exchange at low PPFD, in 2% and 21% oxygen, in developing and mature leaves, which differed greatly in R in darkness. Our results contradicted each of the predictions based on the cc effect: QY exceeded the theoretical maximum value for photosynthetic CO2 uptake; QY was larger in 21% than 2% oxygen; and the change in QY at the Kok effect breakpoint was unaffected by oxygen. Our results strongly suggest the Kok effect arises largely from a progressive decline in R with PPFD that includes both oxygen-sensitive and -insensitive components. We suggest an improved Kok method that accounts for high cc at low PPFD. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  14. Environmental impact of sunscreen nanomaterials: Ecotoxicity and genotoxicity of altered TiO{sub 2} nanocomposites on Vicia faba

    Energy Technology Data Exchange (ETDEWEB)

    Foltete, Anne-Sophie, E-mail: as.foltete@yahoo.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Masfaraud, Jean-Francois, E-mail: masfa@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Bigorgne, Emilie, E-mail: emilie.bigorgne@umail.univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Nahmani, Johanne, E-mail: Johanne.nahmani@univ-metz.fr [Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), Universite Paul Verlaine-Metz, CNRS UMR 7146, Campus Bridoux, Avenue du General Delestraint, 57070 Metz (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France); Chaurand, Perrine, E-mail: chaurand@cerege.fr [Centre Europeen de Recherches et d' Enseignement des Geosciences de l' Environnement (CEREGE), UMR 6635 CNRS/Aix-Marseille Universite, Europole de l' Arbois, 13545 Aix-en-Provence (France); iCEINT, International Consortium for the Environmental Implications of Nanotechnology, F-13545 Aix-en-Provence Cedex 04 (France)

    2011-10-15

    Mineral sunscreen nanocomposites, based on a nano-TiO{sub 2} core, coated with aluminium hydroxide and dimethicone films, were submitted to an artificial ageing process. The resulting Altered TiO{sub 2} Nanocomposites (ATN) were then tested in the liquid phase on the plant model Vicia faba, which was exposed 48 h to three nominal concentrations: 5, 25 and 50 mg ATN/L. Plant growth, photosystem II maximum quantum yield, genotoxicity (micronucleus test) and phytochelatins levels showed no change compared to controls. Oxidative stress biomarkers remained unchanged in shoots while in roots, glutathione reductase activity decreased at 50 mg ATN/L and ascorbate peroxidase activity decreased for 5 and 25 mg ATN/L. Nevertheless, despite the weak response of biological endpoints, ICP-MS measurements revealed high Ti and Al concentrations in roots, and X-ray fluorescence micro-spectroscopy revealed titanium internalization in superficial root tissues. Eventual long-term effects on plants may occur. - Highlights: > TiO{sub 2}-containing sunscreen nanocomposites were artificially aged. > Vicia faba was exposed 48 h to the alteration byproducts in liquid phase. > Few endpoints were modified significantly from control. > A clogging on the roots and titanium penetration in tissues were suspected. > Eventual long-term effects of the particles may occur. - Artificially aged TiO{sub 2}-containing sunscreen nanocomposites caused few damages to Vicia faba in 48 h exposure, but particles clogged on roots and Ti entered the root tissues.

  15. Promutagen activation of triazine herbicides metribuzin and ametryn through Vicia faba metabolism inducing sister chromatid exchanges in human lymphocytes in vitro and in V. faba root tip meristems.

    Science.gov (United States)

    Flores-Maya, Saúl; Gómez-Arroyo, Sandra; Calderón-Segura, María Elena; Villalobos-Pietrini, Rafael; Waliszewski, Stefan M; de la Cruz, Leticia Gómez

    2005-03-01

    The aim of our study was the induction of sister chromatid exchanges (SCE) in human lymphocytes in vitro and in root tip meristems of Vicia faba to evaluate the genotoxic effects of metribuzin and ametryn. Direct treatments of these herbicides on human lymphocytes in vitro applied 24 h after the beginning of culture did not induce SCE; however, they showed a cytotoxic effect in the cultures expressed as cellular death. On the contrary, when extracts of V. faba roots, treated for 4 h with metribuzin and ametryn (in vivo activation), were added to the lymphocyte cultures, SCEs were significantly induced with an asymptotic response. Negative responses appeared with the in vitro assays, in which metribuzin and ametryn were added directly to the 48 h lymphocyte cultures for 4 h. Nevertheless, in treatments in which the S10 metabolic mix was added, the SCE frequencies were significantly different to the control, although a concentration-response relationship was only observed with metribuzin. The results showed that both herbicides needed the V. faba metabolism to produce SCE in human lymphocyte cultures. Metribuzin and ametryn applied to V. faba root tip meristems for 4 h increased SCE frequency significantly, and a concentration-response relationship was observed with both herbicides.

  16. Between plant and diurnal variation in quantities and ratios of volatile compounds emitted by Vicia faba plants.

    Science.gov (United States)

    Webster, Ben; Gezan, Salvador; Bruce, Toby; Hardie, Jim; Pickett, John

    2010-01-01

    Ratios of volatile phytochemicals potentially offer a means for insects to recognise their host-plant species. However, for this to occur ratios of volatiles would need to be sufficiently consistent between plants and over time to constitute a host-characteristic cue. In this context we collected headspace samples from Vicia faba plants to determine how consistent ratios of key volatile phytochemicals used in host location by one of its insect pests, the black bean aphid, Aphis fabae, were. These were (E)-2-hexenal, (Z)-3-hexen-1-ol, 1-hexanol, benzaldehyde, 6-methyl-5-hepten-2-one, octanal, (Z)-3-hexen-1-yl acetate, (R)-linalool, methyl salicylate, decanal, undecanal, (E)-caryophyllene, (E)-beta-farnesene, (S)-germacrene D, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene, which had previously been found to be electrophysiologically and behaviourally active to A. fabae. Although the quantities of volatiles produced by V. faba showed large between plant and diurnal variation, correlations between quantities of compounds indicated that the ratios of certain pairs of volatiles were very consistent. This suggests that there is a host-characteristic cue available to A. fabae in the form of ratios of volatiles. 2009 Elsevier Ltd. All rights reserved.

  17. The Effect of Humic Acid on Nutrient Composition in Broad Bean (Vicia faba L. Roots

    Directory of Open Access Journals (Sweden)

    Sener AKINCI

    2009-12-01

    Full Text Available Humic acids promote the conversion of mineral nutrients into forms available to plants. It also stimulates seed germination and viability, and its main effect usually being more prominent in the roots. The objective of this study was to determine of the influence of humic acid on broad bean (Vicia faba L. cultivar �Eresen 87� on root growth and development as well as nutrient uptake, during investigation in a pot experiment. Treatment with leonardite, as humic acid source positively affected both germination and harvesting, enhancing root length and biomass. Humic acid (HA caused significant increase of fresh (RFW and dry (RDW weights by 30.1% and 56.6% of broad bean roots, respectively. Flame photometer and atomic absorption spectrophotometry analyses revealed that K content was major nutrient among the tested elements. Humic acid increased the contents of Na and K significantly. The content of Ca and Fe was not significantly increased whereas Cu, Mn and Zn content decreased under HA treatment.

  18. DNA Damage in Vicia faba by Exposure to Agricultural Soils from Tlaxcala, Mexico.

    Science.gov (United States)

    Juárez-Santacruz, L; García-Nieto, E; García-Gallegos, E; Romo-Gómez, C; Ortiz-Ortiz, E; Costilla-Salazar, R; Luna-Zendejas, H S

    2015-12-01

    The aim of this research was to quantify some POPs, such as p,p' DDT, p,p' DDE, and PCBs in agricultural soils of Tlaxcala, Mexico and evaluate their capacity for eliciting DNA damage, using Vicia faba as bioindicator. The values of ΣDDTs and ΣPCBs ranged from 8-24 to 118-26,983 µg/kg, respectively. The samples T1 (HQ = 9.3) and T2 (HQ = 53.9) showed concentrations of ΣPCBs higher than Canadian guidelines (SQGE = 500 µg/kg). The genotoxicity testing produced percentages of DNA fragmentation higher than negative control and statistically significant (p < 0.05), both in agricultural soils and organic extracts. The soils T2, T3, N4, and N5 showed a DICA from 2.6 to 3.1 times, statistically higher (p < 0.05) than negative control. In general, the agricultural soils have greater genotoxic capacity than the organic extracts, suggesting a potential risk to biota that depends upon this ecosystem.

  19. Contenidos de taninos y caracterización molecular de variedades de haba (Vicia faba L.) cultivadas por agricultores.

    OpenAIRE

    Jordan Aguilar, Bladimir

    2011-01-01

    En México el haba (Vicia faba L.) es importante para la alimentación de los habitantes del medio rural y urbano, contiene un alto contenido nutritivo, es un alimento balanceado, asimismo en la actualidad los productores demandan variedades con mayor calidad de semilla. El rango en cuanto al contenido de taninos en las semillas de haba cultivadas por los agricultores fue determinado, se estimaron las relaciones entre las variedades de haba mediante la utilización de marcadores moleculares tipo...

  20. Ca2+-mediated remote control of reversible sieve tube occlusion in Vicia faba

    DEFF Research Database (Denmark)

    Furch, Alexandra C.U.; Hafke, Jens B.; Schulz, Alexander

    2007-01-01

    (EPWs), and is reversible in intact plants. The time-course of the wound response was studied in sieve elements of main veins of intact Vicia faba plants using confocal and multiphoton microscopy. Only 15-45 s after burning a leaf tip, forisomes (giant protein bodies specific for legume sieve tubes...... reversible; callose degraded over the subsequent 1-2 h. The heat induction of both modes of occlusion coincided with the passage of an EPW visualized by electrophysiology or the potential-sensitive dye RH-414. In contrast to burning, cutting of the leaf tip induced neither an EPW nor callose deposition...

  1. Folate content in faba beans (Vicia faba L.)—effects of cultivar, maturity stage, industrial processing, and bioprocessing

    Science.gov (United States)

    Hefni, Mohammed E; Shalaby, Mohamed T; Witthöft, Cornelia M

    2015-01-01

    Faba beans are an important source of folate and commonly consumed in Egypt. This study examined the effects of Egyptian industrial food processing (e.g., canning and freezing), germination, cultivar, and maturity stages on folate content, with the aim to develop a candidate functional canned faba bean food with increased folate content. The folate content in four cultivars of green faba beans ranged from 110 to 130 μg 100 g−1 fresh weight (535–620 μg 100 g−1 dry matter [DM]), which was four- to sixfold higher than in dried seeds. Industrial canning of dried seeds resulted in significant folate losses of ∼20% (P = 0.004), while industrial freezing had no effect. Germination of faba beans increased the folate content by >40% (P faba beans resulted in a net folate content of 194 μg 100 g−1 DM, which is 52% more than in conventional canned beans. The consumption of green faba beans should be recommended, providing ∼120 μg dietary folate equivalents per 100 g/portion. PMID:25650294

  2. Phytostabilization of moderate copper contaminated soils using co-inoculation of Vicia faba with plant growth promoting bacteria.

    Science.gov (United States)

    Fatnassi, Imen Challougui; Chiboub, Manel; Saadani, Omar; Jebara, Moez; Jebara, Salwa Harzalli

    2015-03-01

    There is a need to conduct research on the selection of microbial isolates from rhizosphere of plants growing on heavy metal contaminated soils for specific restoration programs. This article suggest a consortium of bacteria combining Rhizobium sp. CCNWSX0481, Rhizobium leguminosarum bv. viciae, Enterobacter cloacae and Pseudomonas sp. 2(2010) that was examined for the ability to promote Vicia faba.L. growth when cultivated on the vineyard of soil moderately contaminated with copper. Data showed that inoculation was significant in nodulation; it increases the number and the weight of nodules of 50%. Co-inoculation was also found to positively influence growth and seed yield, through increasing fresh shoot and fresh root weights by 33 and 26%, respectively, and through rising numbers of seed per pod and pods per plant. In contrast, co-inoculation produced a significant reduction of accumulated copper in roots attending 35%, however, the treatment revealed no significant effects on the copper contents in pods and seeds. The tested inoculum could be an option to promote V. faba growth and to enhance soil fertilization in moderate copper contaminated soils. Further studies on the influence of co-inoculation practices on copper migration in soil-plant systems are recommended to acquire more information for evaluation of this legume safety. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Lead-induced genotoxicity to Vicia faba L. roots in relation with metal cell uptake and initial speciation.

    Science.gov (United States)

    Shahid, M; Pinelli, E; Pourrut, B; Silvestre, J; Dumat, C

    2011-01-01

    Formation of organometallic complexes in soil solution strongly influence metals phytoavailability. However, only few studies deal with the influence of metal speciation both on plant uptake and genotoxicity. In the present study, Vicia faba seedlings were exposed for 6h in controlled hydroponic conditions to 5 μM of lead nitrate alone and chelated to varying degrees by different organic ligands. Ethylenediaminetetraacetic acid and citric acid were, respectively, chosen as models of humic substances and low weight organic acids present in natural soil solutions. Visual Minteq software was used to estimate free lead cations concentration and ultimately to design the experimental layout. For all experimental conditions, both micronucleus test and measure of lead uptake by plants were finally performed. Chelation of Pb by EDTA, a strong chelator, dose-dependently increased the uptake in V. faba roots while its genotoxicity was significantly reduced, suggesting a protective role of EDTA. A weak correlation was observed between total lead concentration absorbed by roots and genotoxicity (r(2)=0.65). In contrast, a strong relationship (r(2)=0.93) exists between Pb(2+) concentration in exposure media and genotoxicity in the experiment performed with EDTA. Citric acid induced labile organometallic complexes did not demonstrate any significant changes in lead genotoxicity or uptake. These results demonstrate that metal speciation knowledge could improve the interpretation of V. faba genotoxicity test performed to test soil quality. Copyright © 2010 Elsevier Inc. All rights reserved.

  4. Contaminant bioavailability in soil and phytotoxicity/genotoxicity tests in Vicia faba L.: a case study of boron contamination.

    Science.gov (United States)

    Barbafieri, Meri; Giorgetti, Lucia

    2016-12-01

    In this work, the model plant for genotoxicity studies Vicia faba L. was used to investigate the relation between Boron (B) content and bioavailability in soil and plant genotoxic/phytotoxic response. A total of nine soil samples were investigated: two soil samples were collected from a B-polluted industrial area in Cecina (Tuscany, Italy), the other samples were obtained by spiking control soil (from a not polluted area of the basin) with seven increased doses of B, from about 20 to 100 mg B kg(-1). As expected, B availability, evaluated by chemical extraction, was higher (twofold) in spiked soils when compared with collected polluted soils with the same B total content. To analyze the phytotoxic effects of B, seed germination, root elongation, biomass production, and B accumulation in plant tissues were considered in V. faba plants grown in the various soils. Moreover, the cytotoxic/genotoxic effects of B were investigated in root meristems by mitotic index (MI) and micronuclei frequency (MCN) analysis. The results highlighted that V. faba was a B-sensitive plant and the appearance of phytotoxic effects, which altered plant growth parameters, were linearly correlated to the bioavailable B concentration in soils. Concerning the occurrence of cytotoxic/genotoxic effects induced by B, no linear correlation was observed even if MCN frequency was logarithmic correlated with the concentration of B bioavailable in soils.

  5. Pea (Pisum sativum and faba beans (Vicia faba in dairy cow diet: effect on milk production and quality

    Directory of Open Access Journals (Sweden)

    Maurizio Moschini

    2012-04-01

    Full Text Available The use of alternative plant proteins in place of the soybean meal protein in diets for producing animals aims to reduce the extra-EU soybean import and partially substitute the GMO in the food chain. Among possible alternatives, the heat-processed legume grains seem interesting for dairy cow diets. Two consecutive experiments were carried out to evaluate flaked pea and faba beans as substitute for soybean meal in diets for Reggiana breed dairy cows producing milk for Parmigiano-Reggiano cheese-making. In both experiments a C concentrate (110 g/kg soybean meal, no pea and faba beans was compared to a PF concentrate (150 g/kg flaked pea, 100 g/kg flaked faba beans, no soybean meal. Forages fed to animals were hay (mixed grass and alfalfa in experiment 1 and hay plus mixed grass in experiment 2. Concentrate intake, milk yield and milk quality (rennet coagulation traits included were similar between feeding groups. Parameters on the grab faecal samples, as empirical indicators of digestibility, had a smaller (Pvs 3.1 and 2.3 vs 2.8%, respectively for PF and C in experiment 1 and 2. Some blood indicators of nitrogen metabolism (protein, albumin, urea were similar between the feeding groups. The inclusion of pea and faba beans, within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation, could represent a feasible opportunity for a total substitution of soybean meal.

  6. Influence of ionizing irradiation on the antioxidant enzymes of Vicia faba L.

    Directory of Open Access Journals (Sweden)

    El-Beltagi, Hossam E. S.

    2010-09-01

    Full Text Available The seeds of Vicia faba L. Giza 834 were exposed to γ-irradiation at dose levels of 2.5, 5.0, 10.0 and 20.0 kGy and after that exposed to He–Ne (632.8 nm or diode (650.0 nm laser irradiation for 5 min. The activities of POD, APOX, CAT, SOD and GST enzymes were significantly stimulated and this stimulation reached its maximum at a dose level of 5.0 kGy for enzymes POD, APOX, CAT and SOD, but for GST enzyme at a dose level 10.0 kGy. For He- Ne laser, with or without different doses (2.5, 5.0, 10.0 and 20.0 kGy of γ-irradiation, enzyme induction was significantly stimulated and positively correlated with the dose levels of γ-irradiation in combination with the He-Ne treatment. There was a significant increase in the concentration of MDA and this increase was more pronounced at dose level 20.0 kGy (38.2 μmol/g d.w compared to the control (3.9 μmol/g d.w. Laser treatment by He–Ne laser or diode laser only caused a slight increase (P 2O2 content significantly increased in all treatments and this increase reached its maximum at dose level 20.0 kGy (36.3 μmol/g d.w compared to the control (2.3 μmol/g d.w.. On the other hand, He-Ne or diode laser treatments combined with γ-irradiation significantly decreased in comparison with γ-irradiation treatments alone. In the case of glutathione content, there were significant increases by γ-irradiation at dose levels 2.5, 5.0, 10.0 and 20.0 kGy. Furthermore, with a combination of γ-irradiation and He-Ne or diode laser, a marked increase in glutathione content was found and was more pronounced than that of gamma irradiation alone.Semillas de Vicia faba L. Giza 834 fueron expuestas a γ-irradiación a dosis de 2.5, 5.0, 10.0 y 20.0 kGy y después expuesta a una radiación laser de He–Ne (632.8 nm o de diodo (650.0 nm durante 5 minutos. Las actividades de las enzimas POD, APOX, CAT, SOD y GST fueron favorecidas significativamente, y éstas alcanzaron un máximo a una dosis de 5.0 kGy para las enzimas

  7. Effects of gamma irradiation and/or cooking on nutritional quality of faba bean (Vicia faba L.) cultivars seeds.

    Science.gov (United States)

    Osman, Asha Mohamed Ali; Hassan, Amro B; Osman, Gammaa A M; Mohammed, Nagat; Rushdi, Mohamed A H; Diab, Eiman E; Babiker, Elfadil E

    2014-08-01

    The effect of gamma irradiation (0.5 and 1.0 kGy) and/or cooking on the proximate composition, mineral content, tannin content, phytic acid content and the in vitro protein digestibility (IVPD) of two Sudanese faba bean cultivars (BB7-S1 and SH-S2) was investigated in the present study. The results obtained revealed that gamma irradiation and/or cooking treatments have slight effect in chemical composition and mineral content, while they caused significant (P ≤ 0.05) reduction on tannin content for both cultivars. Cooking of faba bean seeds also insignificantly (P ≤ 0.05) reduced phytic acid content for both cultivars, while irradiation process and/or cooking had fluctuated effect. For both cultivars, irradiation of seeds and/or cooking increased the in vitro protein digestibility (IVPD), with maximum value of IVPD (79.97%) obtained for cultivar BB7-S1. The results indicate that the treatments used in this study might improve the nutritive quality of faba bean seed due to reduction in antinutritional factors with a concomitant increase in IVPD.

  8. Sister chromatid exchanges in Vicia faba induced by arsenic-contaminated drinking water from Zimapan, Hidalgo, Mexico.

    Science.gov (United States)

    Gómez-Arroyo, S; Armienta, M A; Cortés-Eslava, J; Villalobos-Pietrini, R

    1997-11-27

    Sister chromatid exchanges (SCE) in Vicia faba root tips were used to examine well water containing high levels of arsenic. The increased amount of arsenic was contained in well water from different towns of Zimapan, Hidalgo, Mexico. Treatments of 3 h were applied followed by the differential staining technique of Tempelaar et al. (Mutation Res. 103 (1982) 321-326). Concentrations of arsenic from 0.267 up to 1.070 mg/l were determined by colorimetry in the polluted samples used for this study. These values were above the permissible limit of 0.05 mg/l in drinking water. In all cases, except one in which the As concentration was 0.021, the arsenic-contaminated water produced significant increases of SCE compared with the control (p Comarca Lagunera and the results observed in Zimapan.

  9. Effects of gamma irradiation and/or cooking on nutritional quality of faba bean (Vicia faba L.) cultivars seeds

    OpenAIRE

    Osman, Asha Mohamed Ali; Hassan, Amro B.; Osman, Gammaa A. M.; Mohammed, Nagat; Rushdi, Mohamed A. H.; Diab, Eiman E.; Babiker, Elfadil E.

    2012-01-01

    The effect of gamma irradiation (0.5 and 1.0 kGy) and/or cooking on the proximate composition, mineral content, tannin content, phytic acid content and the in vitro protein digestibility (IVPD) of two Sudanese faba bean cultivars (BB7-S1 and SH-S2) was investigated in the present study. The results obtained revealed that gamma irradiation and/or cooking treatments have slight effect in chemical composition and mineral content, while they caused significant (P ≤ 0.05) reduction on tannin conte...

  10. Genotoxicity of Silver Nanoparticles in Vicia faba: A Pilot Study on the Environmental Monitoring of Nanoparticles

    Directory of Open Access Journals (Sweden)

    Paul B. Tchounwou

    2012-05-01

    Full Text Available The use of silver nanoparticles (AgNPs in commercial products has increased significantly in recent years. Although there have been some attempts to determine the toxic effects of AgNPs in mammalian and human cell-lines, there is little information on plants which play a vital role in ecosystems. The study reports the use of Vicia faba root-tip meristem to investigate the genotoxicity of AgNPs under modified GENE-TOX test conditions. The root tip cells of V. faba were treated with four different concentrations of engineered AgNPs dispersion to study toxicological endpoints such as mitotic index (MI, chromosomal aberrations (CA and micronucleus induction (MN. For each concentration, five sets of microscopy observations were carried out. The results demonstrated that AgNPs exposure significantly increased (p < 0.05 the number of chromosomal aberrations, micronuclei, and decreased the MI in exposed groups compared to control. From this study we infer that AgNPs might have penetrated the plant system and may have impaired mitosis causing CA and MN. The results of this study demonstrate that AgNPs are genotoxic to plant cells. Since plant assays have been integrated as a genotoxicity component in risk assessment for detection of environmental mutagens, they should be given full consideration when evaluating the overall toxicological impact of the nanoparticles in the environment.

  11. Immunolocalization of dually phosphorylated MAPKs in dividing root meristem cells of Vicia faba, Pisum sativum, Lupinus luteus and Lycopersicon esculentum.

    Science.gov (United States)

    Winnicki, Konrad; Żabka, Aneta; Bernasińska, Joanna; Matczak, Karolina; Maszewski, Janusz

    2015-06-01

    In plants, phosphorylated MAPKs display constitutive nuclear localization; however, not all studied plant species show co-localization of activated MAPKs to mitotic microtubules. The mitogen-activated protein kinase (MAPK) signaling pathway is involved not only in the cellular response to biotic and abiotic stress but also in the regulation of cell cycle and plant development. The role of MAPKs in the formation of a mitotic spindle has been widely studied and the MAPK signaling pathway was found to be indispensable for the unperturbed course of cell division. Here we show cellular localization of activated MAPKs (dually phosphorylated at their TXY motifs) in both interphase and mitotic root meristem cells of Lupinus luteus, Pisum sativum, Vicia faba (Fabaceae) and Lycopersicon esculentum (Solanaceae). Nuclear localization of activated MAPKs has been found in all species. Co-localization of these kinases to mitotic microtubules was most evident in L. esculentum, while only about 50% of mitotic cells in the root meristems of P. sativum and V. faba displayed activated MAPKs localized to microtubules during mitosis. Unexpectedly, no evident immunofluorescence signals at spindle microtubules and phragmoplast were noted in L. luteus. Considering immunocytochemical analyses and studies on the impact of FR180204 (an inhibitor of animal ERK1/2) on mitotic cells, we hypothesize that MAPKs may not play prominent role in the regulation of microtubule dynamics in all plant species.

  12. Antifungal activity of acetone extracts from Punica granatum L., Quercus suber L. and Vicia faba L.

    Science.gov (United States)

    Akroum, S

    2017-03-01

    Human and animal mycoses become more frequent and more resistant to traditional treatments. In this work, we tested the in vitro antifungal activity of acetonic extracts of Punica granatum L., Quercus suber L. and Vicia faba L. against seven pathogen fungi and the in vivo antifungal activity against Candida albicans and Trichophyton mentagrophytes. The phytochemical screening was also carried out and showed that the extracts contained mainly proanthocyanidins. Other polyphenols were also present but in low quantity. The acetone extract of V. faba L. gave a good in vitro inhibition of yeasts and was the most active for treating candidiasis in mice. It decreased the percentage of mortality with only 20μg. But the in vivo antifungal activity of this extract on T. mentagrophytes was low. It only showed a small diminution of crusting and erythema after the administration of 100μg. On the contrary, the acetone extracts of P. granatum L. had a poor activity against yeasts and a better one against moulds. It gave the best in vivo antifungal activity against T. mentagrophytes by healing animals with 40μg. The extract of P. granatum L. gave also an interesting in vivo antifungal activity against T. mentagrophytes with an active dose of 80μg. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  13. Biomass growth, micronucleus induction, and antioxidant stress enzyme responses in Vicia faba exposed to cadmium in solution.

    Science.gov (United States)

    Rosa, Edson V Cordova; Valgas, Cleidson; Souza-Sierra, Maria M; Corrêa, Albertina X R; Radetski, Claudemir Marcos

    2003-03-01

    Biomass growth, micronucleus induction, and antioxidative stress enzymes (superoxide dismutase, peroxidase, glutathione reductase, and catalase) were investigated simultaneously in the Vicia faba plant exposed to cadmium in solution. The biomass lowest-observed-effect concentration (LOEC) value was 2,000 microM Cd2+. In the shoots, enzymic activities increased without concentration-response relationships. In the roots, after an initial increase, activities of all enzymes showed negative concentration-response relationships. A significant increase in micronucleus induction was observed at 20 microM Cd2+. Regarding sensitivity, our results showed that biomass endpoint was less sensitive than micronucleus induction, which was less sensitive than antioxidative enzyme activities. The increase of antioxidant stress enzyme activities in response to cadmium exposure may be taken as evidence for an enhanced detoxification capacity of V. faba plants toward reactive oxygen species (and derivatives) that might be generated in the stressed plants. Concomitant micronucleus induction may be also interpreted as a consequence of oxidative stress, upholding the view that cadmium-induced DNA damage is, to some extent, via generation of reactive (intermediate) oxygen species.

  14. Relations between the crude protein content and the amino acid profile of organically produced field beans (Vicia faba L.) and field peas (Pisum sativum L.)

    OpenAIRE

    Witten, Stephanie; Aulrich, Karen

    2015-01-01

    In Organic Farming, grain legumes are important protein feedstuffs. There are hints indicating that the amino acid (AA) profile is affected by factors associated with varying crude protein (CP) contents of crops. The knowledge on this relationship between CP and AA profile needs to be extended to optimize feeding strategies for monogastrics as well as the selection of cultivars and varieties in fodder crop cultivation. Therefore, samples of 67 field beans (Vicia faba L.) and 86 field peas (Pi...

  15. Impact of three different fungicides on fungal epi- and endophytic communities of common bean (Phaseolus vulgaris) and broad bean (Vicia faba).

    Science.gov (United States)

    Prior, René; Mittelbach, Moritz; Begerow, Dominik

    2017-06-03

    In this study, the impacts of three different fungicides to fungal phyllosphere communities on broad bean (Vicia faba, Fabaceae) and common bean (Phaseolus vulgaris, Fabaceae) were analyzed. The fungicides included copper, sulfur, and azoxystrobin. The plants were sowed, grown, and treated under conditions occurring in conventional and organic farming. A culture-based approach was used to identify changes in the phyllosphere fungal community after the treatment. Different effects on species richness and growth index of the epiphytic and endophytic communities for common bean and broad bean could be shown. Treatments with sulfur showed the weakest effect, followed by those based on copper and the systemic azoxystrobin, which showed the strongest effect especially on endophytic communities. The epiphytic fungal community took five weeks to recover after treatment with azoxystrobin. However, the effect of azoxystrobin on the endophytic community lasted more than five weeks. Finally, the data suggest that the surface structure of the host leaves have a huge impact on the mode of action that the fungicides exert.

  16. Weed control under integrated nutrient management systems in faba bean (Vicia faba) production in Egypt Controle de plantas daninhas sob sistemas de manejo integrado em feijão de fava (Vicia faba) no Egito

    National Research Council Canada - National Science Library

    I.M. El-Metwally; M.T. Abdelhamid

    2008-01-01

    Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential...

  17. Resolving browning during the establishment of explant cultures in Vicia faba L. for genetic transformation

    Directory of Open Access Journals (Sweden)

    Helena Klenotičová

    2013-01-01

    Full Text Available Optimisation of in vitro regeneration systems of two explant types for low-tannine cultivars of faba bean based on culturing of shoot apices and cotyledonary nodes were provided by usage of various antioxidants - ascorbic acid, citric acid, glutathione and activated charcoal. In subsequent testing, the combined effects of antioxidants with transformation co-cultivation compounds acetosyringone and L-cysteine was studied. The application of antioxidants lead to decreased callogenesis, citric acids treatments (50 mg.l−1 dramatically decreased necrotic response of explants. However, citric acid, used together with ascorbic acid completely inhibited shoot growth in shoot apex cultures. Glutathion evoked hyperhydricity of explants. Activated charcoal induced rooting on media which are commonly used for shoot proliferation. Combination of acetosyringone with antioxidants influenced shoot proliferation, except of variant with ascorbic acid. Citric acid was the best and universal antioxidant in faba bean in vitro cultures and its use is recommended for faba bean genetic transformation experiments.

  18. Symbiotic effectiveness and phylogeny of rhizobia isolated from faba bean (Vicia faba L.) in Sichuan hilly areas, China.

    Science.gov (United States)

    Xu, Kai Wei; Zou, Lan; Penttinen, Petri; Wang, Ke; Heng, Nan Nan; Zhang, Xiao Ping; Chen, Qiang; Zhao, Ke; Chen, Yuan Xue

    2015-10-01

    A total of 54 rhizobial strains were isolated from faba bean root nodules in 21 counties of Sichuan hilly areas in China, and their symbiotic effectiveness, genetic diversity and phylogeny were assessed. Only six strains increased the shoot dry mass of the host plant significantly (P ≤ 0.05). Based on the cluster analysis of combined 16S rDNA and intergenic spacer region (IGS) PCR-RFLP, the strains were divided into 31 genotypes in 11 groups, indicating a high degree of genetic diversity among the strains. The sequence analysis of three housekeeping genes (atpD, glnII and recA) and 16S rDNA indicated that the strains represented two R. leguminosarum, two Rhizobium spp., R. mesosinicum, Agrobacterium sp. and A. tumefaciens. The strains representing four Rhizobium species were divided into two distinct nodC and nifH genotypes. However, the phylogeny of housekeeping genes and symbiotic genes was not congruent, implying that the strains had been shaped by vertical evolution of the housekeeping genes and lateral evolution of the symbiotic genes. Copyright © 2015 Elsevier GmbH. All rights reserved.

  19. Evaluation of faba beans (Vicia faDa cv. Fiord) and sweet lupins ...

    African Journals Online (AJOL)

    OLCKERS, R.C., 1991. Evaluering van gars as voedingsbron in varkdi€te in die Winterreenstreek. MSc.(Agric)-tesis. Universiteit van Stellenbosch,. Stellenbosch 7600, Suid-Afiika. ORTIZ, L.T., CENTENO, C. & TREVINO, J., 1993. Tannins in faba bean seeds: effects on the digestion of protein and antino acids in growing.

  20. Infestation of Broad Bean (Vicia faba) by the Green Stink Bug (Nezara viridula) Decreases Shoot Abscisic Acid Contents under Well-Watered and Drought Conditions.

    Science.gov (United States)

    Ederli, Luisa; Brunetti, Cecilia; Centritto, Mauro; Colazza, Stefano; Frati, Francesca; Loreto, Francesco; Marino, Giovanni; Salerno, Gianandrea; Pasqualini, Stefania

    2017-01-01

    The response of broad bean (Vicia faba) plants to water stress alone and in combination with green stink bug (Nezara viridula) infestation was investigated through measurement of: (1) leaf gas exchange; (2) plant hormone titres of abscisic acid (ABA) and its metabolites, and of salicylic acid (SA); and (3) hydrogen peroxide (H2O2) content. Furthermore, we evaluated the effects of experimentally water-stressed broad-bean plants on N. viridula performance in terms of adult host-plant preference, and nymph growth and survival. Water stress significantly reduced both photosynthesis (A) and stomatal conductance (gs ), while infestation by the green stink bug had no effects on photosynthesis but significantly altered partitioning of ABA between roots and shoots. Leaf ABA was decreased and root ABA increased as a result of herbivore attack, under both well-watered and water-deprived conditions. Water stress significantly impacted on SA content in leaves, but not on H2O2. However, infestation of N. viridula greatly increased both SA and H2O2 contents in leaves and roots, which suggests that endogenous SA and H2O2 have roles in plant responses to herbivore infestation. No significant differences were seen for green stink bug choice between well-watered and water-stressed plants. However, for green stink bug nymphs, plant water stress promoted significantly lower weight increases and significantly higher mortality, which indicates that highly water-stressed host plants are less suitable for N. viridula infestation. In conclusion two important findings emerged: (i) association of water stress with herbivore infestation largely changes plant response in terms of phytohormone contents; but (ii) water stress does not affect the preference of the infesting insects, although their performance was impaired.

  1. Nutritional improvement of corn pasta-like product with broad bean (Vicia faba) and quinoa (Chenopodium quinoa).

    Science.gov (United States)

    Giménez, M A; Drago, S R; Bassett, M N; Lobo, M O; Sammán, N C

    2016-05-15

    In this study, the nutritional quality of pasta-like product (spaghetti-type), made with corn (Zea mays) flour enriched with 30% broad bean (Vicia faba) flour and 20% of quinoa (Chenopodium quinoa) flour, was determined. Proximate chemical composition and iron, zinc and dietary fiber were determined. A biological assay was performed to assess the protein value using net protein utilization (NPU), true digestibility (TD) and protein digestibility-corrected amino acid score (PDCAAS). Iron and zinc availability were estimated by measuring dialyzable mineral fraction (%Da) resulting from in vitro gastrointestinal digestion. Nutritionally improved, gluten-free spaghetti (NIS) showed significantly increased NPU and decreased TD compared with a non-enriched control sample. One NIS-portion supplied 10-20% of recommended fiber daily intake. Addition of quinoa flour had a positive effect on the FeDa% as did broad bean flour on ZnDa%. EDTA increased Fe- and ZnDa% in all NIS-products, but it also impaired sensorial quality. Copyright © 2016. Published by Elsevier Ltd.

  2. Efecto de la acetilación sobre las propiedades funcionales y nutricionales de almidones de haba (VICIA FABA

    Directory of Open Access Journals (Sweden)

    Constanza López

    2011-03-01

    Full Text Available Se analizaron algunas propiedades funcionales del almidón de haba (Vicia faba, con dos niveles de proteína -12,89% y 4,41%-, obtenido por fraccionamiento por vía húmeda de las semillas secas. Se comparan el secado en rodillos y la liofilización como métodos para deshidratar la muestra, así como las propiedades funcionales del almidón antes y después de acetilarlo con anhídrido acético. También se investigaron ciertas propiedades de interés nutricional con el fin de observar la influencia de la modificación química en la biodisponibilidad del almidón de haba. Se realizó la determinación de almidón total, almidón resistente por retrogradación (AR3, almidón disponible y la velocidad de hidrólisis enzimática en el almidón nativo y en el modificado.

  3. Variation in seed mineral elements profile and yield in field bean (Vicia faba L. var. minor genotypes

    Directory of Open Access Journals (Sweden)

    Sara Lombardo

    2016-12-01

    Full Text Available Field bean (Vicia faba L. var. minor is one of the major leguminous crops cultivated in the world and mainly destined for animal feed. Although its seed is generally recognised as a good protein source, little is known about its mineral elements profile, which is an important aspect for a balanced animal diet. Therefore, the aim of the present work was to assess the seed mineral elements composition, along with some key production parameters, in eight field bean genotypes grown in a Mediterranean environment, without intensive management, over two years (2009/10 and 2010/11. Independently of the year, the seed of Chiaro di Torre Lama was the richest in phosphorus (P, magnesium, calcium and iron contents, while that of Sint 6 and Motta Chiaro 69 were the most effective accumulators of potassium and zinc, respectively. While all the genotypes yielded better in the second year (with more rainfall, the seasonal effect on seed mineral elements composition depended on the genotype. Indeed, the P content was 46% lower in Chiaro di Torre Lama, Motta Chiaro 69 and Sint 6 in the second year, while there was only a negligible seasonal effect for Sint 8 with respect to Fe content. Overall, this crop is reasonably productive under a low management regime and its seed can supply significant amounts of certain minerals (particularly P in feed formulations. Both aspects are important in a perspective of optimising field bean production in the Mediterranean area and, hence, improving farmers’ income.

  4. Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina Thysanoptera (Insecta-Vicia faba (Fabaceae association in Prepuna and Puna in Jujuy, Argentina

    Directory of Open Access Journals (Sweden)

    María Inés Zamar

    2012-03-01

    Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F

  5. Effect of Calcium and Potassium on Antioxidant System of Vicia faba L. Under Cadmium Stress

    Directory of Open Access Journals (Sweden)

    Hayssam M. Ali

    2012-05-01

    Full Text Available Cadmium (Cd in soil poses a major threat to plant growth and productivity. In the present experiment, we studied the effect of calcium (Ca2+ and/or potassium (K+ on the antioxidant system, accumulation of proline (Pro, malondialdehyde (MDA, and content of photosynthetic pigments, cadmium (Cd and nutrients, i.e., Ca2+ and K+ in leaf of Vicia faba L. (cv. TARA under Cd stress. Plants grown in the presence of Cd exhibited reduced growth traits [root length (RL plant−1, shoot length (SL plant−1, root fresh weight (RFW plant−1, shoot fresh weight (SFW plant−1, root dry weight (RDW plant−1 and shoot dry weight (SDW plant−1] and concentration of Ca2+, K+, Chlorophyll (Chl a and Chl b content, except content of MDA, Cd and (Pro. The antioxidant enzymes [peroxidase (POD and superoxide dismutase (SOD] slightly increased as compared to control under Cd stress. However, a significant improvement was observed in all growth traits and content of Ca2+, K+, Chl a, Chl b ,Pro and activity of antioxidant enzymes catalase (CAT, POD and SOD in plants subjected to Ca2+ and/or K+. The maximum alleviating effect was recorded in the plants grown in medium containing Ca2+ and K+ together. This study indicates that the application of Ca2+ and/or K+ had a significant and synergistic effect on plant growth. Also, application of Ca2+ and/or K+ was highly effective against the toxicity of Cd by improving activity of antioxidant enzymes and solute that led to the enhanced plant growth of faba bean plants.

  6. Raw Pea (Pisum sativum, raw Faba bean (Vicia faba var. minor and raw Lupin (Lupinus albus var. multitalia as alternative protein sources in broiler diets

    Directory of Open Access Journals (Sweden)

    Gianfranco Piva

    2010-01-01

    Full Text Available The ban of the meat and bone meal for entering animal diets and the concern of transgenic feeds poses a challenge toanimal nutritionists in Europe. The challenge is to find homegrown protein-rich feedstuffs, making sure no antinutritionalfactors are present which could interfere in the animals’ performance. The raw Pea (Pisum sativum (RP, raw Fababean (Vicia faba, variety minor (RFb and raw Lupin (Lupinus albus, variety multitalia (RL were evaluated as alternativeprotein sources into broiler diets. Six hundred thirty 1d-old Ross male chicks, Marek vaccinated, were randomlyassigned to seven dietary treatments (5 pens per treatment/18 birds per pen. Chicks were floor housed, ad libitum fedisocaloric and isonitrogenous diets and had free access to water. Artificial light was provided 10 h/d. The bulk of the basediet (control diet was corn (48.7%, 56.6% and 57%, solvent-extracted soybean meal (42.8%, 37.3% and 33.4%, cornoil (4.4%, 5.2% and 6.3%, plus synthetic amino acids, minerals, trace minerals and vitamins, respectively for the 1-10d-old, 11-28d-old and 29 to 42d-old growing periods. The RP, RFb and RL entered diets in substitution of the soybeanand corn according to the cost optimization (P100, Fb100 and L100, respectively for RP, RFb and RL and at half of theoptimized quantity (RP50, RFb50 and RL50, respectively for RP, RFb and RL. The amount used as fed basis for the higherlevel of inclusion were: P100: 350 g/kg for all diets; Fb100: 480 g/kg (1-10d-old and 500 g/kg (11-42d-old; L100:360 g/kg (1-10d-old and 300 g/kg (11-42d-old. The average daily gain (ADG were lower (P compared to the control group. Over the whole period of growth, the RFb group had similar ADG compared to the controlgroup and for both levels of inclusion, whereas reduced (P (P growth. Birds performance was improved (P and breast and leg quarter cuts. The RFb and RL could represent valuable protein feeds in broilers diet formulation.

  7. NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling in Vicia faba guard cells.

    Science.gov (United States)

    Yi, Min; Bai, Heli; Xue, Meizhao; Yi, Huilan

    2017-04-01

    NO and H2O2 have been implicated as important signals in biotic and abiotic stress responses of plants to the environment. Previously, we have shown that SO2 exposure increased the levels of NO and H2O2 in plant cells. We hypothesize that, as signaling molecules, NO and H2O2 mediate SO2-caused toxicity. In this paper, we show that SO2 hydrates caused guard cell death in a concentration-dependent manner in the concentration range of 0.25 to 6 mmol L-1, which was associated with elevation of intracellular NO, H2O2, and Ca2+ levels in Vicia faba guard cells. NO donor SNP enhanced SO2 toxicity, while NO scavenger c-PTIO and NO synthesis inhibitors L-NAME and tungstate significantly prevented SO2 toxicity. ROS scavenger ascorbic acid (AsA) and catalase (CAT), Ca2+ chelating agent EGTA, and Ca2+ channel inhibitor LaCl3 also markedly blocked SO2 toxicity. In addition, both c-PTIO and AsA could completely block SO2-induced elevation of intracellular Ca2+ level. Moreover, c-PTIO efficiently blocked SO2-induced H2O2 elevation, and AsA significantly blocked SO2-induced NO elevation. These results indicate that extra NO and H2O2 are produced and accumulated in SO2-treated guard cells, which further activate Ca2+ signaling to mediate SO2 toxicity. Our findings suggest that both NO and H2O2 contribute to SO2 toxicity via Ca2+ signaling.

  8. Increasing phosphorus supply is not the mechanism by which arbuscular mycorrhiza increase attractiveness of bean (Vicia faba) to aphids.

    Science.gov (United States)

    Babikova, Zdenka; Gilbert, Lucy; Randall, Kate C; Bruce, Toby J A; Pickett, John A; Johnson, David

    2014-10-01

    Arbuscular mycorrhizal (AM) fungi, important plant mutualists, provide plants with nutrients such as phosphorus (P) in return for carbon. AM fungi also enhance the attractiveness of plants to aphids via effects on emissions of plant volatiles used in aphid host location. We tested whether increased P uptake by plants is the mechanism through which AM fungi alter the volatile profile of plants and aphid behavioural responses by manipulating the availability of P and AM fungi to broad beans (Vicia faba L.) in a multi-factorial design. If AM fungi affect plant volatiles only via increased P acquisition, we predicted that the emission of volatiles and the attractiveness of mycorrhizal beans to aphids would be similar to those of non-mycorrhizal beans supplied with additional P. AM fungi and P addition increased leaf P concentrations by 40 and 24%, respectively. The production of naphthalene was less in mycorrhizal plants, regardless of P addition. By contrast, production of (S)-linalool, (E)-caryophyllene and (R)-germacrene D was less in plants colonized by AM fungi but only in the absence of P additions. The attractiveness of plants to pea aphids (Acyrthosiphon pisum Harris) was positively affected by AM fungi and correlated with the extent of root colonization; however, attractiveness was neither affected by P treatment nor correlated with leaf P concentration. These findings suggest that increased P uptake is not the main mechanism by which mycorrhiza increase the attractiveness of plants to aphids. Instead, the mechanism is likely to operate via AM fungi-induced plant systemic signalling. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  9. Weed control under integrated nutrient management systems in faba bean (Vicia faba production in Egypt Controle de plantas daninhas sob sistemas de manejo integrado em feijão de fava (Vicia faba no Egito

    Directory of Open Access Journals (Sweden)

    I.M. El-Metwally

    2008-01-01

    Full Text Available Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential. The experiment included five treatments, composed of organic and mineral fertilizers, alone and mixed at different rates, along with a control and six weed control treatments, including oxadiargyl, prometryn, hand hoeing treatments alone or mixed with the herbicides, and a nonweeded treatment (control.The herbicide treatments were not superior to the two hand-hoeing treatments. Using compost favored growth and yield of faba bean more than of weeds. Adding fertilizer also improved most yield parameters. Application of compost alone or combined with 50 or 100% of the recommended NPK rate improved faba bean growth in terms of net assimilation rate, specific leaf area, and leaf weight ratio as components of relative growth rate. This improvement in growth resulted in increase of seed yield, yield components and protein of faba bean. Faba bean yield performance improved under interactive fertilizer effects and weed control treatments as growth improved, as a result of nutrient release from fertilizers and weed control.Dois experimentos em condições de campo foram conduzidos em duas épocas sucessivas - 2005/2006 e 2006/2007 - para determinar se o manejo pode melhorar a competitividade do feijão-fava contra plantas daninhas e contribuir para um maior potencial de produção. Os experimentos incluíram cinco tratamentos, compostos de: fertilizantes orgânicos e minerais, isoladamente ou em mistura em diferentes doses, além do tratamento controle, e seis tratamentos de controle de plantas daninhas, incluindo tratamentos usando oxadiargyl, prometryn, manualmente ou misturados com os herbicidas e um tratamento sem plantas daninhas (controle. Os tratamentos com os herbicidas não foram superiores aos dois tratamentos manuais (hand hoeing

  10. Thidiazuron-induced plant regeneration from protoplasts of Vicia faba cv. Mythos.

    Science.gov (United States)

    Tegeder, M; Gebhardt, D; Schieder, O; Pickardt, T

    1995-12-01

    Protoplasts of 10 cultivars of V. faba were isolated from etiolated shoot-tips and tested for their regeneration capacity. After purification, protoplasts were embedded in sodium alginate and cultivated in the medium of Kao and Michayluk (1975) containing 0.5 mg·1(-1) of each 2,4-dichlorophenoxyacetic acid, naphthylacetic acid and 6-benzylaminopurine. Depending on cultivar, division frequencies of up to 40% were obtained. Six weeks after embedding, protoplast-derived calluses were transferred to Gelrite-solidified media with different combinations of growth regulators. A two step protocol (auxin high/low) was tested for its ability to induce somatic embryogenesis. The formation of globular structures was observed, but no embryo formation could be achieved. In contrast, cultivation of protocalluses on medium supplemented with thidiazuron resulted in shoot development in cultivar Mythos. To generate mature plants, the shoots were grafted onto young seedlings. In order to optimize the in vitro-conditions, different concentrations of thidiazuron alone or in combination with naphthylacetic acid were tested, showing that an increase of thidiazuron and the addition of naphthylacetic acid positively affects both the viability of protocalluses and the regeneration frequency.

  11. Asociación Thysanoptera (Insecta-Vicia faba (Fabaceae en la Prepuna y Puna de Jujuy, Argentina

    Directory of Open Access Journals (Sweden)

    María Inés Zamar

    2012-03-01

    Full Text Available Los distintos estados fenológicos de Vicia faba ofrecen recursos alimenticios y sustratos para el desarrollo de una importante diversidad de insectos. Los objetivos de este estudio fueron: identificar el complejo de tisanópteros antófilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecológicos y determinar el rol que cumplen en esta asociación. El estudio se realizó durante el período floración-fructificación del cultivo de haba, en dos etapas y regiones fitogeográficas de Jujuy: Prepuna (2 479msnm, semanalmente desde octubre-diciembre de 1995-1996 y Puna (3 367msnm, quincenalmente desde diciembre 2007-marzo 2008. Cada muestra consistió de 25 flores tomadas al azar; sólo en Prepuna se realizó un muestreo complementario de tres golpes/planta (n=10 plantas. Se realizaron observaciones sobre sitios de oviposición, ingreso a la flor, lugares de pupación, comportamiento alimenticio y lesiones producidas. En Prepuna, el complejo de tisanópteros está formado por Frankliniella australis, F. occidentalis, F. gemina, F. schultzei y Thrips tabaci; en Puna la diversidad específica está restringida a F. australis y F. gemina. A pesar de que el período siembra-cosecha no coincide en ambas áreas, las fluctuaciones de las poblaciones presentan un mismo patrón: a medida que avanza la floración aumenta el número de tisanópteros, que coincide con la disponibilidad del recurso alimenticio. En ambas áreas, F. australis es la especie dominante y mantiene poblaciones sucesivas en el cultivo; deposita los huevos en los botones florales y las larvas eclosionan cuando se produce la apertura de las flores; la alimentación de larvas y adultos ocasiona manchas plateadas con puntuaciones negras. En la Prepuna, F. australis atraviesa los estados inmaduros móviles en las flores y los quiescentes en el suelo; en la Puna, todos los estados de desarrollo transcurren dentro de las flores. Thrips tabaci, F. gemina, F. shultzei y F

  12. Economical Evaluation of Faba bean (Vicia faba and Maize (Zea mays L. Intercropping Based on Total Relative Value Index and Weeds Growth Reduction

    Directory of Open Access Journals (Sweden)

    J. Hamzei

    2016-05-01

    Full Text Available The chemical control of weeds raises serious concerns about food safety and environmental quality, which have necessitated the need for non chemical weed management techniques such as intercropping. Intercropping can suppress weeds and reduce the use of herbicides in production systems. Therefore, the objective of this work was to evaluate the effects of intercropping of faba bean and maize, as well as hand-weeding on maize grain yield and total grain yield. The experiment was carried out during growing season of 2010 as a randomized complete block design with three replications at the Agricultural Research Station, Faculty of Agriculture, Bu-Ali Sina University, Hamedan, Iran. Sole cropping of maize with weed control (MWF, sole cropping of maize without weed control (MWI, intercropping of 15% faba bean+maize (M+15%F, 30% faba bean+maize (M+30%F, 45% faba bean+maize (M+45%F  and sole cropping of faba bean were the experimental treatments. Weed biomass and density were affected by treatments. With increasing faba bean density in the intercropping treatments, weed biomass and density decreased significantly from 85 plants and 310 g m-2 for MWI treatment to 22 plants and 63 g m-2 for M+45%F treatment, respectively. The greatest number of seed row per ear, seed number per ear and grain and biological yields (8033 and 17933 kg ha-1, respectively were achieved at MWF treatment and the smallest values for these attributes were revealed at MWI treatment. There was no significant difference between MWF and M+45%F treatments for total grain yield (i.e. grain yield of maize + faba bean. Sole cropping of faba bean led to the greatest yield components and grain and biological yields. With increasing faba bean density in intercropping treatments, above mentioned traits (except number of pods per plant were increased significantly. The great values for weed control efficiency (73% and total relative value (1.14 were achieved at M+45%F treatment. Results of

  13. Composting of rice straw with oilseed rape cake and poultry manure and its effects on faba bean (Vicia faba L.) growth and soil properties.

    Science.gov (United States)

    Abdelhamid, Magdi T; Horiuchi, Takatsugu; Oba, Shinya

    2004-06-01

    Composting of rice straw with poultry manure and oilseed rape cake and its effects on growth and yield of faba bean and soil properties was studied in pot experiments at Gifu University, Japan in 2001/2002. The composts reached maturity in 90 days, were rich in organic matter and mineral nutrients, had a high level of stability, and no phytotoxicity. The addition of compost (20-200 g pot(-1)) improved selected soil chemical (increased total N, total C and CEC), physical (decreased particle density) and biological (increased soil respiration rate) properties. Application of composts at a rate of 20 g pot(-1) significantly increased growth, yield, yield components and total crude protein of faba bean plants. The benefit of this compost without chemical fertilizer demonstrated the validity and possibility of sustainable agronomic performance of faba bean using locally available recycled organic materials. Copyright 2003 Elsevier Ltd.

  14. Genotoxicity assessment of particulate matter emitted from heavy-duty diesel-powered vehicles using the in vivo Vicia faba L. micronucleus test.

    Science.gov (United States)

    Corrêa, Albertina X R; Cotelle, Sylvie; Millet, Maurice; Somensi, Cleder A; Wagner, Theodoro M; Radetski, Claudemir M

    2016-05-01

    Diesel exhaust particulate matter (PM) can have an impact on the environment due to its chemical constitution. A large number of substances such as organic compounds, sulfates, nitrogen derivatives and metals are adsorbed to the particles and desorption of these contaminants could promote genotoxic effects. The objective of this study was to assess the in vivo genotoxicity profile of diesel exhaust PM from heavy-duty engines. Extracts were obtained through leaching with pure water and chemical extraction using three organic solvents (dichloromethane, hexane, and acetone). The in vivo Vicia faba micronucleus test (ISO 29200 protocol) was used to assess the environmental impact of the samples collected from diesel exhaust PM. The solid diesel PM (soot) dissolved in water, and the different extracts, showed positive results for micronucleus formation. After the addition of EDTA, the aqueous extracts did not show a genotoxic effect. The absence of metals in the organic solvent extract indicated that organic compounds also had a genotoxic effect, which was not observed for a similar sample cleaned in a C18 column. Thus, considering the ecological importance of higher plants in relation to ecosystems (in contrast to Salmonella spp., which are commonly used in mutagenicity studies), the Vicia micronucleus test was demonstrated to be appropriate for complementing prokaryotic or in vitro tests on diesel exhaust particulate matter included in risk assessments. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. ESTUDIO DE LA CALIDAD PROTEICA Y DEL CONTENIDO DE ENERGÍA METABOLIZABLE DEL HABA (VICIA FABA*

    Directory of Open Access Journals (Sweden)

    Ana Silvia Bermudez

    2010-09-01

    Full Text Available In order to determínate the faba bean CEP, the possible role of bis hemaglutinine on this valué and to know the metabolizable energy in this legume we made two experiments in the poultry section of the experimental Center of Tibaitatá. In each experiment we used 45 chickens in random distribution in groups of five. In the first experiment we used diets whose proteic source was respectively isolated soybean protein (control diet, raw faba bean, and faba bean treated with steam in an autoclave. The results obtained show a low utilization of food when the ratio was prepared with faba beans, probably due to the aminoacids imbalance, also it produced hypertrophia of the páncreas due probably to the presence of antitriptyc agents which were not destroyed by the heat treatment. The nutritional valué of the faba bean protein increase 67o with the inactivation of the favine, although it is still lower (27% compared with the control diet. In the second experiment we obtain relatively high valúes for the faba beans metabolical useful energy compared with other legume valúes like ajonjolí, which shows us that this bean is a good energy supplier.

  16. Effect of air classification and fermentation by Lactobacillus plantarum VTT E-133328 on faba bean (Vicia faba L.) flour nutritional properties.

    Science.gov (United States)

    Coda, Rossana; Melama, Leena; Rizzello, Carlo Giuseppe; Curiel, José Antonio; Sibakov, Juhani; Holopainen, Ulla; Pulkkinen, Marjo; Sozer, Nesli

    2015-01-16

    The effects of air classification and lactic acid bacteria fermentation on the reduction of anti-nutritional factors (vicine and convicine, trypsin inhibitor activity, condensed tannins and phytic acid) and in vitro protein and starch digestibility of faba bean flour were studied. Free amino acid (FAA) profile analysis was also carried out. Air classification allowed the separation of the flour into protein and starch rich fractions, showing different chemical compositions and microstructures. Lactobacillus plantarum growth and acidification in faba bean flour and its fractions were assessed. The anti-nutritional compounds were separated mostly to the fine protein-rich fraction. Fermentation caused the decrease of vicine and convicine contents by more than 91% and significantly reduced trypsin inhibitor activity and condensed tannins (by more than 40% in the protein-rich fraction). No significant (P>0.05) variation was observed for total phenols and phytic acid content. Fermentation increased the amount of FAA, especially of the essential amino acids and γ-aminobutyric acid, enhanced the in vitro protein digestibility and significantly lowered the hydrolysis index. This work showed that the combination of air classification and fermentation improved nutritional functionality of faba bean flour which could be utilized in various food applications. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Citotoxicidad y genotoxicidad de las aguas de los ríos Jequetepeque y Moche mediante el bioindicador ambiental Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Raúl Antonio Beltrán Orbegoso

    2017-01-01

    Full Text Available La evaluación de la toxicidad de las aguas de los ríos como método complementario al análisis físico, químico y biológico proporciona una información integral de la calidad del agua, por tanto, el objetivo del estudio fue determinar los niveles de citotoxicidad y genotoxicidad de las aguas de las cuencas alta, media y baja de los ríos Moche y Jequetepeque, usando el bioindicador ambiental Vicia faba L. “haba” (2n = 12. Se germinaron semillas de V. faba L.; luego las raicillas emergentes se expusieron, durante tres horas, a siete tratamientos: T1 (100 ml de agua destilada, T2 (1 ml agua de río Jequetepeque / 99 ml de agua destilada, T3 (5 ml agua de río Jequetepeque/ 95 ml de agua destilada, T4 (10 ml agua de río Jequetepeque/ 90 ml de agua destilada, T5 (1 ml agua de río Moche/ 99 ml de agua destilada, T6 (5 ml agua de río Moche/ 95 ml de agua destilada y T7 (10 ml agua de río Moche/ 90 ml de agua destilada. Los ápices de las raicillas fueron sometidos a la técnica de Tjio y Levan. El agua de la cuenca media del río Moche del T7, presenta una alta citotoxicidad (índice mitótico de 5,4 % y alteraciones de los índices de fases y un alto efecto genotóxico; las aguas del río Jequetepeque no evidencian efecto citotóxico ni genotóxico de importancia.

  18. Similar Intracellular Location and Stimulus Reactivity, but Differential Mobility of Tailless (Vicia faba) and Tailed Forisomes (Phaseolus vulgaris) in Intact Sieve Tubes

    Science.gov (United States)

    van Bel, Aart J. E.

    2015-01-01

    Sieve elements of legumes contain forisomes—fusiform protein bodies that are responsible for sieve-tube occlusion in response to damage or wound signals. Earlier work described the existence of tailless and tailed forisomes. This study intended to quantify and compare location and position of tailless (in Vicia faba) and tailed (in Phaseolus vulgaris) forisomes inside sieve elements and to assess their reactivity and potential mobility in response to a remote stimulus. Location (distribution within sieve elements) and position (forisome tip contacts) of more than altogether 2000 forisomes were screened in 500 intact plants by laser scanning confocal microscopy in the transmission mode. Furthermore, we studied the dispersion of forisomes at different locations in different positions and their positional behaviour in response to distant heat shocks. Forisome distribution turned out to be species-specific, whereas forisome positions at various locations were largely similar in bushbean (Phaseolus) and broadbean (Vicia). In general, the tailless forisomes had higher dispersion rates in response to heat shocks than the tailed forisomes and forisomes at the downstream (basal) end dispersed more frequently than those at the upstream end (apical). In contrast to the tailless forisomes that only oscillate in response to heat shocks, downstream-located tailed forisomes can cover considerable distances within sieve elements. This displacement was prevented by gentle rubbing of the leaf (priming) before the heat shock. Movement of these forisomes was also prohibited by Latrunculin A, an inhibitor of actin polymerization. The apparently active mobility of tailed forisomes gives credence to the idea that at least the latter forisomes are not free-floating, but connected to other sieve-element structures. PMID:26624625

  19. Similar Intracellular Location and Stimulus Reactivity, but Differential Mobility of Tailless (Vicia faba) and Tailed Forisomes (Phaseolus vulgaris) in Intact Sieve Tubes.

    Science.gov (United States)

    Furch, Alexandra C U; Buxa, Stefanie V; van Bel, Aart J E

    2015-01-01

    Sieve elements of legumes contain forisomes-fusiform protein bodies that are responsible for sieve-tube occlusion in response to damage or wound signals. Earlier work described the existence of tailless and tailed forisomes. This study intended to quantify and compare location and position of tailless (in Vicia faba) and tailed (in Phaseolus vulgaris) forisomes inside sieve elements and to assess their reactivity and potential mobility in response to a remote stimulus. Location (distribution within sieve elements) and position (forisome tip contacts) of more than altogether 2000 forisomes were screened in 500 intact plants by laser scanning confocal microscopy in the transmission mode. Furthermore, we studied the dispersion of forisomes at different locations in different positions and their positional behaviour in response to distant heat shocks. Forisome distribution turned out to be species-specific, whereas forisome positions at various locations were largely similar in bushbean (Phaseolus) and broadbean (Vicia). In general, the tailless forisomes had higher dispersion rates in response to heat shocks than the tailed forisomes and forisomes at the downstream (basal) end dispersed more frequently than those at the upstream end (apical). In contrast to the tailless forisomes that only oscillate in response to heat shocks, downstream-located tailed forisomes can cover considerable distances within sieve elements. This displacement was prevented by gentle rubbing of the leaf (priming) before the heat shock. Movement of these forisomes was also prohibited by Latrunculin A, an inhibitor of actin polymerization. The apparently active mobility of tailed forisomes gives credence to the idea that at least the latter forisomes are not free-floating, but connected to other sieve-element structures.

  20. Drosophila melanogaster, Vicia faba and Arabidopsis thaliana short-term bioassays in genotoxicity evaluation of air and soil samples from sites surrounding two industrial factories in the Czech Republic.

    Science.gov (United States)

    Chroust, K; Kuglík, P; Relichová, J; Holoubek, I; Cáslavský, J; Veselská, R; Rysková, M; Benedík, J

    1997-01-01

    The Somatic Mutation and Recombination Test (SMART) in wing cells of Drosophila melanogaster, the Vicia faba cytogenetic tests-Sister Chromatid Exchange (SCE) and Micronucleus Test (MN), and the Müller test for gametic mutations in Arabidopsis thaliana were used for genotoxicity testing of environmental samples of pollutants from the surroundings of LACHEMA chemical factory (Brno, Czech Republic) and DEZA factory in Valasské Mezirící (Moravia, Czech Republic). Tested soil and air samples were taken from the near vicinity of both factories. The surroundings of both sites are heavy loaded by exhalation of chemicals from the factories. Chemical analyses of the 16 Polycyclic Aromatic Hydrocarbons (PAHs) according to the United States Environmental Protection Agency (US EPA) list of priority pollutants and heavy metals were performed in both soil and air samples. The Drosophila wing spot test was positive in 70.6% of the tested samples, the Vicia sister chromatid exchange test in 62.5%, and the Arabidopsis Müller test in 58.9%. The micronucleus Vicia faba test was quite insensitive in tested environmental samples. The concordance between SMART and SCE was 62.5%, between SMART and Müller test 76.5%, and between Müller test and SCE 100%. Total concordance of these three tests was 79.7%. Müller test for gametic mutation in Arabidopsis thaliana and cytogenetic SCE test in Vicia faba seem to be quite sensitive and convenient plant bioassays for assessing the mutagenic potential of environmental agents, when compared to the SMART test in Drosophila melanogaster.

  1. Controle de plantas daninhas sob sistemas de manejo integrado em feijão de fava (Vicia faba) no Egito

    OpenAIRE

    El-Metwally, I.M.; Abdelhamid, M.T.

    2008-01-01

    Two field experiments were conducted in two successive seasons, 2005/2006 and 2006/2007, to determine whether management can improve faba bean competitiveness with weeds, thus helping to achieve its yield potential. The experiment included five treatments, composed of organic and mineral fertilizers, alone and mixed at different rates, along with a control and six weed control treatments, including oxadiargyl, prometryn, hand hoeing treatments alone or mixed with the herbicides, and a nonweed...

  2. In vitro fermentation of lupin seeds (Lupinus albus) and broad beans (Vicia faba): dynamic modulation of the intestinal microbiota and metabolomic output.

    Science.gov (United States)

    Gullón, Patricia; Gullón, Beatriz; Tavaria, Freni; Vasconcelos, Marta; Gomes, Ana Maria

    2015-10-01

    Broad beans (Vicia faba) and lupin seeds (Lupinus albus) are legumes rich in a wide range of compounds, which may represent a useful dietary approach for modulating the human gut microbiome. In this work, after in vitro digestion, legume samples were used as carbon sources in anaerobic batch cultures to evaluate their impact on the intestinal microbiota composition and on their metabolic products. The fermentations were monitored by a decrease in pH, generation of short chain fatty acids (SCFA) and lactate and the changes in the dynamic bacterial populations by fluorescence in situ hybridization (FISH). The total SCFA at the end of fermentation was 81.52 mM for lupin seeds and 78.41 mM for broad beans accompanied by a decrease of the pH for both legumes. The microbial groups that increased significantly (P < 0.05) were Bifidobacterium spp., Lactobacillus-Enterococcus, Atopobium, Bacteroides-Pretovella, Clostridium coccoides-Eubacterium rectale, Faecalibacterium prausnitzii and Roseburia intestinalis. This impact on the intestinal microbiota suggests that lupin seeds and broad beans may be used in the development of novel functional foods, which can be included in dietary strategies for human health promotion.

  3. Protein quality in cereals and pulses. 2. Influence of polyethyleneglycol on the nutritional availability of methionine in sorghum (Sorghum vulgar Pers.), field beans (Vicia faba L.) and barley.

    Science.gov (United States)

    Ford, J E; Hewitt, D

    1979-09-01

    1. Polyethyleneglycol (PEG 4000) was examined for its influence on relative nutritional value (RNV) and available methionine in sorghum (Sorghum vulgare Pers.), field beans (Vicia faba L.) and barley, as measured microbiologically with Streptococcus zymogenes. The results were assessed in relation to the content of tannins in the test samples. 2. In grain of hybrid sorghum the RNV averaged 87 (range 79--92) for six low-tannin varieties and 41 (30--53) for eleven high-tannin varieties. The corresponding available methionine values averaged 17.0 (15.7--18.9) and 8.9 (6.7--11.0) g/kg protein. Addition of PEG 4000 to the test samples increased the average RNV of the high-tannin varieties from 41 to 78, and the average available methionine content from 8.9 to 16.2 g/kg protein. 3. With seed of ten coloured flowered varieties of field beans, treatment with PEG gave a small but consistent increase in the available methionine content, which resulted from the inactivation of tannins in the testa. 4. In twenty-three samples of barley grain, treatment with PEG had no effect on the values obtained for available methionine. 5. Treatment of high-tannin sorghum grain with ammonia has been reported to inactivate the tannins and increase the nutritional value for rats and chicks. This finding was confirmed. The present study showed that ammonia and PEG 4000 were equally effective in enhancing the nutritional quality as measured in the microbiological tests.

  4. Polycyclic aromatic hydrocarbon-contaminated soils: bioaugmentation of autochthonous bacteria and toxicological assessment of the bioremediation process by means of Vicia faba L.

    Science.gov (United States)

    Ruffini Castiglione, Monica; Giorgetti, Lucia; Becarelli, Simone; Siracusa, Giovanna; Lorenzi, Roberto; Di Gregorio, Simona

    2016-04-01

    Two bacterial strains, Achromobacter sp. (ACH01) and Sphingomonas sp. (SPH01), were isolated from a heavily polycyclic aromatic hydrocarbon (PAH)-contaminated soil (5431.3 ± 102.3 ppm) for their capacity to use a mixture of anthracene, pyrene, phenanthrene and fluorene as sole carbon sources for growth and for the capacity to produce biosurfactants. The two strains were exploited for bioaugmentation in a biopile pilot plant to increase the bioavailability and the degradation of the residual PAH contamination (99.5 ± 7.1 ppm) reached after 9 months of treatment. The denaturing gel gradient electrophoresis (DGGE) profile of the microbial ecology of the soil during the experimentation showed that the bioaugmentation approach was successful in terms of permanence of the two strains in the soil in treatment. The bioaugmentation of the two bacterial isolates positively correlated with the PAH depletion that reached 7.9 ± 2 ppm value in 2 months of treatment. The PAH depletion was assessed by the loss of the phyto-genotoxicity of soil elutriates on the model plant Vicia faba L., toxicological assessment adopted also to determine the minimum length of the decontamination process for obtaining both the depletion of the PAH contamination and the detoxification of the soil at the end of the process. The intermediate phases of the bioremediation process were the most significant in terms of toxicity, inducing genotoxic effects and selective DNA fragmentation in the stem cell niche of the root tip. The selective DNA fragmentation can be related to the selective induction of cell death of mutant stem cells that can compromise offsprings.

  5. Bacterially produced Pt-GFP as ratiometric dual-excitation sensor for in planta mapping of leaf apoplastic pH in intact Avena sativa and Vicia faba.

    Science.gov (United States)

    Geilfus, Christoph-Martin; Mühling, Karl H; Kaiser, Hartmut; Plieth, Christoph

    2014-01-01

    Ratiometric analysis with H(+)-sensitive fluorescent sensors is a suitable approach for monitoring apoplastic pH dynamics. For the acidic range, the acidotropic dual-excitation dye Oregon Green 488 is an excellent pH sensor. Long lasting (hours) recordings of apoplastic pH in the near neutral range, however, are more problematic because suitable pH indicators that combine a good pH responsiveness at a near neutral pH with a high photostability are lacking. The fluorescent pH reporter protein from Ptilosarcus gurneyi (Pt-GFP) comprises both properties. But, as a genetically encoded indicator and expressed by the plant itself, it can be used almost exclusively in readily transformed plants. In this study we present a novel approach and use purified recombinant indicators for measuring ion concentrations in the apoplast of crop plants such as Vicia faba L. and Avena sativa L. Pt-GFP was purified using a bacterial expression system and subsequently loaded through stomata into the leaf apoplast of intact plants. Imaging verified the apoplastic localization of Pt-GFP and excluded its presence in the symplast. The pH-dependent emission signal stood out clearly from the background. PtGFP is highly photostable, allowing ratiometric measurements over hours. By using this approach, a chloride-induced alkalinizations of the apoplast was demonstrated for the first in oat. Pt-GFP appears to be an excellent sensor for the quantification of leaf apoplastic pH in the neutral range. The presented approach encourages to also use other genetically encoded biosensors for spatiotemporal mapping of apoplastic ion dynamics.

  6. IMPROVING THE TOLERANCE OF Vicia faba AGAINST ENVIRONMENTAL SALINITY RESULTED FROM THE IRRIGATION WITH SEA WATER BY USING KNO3 AND (NH42SO4 AS CHEMICAL OSMOREGULATORS Mejoramiento de la tolerancia de Vicia faba a salinidad ocasionada por irrigación con agua de mar usando KNO3 AND (NH42SO4 como osmoreguladores químicos

    Directory of Open Access Journals (Sweden)

    KAMEL MOHAMED

    2012-05-01

    Full Text Available The familiar solutes, Na+, K+, Ca2+, Mg2+, Cl-, PO4(3-, SO4(2-, soluble carbohydrates, amino acids and soluble proteins, which play a role in osmotic adjustment were estimated to investigate the role of potassium nitrate and ammonium sulphate as osmoregulators and their effects on the solutes composition. Vicia faba L. was cultivated and irrigated with 5, 10, 15 and 20 % (v:v sea water. The plants were divided to three groups. The first was irrigated with sea water only. The second was treated with 5 mM KNO3 while the third was treated with 5mM (NH42SO4. The plants were left to grow until flowering stage. The results indicated that the non treated group increased the soluble carbohydrates in the roots to avoid the influx of sodium. The treatment with KNO3 decreased the sodicity (SAR while (NH42SO4 treatment decreased the SK:Na value in the shoots at higher salinity. The availability of nitrogen as nitrate or ammonium ions enhances the accumulation of soluble carbohydrates in shoots. The plants of all groups were depended on Ca2+, as compatible solute more than Na+, and K+.Los solutos Na+, K+, Ca2+, Mg2+, Cl-, PO4(3-, SO4(2-, carbohidratos y proteínas solubles, así como amino ácidos son importantes en ajuste osmótico y fueron estimados para determinar el papel de nitrato de potasio y sulfato de amonio como osmoreguladores y su efecto en la composición de solutos. Vicia faba L. fue cultivada e irrigada con 5, 10, 15 y 20 % (v:v de agua de mar permitiendo crecimiento hasta el estado de floración. Las plantas fueron divididas en tres grupos. El primero fue irrigado con agua de mar solamente. El segundo fue tratado con 5 mM KNO3, mientras que el tercer grupo fue expuesto a 5mM (NH42SO4. Los resultados indican que las plantas del primer grupo (no tratado incrementan carbohidratos solubles en sus raíces para evitar influjo de sodio. El tratamiento con KNO3 disminuye riqueza de sodio (SAR mientras que la exposición a (NH42SO4 diminuye la de SK

  7. Pea seeds (Pisum sativum, faba beans (Vicia fabavar. minor and lupin seeds (Lupinus albus var. multitalia as protein sources in broiler diets: effect of extrusion on growth performance

    Directory of Open Access Journals (Sweden)

    Gianfranco Piva

    2010-01-01

    Full Text Available The effect of extrusion of pea seeds (Pisum sativum (PS, faba bean (Vicia faba, variety minor (FB and lupin seeds (Lupinus albus, variety multitalia (LS on broiler performance were evaluated. Four hundred sixty two 1d-old Ross male chicks, Marek vaccinated, were randomly assigned to seven dietary treatments (3 pens per treatment/22 birds per pen. Chicks were floor housed, ad libitum fed isocaloric and isonitrogenous diets and had free access to water. Artificial light was provided 10 h/d. The bulk of the base diet (control diet was corn (48.8%, 53.7% and 57%, solvent-extracted soy- bean meal (42.8%, 37.3% and 33.4%, corn oil (4.4%, 5.2% and 6.3%, plus synthetic amino acids, minerals, trace minerals and vitamins, respectively for the 1-10d-old, 11-28d-old and 29 to 42d-old growing periods. The amounts of PS, FB and LS used on an as fed basis were: PS and extruded PS (EPS: 353 (1-10d-old, 356 (11-28d-old and 350 (29- 42d-old g/kg; FB and extruded FB (EFB: 479 (1-10d-old, 497 (11-28d-old and 500 (29-42d old g/kg; LS and extrud- ed LS (ELS: 360 (1-10d-old and 300 (11-42d-old g/kg. High levels of pea (350 g/kg and faba bean (500 g/kg did not show negative effects on body weight gain (BWG and bird feed intake compared to control. Lupin at the 300 g/kg level reduced (P< 0.05 the BWG during the finishing period (22 to 42 d, however the effect disappeared over the whole experimental period (1-42 d compared to the control group. The ELS group had a lower (P< 0.01 feed intake com- pared to the control group and to the LS group. The feed conversion rate (FCR was similar among groups for the whole experimental period; however during the grower period the FCR was higher (P< 0.05 for the PS, FB and EFB groups com- pared to the control group. Birds consuming the PS diet had a reduced (P< 0.05 eviscerated carcass yield compared to the control group. The breast meat percent yield was higher (P< 0.01 for birds consuming the FB and EFB diets compared to the control

  8. Analyse de la tolérance des populations locales de fève (Vicia faba L. à la sécheresse au stade juvénile

    Directory of Open Access Journals (Sweden)

    Nora AQTBOUZ

    2016-03-01

    Full Text Available Drought is the most important abiotic stress responsible of the production instability and lower levels of yields of faba bean (Vicia faba L.. The cropping of tolerant varieties can be an opportunity to stabilize production. The objective of the present study was to evaluate the genetic variability and to study the drought tolerance in the juvenile plant stage in a collection of local Moroccan faba bean populations from the province of Taounate. A number of 60 local populations were studied under controlled conditions in a greenhouse. Different morphological and physiological traits were studied before and under water stress and during the recovery phase. The difference between recovery and water stress phases estimates the capacity of local populations to recover from drought. The local populations contain a wide diversity for different studied traits. The gain in dry matter has a negative and highly significant correlation with dry matter yield under water stress (r = -0.64 **. The populations 16, 47, 1 and 9 have proven to be the most drought tolerant at juvenile stage.

  9. Faba bean in cropping systems

    DEFF Research Database (Denmark)

    Steen Jensen, Erik; Peoples, Mark B.; Hauggaard-Nielsen, Henrik

    2010-01-01

    The grain legume (pulse) faba bean (Vicia faba L.) is grown world-wide as a protein source for food and feed. At the same time faba bean offers ecosystem services such as renewable inputs of nitrogen (N) into crops and soil via biological N2 fixation, and a diversification of cropping systems. Even...... though the global average grain yield has almost doubled during the past 50 years the total area sown to faba beans has declined by 56% over the same period. The season-to-season fluctuations in grain yield of faba bean and the progressive replacement of traditional farming systems, which utilized...... legumes to provide N to maintain soil N fertility, with industrialized, largely cereal-based systems that are heavily reliant upon fossil fuels (=N fertilizers, heavy mechanization) are some of the explanations for this decline in importance. Past studies of faba bean in cropping systems have tended...

  10. Integration of sunflower (Helianthus annuus residues with a pre-plant herbicide enhances weed suppression in broad bean (Vicia faba Integração de resíduos de girassol (Helianthus annuus com herbicida pré-emergente na supressão de plantas daninhas na cultura da fava (Vicia faba

    Directory of Open Access Journals (Sweden)

    I.S Alsaadawi

    2011-12-01

    Full Text Available Field trial was conducted with the aim of utilizing allelopathic crop residues to reduce the use of synthetic herbicides in broad bean (Vicia faba fields. Sunflower residue at 600 and 1,400 g m-2 and Treflan (trifluralin at 50, 75 and 100% of recommended dose were incorporated into the soil alone or in combination with each other. Untreated plots were maintained as a control. Herbicide application in plots amended with sunflower residue had the least total weed count and biomass, which was even better than herbicide used alone. Integration of recommended dose of Treflan with sunflower residue at 1,400 g m-² produced maximum (987.5 g m-2 aboveground biomass of broad bean, which was 74 and 36% higher than control and recommended herbicide dose applied alone, respectively. Combination of herbicide and sunflower residue appeared to better enhance pod number and yield per unit area than herbicide alone. Application of 50% dose of Treflan in plots amended with sunflower residue resulted in similar yield advantage as was noticed with 100% herbicide dose. Chromatographic analysis of residue-infested field soil indicated the presence of several phytotoxic compounds of phenolic nature. Periodic data revealed that maximum suppression in weed density and dry weight synchronized with peak values of phytotoxins observed 4 weeks after incorporation of sunflower residues. Integration of sunflower residues with lower herbicide rates can produce effective weed suppression without compromising yield as a feasible and environmentally sound approach in broad bean fields.O experimento foi realizado com o objetivo de utilizar resíduos agrícolas com potencial alelopático para reduzir o uso de herbicidas sintéticos em fava (Vicia faba. Resíduos de girassol (600 e 1,400 g m-2 e Treflan (50, 75 e 100% da dose recomendada foram incorporados ao solo isoladamente ou em combinação uns com os outros. Parcelas não tratadas foram mantidas como controle. A aplicação de

  11. Management of faba bean gall in faba bean producing area of Eastern Amhara, Ethiopia

    Directory of Open Access Journals (Sweden)

    Bogale Nigir Hailemariam

    2017-12-01

    Full Text Available Faba bean new disease (faba bean gall (Olpidium viciae (Kusano is the most destructive disease of faba bean ((Vicia faba L. in Ethiopia, particularly in Amhara, Tigray and some part of Oromia region. This problem needs immediate sound management strategy to maximize faba bean productivity. A field study was carried out in Geregera and Jama during the 2013 and 2014 main crop season and Maybar watershed in 2014 to verify the fungicide to faba bean gall. The objective of this study was evaluating effective fungicides for the management of faba bean new disease. The treatments were baylaton in the form of seed dressing and foliar spray; mancozeb, redomil, chlorotalonin and cruzet in the form of foliar spray and apron star and theram used as a foliar spray and also untreated check used as a comparison. The result showed that significantly differ between treatments (p

  12. Occurrence of broad bean (Vicia faba L. diseases in Olsztyn-Elbąg and Bydgoszcz Provinces

    Directory of Open Access Journals (Sweden)

    Stanisław Sadowski

    2013-12-01

    Full Text Available During the years 1981-1985, there were conducted studies of the healthiness of broad bean,'Nadwiślański' variety, cultivated in different soil and climate conditions of the two regions: i.e. Bydgoszcz - comparatively warmer and drier, and Olsztyn-Elbląg - colder and moister. It was found that the main reason for a premature broad bean leaves dry in up in the Olsztyn-Elbląg Region was caused by the fungi Cercospora and Botrytis, and in the Bydgoszcz Region - the root rot which occurs here to a greater extent. Root gangrene was greater intensity in drier and lighter soils. Rotting broad bean roots were most frequently occupied by the fungi of the Fusarium family (ca. 70%. The prevailing species were Fusarium oxysporum, next F. solani and more rarely F. culmorum and F. avenaceum. Climate conditions and soil species affected considerably the species composition of the root fungi.

  13. Effects of faba bean and faba bean hulls on expression of selected genes in the small intestine of piglets

    NARCIS (Netherlands)

    Jansman, A.J.M.; Baal, van J.; Meulen, van der J.; Smits, M.A.

    2012-01-01

    In a small intestinal segment perfusion (SISP) study in pigs, effects were studied of intestinal perfusion of ground faba beans (Vicia faba), faba bean hulls, or saline on intestinal net fluid absorption in intestinal segments either challenged or not with an enterotoxigenic Escherichia coli (ETEC).

  14. (Vicia faba) IN SOUTHERN ETHIOPIA

    African Journals Online (AJOL)

    Win7Ent

    2013-06-03

    Jun 3, 2013 ... iron, zinc, calcium, riboflavin, vitamin A, and vitamin C [4]. Although Ethiopia has a fairly large livestock population, availability of meat and milk for local human consumption is limited, especially in rural areas where wealth index values are in the lower quintiles, according to the most recent Demographic ...

  15. (Vicia faba) IN SOUTHERN ETHIOPIA

    African Journals Online (AJOL)

    Win7Ent

    2013-06-03

    Jun 3, 2013 ... in 22.5, 4.7, and 8.3% of study children, respectively. Questionnaires ..... this study, however, requires preparation of the raw ingredients. .... Survey 2009/10 Report for the National Nutrition Program of Ethiopia. Ethiopian ...

  16. Salt tolerance analysis of chickpea, faba bean and durum wheat varieties. I. Chickpea and faba bean

    NARCIS (Netherlands)

    Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Oweis, T.

    2005-01-01

    Two varieties of chickpea (Cicer arietinum L.) and faba bean (Vicia faba), differing in drought tolerance according to the classification of the International Center for Agronomic Research in Dry Areas (ICARDA), were irrigated with waters of three different salinity levels in a lysimeter experiment

  17. In vitro investigations of the potential health benefits of Australian-grown faba beans (Vicia faba L.): chemopreventative capacity and inhibitory effects on the angiotensin-converting enzyme, α-glucosidase and lipase.

    Science.gov (United States)

    Siah, Siem D; Konczak, Izabela; Agboola, Samson; Wood, Jennifer A; Blanchard, Christopher L

    2012-08-01

    The functional properties, including antioxidant and chemopreventative capacities as well as the inhibitory effects on angiotensin-converting enzyme (ACE), α-glucosidase and pancreatic lipase, of three Australian-grown faba bean genotypes (Nura, Rossa and TF(Ic*As)*483/13) were investigated using an array of in vitro assays. Chromatograms of on-line post column derivatisation assay coupled with HPLC revealed the existence of active phenolics (hump) in the coloured genotypes, which was lacking in the white-coloured breeding line, TF(Ic*As)*483/13. Roasting reduced the phenolic content, and diminished antioxidant activity by 10-40 % as measured by the reagent-based assays (diphenylpicrylhydrazyl, 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) and oxygen radical absorbance capacity) in all genotypes. Cell culture-based antioxidant activity assay (cellular antioxidant activity) showed an increase of activity in the coloured genotypes after roasting. Faba bean extracts demonstrated cellular protection ability against H₂O₂-induced DNA damage (assessed using RAW264.7 cells), and inhibited the proliferation of all human cancer cell lines (BL13, AGS, Hep G2 and HT-29) evaluated. However, the effect of faba bean extracts on the non-transformed human cells (CCD-18Co) was negligible. Flow cytometric analyses showed that faba bean extracts successfully induced apoptosis of HL-60 (acute promyelocytic leukaemia) cells. The faba bean extracts also exhibited ACE, α-glucosidase and pancreatic lipase inhibitory activities. Overall, extracts from Nura (buff-coloured) and Rossa (red-coloured) were comparable, while TF(Ic*As)*483/13 (white-coloured) contained the lowest phenolic content and exhibited the least antioxidant and enzyme inhibition activities. These results are important to promote the utilisation of faba beans in human diets for various health benefits.

  18. Pea (Pisum sativum) and faba bean (Vicia faba L.) seeds as protein sources in growing-finishing heavy pig diets: effect on growth performance, carcass characteristics and on fresh and seasoned Parma ham quality

    OpenAIRE

    Francesco Masoero; Carla Cerioli; Samantha Sigolo; Mauro Morlacchini; Aldo Prandini

    2011-01-01

    The effect of pea and faba bean inclusion in growing-finishing heavy pig diets was evaluated. The following iso-lysinic and iso-energetic diets offered to the pigs in three phases (40-80; 80-120; 120-160 kg) were compared: CTR, control diet with soybean meal (SBM) as protein source; RP, CTR diet where pea replaced SBM; RF, CTR diet where faba bean replaced SBM. 126 animals were randomly distributed in 3 homogeneous groups with 42 animals each (7 pens with 6 animals each per treatment). The RP...

  19. The use of whole faba beans in emulsion gel

    OpenAIRE

    Wang, Jing

    2015-01-01

    The faba bean (Vicia faba L.) is an economical protein source used in food and feed worldwide. It has high protein content and well-balanced amino acid composition. Since the starch fraction of faba beans causes problems in protein gelation, it hinders the use of whole faba beans for tofu production. Due to economical, ecological and nutritional reasons, it is worthwhile to develop a new way for producing whole faba bean tofu without discarding any part of faba beans. The aim of this thesis w...

  20. Protective role of α-tocopherol on two Vicia faba cultivars against seawater-induced lipid peroxidation by enhancing capacity of anti-oxidative system

    Directory of Open Access Journals (Sweden)

    Salwa A. Orabi

    2016-06-01

    Full Text Available To examine the effect of seawater stress on growth, yield, physiological and antioxidant responses of faba bean plant and whether the exogenous application with vitamin E could mitigate the adverse effect of salinity stress or not, a pot experiment was carried out during 2011/12 winter season under green house of the National Research Centre, Dokki, Cairo, Egypt. Two faba bean cultivars (Giza 3 and Giza 843 irrigated with diluted seawater (Tap water, 3.13 or 6.25 dS m−1 and α-tocopherol (0, 50 or 100 mg L−1 were used. At 75 days after sowing, growth sample was taken for vegetative growth measurement, proline, carotenoids, antioxidant enzyme activities (SOD, CAT, POX and PAL, lipid peroxidation, and inorganic ions as well as seed yield and yield attributes were determined. The results revealed that seawater triggered significant inhibitory effects on faba bean growth and yield especially for Giza 3 cultivar with obvious increments in MDA and Na+ ion contents. Foliar application with α-tocopherol at rate of 100 mg L−1 followed by 50 mg L−1 on faba bean plants exerted certain alleviative effects on these indices in particular on Giza 843. α-Tocopherol could play an important role in alleviation of injury of faba bean irrigated with diluted seawater through the enhancement of the protective parameters such as antioxidant enzymes, proline, carotenoids, and inorganic ions (K+ and Ca2+ to be effective in decreasing MDA content, lessening the harmful effect of salinity, and improving faba bean growth, seed yield and seed yield quality.

  1. Phosphorylation of H2AX histones in response to double-strand breaks and induction of premature chromatin condensation in hydroxyurea-treated root meristem cells of Raphanus sativus, Vicia faba, and Allium porrum.

    Science.gov (United States)

    Rybaczek, Dorota; Maszewski, Janusz

    2007-01-01

    Histone H2A variant H2AX is rapidly phosphorylated on the induction of DNA double-strand breaks by ionizing radiation and hydroxyurea-mediated replication arrest, resulting in the formation of gamma-H2AX foci along megabase chromatin domains nearby the sites of incurred DNA damage. In an attempt to establish a relationship between species-specific nuclear architecture and H2AX phosphorylation in S/G(2) phase-arrested root meristem cells, immunocytochemical comparisons using an antibody raised against human gamma-H2AX were made among three plants differing with respect to DNA contents: Allium porrum, representing a reticulate type of DNA package, Vicia faba, having semireticulate cell nuclei, and Raphanus sativus, characterised by a chromocentric type of chromatin. Another approach was aimed at determining possible correlations between the extent of hydroxyurea-induced phosphorylation of H2AX histones and the quantities of root meristem cells induced by caffeine to enter aberrant mitotic division (premature chromosome condensation). It was concluded that the higher-order structure of chromatin may contribute to the accessibility of molecular factors engaged in the recognition and repair of genetic lesions. Consequently, in contrast to A. porrum and V. faba, a diffuse chromatin in chromocentric cell nuclei of R. sativus may become more vulnerable both to generate DNA double-strand breaks and to recruit molecular elements needed to arrange the cell cycle checkpoint functions, and thus, more resistant to factors which allow the cells to enter premature chromosome condensation spontaneously. On the other hand, however, caffeine-mediated overriding of the S-M checkpoint control system resulted in the typical appearance of premature chromosome condensation, irrespective of the genomic content of DNA.

  2. Plant growth, metabolism and adaptation in relation to stress conditions. XXVII. Can ascorbic acid modify the adverse effects of NaCl and mannitol on amino acids, nucleic acids and protein patterns in Vicia faba seedlings?

    Science.gov (United States)

    Younis, M E; Hasaneen, M N A; Kazamel, A M S

    2009-03-01

    The adverse effects of either NaCl or mannitol on amino acids, protein patterns and nucleic acids in Vicia faba seeds were investigated. The exogenous addition of 4 mM ascorbic acid to the stressing media in which the broad bean seeds were germinated in combination with either the ionic (NaCl) or osmotic (mannitol) stressor induced significant protective changes in the total amount and in the relative composition of amino acids in general and in proline, glycine, glutamic, aspartic, alanine and serine in particular. It also induced changes in nucleic acids (RNA and DNA) content. These changes occurred throughout the entire period of the experiments (12 days). Separate administration of NaCl or mannitol enhanced the occurrence of particular novel proteins that were not detected in control bean seeds (water medium). Protein banding patterns of broad bean seedlings treated with NaCl or mannitol in combination with 4 mM ascorbic acid showed different de novo protein bands, with different molecular weights, at different stages of seedlings growth, with lower levels or a nearly complete absence of the major stress proteins. The pattern of changes for amino acids and nucleic acids and the range of protein bands extracted from the variously treated broad bean seedlings indicate a positive role of ascorbic acid in the alleviation of the damage effects induced by NaCl and mannitol. The importance of this role in the stress tolerance of broad beans is discussed.

  3. Progress report on enhancing faba bean germplasm for improved winter-hardiness at Pullman, Washington

    Science.gov (United States)

    Faba bean (Vicia faba L.) has been cultivated from early Neolithic times. Numerous varieties have been selected for adaptation to a wide range of environments worldwide and for different end-uses such as dry grain, vegetable, feed, forage and green manure. The USDA faba bean germplasm collection con...

  4. Pea (Pisum sativum and faba bean (Vicia faba L. seeds as protein sources in growing-finishing heavy pig diets: effect on growth performance, carcass characteristics and on fresh and seasoned Parma ham quality

    Directory of Open Access Journals (Sweden)

    Francesco Masoero

    2011-10-01

    Full Text Available The effect of pea and faba bean inclusion in growing-finishing heavy pig diets was evaluated. The following iso-lysinic and iso-energetic diets offered to the pigs in three phases (40-80; 80-120; 120-160 kg were compared: CTR, control diet with soybean meal (SBM as protein source; RP, CTR diet where pea replaced SBM; RF, CTR diet where faba bean replaced SBM. 126 animals were randomly distributed in 3 homogeneous groups with 42 animals each (7 pens with 6 animals each per treatment. The RP and RF diets did not negatively affect the carcass characteristics both of the pigs slaughtered at the conventional weight (127.5 kg and heavy pigs (158.5 kg. The pigs fed the RP and RF diets ate similarly to the pigs fed the CTR overall the trial but RF pigs grew better than CTR animals. The subcutaneous fat of the fresh hams destined for Parma ham production and obtained from pigs fed RP diet had a higher omega 3 fatty acid percentage. Moreover, the RP and RF diets resulted in fat with better omega 3/omega 6 ratio compared with CTR. All the fat samples had iodine numbers within the limit value (70 reported by the Production Disciplinary of Parma ham. No treatment effect was found on the analytical and sensorial characteristics of the Parma hams, except for the aged taste which was more intense in the hams obtained from pigs fed the RF diet. These results indicate that pea and faba bean may be used as an alternative to imported SBM.

  5. faba bean and field pea seed proportion for intercropping system

    African Journals Online (AJOL)

    Administrator

    Intercropping of Faba bean (Vicia fabae) and field pea (Pisum sativum) is an important cropping system in the. Horro highlands of Ethiopia, but seed proportions balance is important to intercrop productivity. An experiment was conducted to determine the optimum seed rates on component crop yield and land equivalent ...

  6. Oxidative Damage and Mutagenic Potency of Fast Neutron and UV-B Radiation in Pollen Mother Cells and Seed Yield of Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Ekram Abdel Haliem

    2013-01-01

    Full Text Available In recent years, there has been a great deal of attention toward free radicals, reactive oxygen species (ROS generated by exposure of crop plant cells to physical radiations. Henceforth, the current study was planned to compare oxidative stress and mutagenic potential of different irradiation doses of fast neutron (FN and UV-B on meiotic-pollen mother cells (PMCs, pollen grains (PGs and seeds yielded from irradiated faba beans seedlings. On the cytogenetic level, each irradiation type had special interference with DNA of PMC and exhibited wide range of mutagenic action on the frequency and type of chromosomal anomalies, fertility of PGs and seed yield productivity based on the irradiation exposure dose and radiation sensitivity of faba bean plants compared with un-irradiated ones. On the molecular level, SDS-PAGE and RPAD-PCR analyses of seeds yielded from irradiated seedlings exhibited distinctive polymorphisms based on size, intensity, appearance, and disappearance of polypeptides bands compared with un-irradiated ones. The total values of protein and DNA polymorphisms reached 88% and 90.80% respectively. The neutron fluency (2.3 × 106 n/cm2 and UV-B dose for 1 hr were recorded as bio-positive effects. The present study proved that genetic variations revealed by cytogenetic test could be supported by gene expression (alterations in RAPD and protein profiles.

  7. Influence of Growth Stage and Leaf Age on Expression of the Components of Partial Resistance of Faba Bean to Botrytis fabae Sard.

    Directory of Open Access Journals (Sweden)

    A. Bouhassan

    2004-12-01

    Full Text Available In detached leaf tests on faba bean (Vicia faba L., genotypes partially resistant and susceptible to Botrytis fabae were examined. Expression of four components of partial resistance to a virulent isolate of B. fabae differed depending on the plant age and the leaf age of the genotypes. The incubation period of resistant genotypes at the podding stage was longer than that of susceptible genotypes at the same stage. The area under disease progress curve (AUDPC of the lesion size increased from the seedling to the flowering stage but declined at the podding stage in all genotypes. Differences between resistant and susceptible genotypes for lesion size were significant except on old leaves from plants at the podding stage. The latent period decreased, and spore production increased with increasing growth and leaf age but there was significant interaction with the genotype. These last two components of partial resistance were more clearly expressed at all growth stages on FRY167 (highly resistant but were expressed only at the seedling and podding stages on FRY7 (resistant. The resistant line BPL710 was not significantly different from the susceptible genotypes for the latent period at any growth stage, and for spore production at the seedling and flowering stages. Leaf age affected all genotypes, but with a significant interaction between leaf age and growth stage. Components of partial resistance were more strongly expressed on young leaves from plants at the seedling or flowering stage.

  8. Yield and quality attributes of faba bean inbred lines grown under marginal environmental conditions of Sudan

    OpenAIRE

    Gasim, Seif; Hamad, Solafa A.A.; Abdelmula, Awadalla; Mohamed Ahmed, Isam A.

    2015-01-01

    Abstract Faba beans (Vicia faba L.) represent an essential source of food protein for many people in Sudan, especially those who cannot afford to buy animal meat. The demand for faba bean seeds is greatly increased in recent years, and consequently its production area was extended southward where the climate is marginally suitable. Therefore, this study was aimed to evaluate seed yield and nutritional quality of five faba bean inbred lines grown under marginal environmental conditions of Suda...

  9. Variation of L-DOPA in the leaf and flower tissues of seven faba bean accessions with different flower colors

    Science.gov (United States)

    Faba bean (Vicia faba L.) has been selected to adapt to a wide range of environments worldwide and is grown for different end-uses such as food, feed, forage and green manure. Particularly noteworthy in faba bean is the medicinally important component L-3,4-dihydroxy phenylalanine (L-DOPA), the majo...

  10. IMPROVING THE TOLERANCE OF Vicia fabaAGAINST ENVIRONMENTAL SALINITY RESULTED FROM THE IRRIGATION WITH SEA WATER BY USING K2 SO4 AND (NH42SO4 AS CHEMICAL OSMOREGULATORS.

    Directory of Open Access Journals (Sweden)

    Kamel Mohamed

    2012-08-01

    Full Text Available Vicia faba L. was cultivated with irrigation with 5, 10, 15 and 20% (v:v sea water. The plants were divided to three groups. The first was irrigated without treatments while the second was treated with 5 mM KNO3 and the third was treated with 5mM (NH42 SO4. The plants were left to grow until flowering stage. The famous solutes Na+, K+, Ca2+, Mg2+, Cl-, PO43-, SO42-, soluble carbohydrates, amino acids and soluble proteins were estimated to investigate the role of potassium nitrate and ammonium sulphates as osmoregulators. The results indicated that the non-treated group increased the soluble carbohydrates in the roots to avoid the influx of sodium. The treatment with KNO3 decreased the sodicity (SAR in the shoots. The availability of nitrogen as nitrate or ammonium ions enhances the accumulation of soluble carbohydrates in shoots. KNO3 treatment decreased SAR strongly while (NH42 SO4 treatment the SK:Na value in the shoots at higher salinity. The plants of all groups were depended on Ca2+ as compatible solute

  11. Association of Faba Bean Rust ( Uromyces viciae-fabae ) with ...

    African Journals Online (AJOL)

    ... stage and field management practices. The mean incidence of the disease varied from 44.6% in Bedeno to 98% in Tullo, while severity of the disease varied from 12.7% in Bedeno to 65% in Gorogutu and Kurfachale districts. Logistic regression analysis for the association of rust incidence and severity with environmental ...

  12. Faba beans in diets for growing-finishing pigs

    Directory of Open Access Journals (Sweden)

    K. PARTANEN

    2008-12-01

    Full Text Available Two experiments were carried out to study the effects of using the new faba bean (Vicia faba L. cultivar Kontu as a domestic protein source for growing-finishing pigs.In Experiment 1,120 pigs were used with a body weight (BWof 25–110 kg to study the effects of replacing 0, 25, 50, 75,and 100%of rapeseed meal with faba beans in barley +rapeseed meal based diets. Restrictedly fed grower and finisher diets contained 137–317 and 114–260 g kg–1 faba beans, respectively. A barley +soya bean meal based diet was included as a control. The replacement of rapeseed meal with faba beans exerted a quadratic effect on daily weight gain and on the feed conversion ratio of pigs in the growing period and during total fattening (P

  13. Effect of condensed tannins in hulls of faba beans (Vivia faba L.) on the activities of trypsin (EC 2.4.21.4) and chymotrypsin (EC 2.4.21.1) in digesta collected from the small intestine of pigs

    NARCIS (Netherlands)

    Jansman, A.J.M.; Enting, H.; Verstegen, M.W.A.; Huisman, J.

    1994-01-01

    The effects of condensed tannins in hulls of faba beans (Vicia faba L.) on the activities of trypsin (EC 3.4.21.4) and chymotrypsin (EC 3.4.21.1) in digesta obtained from the small intestine of pigs were studied. Using four castrated male pigs (mean body weight 83 kg) fitted with both a simple

  14. In vitro inhibition of ETEC K88 adhesion by pea hulls and of LT enterotoxin binding by faba bean hulls

    NARCIS (Netherlands)

    Becker, P.M.; Meulen, van der J.; Jansman, A.J.M.; Wikselaar, van P.G.

    2012-01-01

    Enterotoxigenic Escherichia coli (ETEC) expressing K88 (F4) adhesins are associated with post-weaning diarrhoea in piglets. Different grain fractions from pea (Pisum sativum) and faba bean (Vicia faba) were tested in vitro for their capacity to counteract aetiological factors, which contribute to

  15. Early changes of the pH of the apoplast are different in leaves, stem and roots of Vicia faba L. under declining water availability

    Czech Academy of Sciences Publication Activity Database

    Karuppanapandian, T.; Geilfus, C.M.; Muehling, K.H.; Novák, Ondřej; Gloser, V.

    2017-01-01

    Roč. 255, FEB (2017), s. 51-58 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : xylem sap constituents * abscisic-acid * stomatal conductance * leaf apoplast * helianthus-annuus * plant-responses * intact plants * nacl stress * drying soil * guard-cells * Drought stress * Abscisic acid * Soil drying * Xylem sap * Osmolality * Water relations * Leaf water potential Subject RIV: EF - Botanics Impact factor: 3.437, year: 2016

  16. Early insights into the genome sequence of Uromyces fabae

    Directory of Open Access Journals (Sweden)

    Tobias eLink

    2014-10-01

    Full Text Available Uromyces fabae is a major pathogen of broad bean, Vicia faba. U. fabae has served as a model among rust fungi to elucidate the development of infection structures, expression and secretion of cell wall degrading enzymes and gene expression. Using U. fabae, enormous progress was made regarding nutrient uptake and metabolism and in the search for secreted proteins and effectors. Here, we present results from a genome survey of U. fabae. Paired end Illumina sequencing provided 53 Gb of data. An assembly gave 59,735 scaffolds with a total length of 216 Mb. K-mer analysis estimated the genome size to be 329 Mb. Of a representative set of 23,153 predicted proteins we could annotate 10,209, and predict 599 secreted proteins. Clustering of the protein set indicates families of highly likely effectors. We also found new homologs of RTP1p, a prototype rust effector. The U. fabae genome will be an important resource for comparative analyses with U. appendiculatus and P. pachyrhizi and provide information regarding the phylogenetic relationship of the genus Uromyces with respect to other rust fungi already sequenced, namely Puccinia graminis f. sp. tritici, P. striiformis f. sp. tritici, Melampsora lini, and Melampsora larici-populina.

  17. An evaluation of fababean (Vicia faba) and lupin (Lupinus albus ...

    African Journals Online (AJOL)

    No significant differences in CP degra- dability between fababean and lupin seed were observed, while. DM degradability was significantly (P •••0.05) higher for lupin seed at the low outflow rate, but significantly (P •••0.05) lower for lupin seed at the high outflow rate. Several other researchers (Cronje, 1983; Freer & Dove, ...

  18. An evaluation of fababean (Vicia faba) and lupin (Lupinus albus ...

    African Journals Online (AJOL)

    chemiese samestelling van fababoon- en lupiensaad en stoppel is bepaal. Skape op beide stoppellande het toegeneem in liggaams- massa (P ~ 0.01) oor die eerste 35 dae van beweiding, waama skape op beide weidings se gemiddelde liggaamsmassa afgeneem het. Die gemiddelde liggaamsmassa van die hamels het ...

  19. An evaluation of fababean ( Vicia faba ) and lupin ( Lupinus albus ...

    African Journals Online (AJOL)

    Die eksperiment is uitgevoer om fababoon- en soetlupien-oesreste as somerweiding vir jong Merinohamels te vergelyk. Die droë materiaal (DM)- en ruproteïen (RP)-degradeelbaarheid sowel as die chemiese samestelling van fababoon- en lupiensaad en stoppel is bepaal. Skape op beide stoppellande het toegeneem in ...

  20. Intercropping of wheat (Triticum aestivum) and bean (Vicia faba ...

    African Journals Online (AJOL)

    use

    2011-12-05

    Dec 5, 2011 ... Details of field and soil characteristics and meteoro- logical data of experimental site are given in Tables 1 and 2. Experimental design. The treatments were compared in a complete randomized block design with four replications. Five treatments were included in the experiment as showed in Table 3.

  1. Intercropping of wheat ( Triticum aestivum ) and bean ( Vicia faba ...

    African Journals Online (AJOL)

    The experiment was carried out as randomized complete block design with four replications. The results show that intercropping systems had a significant effect on environmental resources consumption, where intercropping systems had more light interception and water, and nutrient uptake compared to sole crops, ...

  2. Polyphenol content and glycemic load of pasta enriched with Faba bean flour

    OpenAIRE

    Imma Turco; Tiziana Bacchetti; Cecilia Bender; Ganiyu Oboh; Benno Zimmermann; Gianna Ferretti

    2016-01-01

    Background: Legumes contain elevated levels of health functional components. The objective of the present paper was to evaluate the nutritional properties and the post-prandial glycaemic responses of pasta obtained using 35% Vicia Faba (VF) bean flour, which is an important source of fiber and phytochemical compounds. Results: Protein and fiber content were higher in VF pasta compared with durum wheat semolina (DWS) pasta. The total phenol content in VF pasta was about two...

  3. Effect of petroleum-derived substances on life history traits of black bean aphid (Aphis fabae Scop.) and on the growth and chemical composition of broad bean.

    Science.gov (United States)

    Rusin, Milena; Gospodarek, Janina; Nadgórska-Socha, Aleksandra; Barczyk, Gabriela

    2017-04-01

    The aim of the study was to determine the effects of various petroleum-derived substances, namely petrol, diesel fuel and spent engine oil, on life history traits and population dynamics of the black bean aphid Aphis fabae Scop. and on growth and chemical composition of its host plant Vicia faba L. Each substance was tested separately, using two concentrations (9 g kg-1 and 18 g kg-1). The experiment was conducted in four replications (four pots with five plants in each pot per treatment). Plants were cultivated in both control and contaminated soils. After six weeks from soil contamination and five weeks from sowing the seeds, observations of the effect of petroleum-derived substances on traits of three successive generations of aphids were conducted. Aphids were inoculated separately on leaves using cylindrical cages hermetically closed on both sides. Contamination of aphid occurred through its host plant. Results showed that all tested substances adversely affected A. fabae life history traits and population dynamics: extension of the prereproductive period, reduction of fecundity and life span, reduction of the population intrinsic growth rate. In broad bean, leaf, roots, and shoot growth was also impaired in most conditions, whereas nutrient and heavy metal content varied according to substances, their concentration, as well as plant part analysed. Results indicate that soil contamination with petroleum-derived substances entails far-reaching changes not only in organisms directly exposed to these pollutants (plants), but also indirectly in herbivores (aphids) and consequently provides information about potential negative effects on further links of the food chain, i.e., for predators and parasitoids.

  4. Faba bean forisomes can function in defence against generalist aphids.

    Science.gov (United States)

    Medina-Ortega, Karla J; Walker, Gregory P

    2015-06-01

    Phloem sieve elements have shut-off mechanisms that prevent loss of nutrient-rich phloem sap when the phloem is damaged. Some phloem proteins such as the proteins that form forisomes in legume sieve elements are one such mechanism and in response to damage, they instantly form occlusions that stop the flow of sap. It has long been hypothesized that one function of phloem proteins is defence against phloem sap-feeding insects such as aphids. This study provides the first experimental evidence that aphid feeding can induce phloem protein occlusion and that the aphid-induced occlusions inhibit phloem sap ingestion. The great majority of phloem penetrations in Vicia faba by the generalist aphids Myzus persicae and Macrosiphum euphorbiae triggered forisome occlusion and the aphids eventually withdrew their stylets without ingesting phloem sap. This contrasts starkly with a previous study on the legume-specialist aphid, Acyrthosiphon pisum, where penetration of faba bean sieve elements did not trigger forisome occlusion and the aphids readily ingested phloem sap. Next, forisome occlusion was demonstrated to be the cause of failed phloem ingestion attempts by M. persicae: when occlusion was inhibited by the calcium channel blocker lanthanum, M. persicae readily ingested faba bean phloem sap. © 2014 John Wiley & Sons Ltd.

  5. Evaluation of faba beans ( Vicia faba cv. Fiord) and sweet lupins ...

    African Journals Online (AJOL)

    l l threed ietsw eree valuatedin a growth trial using l0 pigs( flveb oarsa ndf lve gilts)o vert heg rowthi nterval3 0-90 kg. The experimentadle signw asa 3 (diets)x 2 (sex)f 'actorialC. arcassc haracteristicwse red etermineda t thee ndo f theg rowtht rial.P igsi n the metabolisrna ndN balance trial consurned5 % less( P < 0.01)o ...

  6. Evaluation of dehulled faba bean (Vicia faba cv. Fiord) as a protein ...

    African Journals Online (AJOL)

    p2492989

    predicted that traditional sources of protein for livestock will become increasingly scarce because of the need to feed a progressively larger human population that will compete with an expanding intensive livestock industry that is being forced to exclude animal protein sources in animal feeds. As a result, a considerable.

  7. Nutritional evaluation of dehulled faba bean (Vicia faba cv. Fiord) in ...

    African Journals Online (AJOL)

    p2492989

    formulated to meet or exceed NRC (1998) nutrient requirements of weaner pigs. Diluting full-fat soya with ..... Of interest was whether a significant trend in performance would be evident as a result of the .... supplement for swine. Can. J. Anim.

  8. Yield and quality attributes of faba bean inbred lines grown under marginal environmental conditions of Sudan.

    Science.gov (United States)

    Gasim, Seif; Hamad, Solafa A A; Abdelmula, Awadalla; Mohamed Ahmed, Isam A

    2015-11-01

    Faba beans (Vicia faba L.) represent an essential source of food protein for many people in Sudan, especially those who cannot afford to buy animal meat. The demand for faba bean seeds is greatly increased in recent years, and consequently its production area was extended southward where the climate is marginally suitable. Therefore, this study was aimed to evaluate seed yield and nutritional quality of five faba bean inbred lines grown under marginal environmental conditions of Sudan. The inbred lines have considerable (P ≤ 0.05) variability in yield and yield components, and seed chemical composition. The mean carbohydrate content was very high (501.1 g kg(-1)) and negatively correlated with seed yield, whereas the average protein content was relatively high (253.1 g kg(-1)) and positively correlated with seed yield. Globulin was the significant fraction (613.5 g kg(-1)protein) followed by albumin (200.2 g kg(-1)protein). Biplot analysis indicates that inbred lines Hudeiba/93-S5 and Ed-damar-S5 outscore other lines in terms of seed yield and nutritional quality. This study demonstrates that Hudeiba/93-S5 and Ed-damar-S5 are useful candidates in faba bean breeding program to terminate the protein deficiency malnutrition and provide healthy and nutritious meal for people living in subtropical areas.

  9. Feeding of Dehulled-micronized Faba Bean ( var. minor as Substitute for Soybean Meal in Guinea Fowl Broilers: Effect on Productive Performance and Meat Quality

    Directory of Open Access Journals (Sweden)

    Vincenzo Tufarelli

    2015-10-01

    Full Text Available The present study aimed to assess the effect of dietary substitution of soybean meal (SBM with dehulled-micronized faba bean (Vicia faba var. minor in guinea fowl broilers on their growth traits, carcass quality, and meat fatty acids composition. In this trial, 120 day-old guinea fowl keets were randomly assigned to two treatments which were fed from hatch to 12 weeks of age. Birds were fed two wheat middlings-based diets comprising of a control treatment which contained SBM (78.3 g/kg and a test diet containing dehulled-micronized faba bean (130 g/kg as the main protein source. Substituting SBM with faba bean had no adverse effect on growth traits, dressing percentage, or breast and thigh muscles relative weight of the guinea fowls. Conversely, a decrease (p<0.05 of abdominal fat was found in guinea fowls fed the faba bean-diet. Breast muscle of birds fed faba bean had higher L* score (p<0.05 and water-holding capacity (p<0.05 than the SBM control diet. Meat from guinea fowls fed faba bean had less total lipids (p<0.05 and cholesterol (p<0.01, and higher concentrations of phospholipids (p<0.01. Feeding faba bean increased polyunsaturated fatty acid concentrations in breast meat and decreased the saturated fatty acid levels. Moreover, dietary faba bean improved the atherogenic and thrombogenic indexes in guinea fowl breast meat. Results indicated that substitution of SBM with faba bean meal in guinea fowl diet can improve carcass qualitative traits, enhancing also meat lipid profile without negatively affecting growth performance.

  10. Assessment of genetic diversity among faba bean genotypes using agro-morphological and molecular markers.

    Science.gov (United States)

    Ammar, Megahed H; Alghamdi, Salem S; Migdadi, Hussein M; Khan, Muhammad A; El-Harty, Ehab H; Al-Faifi, Sulieman A

    2015-05-01

    Forty faba bean (Vicia faba L.) genotypes were evaluated for their agro-morphological performance and molecular diversity under Central Region of Saudi Arabia conditions during 2010-11 and 2011-12 seasons. Field performance results showed that faba genotypes exhibited a significant amount of variation for their agro-morphological studied parameters. Giza40 recorded the tallest genotype (139.5 cm), highest number of seeds per plants (100.8), and the highest seed yield per plant (70.8 g). The best performing genotypes were Giza40, FLIP03-014FB, Gazira1 and Goff1. Genetic variability among genotypes was determined using Sequence Related Amplified Polymorphism (SRAP) and Amplified Fragment Length Polymorphism (AFLP) markers. A total of 183 amplified fragments (alleles) and 1758 polymorphic fragments (bands) in SRAP and 202 alleles and 716 bands in AFLP were obtained using six SRAP and four AFLP primer combinations respectively. Polymorphism information content (PIC) values for AFLP and SRAP markers were higher than 0.8, indicating the existence of a considerable amount of genetic diversity among faba tested genotypes. The UPGMA based clustering of faba genotypes was largely based on origin and/or genetic background. Result of cluster analysis based on SRAP showed weak and not significant correlation while, it was highly significant based on AFLP analysis with agro-morphological characters (r = 0.01, p > 0.54 and r = 0.26, p < 0.004 respectively). Combined SRAP and AFLP markers proved to be significantly useful for genetic diversity assessment at molecular level. They exhibited high discrimination power, and were able to distinguish the faba bean genotypes with high efficiency and accuracy levels.

  11. Faba bean drought responsive gene identification and validation.

    Science.gov (United States)

    Ammar, Megahed H; Khan, Altaf M; Migdadi, Hussein M; Abdelkhalek, Samah M; Alghamdi, Salem S

    2017-01-01

    This study was carried out to identify drought-responsive genes in a drought tolerant faba bean variety (Hassawi 2) using a suppressive subtraction hybridization approach (SSH). A total of 913 differentially expressed clones were sequenced from a differential cDNA library that resulted in a total of 225 differentially expressed ESTs. The genes of mitochondrial and chloroplast origin were removed, and the remaining 137 EST sequences were submitted to the gene bank EST database (LIBEST_028448). A sequence analysis identified 35 potentially drought stress-related ESTs that regulate ion channels, kinases, and energy production and utilization and transcription factors. Quantitative PCR on Hassawi 2 genotype confirmed that more than 65% of selected drought-responsive genes were drought-related. Among these induced genes, the expression levels of eight highly up-regulated unigenes were further analyzed across 38 selected faba bean genotypes that differ in their drought tolerance levels. These unigenes included ribulose 1,5-bisphosphate carboxylase (rbcL) gene, non-LTR retroelement reverse related, probable cyclic nucleotide-gated ion channel, polyubiquitin, potassium channel, calcium-dependent protein kinase and putative respiratory burst oxidase-like protein C and a novel unigene. The expression patterns of these unigenes were variable across 38 genotypes however, it was found to be very high in tolerant genotype. The up-regulation of these unigenes in majority of tolerant genotypes suggests their possible role in drought tolerance. The identification of possible drought responsive candidate genes in Vicia faba reported here is an important step toward the development of drought-tolerant genotypes that can cope with arid environments.

  12. Faba bean drought responsive gene identification and validation

    Directory of Open Access Journals (Sweden)

    Megahed H. Ammar

    2017-01-01

    Full Text Available This study was carried out to identify drought-responsive genes in a drought tolerant faba bean variety (Hassawi 2 using a suppressive subtraction hybridization approach (SSH. A total of 913 differentially expressed clones were sequenced from a differential cDNA library that resulted in a total of 225 differentially expressed ESTs. The genes of mitochondrial and chloroplast origin were removed, and the remaining 137 EST sequences were submitted to the gene bank EST database (LIBEST_028448. A sequence analysis identified 35 potentially drought stress-related ESTs that regulate ion channels, kinases, and energy production and utilization and transcription factors. Quantitative PCR on Hassawi 2 genotype confirmed that more than 65% of selected drought-responsive genes were drought-related. Among these induced genes, the expression levels of eight highly up-regulated unigenes were further analyzed across 38 selected faba bean genotypes that differ in their drought tolerance levels. These unigenes included ribulose 1,5-bisphosphate carboxylase (rbcL gene, non-LTR retroelement reverse related, probable cyclic nucleotide-gated ion channel, polyubiquitin, potassium channel, calcium-dependent protein kinase and putative respiratory burst oxidase-like protein C and a novel unigene. The expression patterns of these unigenes were variable across 38 genotypes however, it was found to be very high in tolerant genotype. The up-regulation of these unigenes in majority of tolerant genotypes suggests their possible role in drought tolerance. The identification of possible drought responsive candidate genes in Vicia faba reported here is an important step toward the development of drought-tolerant genotypes that can cope with arid environments.

  13. Impact of Faba Bean-Seed Rhizobial Inoculation on Microbial Activity in the Rhizosphere Soil during Growing Season.

    Science.gov (United States)

    Siczek, Anna; Lipiec, Jerzy

    2016-05-20

    Inoculation of legume seeds with Rhizobium affects soil microbial community and processes, especially in the rhizosphere. This study aimed at assessing the effect of Rhizobium inoculation on microbial activity in the faba bean rhizosphere during the growing season in a field experiment on a Haplic Luvisol derived from loess. Faba bean (Vicia faba L.) seeds were non-inoculated (NI) or inoculated (I) with Rhizobium leguminosarum bv. viciae and sown. The rhizosphere soil was analyzed for the enzymatic activities of dehydrogenases, urease, protease and acid phosphomonoesterase, and functional diversity (catabolic potential) using the Average Well Color Development, Shannon-Weaver, and Richness indices following the community level physiological profiling from Biolog EcoPlate™. The analyses were done on three occasions corresponding to the growth stages of: 5-6 leaf, flowering, and pod formation. The enzymatic activities were higher in I than NI (p < 0.05) throughout the growing season. However, none of the functional diversity indices differed significantly under both treatments, regardless of the growth stage. This work showed that the functional diversity of the microbial communities was a less sensitive tool than enzyme activities in assessment of rhizobial inoculation effects on rhizosphere microbial activity.

  14. Polyphenol content and glycemic load of pasta enriched with Faba bean flour

    Directory of Open Access Journals (Sweden)

    Imma Turco

    2016-05-01

    Full Text Available Background: Legumes contain elevated levels of health functional components. The objective of the present paper was to evaluate the nutritional properties and the post-prandial glycaemic responses of pasta obtained using 35% Vicia Faba (VF bean flour, which is an important source of fiber and phytochemical compounds. Results: Protein and fiber content were higher in VF pasta compared with durum wheat semolina (DWS pasta. The total phenol content in VF pasta was about two fold higher compared to that of DWS pasta. A higher total flavonoid content, higher antioxidant activity against peroxyl radicals evaluated by oxygen radical absorbance capacity (ORAC assay was also observed in VF pasta. The comparison of post-prandial increase of glucose after VF intake or DWS demonstrated significant differences and VF pasta exhibited a lower glycemic index value, a lower glycemic load and higher glycemic profile compared with DWS pasta. Conclusion: The results suggest that enrichment with 35% Vicia faba bean has potential health benefits and that VF flour can be used as an ingredient to prepare added-value products.

  15. Occurrence of phytoplasma phyllody and witches' broom disease of faba bean in Bihar.

    Science.gov (United States)

    Singh, Anil K; Bhatt, B P; Manibhushan

    2013-09-01

    Faba bean (Vicio faba) plants showed symptoms of shoe stringed leaves, phyllody and flower abortion in experimental field. The first symptoms consisted of phyllody mild yellowing, vein clearing and slightly inward folding of newly formed leaves in the apical region of the plant. The disease was characterized by a series of floral abnormalities including virescence, phyllody and proliferation of sprouts together with other abnormalities, such as loss of apical dominance, vivipary and enhanced vegetative growth. Ambient temperature found to be contributing positively on disease development. Under climate change condition there may be every possible chance for speedy spread of this very economic important disease to the earlier not known regions.

  16. Determination of 4-Chloroindole-3-Acetic Acid Methyl Ester in Lathyrus Vicia and Pisum by Gas Chromatography - Mass Spectrometry

    DEFF Research Database (Denmark)

    Engvild, Kjeld Christensen; Egsgaard, Helge; Larsen, Elfinn

    1980-01-01

    4-Chloroindole-3-acetic acid methyl ester was identified unequivocally in Lathyrus latifolius L., Vicia faba L. and Pisum sativum L. by thin layer chromatography, gas chromatography and mass spectrometry. The gas chromatographic system was able to separate underivatized chloroindole-3-acetic acid...... methyl ester isomers. The quantitative determination of 4-chloroindole-3-acetic acid methyl ester in immature seeds of these three species was performed by gas chromatography – mass spectrometry using deuterium labelled 4-chloro-indole-3-acetic acid methyl ester as an internal standard. P. sativum...

  17. Faba bean in microspore culture

    OpenAIRE

    Hautsalo, Juho

    2013-01-01

    The objective of this study was to develop functional method for producing doupled-haploid plants for faba bean. Microspore culture is an advanced method to produce doubled-haploids and it is based on the totipotent nature of plant cells, since even a microspore, which is an immature pollen cell with haploid genome, can develop into a plant. This plant is either haploid or doupled haploid depending on whether there has been chromosome doubling or not and because the chromosomes either do not ...

  18. Response of different genotypes of faba bean plant to drought stress.

    Science.gov (United States)

    Siddiqui, Manzer H; Al-Khaishany, Mutahhar Y; Al-Qutami, Mohammed A; Al-Whaibi, Mohamed H; Grover, Anil; Ali, Hayssam M; Al-Wahibi, Mona S; Bukhari, Najat A

    2015-05-05

    Drought stress is one of the major abiotic stresses that are a threat to crop production worldwide. Drought stress impairs the plants growth and yield. Therefore, the aim of the present experiment was to select the tolerant genotype/s on the basis of moprpho-physiological and biochemical characteristics of 10 Vicia faba genotypes (Zafar 1, Zafar 2, Shebam, Makamora, Espan, Giza Blanka, Giza 3, C4, C5 and G853) under drought stress. We studied the effect of different levels of drought stress i.e., (i) normal irrigation (ii) mild stress (iii) moderate stress, and (iv) severe stress on plant height (PH) plant-1, fresh weight (FW) and dry weight (DW) plant-1, area leaf-1, leaf relative water content (RWC), proline (Pro) content, total chlorophyll (Total Chl) content, electrolyte leakage (EL), malondialdehyde (MDA), hydrogen peroxide (H2O2) content, and activities of catalase (CAT), peroxidase (POD) and superoxide dismutase (SOD) of genotypes of faba bean. Drought stress reduced all growth parameters and Total Chl content of all genotypes. However, the deteriorating effect of drought stress on the growth performance of genotypes "C5" and "Zafar 1" were relatively low due to its better antioxidant enzymes activities (CAT, POD and SOD), and accumulation of Pro and Total Chl, and leaf RWC. In the study, genotype "C5" and "Zafar 1" were found to be relatively tolerant to drought stress and genotypes "G853" and "C4" were sensitive to drought stress.

  19. Improvement of Faba Bean Yield Using Rhizobium/Agrobacterium Inoculant in Low-Fertility Sandy Soil

    Directory of Open Access Journals (Sweden)

    Sameh H. Youseif

    2017-01-01

    Full Text Available Soil fertility is one of the major limiting factors for crop’s productivity in Egypt and the world in general. Biological nitrogen fixation (BNF has a great importance as a non-polluting and a cost-effective way to improve soil fertility through supplying N to different agricultural systems. Faba bean (Vicia faba L. is one of the most efficient nitrogen-fixing legumes that can meet all of their N needs through BNF. Therefore, understanding the impact of rhizobial inoculation and contrasting soil rhizobia on nodulation and N2 fixation in faba bean is crucial to optimize the crop yield, particularly under low fertility soil conditions. This study investigated the symbiotic effectiveness of 17 Rhizobium/Agrobacterium strains previously isolated from different Egyptian governorates in improving the nodulation and N2 fixation in faba bean cv. Giza 843 under controlled greenhouse conditions. Five strains that had a high nitrogen-fixing capacity under greenhouse conditions were subsequently tested in field trials as faba bean inoculants at Ismaillia Governorate in northeast Egypt in comparison with the chemical N-fertilization treatment (96 kg N·ha−1. A starter N-dose (48 kg N·ha−1 was applied in combination with different Rhizobium inoculants. The field experiments were established at sites without a background of inoculation under low fertility sandy soil conditions over two successive winter growing seasons, 2012/2013 and 2013/2014. Under greenhouse conditions, inoculated plants produced significantly higher nodules dry weight, plant biomass, and shoot N-uptake than non-inoculated ones. In the first season (2012/2013, inoculation of field-grown faba bean showed significant improvements in seed yield (3.73–4.36 ton·ha−1 and seed N-yield (138–153 Kg N·ha−1, which were higher than the uninoculated control (48 kg N·ha−1 that produced 2.97 Kg·ha−1 and 95 kg N·ha−1, respectively. Similarly, in the second season (2013

  20. Soil genotoxicity assessment--results of an interlaboratory study on the Vicia micronucleus assay in the context of ISO standardization.

    Science.gov (United States)

    Cotelle, Sylvie; Dhyèvre, Adrien; Muller, Serge; Chenon, Pascale; Manier, Nicolas; Pandard, Pascal; Echairi, Abdelwahad; Silvestre, Jérôme; Guiresse, Maritxu; Pinelli, Eric; Giorgetti, Lucia; Barbafieri, Meri; Silva, Valéria C; Engel, Fernanda; Radetski, Claudemir M

    2015-01-01

    The Vicia micronucleus assay was standardized in an international protocol, ISO 29200, "Assessment of genotoxic effects on higher plants-Vicia faba micronucleus test," for soil or soil materials (e.g., compost, sludge, sediment, waste, and fertilizing materials). The aim of this interlaboratory study on the Vicia micronucleus assay was to investigate the robustness of this in vivo assay in terms of its applicability in different countries where each participant were asked to use their own seeds and reference soil, in agreement with the ISO 29200 standard. The ISO 29200 standard protocol was adopted for this study, and seven laboratories from three countries (France, Italy, and Brazil) participated in the study. Negative and positive controls were correctly evaluated by 100 % of the participants. In the solid-phase test, the micronucleus frequency (number of micronuclei/1,000 cells) varied from 0.0 to 1.8 for the negative control (i.e., Hoagland's solution) and from 5.8 to 85.7 for the positive control (i.e., maleic hydrazide), while these values varied from 0.0 to 1.7 for the negative control and from 14.3 to 97.7 for the positive control in the case of liquid-phase test. The variability in the data obtained does not adversely affect the robustness of the protocol assessed, on the condition that the methodology described in the standard ISO 29200 is strictly respected. Thus, the Vicia micronucleus test (ISO 29200) is appropriate for complementing prokaryotic or in vitro tests cited in legislation related to risk assessment of genotoxicity potential.

  1. Sporoderm infrastructural and cytochemical modifications in cytoplasmic male sterile broad-bean (Vicia faba L.

    Directory of Open Access Journals (Sweden)

    Jean-Claude Audran

    2014-01-01

    Full Text Available A comparative study of mature sporoderms of sterile and fertile pollen grains was performed using electron microscopic techniques. In sterile pollen grains, intine is lacking; ectexine sculpture is reduced and tectum is overlaid by membranous systems. Infratectal texture is compact and a sporopollenin granulous mass is obturing the aperture central region. Endexine reacts with proteins and acidic carbohydrates tests.

  2. ALLEVIATION OF SALINITY STRESS ON Vicia faba L. PLANTS VIA SEED PRIMING WITH MELATONIN

    Directory of Open Access Journals (Sweden)

    Mona Gergis DAWOOD

    2015-01-01

    Full Text Available La melatonina es una molécula ambientalmente amigable con una potente capacidad antioxidante y de trampa de radicales libres. Dos experimentos en materas fueron realizados en dos inviernos consecutivos (2011/2012 y 2012/2013 en instalaciones del Centro Nacional de Investigaciones, Dokki, Cairo, Egipto, para estudiar el potencial de la melatonina (100 mM and 500 mM para disminuir los efectos nocivos del agua de mar diluida a concentraciones relativamente bajas y altas (3,85 dS/m and 7,69 dS/m, respectivamente. Los resultados mostraron que la irrigación de plantas de haba con agua de mar diluida reduce los parámetros de crecimiento (altura de la planta, número de hojas/planta, peso fresco y seco de la planta, el contenido relativo de agua (RWC, los pigmentos fotosintéticos (clorofilas a, b y carotenoides, el ácido indo lacético, los carbohidratos totales, K+, Ca+2, al igual que las relaciones K+/Na+ y Ca2+/Na+. Esto fue acompañado por un incremento significativo en el contenido de fenoles, solutos compatibles (carbohidratos solubles totales, aminoácidos libres, prolina, Na+ y Cl- en comparación con las plantas control (plantas no tratadas. De otro lado, los tratamientos con melatonina mejoraron los parámetros de crecimiento, RWC, los pigmentos fotosintéticos, carbohidratos totales, contenido fenólico total, ácido indo acético, K+,Ca+2 al igual que las relaciones K+/Na+ y Ca+2/ Na+ , tanto en las plantas irrigadas con agua dulce de la llave como en las irrigadas con agua de mar diluida en comparación con los controles correspondientes. De otro lado, los tratamientos con melatonina redujeron los niveles de solutos compatibles, al igual que los contenidos de Na+ y Cl-, en comparación con los controles. El estrés por salinidad y/o los tratamientos con melatonina indujeron la producción de nuevas bandas de proteínas que no estuvieron presentes en las plantas control. El tratamiento de melatonina 500 mM tuvo un efecto más pronunciado que el tratamiento de 100 mM en disminuir los efectos adversos de los dos niveles de salinidad estudiados sobre el comportamiento de las plantas de haba.

  3. Effect of salt stress on plant growth and metabolism of bean plant Vicia faba (L.

    Directory of Open Access Journals (Sweden)

    Amira M.S. Abdul Qados

    2011-01-01

    An increase was observed in the protein content in the two measurement periods due to the impact of salinity stress. A directly proportional relationship was found between protein content and the increase in salt concentrations in the first measurement period, while it was inversely proportional in the second.

  4. Acumulación de arsénico en el cultivo de habas (Vicia Faba)

    OpenAIRE

    Francisco Prieto García; Judith Callejas Hernández; Alma D. Román Gutiérrez; Judith Prieto Méndez; Alberto J. Gordillo Martínez; María A. Méndez Marzo

    2007-01-01

    La presencia de arsénico en aguas y suelos de Zimapán, en el estado de Hidalgo, México, causa que los cultivos de haba presenten concentraciones apreciables de dicho elemento. Los suelos evaluados presentaron texturas, conductividad, contenidos de N y de arsénico diferentes, pero resultados similares en pH, potencial redox, y contenido de materia orgánica. La elevada bioacumulación de arsénico en estos suelos fue directamente proporcional al tiempo de exposición. Las concentraciones de arséni...

  5. Asociacion Thysanoptera -Vicia faba en la Prepuna y Puna de Jujuy, Argentina

    National Research Council Canada - National Science Library

    Zamar, Maria Ines; Neder de Roman, Lilia Estela

    2012-01-01

    .... Los objetivos de este estudio fueron: identificar el complejo de tisanopteros antofilos, analizar las fluctuaciones de las poblaciones, conocer aspectos bioecologicos y determinar el rol que cumplen en esta asociacion...

  6. Acumulación de arsénico en el cultivo de habas (Vicia Faba

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    2007-01-01

    Full Text Available La presencia de arsénico en aguas y suelos de Zimapán, en el estado de Hidalgo, México, causa que los cultivos de haba presenten concentraciones apreciables de dicho elemento. Los suelos evaluados presentaron texturas, conductividad, contenidos de N y de arsénico diferentes, pero resultados similares en pH, potencial redox, y contenido de materia orgánica. La elevada bioacumulación de arsénico en estos suelos fue directamente proporcional al tiempo de exposición. Las concentraciones de arsénico acumuladas más altas se obtuvieron en la raíz, el tallo, y las hojas, respectivamente. Concentraciones de 4 mg l-1, fueron letales para el cultivo; el fenómeno se apreció a partir de la etapa III de desarrollo, con la aparición de daños en las raíces y un fuerte efecto en la floración, que inhibió la formación de vainas.

  7. Interactions between extrafloral nectaries, aphids and ants: are there competition effects between plant and homopteran sugar sources?

    NARCIS (Netherlands)

    Engel, V.; Fischer, M.D.; Wäckers, F.L.; Volkl, W.

    2001-01-01

    Broad bean (Vicia faba), an annual plant bearing extrafloral nectaries (EFN) at the base of the upper leaves, is regularly infested by two aphid species, Aphis fabae and Acyrthosiphon pisum. EFN and A. fabae are commonly attended by the ant, Lasius niger, while Ac. pisum usually remains uninfested.

  8. Effects of faba beans with different concentrations of vicine and convicine on egg production, egg quality and red blood cells in laying hens.

    Science.gov (United States)

    Lessire, M; Gallo, V; Prato, M; Akide-Ndunge, O; Mandili, G; Marget, P; Arese, P; Duc, G

    2017-08-01

    The faba bean (Vicia faba L.) is a potential source of proteins for poultry, mainly for laying hens whose protein requirements are lower than those of other birds such as growing broilers and turkeys. However, this feedstuff contains anti-nutritional factors, that is, vicine (V) and convicine (C) that are already known to reduce laying hen performance. The aim of the experiment reported here was to evaluate the effects of a wide range of dietary V and C concentrations in laying hens. Two trials were performed with laying hens fed diets including 20% or 25% of faba bean genotypes highly contrasting in V+C content. In Trial 1, faba beans from two tannin-containing cultivars, but with high or low V+C content were dehulled in order to eliminate the tannin effect. In addition to the contrasting levels of V+C in the two cultivars, two intermediate levels of V+C were obtained by mixing the two cultivars (70/30 and 30/70). In Trial 2, two isogenic zero-tannin faba bean genotypes with high or low V+C content were used. In both trials, a classical corn-soybean diet was also offered to control hens. Each experimental diet was given to 48 laying hens for 140 (Trial 1) or 89 (Trial 2) days. Laying performance and egg quality were measured. The redox sensitivity of red blood cells (RBCs) was assessed by measuring hemolysis and reduced glutathione (GSH) concentration in these cells. Egg weight was significantly reduced by the diets containing the highest concentrations of V+C (Pbean genotypes with low concentrations of V+C can therefore be used in laying hen diets up to 25% without any detrimental effects on performance levels or egg characteristics, without any risk of hemolysis of RBCs.

  9. Effect of straw mulch residues of previous crop oats on the weed population in direct seeded faba bean in Organic Farming

    Directory of Open Access Journals (Sweden)

    Massucati, Luiz Felipe Perrone

    2014-02-01

    Full Text Available Under conditions of Organic Farming, we investigated whether direct seeding of faba bean (Vicia faba L. into straw mulch from residues of precrop oats used for weed control enables at least occasional/opportunistic direct seeding in Organic Agriculture. Eight field trials were carried out at different study sites in North Rhine-Westphalia, Germany, in 2008-2009 and 2009-2010. Direct seeding (DS was performed into mulch layers of 0,4 and 6 t ha-1 of straw residues applied to the remaining stubble, simulating different yield levels of the precrop oats. LBS was used as a reference treatment, where straw was harvested, stubble tillage performed and seedbed prepared in fall and oil radish (Raphanus sativus grown as winter cover crop. Mouldboard ploughing combined with conventional seedbed preparation was performed in early spring to V. faba. Compared with LBS, straw mulch with subsequent direct seeding suppressed especially dicotyledonous annuals significantly. DS treatments with straw reduced the abundance of this group by 81 and 85% compared with LBS. Straw mulch resulted in effective suppression of photosensitive weeds such as Matricaria spp. and late germinating Chenopodium album. Grasses and perennial species occurred independent of the amount of straw. Compared with DS, the abundance of these weeds was reduced by 64 and 82% in LBS treatment. The shoot dry matter production of faba bean was retarded by DS compared with LBS, but significant yield losses could be avoided with straw residues of at least 4 t ha-1. Sufficient amount of straw of from the previous crop is a key criterion to facilitate organic no-till farming of faba bean in a suitable crop sequence when pressure of perennials and grasses is low.

  10. Response of Different Genotypes of Faba Bean Plant to Drought Stress

    Directory of Open Access Journals (Sweden)

    Manzer H. Siddiqui

    2015-05-01

    Full Text Available Drought stress is one of the major abiotic stresses that are a threat to crop production worldwide. Drought stress impairs the plants growth and yield. Therefore, the aim of the present experiment was to select the tolerant genotype/s on the basis of moprpho-physiological and biochemical characteristics of 10 Vicia faba genotypes (Zafar 1, Zafar 2, Shebam, Makamora, Espan, Giza Blanka, Giza 3, C4, C5 and G853 under drought stress. We studied the effect of different levels of drought stress i.e., (i normal irrigation (ii mild stress (iii moderate stress, and (iv severe stress on plant height (PH plant−1, fresh weight (FW and dry weight (DW plant−1, area leaf−1, leaf relative water content (RWC, proline (Pro content, total chlorophyll (Total Chl content, electrolyte leakage (EL, malondialdehyde (MDA, hydrogen peroxide (H2O2 content, and activities of catalase (CAT, peroxidase (POD and superoxide dismutase (SOD of genotypes of faba bean. Drought stress reduced all growth parameters and Total Chl content of all genotypes. However, the deteriorating effect of drought stress on the growth performance of genotypes “C5” and “Zafar 1” were relatively low due to its better antioxidant enzymes activities (CAT, POD and SOD, and accumulation of Pro and Total Chl, and leaf RWC. In the study, genotype “C5” and “Zafar 1” were found to be relatively tolerant to drought stress and genotypes “G853” and “C4” were sensitive to drought stress.

  11. INTERACTIVE EFFECTS OF SALINITY STRESS AND NICOTINAMIDE ON PHYSIOLOGICAL AND BIOCHEMICAL PARAMETERS ON FABA BEAN PLANT

    Directory of Open Access Journals (Sweden)

    Magdi T. Abdelhamid

    2013-09-01

    Full Text Available A possible survival strategy of plants under saline conditions is to use some compounds that could alleviate salt stress effect. One of these compounds is nicotinamide. The effect of exogenously application of nicotinamide with different concentrations (0, 200 and 400 mg/l on Vicia faba L. plant against different NaCl treatments (0, 50 and 100 mM NaCl was investigated at the wire house of the National Research Centre, Cairo, Egypt. Salinity stress reduced significantly plant height, dry weight of shoot, photosynthetic pigments, polysaccharides, total carbohydrates, total-N contents of shoot, seed yield, total carbohydrates & total crude protein of the yielded seeds compared with those of the control plants. In contrast, salinity induced marked increases in sucrose, total soluble sugars, total free amino acids, proline, lipid peroxidation product (MDA and some oxidative enzymes (polyphenol oxidase and peroxidase enzymes. Also, salinity stress increased Na+ contents with the decreases of other macro and micro elements contents (P, K+, Mg+, Ca2+, Fe2+, Mn2+, Zn2+ and Cu2+ of shoots and the yielded seeds of faba bean. Foliar spraying of nicotinamide alleviated the adverse effects of salinity stress through increased plant height, dry weight of shoot, photosynthetic pigments, polysaccharides, total carbohydrates, total-N contents of shoot and seed yield as well as, sucrose, total soluble sugars, total free amino acids and proline, compared with those of the corresponding salinity levels, while decreased lipid peroxidation product as MDA and the oxidative enzymes (polyphenol oxidase and peroxidase enzymes. Nicotinamide inhibited the uptake of Na+ and accelerated the accumulation of P, K+ , Mg+, Ca2+, Fe2+, Mn2+, Zn2+ and Cu2+ contents in the shoots of salt stressed plants and enhanced total carbohydrate and total crude protein percentage and solutes concentrations in seeds of salinity treated plants. 

  12. ( Vicia peregrina ) seed as protein source for mirror carp ( Cyprinus ...

    African Journals Online (AJOL)

    An 80-day feeding trial was conducted in a recirculation system aquarium operating at 26 ± 0.3 °C, to evaluate the nutritive value of Vicia peregrina seed as a possible protein source in the diet of mirror carp (Cyprinus carpio) fingerlings. Vicia peregrina seed was included in the diets at different levels, viz. 100, 200, 300 g ...

  13. The potentiality of Trichoderma harzianum in alleviation the adverse effects of salinity in faba bean plants.

    Science.gov (United States)

    Abd El-Baki, G K; Mostafa, Doaa

    2014-12-01

    The interaction between sodium chloride and Trichoderma harzianum (T24) on growth parameters, ion contents, MDA content, proline, soluble proteins as well as SDS page protein profile were studied in Vicia faba Giza 429. A sharp reduction was found in fresh and dry mass of shoots and roots with increasing salinity. Trichoderma treatments promoted the growth criteria as compared with corresponding salinized plants. The water content and leaf area exhibited a marked decrease with increasing salinity. Trichoderma treatments induced a progressive increase in both parameters. Both proline and MDA contents were increased progressively as the salinity rose in the soil. Trichoderma treatments considerably retarded the accumulation of both parameters in shoots and roots. Both Na+ and K+ concentration increased in both organs by enhancing salinity levels. The treatment with Trichoderma harzianum enhanced the accumulation of both ions. Exposure of plants to different concentrations of salinity, or others treated with Trichoderma harzianum produced marked changes in their protein pattern. Three types of alterations were observed: the synthesis of certain proteins declined significantly, specific synthesis of certain other proteins were markedly observed and synthesis of a set specific protein was induced de novo in plant treated with Trichoderma harzianum.

  14. Interaction between faba bean cultivars and the Rhizobium ...

    African Journals Online (AJOL)

    The efficiency of eight Rhizobium leguminosarum strains isolated from root nodules of Faba bean plants which were collected from different Governorate in Egypt has been examined. After inoculation of faba bean seeds with each Rhizobium strain individually, we measured the growth promotion, nodule formation and plant ...

  15. [Faba bean fusarium wilt (Fusarium oxysporum )control and its mechanism in different wheat varieties and faba bean intercropping system].

    Science.gov (United States)

    Dong, Yan; Dong, Kun; Zheng, Yi; Tang, Li; Yang, Zhi-Xian

    2014-07-01

    Field experiment and hydroponic culture were conducted to investigate effects of three wheat varieties (Yunmai 42, Yunmai 47 and Mianyang 29) and faba bean intercropping on the shoot biomass, disease index of fusarium wilt, functional diversity of microbial community and the amount of Fusarium oxysporum in rhizosphere of faba bean. Contents and components of the soluble sugars, free amino acids and organic acids in the root exudates were also examined. Results showed that, compared with monocropped faba bean, shoot biomass of faba bean significantly increased by 16.6% and 13.4%, disease index of faba bean fusarium wilt significantly decreased by 47.6% and 23.3% as intercropped with Yunmai 42 and Yunmai 47, but no significant differences of both shoot biomass and disease index were found as intercropped with Mianyang 29. Compared with monocropped faba bean, the average well color development (AWCD value) and total utilization ability of carbon sources of faba bean significantly increased, the amount of Fusarium oxysporum of faba bean rhizosphere significantly decreased, and the microbial community structures of faba bean rhizosphere changed as intercropped with YM42 and YM47, while no significant effects as intercropped with MY29. Total contents of soluble sugar, free amino acids and organic acids in root exudates were in the trend of MY29>YM47>YM42. Contents of serine, glutamic, glycine, valine, methionine, phenylalanine, lysine in root exudates of MY29 were significantly higher than that in YM42 and YM47. The arginine was detected only in the root exudates of YM42 and YM47, and leucine was detected only in the root exudates of MY29. Six organic acids of tartaric acid, malic acid, citric acid, succinic acid, fumaric acid, t-aconitic acid were detected in root exudates of MY29 and YM47, and four organic acids of tartaric acid, malic acid, citric acid, fumaric acid were detected in root exudates of YM42. Malic acid content in root exudates of YM47 and MY29 was

  16. Variation in quantitative characters of faba bean after seed ...

    African Journals Online (AJOL)

    Variation in quantitative characters of faba bean after seed irradiation and associated molecular changes. Sonia Mejri, Yassine Mabrouk, Marie Voisin, Philippe Delavault, Philippe Simier, Mouldi Saidi, Omrane Belhadj ...

  17. Implication du stress oxydatif dans la toxicité du plomb sur une plante modèle, Vicia faba

    OpenAIRE

    Pourrut, Bertrand

    2008-01-01

    Le plomb est un des métaux les plus utilisés par l'Homme mais c'est aussi l'un des plus toxiques. Dans les écosystèmes, la teneur en plomb d'origine anthropique n'a cessé d'augmenter depuis plusieurs siècles. Dans plusieurs régions en France, le plomb pose actuellement des problèmes importants en matière de contamination de l'environnement. Les plantes, du fait de leur immobilité, sont particulièrement exposées. De nombreuses études ont déjà évalué la toxicité de ce métal sur les végétaux, ma...

  18. Utilización de harina de haba (vicia faba l.) en la elaboración de pan

    OpenAIRE

    Rocha Espinoza, Ma. Del Carmen; Vásquez Arreaga, María N.; Cornejo Zuñiga, Fabiola

    2011-01-01

    En nuestro país, se han venido desarrollando investigaciones que permiten reemplazar parcialmente la harina de trigo por harinas no tradicionales, con el fin de reducir costos. En el presente trabajo se pretende conocer la influencia del uso de harinas no tradicionales (harina de haba) en la retro degradación del pan. Se comenzó con una caracterización de los aspectos físicos y químicos más importantes de la materia prima; color, olor, estado de madurez, humedad, pH, acidez y actividad de ...

  19. Preparación y determinación de propiedades funcionales de Concentrados proteicos de haba (Vicia faba

    Directory of Open Access Journals (Sweden)

    Lina Modercay

    2010-07-01

    Full Text Available Con cl propósito de obtener concentrados proteicos de haba, que eventualmente puedan ser empleados en la elaboración de alimentos para consumo humano, se establecieron a nivel de laboratorio, las condiciones para la extracción de las proteínas a partir de harina de haba baja en tegumento. Los resultados muestran que se obtiene un concentrado con más de 60% de proteína bruta en base seca, al suspender la harina de haba en agua en unarclaci'on I:6apH 8 manteniendo el sistema con agitación constante durante 0.5 hora a 40 °C y posteriormente acidificando el sobrenadante con HCl IN hasta pH 5.5. El método más aconsejable para el proceso de secado, es cl de rodillos de acuerdo con las características químicas, físicas y funcionales del producto.

  20. PREPARACIÓN DE PELÍCULAS PARA ALIMENTOS A PARTIR DE CONCENTRADOS PROTEICOS DE HABA (Vicia faba

    Directory of Open Access Journals (Sweden)

    Ana Patricia Rozo

    2008-02-01

    Full Text Available El trabajo se planeó con el objeto de evaluar la factibilidad de utilizar concentrados proteicos de haba en la preparación de películas para recubrir alimentos, utilizando como patrón de comparación películas preparadas con albúmina fresca de huevo.Los resultados muestran que utilizando concentrados proteicos de haba sin deshidratar, en suspensiones que contengan 5 g de proteína por 100 g de agua, y adicionando glicerol como agente plastificante,se pueden obtener películas cuyas características de permeabilidad alvapor de agua, solubilidad y contenido de agua dependen de las condiciones de secado del material.

  1. Produção e qualidade proteica da fava (Vicia faba), ervilha (Pisum sativum) e triticale (x Triticosecale)

    OpenAIRE

    Laranjeira, Sara Silva

    2017-01-01

    Dissertação de Mestrado em Engenharia Agronómica As restrições económicas e ambientais de fertilizantes azotados minerais utilizados na produção de gramíneas conferem um papel de relevo ao cultivo de leguminosas com incorporação dos seus resíduos no solo como fonte de azoto para as culturas principais da rotação. A reduzida investigação em Portugal sobre a utilização de espécies leguminosas em condições mediterrânicas como fonte de azoto, conduziu-nos ao presente estudo realizado no campus...

  2. Quantification of cyanamide in young seedlings of Vicia species, Lens culinaris, and Robinia pseudo-acacia by gas chromatography-mass spectrometry.

    Science.gov (United States)

    Kamo, Tsunashi; Takemura, Tomoko; Wasano, Naoya; Fujii, Yoshiharu; Hiradate, Syuntaro

    2012-01-01

    We quantified the cyanamide content of young leaves of nine Vicia species, Lens culinaris, and Robinia pseudo-acacia using a modified analytical procedure that made it possible to measure the cyanamide content of a single leaf. Recent molecular phylogenetic analysis suggests that cyanamide is present in V. benghalensis, which is placed in a monophyletic group with cyanamide-biosynthesizing plants, V. villosa and V. cracca; this suggestion was verified.

  3. Desinfección de semilla de faba granja asturiana

    OpenAIRE

    González, A.J.

    2009-01-01

    Se evaluaron diferentes tratamientos desinfectantes sobre semillas de faba granja asturiana tanto en laboratorio como en campo, con el fin de seleccionar los más eficaces. Los resultados nos llevan a proponer el tratamiento con tiram, a la dosis de 1,5 gramos de producto por kilogramo de semilla, como el antifúngico más adecuado. Different disinfection treatments were assessed on Asturian white beans (faba de la granja variety) both in the laboratory and in the field with the aim of select...

  4. In vitro plant regeneration from Turkish Narbon Vetch (Vicia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-02-18

    Feb 18, 2009 ... containing peat moss and acclimatized in the greenhouse. Acclimatization was done by covering pots with polyethylene bags to maintain initial humidity for 1 .... Vicia L. In Davis PH (Ed.), Flora of Turkey and the East Aegean Islands. Edinburgh, Edinburgh University Press. 3: 274-325. Diallo MS, Ndiaye A, ...

  5. In vitro plant regeneration from Narbon Vetch ( Vicia narbonensis L ...

    African Journals Online (AJOL)

    Narbon vetch (Vicia narbonensis L.) is an agriculturally important forage plant that widely grows in an area extending from Central Europe to various parts of Asia. The study reports axillary shoot regeneration from cotyledonary node explants obtained from, in vitro raised seeds of 4 - 5 and 14 - 15 days old seedlings on MS ...

  6. Chemical composition and in vitro gas production of vetch ( Vicia ...

    African Journals Online (AJOL)

    Chemical composition and in vitro gas production of vetch (Vicia sativa) and some browse and grass species from northern Ethiopia were investigated. Vetch (fresh cut) was sampled in September and vetch hay samples were taken in October both during the early dry period. Samples of the browse and grass species were ...

  7. In vitro plant regeneration from Turkish Narbon Vetch ( Vicia ...

    African Journals Online (AJOL)

    Narbon vetch (Vicia narbonensis L.) is an important forage species among vetches of central Europe, Mediterranean, Near East, Ethiopia, central Asia and India. The study reports in vitro micropropagation of narbon vetch using cotyledon node, shoot tip and zygotic embryo explants on MS medium containing 0.25, 0.50, ...

  8. Grain Yield and Economic Benefit of Intercropping Barley and Faba ...

    African Journals Online (AJOL)

    Farmers in the highland areas of southern Ethiopia own less cultivable land. Barley and faba bean are important crops in the southern highlands of Ethiopia. However, rapid population growth in the region, which has led to scarcity of cultivable land, is threatening cultivation of these crops. Therefore, farmers often resort to ...

  9. Amylolytic treatment on faba bean for producing emulsions and emulsion gels

    OpenAIRE

    Suryanarayanan, Tilak

    2015-01-01

    The objective of the thesis was to investigate the effect of carbohydrates on solubility, emulsifying, gelling and water holding properties of proteins. Faba bean is a readily available pulse crop with high protein content similar to soy bean and there is a lot of potential for a novel, high protein fermented gel product to be made from a pulse crop like faba bean. This is mainly due to its remarkable nutritional properties, functional properties and low cost, the demand for faba bean protein...

  10. High concentrations of Na+ and Cl- ions in soil solution have simultaneous detrimental effects on growth of faba bean under salinity stress.

    Science.gov (United States)

    Tavakkoli, Ehsan; Rengasamy, Pichu; McDonald, Glenn K

    2010-10-01

    Despite the fact that most plants accumulate both sodium (Na(+)) and chloride (Cl(-)) ions to high concentration in their shoot tissues when grown in saline soils, most research on salt tolerance in annual plants has focused on the toxic effects of Na(+) accumulation. There have also been some recent concerns about the ability of hydroponic systems to predict the responses of plants to salinity in soil. To address these two issues, an experiment was conducted to compare the responses to Na(+) and to Cl(-) separately in comparison with the response to NaCl in a soil-based system using two varieties of faba bean (Vicia faba), that differed in salinity tolerance. The variety Nura is a salt-sensitive variety that accumulates Na(+) and Cl(-) to high concentrations while the line 1487/7 is salt tolerant which accumulates lower concentrations of Na(+) and Cl(-). Soils were prepared which were treated with Na(+) or Cl(-) by using a combination of different Na(+) salts and Cl(-) salts, respectively, or with NaCl. While this method produced Na(+)-dominant and Cl(-)-dominant soils, it unavoidably led to changes in the availability of other anions and cations, but tissue analysis of the plants did not indicate any nutritional deficiencies or toxicities other than those targeted by the salt treatments. The growth, water use, ionic composition, photosynthesis, and chlorophyll fluorescence were measured. Both high Na(+) and high Cl(-) reduced growth of faba bean but plants were more sensitive to Cl(-) than to Na(+). The reductions in growth and photosynthesis were greater under NaCl stress and the effect was mainly additive. An important difference to previous hydroponic studies was that increasing the concentrations of NaCl in the soil increased the concentration of Cl(-) more than the concentration of Na(+). The data showed that salinity caused by high concentrations of NaCl can reduce growth by the accumulation of high concentrations of both Na(+) and Cl(-) simultaneously, but

  11. Vicia vulcanorum (Fabaceae a new species from the island of Lanzarote (Canary Islands

    Directory of Open Access Journals (Sweden)

    Morales-Mateos, J. B.

    2012-12-01

    Full Text Available Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, a new species of subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. is described and illustrated from the island of Lanzarote, Canary Islands, north-west of Africa. It is related to and compared with Vicia cirrhosa C. Sm. ex Webb & Berthel. and Vicia filicaulis Webb & Berthel., two endemic species from the western and central group of the Canary Islands, and Vicia ferreirensis Goyder, an endemic species from Porto Santo Island, Madeira Archipelago.Se describe e ilustra Vicia vulcanorum J. Gil & M. L. Gil (Fabaceae, una nueva especie y endemismo de la isla de Lanzarote, Islas Canarias, perteneciente al subg. Cracca (Dumort. Peterm., sect. Cracca Dumort. Se encuentra relacionada y es comparada con Vicia cirrhosa C. Sm. ex Webb & Berthel. y Vicia filicaulis Webb & Berthel., especies endémicas de las islas centrales y occidentales del archipiélago canario, y con Vicia ferreirensis Goyder, especie endémica de la isla de Porto Santo, en el archipiélago de Madeira.

  12. Systemic Collyriclum faba (Trematoda: Collyriclidae) Infection in a Wild Common Raven ( Corvus corax ).

    Science.gov (United States)

    Mete, Aslı; Rogers, Krysta; Houston, Robin

    2017-01-01

    A hatch-year Common Raven ( Corvus corax ) with subcutaneous and internal pseudocysts, filled with fluid, containing a pair of adult trematodes and numerous eggs consistent with Collyriclum faba, died near a riverbank in California, US. While C. faba is incidental in many Passeriformes, this case was a fatal systemic infection.

  13. Observaciones cariológicas en Vicia amphicarpa sensu lato

    Directory of Open Access Journals (Sweden)

    Tardío Pato, F. Javier

    1998-12-01

    Full Text Available Cytological studies were carried out on twenty four amphicarpic wild populations of Vicia sativa group from different sites (19 from Spain, 4 from Syria and 1 from Turkey. Morphologically, 19 accessions can be attributed to taxon Dorthes and 5 to V. angustifolia subsp. pseudoangustifolia (Rouy Tardío, comb. nov. In our studies, these two taxa show different chromosome numbers, V. amphicarpa Dorthes, has 14 chromosomes, while V. angustifolia subsp. pseudoangustifolia has only 12. Furthermore, the form of the chromosomes in the karyotypes of both taxa is quite different. The chromosome number and the morphology of the karyotype found in the first taxon agree with most of previous reports on V. amphicarpa, with a very characteristic short metacentric and six acrocentric chromosomes, one of them satellited. However, the second taxon has a very different karyotype with three large chromosomes, one of them submetacentric and another satellited, plus another three chromosomes which are significantly smaller. Therefore, we can conclude that within the genus Vicia, at least two amphicarpic taxa exist, clearly differentiated, both in morphological and karyotypical characteristics.Se estudian cariológicamente 24 poblaciones anficárpicas silvestres pertenecientes al grupo Vicia sativa, de distinta procedencia (19 españolas, cuatro de Siria y una de Turquía. Se encuentran diferencias en los números cromosomáticos y en los cariótipos. Diecinueve poblaciones presentan 14 cromosomas y cariotipo como el observado por otros autores, constituido por un pequeño cromosoma metacéntrico y seis acrocéntricos, uno de ellos con satélite. Éstas corresponden a V. amphicarpa Dorthes. Las otras cinco, con 2n = 12 y cariotipo con tres cromosomas grandes, uno de ellos submetacéntrico, otro con satélite, y otros tres mucho más pequeños, corresponden a V. angustifolia subsp. pseudoangustifolia (Rouy Tardío. Esta anterior se propone como combinación nueva. Por

  14. [Studies on the chemical constitutens of Vicia amoena Fisch].

    Science.gov (United States)

    Wei, F; Yan, W M

    1997-10-01

    One new flavonoide was isolated from Vicia amoena Fisch. On the basis of spectral (UV, MS, NMR) and chemical reactions, it was elucidated to be kaempferol-3-O-beta-D-mannoside, named amoenin(A3). Moreover, five known compounds have been isolated and identified as quercetin, kaempferol, quercetin-3-O-alpha-L-rhamoside, quercetin-3-O-beta-D-glucoside, kaempferol-3, 7-O-alpha-L-dirhamoside. The total flavonoides showed significant effects on inducing hyperlipidemia and increasing micro-blood vessel elasticity.

  15. Influence of fermented faba bean flour on the nutritional, technological and sensory quality of fortified pasta.

    Science.gov (United States)

    Rizzello, Carlo G; Verni, Michela; Koivula, Hanna; Montemurro, Marco; Seppa, Laila; Kemell, Marianna; Katina, Kati; Coda, Rossana; Gobbetti, Marco

    2017-02-22

    Faba bean has gained increasing attention from the food industry and the consumers mainly due to the quality of its protein fraction. Fermentation has been recently recognized as the most efficient tool for improving its nutritional and organoleptic properties. In this study, faba bean flour fermented with Lactobacillus plantarum DPPMAB24W was used to fortify semolina pasta. Pasta samples including different percentages of fermented faba bean flour were produced at the pilot-plant level and characterized using an integrated approach for chemical, nutritional, technological, and sensory features. At a substitution level of 30%, pasta had a more homogeneous texture and lower cooking loss compared to 50% addition. The impact of faba bean flour addition on pasta technological functionality, particularly of the protein fraction, was also assessed by scanning electron microscopy and textural profile analysis. Compared to traditional (semolina) pasta and pasta containing unfermented faba bean flour, the nutritional profile (in vitro protein digestibility and nutritional indexes - chemical score (CS), sequence of limiting essential amino acids, Essential Amino Acid Index (EAAI), Biological Value (BV), Protein Efficiency Ratio (PER), and Nutritional Index (NI)) and the resistant starch content of pasta containing 30% fermented faba bean flour markedly improved, while the starch hydrolysis rate decreased, without negatively affecting technological and sensory features. The use of fermentation technology appears to be a promising tool to enhance the quality of pasta and to promote the use of faba bean flour.

  16. [Effect of wheat and faba bean intercropping on root exudation of low molecular weight organic acids].

    Science.gov (United States)

    Xiao, Jing-Xiu; Zheng, Yi; Tang, Li

    2014-06-01

    Pot experiment of wheat and faba bean intercropping was conducted and exudates from wheat and faba bean roots were collected at different growth stages. Low molecular weight organic acids (OA) in root exudates were examined by HPLC. The results showed that wheat and faba bean intercropping significantly increased the total amounts of OA exuded by roots. At tillering (57 d), booting (120 d) and filling stages (142 d), intercropping increased the total amounts of OA in wheat root exudates by 155%, 35.6% and 92.6% respectively, in comparison with that of monoculture wheat (MW). At branching (57 d) and filling stages (142 d), intercropping increased the total amounts of OA in faba bean root exudates by 87.4% and 38.7%, respectively, in comparison with that of monoculture faba bean (MF). Wheat and faba bean intercropping changed the types of OA exuded by roots. At tillering stage, lactic acid was identified in root exudates of intercropping wheat (IW), but not in that of MW. At jointing stage (98 d), citric acid was identified in root exudates of IW, but not in that of MW, and acetic acid was vice versa. At branching stage, acetic acid was identified in root exudates of intercropping faba bean (IF), but not in that of MF, and lactic acid was vice versa. At filling stage, lactic acid was identified in root exudates of IF, but not in that of MF. Wheat and faba bean intercropping increased the OA exudation rate of wheat. At booting stage, the exudation rates of citric and fumaric acid from IW were 179 and 184-times as that of from MW, respectively. At filling stage, the exudation rate of lactic acid from IW was 2.53-times as that from MW. In conclusion, wheat and faba bean intercropping increased the rate and total amount, and changed the types of OA exuded by roots.

  17. INTERACTIVE EFFECTS OF SALINITY STRESS AND NICOTINAMIDE ON PHYSIOLOGICAL AND BIOCHEMICAL PARAMETERS OF FABA BEAN PLANT

    Directory of Open Access Journals (Sweden)

    MAGDI T. ABDELHAMID

    2013-01-01

    Full Text Available Una posible estrategia de supervivencia para plantas que se desarrollan bajo condiciones de salinidad es emplear algunos compuestos que les permitan disminuir el estrés salino. Uno de estos compuestos es la nicotinamida (vitamina B3/ niacina. Se investigó el efecto de la aplicación exógena de nicotinamida en diferentes concentraciones (0, 200 o 400 mg l-1 sobre plantas de haba (Vicia faba L. creciendo a diferentes niveles de NaCl (0, 50 o 100 mM en los terrenos del National Research Centre, Cairo, Egipto. El estrés por salinidad reduce significativamente los contenidos de pigmentos fotosintéticos, polisacáridos, carbohidratos totales, nitrógeno total, peso de las plantas, número de hojas, pesos fresco y seco de tallos, rendimiento de semillas, y contenido de carbohidratos y proteina cruda total en semillas comparado con plantas control. En contraste, la salinidad induce incrementos marcados en sacarosa, azúcares solubles totales, aminoácidos libres totales, prolina, productos de peroxidación de lípidos como el malondialdehido (MDA y algunas enzimas oxidativas (polifenol oxidasa y peroxidasa. También, el estrés por salinidad incrementa el contenido de Na+ y genera disminución de otros macronutrientes y micronutrientes (P, K+, Mg2+, Ca2+, Fe2+, Mn2+, Zn2+ y Cu2+ de los tallos y el rendimiento de semillas en plantas de haba. La aspersión foliar de nicotinamida disminuye los efectos adversos del estrés salino incrementando los pigmentos fotosintéticos, polisacáridos, carbohidratos totales, concentración total de nitrógeno en tallos, peso de las plantas, número de hojas, pesos frescos y secos de tallos, y rendimiento de semillas; así como los niveles de sacarosa, azúcares solubles totales, aminoácidos libres totales y prolina, comparado con aquellos correspondientes al estrés por salinidad, mientras disminuyeron los productos de peroxidación de lípidos (MDA y las enzimas oxidativas (polifenol oxidasas y peroxidasas. La

  18. Population Dynamics of Empoasca fabae (Hemiptera: Cicadellidae) in Central Iowa Alfalfa Fields.

    Science.gov (United States)

    Weiser Erlandson, L A; Obrycki, J J

    2015-01-01

    Adults and nymphs of Empoasca fabae Harris (Hemiptera: Cicadellidae) and adults of predatory species in the families Coccinellidae, Anthocoridae, Nabidae, Chrysopidae, and Hemerobiidae were sampled in Iowa alfalfa fields from June to September in 1999 and 2000. The relationship between each predatory taxa and E. fabae was examined using regression analysis. In 2000, all predators were found to be positively correlated with the presence of E. fabae during all periods sampled and most likely contributed to mortality. Orius insidiosus (Say) (Hemiptera: Anthoridae) was the most numerous insect predatory species; population numbers ranged from 0 to 1 and 0.1 to 3.7 adults per 0.25 m(2) in 1999 and 2000, respectively. Partial life tables were constructed for E. fabae nymphs for two alfalfa-growing periods. Nymphs were grouped into three age intervals: first and second, third and fourth, and fifth instars. For the first alfalfa growing period examined, E. fabae nymphal mortality was 70% in 1999 and 49% in 2000. During the last growing period of each season (August-September), total nymphal mortality was relatively low (<25%). Adult E. fabae density ranged from 5.4 to 25.6 and 1.4-9.2 per 0.25 m(2) in 1999 and 2000, respectively. E. fabae population peaks were similar for each age interval in all growing periods. This study provides further information on the population dynamics of E. fabae and its relationship with select predatory species in Iowa alfalfa fields. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  19. Climate Change and Phenology: Empoasca fabae (Hemiptera: Cicadellidae Migration and Severity of Impact.

    Directory of Open Access Journals (Sweden)

    Mitchell B Baker

    Full Text Available Climate change can benefit individual species, but when pest species are enhanced by warmer temperatures agricultural productivity may be placed at greater risk. We analyzed the effects of temperature anomaly on arrival date and infestation severity of potato leafhopper, Empoasca fabae Harris, a classic new world long distance migrant, and a significant pest in several agricultural crops. We compiled E. fabae arrival dates and infestation severity data at different states in USA from existing literature reviews and agricultural extension records from 1951-2012, and examined the influence of temperature anomalies at each target state or overwintering range on the date of arrival and severity of infestation. Average E. fabae arrival date at different states reveal a clear trend along the south-north axis, with earliest arrival closest to the overwintering range. E. fabae arrival has advanced by 10 days over the last 62 years. E. fabae arrived earlier in warmer years in relation to each target state level temperature anomaly (3.0 days / °C increase in temperature anomaly. Increased temperature had a significant and positive effect on the severity of infestation, and arrival date had a marginal negative effect on severity. These relationships suggest that continued warming could advance the time of E. fabae colonization and increase their impact on affected crops.

  20. Influence of conservation tillage and zero tillage on arable weeds in organic faba bean production

    Directory of Open Access Journals (Sweden)

    Jung, Rüdiger

    2016-02-01

    Full Text Available The field experiments were conducted in 2008, 2009 and 2010 on a Gleyic Cambisol near Goettingen, Lower Saxony, Germany. A crop sequence of summer barley, winter cover crops (intercropped oat and sunflower and summer faba bean was examined under organic farming conditions. Emphasis was given to the studying of arable weeds in faba beans. However, enhancing symbiotic nitrogen fixation of summer faba beans by accumulation of soil-nitrogen by winter cover crops was a second objective in these experiments. The faba bean field plots had been cultivated with three different tillage systems: 1. zero tillage, sowing with cross-slottechnique, 2. conservation tillage (wing share cultivator, rotary harrow sowing with cross-slot-technique and 3. conventional tillage with mouldboard plough followed by rotary harrow, sowing with precision monoseeder. In plots with zero tillage preceding cover crops were left as mulch on the soil surface. Cover crops accumulated adequate nitrogen amounts and following faba beans reacted with significant increase (up to 10% in symbiotic nitrogen fixation. Maximum of arable weed biomass was observed in zero tillage-plots at the end of May or early in June. The abundance of the predominant weed wild mustard (Sinapis arvensis increased with tillage intensity, whereas the abundance of creeping thistle (Cirsium arvense increased in 2010 with decreasing tillage intensity. Average grain yield of faba beans was low with only 3.0 and 2.4 t ha-1 in 2009 and 2010, respectively.

  1. Effect of soaking, germination, autoclaving and cooking on chemical and biological value of guar compared with faba bean.

    Science.gov (United States)

    Khalil, M M

    2001-08-01

    Raw, soaked, germinated, autoclaved and cooked both of guar and faba bean were chemically and biologically evaluated. Crude protein, crude fiber and ash contents of guar and faba bean decreased as a result of all treatments with the exception of protein content in both germinated guar and faba bean. A slight decrease in lipid content was noticed during germination, while there were no changes in lipids after soaking, autoclaving and cooking. Protein content of guar was higher than of faba bean, and showed higher values for all amino acids than faba bean protein except for lysine and tryptophan. Germination caused a slight increase in total essential amino acids, while soaking caused a slight decrease in both of guar and faba bean. There was a slight decrease in the mineral contents by the heat processes with the exception of Mg and Mn for guar and Na, Mn for faba bean due to the cooking process. Germinated guar and faba bean showed noticeable decrease in Na, K, Cu, Mn and Mg and a slight increase in Fe and Zn than the raw materials. Germination was more effective in reducing phytic acid than heat treatment, and therefore it improves the nutritional quality of both guar and faba bean. Protein efficiency ratio (PER), true digestibility (DT) and biological value (BV) were estimated in all treatments under study using rat bioassay procedures. Data revealed pronounced improvements of the nutritive value as a result of all processes under study especially germination being the most effective.

  2. The effects of Aphis fabae infestation on the antioxidant response and heavy metal content in field grown Philadelphus coronarius plants

    Energy Technology Data Exchange (ETDEWEB)

    Kafel, Alina, E-mail: akafel@us.edu.pl [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland); Nadgorska-Socha, Aleksandra [University of Silesia, Department of Ecology, Bankowa 9, PL 40-007, Katowice (Poland); Gospodarek, Janina [Agricultural University of Krakow, Department of Agricultural Environment Protection, Mickiewicza 21, PL 31-120, Krakow (Poland); Babczynska, Agnieszka; Skowronek, Magda [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland); Kandziora, Marta [University of Silesia, Department of Ecology, Bankowa 9, PL 40-007, Katowice (Poland); Rozpedek, Katarzyna [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland)

    2010-02-01

    The purpose of this study was to explore a possible relationship between the soil availability of metals and their concentrations in various parts of Philadelphuscoronarius plants. Moreover, the possible impact of an aphid infestation on the contamination and antioxidant response of plants from the urban environment of Krakow and the reference rural area of Zagaje Stradowskie (southern Poland) was analyzed. The contents of the glutathione, proline, non-protein - SH groups, antioxidants, and phosphorous and the levels of guaiacol peroxidase and catalase activity in leaves and shoots either infested or not by the aphid Aphis fabae Scop., were measured. The potential bioavailability of metals (Cd; Cu; Ni; Pb; Zn) in the soil and their concentrations in P. coronarius plants originating from both sites were compared. The antioxidant responses were generally elevated in the plants in the polluted area. Such reactions were additionally changed by aphid infestation. Generally, the concentrations of metals in the HNO{sub 3} and CaCl{sub 2} extractants of the soils from two layers at the 0-20 and 20-40 cm depths from the polluted area were higher than in those from the reference area. Such differences were found for nickel and lead (in all examined extractants), zinc (in soil extractants from the layer at 20-40 cm) and cadmium (in HNO{sub 3} extractants). Significant positive relationships between the lead concentrations in the soil and in the plants were found. In the parts of plants from the polluted area, higher concentrations of Pb and Zn (leaves and shoots) and Cd (shoots) were recorded. The shoots and leaves of plants infested with aphids had higher concentrations of Zn but lower Pb. Moreover, their leaves had higher contaminations of Cu and Ni. In conclusion, aphids affected not only the antioxidant response of the plants but also their contamination with metals, especially contamination of the leaves.

  3. Effect of ensiling moist field bean (Vicia faba), pea (Pisum sativum) and lupine (Lupinus spp.) grains on the contents of alkaloids, oligosaccharides and tannins.

    Science.gov (United States)

    Gefrom, A; Ott, E M; Hoedtke, S; Zeyner, A

    2013-12-01

    Ensiling legume grain may be an inexpensive and ecologically interesting method to produce a high-protein feed of local origin. The typically patchy maturation recommends harvesting and ensiling the seeds in moist condition. Developing a method for preserving legume grains harvested before maturation by lactic acid fermentation would have several advantages. Under laboratory conditions, crushed legume seeds of beans, peas and lupines with high moisture content of 35 % were ensiled with different additives (molasses and lactic acid bacteria). To characterize the final silages, contents of proximate nutrients and antinutritional factors (alkaloids, oligosaccharides, tannins) were analysed. The addition of lactic acid bacteria ensured a fast and pronounced lactic acid production and decreased contents of undesired fermentation products like ethanol. An additional use of molasses for ensilage did not provide a remarkable additional benefit. Excluding sugar and starch, the contents of proximate nutrients were not remarkably altered after ensiling. As an overall effect, lactic acid fermentation reduced tannins and oligosaccharides. It can be supposed that the oligosaccharides after breakdown of the complex molecules acted as a source of fermentable carbohydrates. A relevant reduction of alkaloids did not occur. The lactic acid fermentation of legume grains can be recommended as an appropriate method for conservation. With respect to the economic advantages and compared with methods of chemical preservation, the lactic acid fermentation of legume grains under anaerobic conditions is an environmentally compliant procedure and therefore also an option for organic farming. © 2012 Blackwell Verlag GmbH.

  4. Determinación de las mejores condiciones para la extracción de la lectina de raíz de haba (vicia faba)

    OpenAIRE

    Navarro, Y.; Pérez, G

    2010-01-01

    Para la determinación de las mejores condiciones de extracción de la lectina de raíz de haba (LRH), se utilizaron iniciaimente raíces enteras y paredes celulares de raíces. De acuerdo con los resultados, se establecieron las condiciones experimentales para la preparación de paredes celulares por tres métodos. Se encontró que el Método I, en el cual se usó Sarkosyl 0.5%, KH2PO4 0.01 M pH 6.0 para la obtención de paredes celulares y luego se extrajo la lectina con buffer de citrato de sodio 0.1...

  5. Induction de la phytotoxicité du Plomb chez Vicia faba L. : rôles de l'absorption et de la spéciation

    OpenAIRE

    Shahid, Muhammad

    2010-01-01

    Peu d'études concernent actuellement l'influence de la spéciation du plomb (polluant métallique toxique, persistant et très présent dans les écosystèmes) sur sa phyto-toxicité. Pourtant, l'absorption des métaux, leur translocation et les mécanismes impliqués dans leur phyto-toxicité peuvent être fortement modifiés par ce paramètre. Dans ce contexte, l'objectif de la thèse était d'étudier l'influence de la spéciation chimique du plomb (formation de divers complexes organométalliques) sur sa ph...

  6. Nutritional value of raw and micronised field beans (Vicia faba L. var. minor) with and without enzyme supplementation containing tannase for growing chickens.

    Science.gov (United States)

    Abdulla, Jalil Mahmwd; Rose, Stephen Paul; Mackenzie, Alexander Mackay; Ivanova, Sonya Georgieva; Staykova, Genoveva Petrova; Pirgozliev, Vasil Radoslavov

    2016-10-01

    An experiment examined the effects of two field bean cultivar samples with different tannin contents, the effect of heat treatment (micronising) and the effect of dietary supplementation of a proprietary enzyme preparation containing tannase, pectinase, and xylanase activities on metabolisable energy (ME), total tract dry matter digestibility (DMD) and ether extract digestibility (EED), nitrogen retention (NR), tannin degradability, gastrointestinal tract (GIT) development, and endogenous mucin losses excretion in broiler chickens. The Control diet contained per kg 221 g crude protein and 12.83 MJ ME. Four additional diets contained 300 g/kg of each of the two untreated or micronised experimental field bean cultivar samples. Each diet was then split into two batches and one of them was supplemented with 3400 units tannase per kg diet resulting in 10 diets in total. Each diet was fed to seven pens with two randomly selected male broilers each. Birds fed the high tannin bean sample had a lower weight gain (p beans increased (p beans reduced the degradability of condensed tannins and increased endogenous mucin losses (p bean samples were not improved by heat treatment, but enzyme supplementation improved the feeding value of all diets regardless of the bean samples or heat treatment. Further research is warranted to study the effectiveness of tannase supplementation in poultry diet formulations by dose response trials with purified tannase preparations.

  7. Feeding value of field beans (Vicia faba L. var. minor) with and without enzyme containing tannase, pectinase and xylanase activities for broilers.

    Science.gov (United States)

    Abdulla, Jalil Mahmwd; Rose, Stephen Paul; Mackenzie, Alexander Mackay; Pirgozliev, Vasil Radoslavov

    2017-04-01

    Effects of field beans with various tannin content and exogenous enzyme mixture containing tannase, pectinase and xylanase activities on N-corrected dietary apparent metabolisable energy (AMEn), coefficients of dry matter (DMR) and nitrogen retention (NR), fat digestibility, gastrointestinal tract (GIT) development, jejunal villus morphometry, ileal digesta viscosity and sialic acid were examined. Birds' growth performance and energy conversion ratio (ECR) were also measured. Birds were fed one of eight mash diets. The Control diet contained as major ingredients wheat (400 g/kg) and soybean meal (SBM) (127 g/kg and 221 g crude protein/kg and 12.83 MJ AMEn/kg. To reduce nutrient density, the Control diet also contained washed sand at 119 g/kg. Another three diets containing 300 g/kg of each of three experimental field bean cultivar samples in replacement for SBM and sand were also mixed. Each diet was fed to nine pens with two male Ross 308 broilers. Diets high in tannin had low AMEn, ECR, DMR and NR (p beans increased (p beans with different tannin contents may vary when fed to broilers. The supplementation of the enzyme mixture improved the feeding value of diets for broilers. The beneficial effect of the addition of the enzyme mixture seems to be mediated through reduced ileal digesta viscosity and improved nutrient availability.

  8. Evaluación de cinco genotipos de haba (Vicia faba L. con seis niveles de fósforo en Tecámac, México

    Directory of Open Access Journals (Sweden)

    Edgar Jesús Morales Rosales

    2002-01-01

    Full Text Available Por medio de una investigación de campo, basada en el diseño de bloques al azar con 30 tratamientos y tres repeticiones con un arreglo factorial, se evaluó: altura a la primera vaina (APV, altura final (AF, número de tallos (NT, número de granos por vaina (NGV, número de vainas por planta (NVP, peso de 100 semillas P(100S y rendimiento de grano (REND. El análisis de varianza reveló efectos significativos e interesantes para los cinco genotipos de haba.

  9. [The feed value in growing pigs of a new cultivar of field beans (Vicia faba L.) supplemented with DL-methionine or DL-methionine-hydroxyanalog].

    Science.gov (United States)

    Abel, H j; Burghard, G

    2002-02-01

    A basal control mixture of barley, soy bean meal and soy bean oil was replaced by 25% of the new field bean-cultivar 'Divine' and the resulting two mixtures were supplemented with minerals, trace elements, vitamins and amino acids according to the ideal protein concept. The control diet was adjusted with DL-methionine (DL-Met), the field bean mixture either with DL-Met or DL-methionine-hydroxyanalogue (DL-MHA) assuming biological equivalence on a molar basis for both supplements. The three experimental diets were fed to growing pigs (35-40 kg bwt.). Spontaneous urine samples were analysed separately for determining parameters that characterize the acid-base status of the pigs. There were no significant differences between experimental groups in nutrient digestibilities. The level of bacterially fermentable substances was increased in the diets containing field beans. The field beans contained 14 mg ME/kg DM. There were no significant (p mixtures resulted from a higher electrolyte balance of the diet.

  10. CONTENIDO Y TRASLOCACIÓN DE PLOMO EN AVENA (Avena sativa, L. Y HABA (Vicia faba, L. DE UN SUELO CONTAMINADO

    Directory of Open Access Journals (Sweden)

    Elizabeth García-Gallegos

    2011-01-01

    Full Text Available Un experimento en invernadero se estableció para determinar la concentración de plomo (Pb en suelo, raíz y parte aérea de haba y avena; se calculó el factor de bioconcentración y traslocación en las dos especies. Se probaron 50, 100 y 150 mg·Pb·kg-1 de suelo, incluyendo un control. Las plantas se colectaron a los 60 días después de la siembra y se midieron altura de planta (AP, volumen radical (VR y biomasa seca total (BST, además del contenido de Pb en suelo, raíz y parte aérea. La cuantificación de Pb se realizó por espectrofotometría de absorción atómica. El suelo cultivado con haba presentó un 28.48 % de PbEDTA. Las variables AP, VR y BST no fueron afectadas de manera drástica por las concentraciones de Pb probadas. Las plantas de haba y avena absorbieron un total de 55 mg·kg-1 y 45.3 mg·kg-1, respectivamente, las cuales se consideran tóxicas para plantas cultivadas. Los resultados pueden servir de base para ampliar el conocimiento del contenido de Pb absorbido y traslocado en plantas de haba y avena, ya que la capacidad de tolerar y absorber Pb es específica de la especie, inclusive de la variedad de planta.

  11. Nutritional value of raw and micronised field beans (Vicia fabaL. var.minor) with and without enzyme supplementation containing tannase for growing chickens

    OpenAIRE

    Abdulla, J.M.; Rose, S. P.; Mackenzie, A M; Ivanova, S.G.; Staykova, G.P.; Pirgozliev, V.

    2016-01-01

    An experiment examined the effects of two field bean cultivar samples with different tannin contents, the effect of heat treatment (micronising) and the effect of dietary supplementation of a proprietary enzyme preparation containing tannase, pectinase, and xylanase activities on metabolisable energy (ME), total tract dry matter digestibility (DMD) and ether extract digestibility (EED), nitrogen retention (NR), tannin degradability, gastrointestinal tract (GIT) development, and endogenous muc...

  12. Determinación de las mejores condiciones para la extracción de la lectina de raíz de haba (vicia faba

    Directory of Open Access Journals (Sweden)

    Y. De navarro

    2010-07-01

    Full Text Available Para la determinación de las mejores condiciones de extracción de la lectina de raíz de haba (LRH, se utilizaron iniciaimente raíces enteras y paredes celulares de raíces. De acuerdo con los resultados, se establecieron las condiciones experimentales para la preparación de paredes celulares por tres métodos. Se encontró que el Método I, en el cual se usó Sarkosyl 0.5%, KH2PO4 0.01 M pH 6.0 para la obtención de paredes celulares y luego se extrajo la lectina con buffer de citrato de sodio 0.1 M pH 4.2, es el más adecuado. El fraccionamiento se realizó por filtración por gel usando Sephadex G-25.

  13. The metabolism of ageing seeds: changes in the raffinose family oligosaccharides during storage of field bean (Vicia faba var. minor Harz seeds

    Directory of Open Access Journals (Sweden)

    Kazimierz Zalewski

    2014-01-01

    Full Text Available Seeds of field bean cv. Nadwiślański harvested in 1980, 1986 and 1992 were studied. Results of investigations showed that the four analysed sugars (saccharine, verbascose, raffinose and stachyose made up from 60.1 mg of 1 g dry matter of seeds harvested in 1992 to 67 mg of seeds collected in 1986. After three years of storage in laboratory conditions we observed a decline of the amount of these oligosaccharides. The saccharose:raffinose family oligosaccharides ratio grows with the seed age.

  14. Response of bean (Vicia faba L. plants to low sink demand by measuring the gas exchange rates and chlorophyll a fluorescence kinetics.

    Directory of Open Access Journals (Sweden)

    Bo-Fang Yan

    Full Text Available BACKGROUND: The decline of photosynthesis in plants under low sink demand is well known. Previous studies focused on the relationship between stomatal conductance (gs and net photosynthetic rate (Pn. These studies investigated the effect of changes in Photosystem II (PSII function on the Pn decline under low sink demand. However, little is known about its effects on different limiting steps of electron transport chain in PSII under this condition. METHODOLOGY/PRINCIPAL FINDING: Two-month-old bean plants were processed by removing pods and flowers (low sink demand. On the 1(st day after low sink demand treatment, a decline of Pn was accompanied by a decrease in gs and internal-to-ambient CO2 concentration ratio (Ci/Ca. From the 3(rd to 9(th day, Pn and gs declined continuously while Ci/Ca ratio remained stable in the treatment. Moreover, these values were lower than that of control. Wk (a parameter reflecting the damage to oxygen evolving complex of the donor side of PSII values in the treatment were significantly higher than their corresponding control values. However, RCQA (a parameter reflecting the number of active RCs per excited cross-section of PSII values in the treatment were significantly lower than control from the 5(th day. From the 11(th to 21(st day, Pn and gs of the treatment continued to decline and were lower than control. This was accompanied by a decrease of RCQA, and an increase of Wk. Furthermore, the quantum yield parameters φPo, φEo and ψEo in the treatment were lower than in control; however, Ci/Ca values in the treatment gradually increased and were significantly higher than control on the 21(st day. CONCLUSIONS: Stomatal limitation during the early stage, whereas a combination of stomatal and non-stomatal limitation during the middle stage might be responsible for the reduction of Pn under low sink demand. Non-stomatal limitation during the late stages after the removal of the sink of roots and pods may also cause Pn reduction. The non-stomatal limitation was associated with the inhibition of PSII electron transport chain. Our data suggests that the donor side of PSII was the most sensitive to low sink demand followed by the reaction center of PSII. The acceptor side of PSII may be the least sensitive.

  15. The fungi communities of the soil environment of Triticum aestivum and its forecrops: Hordeum vulgare, Vicia faba ssp. minor and Trifolium pratense

    Directory of Open Access Journals (Sweden)

    Elżbieta Pląskowska

    2014-08-01

    Full Text Available The species spectrum and abundance of the fungi communities were affected by the soil environment developed by wheat and its forecrops, and by atmospheric conditions. The fungi of the genus Fusarium were the greatest threat to winter wheat regardless of the forecrop. The field bean was the best forecrop to the wheat whereas spring barley was the worst.

  16. Effect of different Planting Pattern of Wheat (Triticum aestivum and Bean (Vicia faba on Grain Yield, Dry Matter Production and Weed Biomass

    Directory of Open Access Journals (Sweden)

    Hamdollah ESKANDARI

    2010-12-01

    Full Text Available An experiment was conducted in University of London, Kent, UK during the year 2003. The aim of experiment was to investigate the effects of planting pattern on performance of wheat and bean intercrops. A complete randomized block design with four replications was employed to compare the treatments. Treatments included wheat sole crop (W, Bean sole crop (B, within row intercropping (M1, row intercropping (M2 and mix cropping (M3. The density of intercropping was according to replacement design (one wheat replaced by three bean plants. The results showed that total dry matter achieved by intercrops was significantly higher than those achieved by either wheat or bean sole crop. Regarding to weed control, intercrops were more effective than sole crops, especially bean sole crop. Crops performance in terms dry weight, height and percentage of leaf, stem pod and ear was affected by cropping systems depending on crop species, where wheat showed more changes compared to bean . Grain yield, harvest index and thousand grain weights of wheat were decreased in intercropping while bean had reduction only in grain yield.

  17. EFFECT OF FOLIAR APPLICATION OF AMINOACIDS ON PLANT YIELD AND PHYSIOLOGICAL PARAMETERS IN FABA BEAN PLANTS IRRIGATED WITH SEAWATER

    Directory of Open Access Journals (Sweden)

    Magdi T. ABDELHAMID

    2014-05-01

    Full Text Available Salinity decreases yield in arid and semi-arid areas. With increasing demand for irrigation water, alternative sources are being sought. Seawater salinity was previously considered unusable for irrigation. However, this water can be used successfully to grow crops under certain conditions. Amino acids is well known biostimulant which has positive effects on plant growth and yield, and significantly mitigates the injuries caused by abiotic stresses Therefore, in the present study, the effect of exogenously treatment amino acid on faba bean plant growing under sea water salt stress was investigated. Reduction of salinity damage in faba bean by using a mixture of amino acids to improve morphological and biochemical parameters, and thus raising the level of plant yield was tested. A pot experiment was conducted to alleviate the harmful effects of seawater salinity on faba bean cv. Giza 843 by foliar spraying of an amino acid mixture with different concentrations (0.0, 500, 1000 or 1500 mg L-1. Irrigation of faba bean plants with seawater levels of 3.13 and 6.25 dS m-1 led to significant reductions in plant height, number of leaves plant, fresh and dry weight of shoots, photosynthetic pigments, total carbohydrates, polysaccharides, nucleic acid DNA and RNA contents of faba bean leaves. Seawater salinity induced higher contents of Na+ and Cl- and decreased contents of K+, K+:Na+, Ca2+, Mg2+ and P3+. Irrigation of faba bean plant with different levels of seawater decreased seed yield and total dry weight per plant compared with those irrigated with tap water. Also, total carbohydrates and total protein contents in seeds were reduced by increased seawater salinity levels. Amino acid application as foliar spray significantly improved all the reduced parameters due to seawater stress. However, the highest level of amino acid of 1500 mg L-1 exerted the strongest effect in alleviating the harmful effect of seawater salinity stress. Efecto de la aplicaci

  18. Taking Leave?

    CERN Multimedia

    2000-01-01

    Planning a holiday? Then if you're a member of the personnel, you'll need to use the Laboratory's new leave system that will be put in place on 1 October. Leave allocations don't change - you are entitled to just as much holiday as before - but instead of being credited annually, your leave will be credited on a monthly basis, and this information will be communicated on your salary slip. The reason for the change is that with the various new leave schemes such as Recruitment by Saved Leave (RSL) and the Progressive Retirement Programme (PRP), a streamlined procedure was required for dealing with all kinds of leave. In the new system, each member of the personnel will have leave accounts to which leave will be credited monthly from the payroll and debited each time an absence is registered in the CERN Electronic Document Handling system (EDH). Leave balances will appear on monthly pay slips, and full details of leave transactions and balances will be available through EDH at all times. As the leave will be c...

  19. Effect of selected Egyptian cooking methods on faba bean nutritive value and dietary protein utilization 2: ability of faba bean products to support hemoglobin response in rats.

    Science.gov (United States)

    Bakr, A A; Bayomy, M F

    1997-01-01

    To evaluate the dietary protein utilization and iron deficiency anemia as affected by the faba bean nutrient intake, a bioassay with rats was carried out with different experimental diets containing four faba bean products (stewed beans 'Medammis', deep fried dough 'Falafel', boiled germinated beans 'Nabet Soup' and poured paste 'Bissara') widely consumed in the Middle East. Amino acid composition of all faba bean products was determined and compared to raw beans. Severe heat-processing markedly decreased some essential amino acids, especially phenylalanine, cystine, methionine and tryptophan. Protein scores were 24.6, 19.5, 29.2, 28.2 and 35.6 for raw faba beans, 'Medammis', 'Falafel', 'Nabet Soup' and 'Bissara', respectively. 'Bissara' possessed the highest nutritional value, since it had the lowest GDR value [Grams consumed of product to cover the daily requirements for adult man in protein (63 g) and in energy (2900 kcal)] for the limiting amino acids (L A A). As indicated by P S/150 values [Satisfaction of the daily requirements of the adult man when 150 g (one can content) are consumed of product] for L A A, i.e. methionine+cystine (lowest P S/150 value), the above-mentioned faba bean products cover about 53, 77, 77 and 97% of the daily requirements of adult man in L A A, respectively. Fecal nitrogen excretion increased and true nitrogen digestibility decreased significantly (p < 0.01) with the inclusion of 'Medammis' in the diet. 'Nabet Soup' exhibited the highest true nitrogen digestibility. In contrast, the biological value of nitrogen was apparently unaffected. Highest blood hemoglobin level was found in rats fed diets containing 'Bissara', 'Falafel' and 'Nabet Soup', whereas the addition of 'Medammis' in the diet induced a significant (p < 0.05) reduction in blood hemoglobin level of fed rats.

  20. Faba bean in dairy cow diet: effect on milk production and quality

    OpenAIRE

    Rosanna Scipioni; Domenico Pietro Lo Fiego; Luisa Antonella Volpelli; Michele Comellini

    2010-01-01

    Two consecutive trials were carried out to test flaked faba beans as a partial substitute for soybean meal (SBM) in the diet of Reggiana breed dairy cows. In both trials a “Control” concentrate (12% dehulled SBM) was compared to a “Faba” concentrate (7.5% dehulled SBM; 10% flaked faba beans). Forages fed to animals included hay (mixed grass and alfalfa) plus green mixed grass in trial 1, hay only in trial 2. Concentrate intake, faecal scores, milk yield and quality wer...

  1. On the presence of Vicia vicioides in Alicante

    Directory of Open Access Journals (Sweden)

    Pérez-Haase, A.

    2008-12-01

    Full Text Available Please read the Spanish version of this Abstract.

    En el presente trabajo se actualiza el conocimiento corológico de la leguminosa Vicia vicioides (Desf. Cout. en la provincia de Alicante, aportando información sobre cinco nuevas poblaciones, que se añaden a la única localidad conocida previamente.

  2. Effect of Debudding of Faba bean on the Soluble Nitrogen and ...

    African Journals Online (AJOL)

    Nitrogenase activity (measured as ARA) of debudded plants was ... Key words: Acetylene reduction activity, faba bean, feedbackcontrol, legume, nitrogenase activity, nitrogen ftxati on, nodules regulate .... Effect of debudding on nitrogenase activity (AR), soluble carbohydrate and nitrogen and ammonium content of nodules ...

  3. Contributions of photosynthetic and non-photosynthetic cell types to leaf respiration in Vicia faba L. and their responses to growth temperature.

    Science.gov (United States)

    Long, Benedict M; Bahar, Nur H A; Atkin, Owen K

    2015-11-01

    In intact leaves, mitochondrial populations are highly heterogeneous among contrasting cell types; how such contrasting populations respond to sustained changes in the environment remains, however, unclear. Here, we examined respiratory rates, mitochondrial protein composition and response to growth temperature in photosynthetic (mesophyll) and non-photosynthetic (epidermal) cells from fully expanded leaves of warm-developed (WD) and cold-developed (CD) broad bean (Vicia faba L.). Rates of respiration were significantly higher in mesophyll cell protoplasts (MCPs) than epidermal cell protoplasts (ECPs), with both protoplast types exhibiting capacity for cytochrome and alternative oxidase activity. Compared with ECPs, MCPs contained greater relative quantities of porin, suggesting higher mitochondrial surface area in mesophyll cells. Nevertheless, the relative quantities of respiratory proteins (normalized to porin) were similar in MCPs and ECPs, suggesting that ECPs have lower numbers of mitochondria yet similar protein complement to MCP mitochondria (albeit with lower abundance serine hydroxymethyltransferase). Several mitochondrial proteins (both non-photorespiratory and photorespiratory) exhibited an increased abundance in response to cold in both protoplast types. Based on estimates of individual protoplast respiration rates, combined with leaf cell abundance data, epidermal cells make a small but significant (2%) contribution to overall leaf respiration which increases twofold in the cold. Taken together, our data highlight the heterogeneous nature of mitochondrial populations in leaves, both among contrasting cell types and in how those populations respond to growth temperature. © 2015 John Wiley & Sons Ltd.

  4. The Potential Use of Fermented Chickpea and Faba Bean Flour as Food Ingredients.

    Science.gov (United States)

    Chandra-Hioe, Maria V; Wong, Christina H M; Arcot, Jayashree

    2016-03-01

    Apart from being a rich and inexpensive protein source, legumes provide essential vitamins, minerals and dietary fibre. Considering the nutritional benefits, legumes flour can potentially be incorporated in the development of new products. The aim of this study was to investigate whether fermentation affects the protein content, in vitro protein digestibility, trypsin inhibitor activity and the functionality of proteins in faba bean, desi and kabuli chickpea. Australian grown chickpea and faba bean were selected and initially soaked, de-hulled, dried and milled into flour. This was fermented with lyophilised yoghurt cultures in a 30 °C orbital shaker for 16 h. While protein contents in fermented desi and kabuli flour were lower than their raw counterparts (p > 0.05), it was significantly higher in fermented faba bean. A significant increase (9.5%) in in vitro protein digestibility was found in fermented desi. Trypsin inhibitor activity in fermented desi, kabuli and faba bean reduced by 2.7, 1.1 and 4.7%, respectively (p > 0.05). Overall, the in vitro protein digestibility in flour samples increased, while simultaneously reducing the trypsin inhibitor activity. The water absorption capacity of the fermented kabuli flour significantly increased by 11.3%. All fermented flour samples had significantly higher oil absorption capacity than their corresponding raw flour that was likely due to increased insoluble hydrophobic protein. Although, the foaming capacity in all fermented flour samples was significantly lower than their respective raw samples, only fermented desi and faba bean flour showed lower foaming stability (p > 0.05). The present study suggests that fermented legume flour could fulfill the demand for innovative products of higher nutritional value.

  5. Exploring the Microbiota of Faba Bean: Functional Characterization of Lactic Acid Bacteria

    Directory of Open Access Journals (Sweden)

    Michela Verni

    2017-12-01

    Full Text Available This study investigated the metabolic traits of 27 lactic acid bacteria (LAB strains belonging to different species, previously isolated from faba bean. The activities assayed, related to technological and nutritional improvement of fermented faba bean, included peptidases, β-glucosidase, phytase, as well as exopolysaccharides synthesis and antimicrobial properties. In addition, the bacteria performance as starter cultures during faba bean fermentation on proteolysis, antioxidant potential, and degradation of condensed tannins were assessed. Fermentative profiling showed that only 7 out of 27 strains were able to metabolize D-raffinose, particularly Leuc. mesenteroides I01 and I57. All strains of Pediococcus pentosaceus exerted high PepN activity and exhibited β-glucosidase activity higher than the median value of 0.015 U, while phytase activity was largely distributed among the different strains. All the weissellas, and in lower amount leuconostocs, showed ability to produce EPS from sucrose. None of the strains did not survive the simulated gastrointestinal tract with the exception of P. pentosaceus I56, I76, 147, I214, having a viability of 8–9 log CFU/ml at the end of the treatment. None of the strains showed antimicrobial activity toward Staphylococcus aureus, while eight strains of P. pentosaceus exhibited a strong inhibitory activity toward Escherichia coli and Listeria monocytogenes. Generally, the doughs fermented with pediococci exhibited high amount of total free amino acids, antioxidant activity, and condensed tannins degradation. These results allowed the identification of LAB biotypes as potential starter cultures for faba bean bioprocessing, aiming at the enhancement of faba bean use in novel food applications.

  6. Effect of cooking methods on selected physicochemical and nutritional properties of barlotto bean, chickpea, faba bean, and white kidney bean

    National Research Council Canada - National Science Library

    Güzel, Demet; Sayar, Sedat

    2012-01-01

    The effects of atmospheric pressure cooking (APC) and high-pressure cooking (HPC) on the physicochemical and nutritional properties of barlotto bean, chickpea, faba bean, and white kidney bean were investigated...

  7. Leaves, stem

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-03

    Dec 3, 2008 ... leaves pale yellowish green in colour with greenish cream scented flower and yellow fruits oval in shape ... When an herbal product is ingested the body interacts with it in an attempt to get rid of any harmful toxins, especially if the body cannot convert the foreign subs- tances into cellular components. In this ...

  8. Combination of different methods for direct control of Vicia hirsuta in winter wheat

    OpenAIRE

    Lukashyk, P.; Köpke, U.

    2005-01-01

    Combinations of three different direct methods for controlling Vicia hirsuta (kainite application, flame weeding and harrowing) were investigated in field experiments. They were based on different strategies at early growth stages of V. hirsuta and standardised harrowing at late growth stages. The highest efficacy of kainite application and flame weeding was achieved at the one leaf stage of V. hirsuta. Winter wheat regeneration from damage caused by both kainite and thermal control was satis...

  9. Comparative transcriptional profiling provides insights into the evolution and development of the zygomorphic flower of Vicia sativa (Papilionoideae.

    Directory of Open Access Journals (Sweden)

    Zhipeng Liu

    Full Text Available BACKGROUND: Vicia sativa (the common vetch possesses a predominant zygomorphic flower and belongs to the subfamily Papilionoideae, which is related to Arabidopsis thaliana in the eurosid II clade of the core eudicots. Each vetch flower consists of 21 concentrically arranged organs: the outermost five sepals, then five petals and ten stamens, and a single carpel in the center. METHODOLOGY/PRINCIPAL FINDINGS: We explored the floral transcriptome to examine a genome-scale genetic model of the zygomorphic flower of vetch. mRNA was obtained from an equal mixture of six floral organs, leaves and roots. De novo assembly of the vetch transcriptome using Illumina paired-end technology produced 71,553 unigenes with an average length of 511 bp. We then compared the expression changes in the 71,553 unigenes in the eight independent organs through RNA-Seq Quantification analysis. We predominantly analyzed gene expression patterns specific to each floral organ and combinations of floral organs that corresponded to the traditional ABC model domains. Comparative analyses were performed in the floral transcriptomes of vetch and Arabidopsis, and genomes of vetch and Medicago truncatula. CONCLUSIONS/SIGNIFICANCE: Our comparative analysis of vetch and Arabidopsis showed that the vetch flowers conform to a strict ABC model. We analyzed the evolution and expression of the TCP gene family in vetch at a whole-genome level, and several unigenes specific to three different vetch petals, which might offer some clues toward elucidating the molecular mechanisms underlying floral zygomorphy. Our results provide the first insights into the genome-scale molecular regulatory network that controls the evolution and development of the zygomorphic flower in Papilionoideae.

  10. Multielemental Fingerprinting as a Tool for Authentication of Organic Wheat, Barley, Faba Bean, and Potato

    DEFF Research Database (Denmark)

    Laursen, Kristian Holst; Schjørring, Jan Kofod; Olesen, Jørgen E

    2011-01-01

    between organic and conventional crops were found in the content of essential plant nutrients when statistically analyzed individually. However, chemometric analysis of multielemental fingerprints comprising up to 14 elements allowed discrimination. The discrimination power was further enhanced......The multielemental composition of organic and conventional winter wheat, spring barley, faba bean, and potato was analyzed with inductively coupled plasma−optical emission spectrometry (ICP-OES) and −mass spectrometry (ICP-MS). The crops were cultivated in two years at three geographically...... different field locations, each accommodating one conventional and two organic cropping systems. The conventional system produced the highest harvest yields for all crops except the nitrogen-fixing faba bean, whereas the dry matter content of each crop was similar across systems. No systematic differences...

  11. Potential candidates for biological control of the black bean aphid Aphis fabae in Serbia

    Directory of Open Access Journals (Sweden)

    Stanković, S.S.

    2015-09-01

    Full Text Available The black bean aphid is widely spread aphid species in the Palaearctic, known to attack over 1150 plant species. Because some of the host plants are of great agricultural interest, Aphis fabae represent a very important pest. We assembled all data concerning the presence of this pest and connected it in tritrophic associations. In the period of 24 years investigation on the territory of Serbia it has been recorded in 107 trophic associations. In total there are 145 findings of A. fabae parasitized by 19 taxa of Aphidiinae (Brackonidae from seven genera. The most suitable biocontrol agents for the black bean aphid are Lysiphlebus fabarum, Binodoxys angelicae, Lipolesis gracilis and the introduced species Lysiphlebus testaceipes.

  12. [Use of the HPLC method for determination of glucopiranosides during ripening of faba bean seeds].

    Science.gov (United States)

    Nestorowicz, J; Pierzynowska-Kornik, G; Zadernowski, R

    1996-01-01

    Uridine (C9H12N2O6) was applied as an internal standard for the determination of glucopiranosides in faba bean seeds by the HPLC method. The relative UV response factors of vaccine or convicine to uridine were determined (1.12 and 0.79, respectively). The changes in the content of vaccine and convicine during ripening of faba bean seeds were followed. It was observed that with the increase in the seed dry matter content from 0.18 kg/kg to 0.78 kg/kg, the dry matter based content of vaccine decreased from 26.225 g/kg to 0.243 g/kg, and that of convicine from 9.051 g/kg to 0.094 g/kg.

  13. Potential bioethanol and biogas production using lignocellulosic biomass from winter rye, oilseed rape and faba bean

    Energy Technology Data Exchange (ETDEWEB)

    Petersson, Anneli; Thomsen, Mette H.; Hauggaard-Nielsen, Henrik; Thomsen, Anne-Belinda [Risoe National Laboratory, P.O. Box 49, DK-4000 Roskilde (Denmark)

    2007-11-15

    To meet the increasing need for bioenergy several raw materials have to be considered for the production of e.g. bioethanol and biogas. In this study, three lignocellulosic raw materials were studied, i.e. (1) winter rye straw (Secale cereale L), (2) oilseed rape straw (Brassica napus L.) and (3) faba bean straw (Viciafaba L.). Their composition with regard to cellulose, hemicellulose, lignin, extractives and ash was evaluated, as well as their potential as raw materials for ethanol and biogas production. The materials were pretreated by wet oxidation using parameters previously found to be optimal for pretreatment of corn stover (195 C, 15 min, 2 g l{sup -1} Na{sub 2}CO{sub 3} and 12 bar oxygen). It was shown that pretreatment was necessary for ethanol production from all raw materials and gave increased biogas yield from winter rye straw. Neither biogas productivity nor yield from oilseed rape straw or faba bean straw was significantly affected by pretreatment. Ethanol was produced by the yeast Saccharomyces cerevisiae during simultaneous enzymatic hydrolysis of the solid material after wet oxidation with yields of 66%, 70% and 52% of theoretical for winter rye, oilseed rape and faba bean straw, respectively. Methane was produced with yields of 0.36, 0.42 and 0.44 l g{sup -1} volatile solids for winter rye, oilseed rape and faba bean straw, respectively, without pretreatment of the materials. However, biogas productivity was low and it took over 50 days to reach the final yield. It could be concluded that all three materials are possible raw materials for either biogas or ethanol production; however, improvement of biogas productivity or ethanol yield is necessary before an economical process can be achieved. (author)

  14. Improving Tolerance of Faba Bean during Early Growth Stages to Salinity through Micronutrients Foliar Spray

    OpenAIRE

    Mohamed M. EL FOULY; Zeinab M. MOBARAK; Zeinab A. SALAMA

    2010-01-01

    Salinity, either of soil or of irrigation water, causes disturbances in plant growth and nutrient balance. Previous work indicates that applying nutrients by foliar application increases tolerance to salinity. A pot experiment with three replicates was carried out in the green house of NRC, Cairo, Egypt, to study the effect of micronutrients foliar application on salt tolerance of faba bean. Two concentrations of a micronutrient compound (0.1% and 0.15%) were sprayed in two different treatmen...

  15. Effect of extrusion, espansion and toasting on the nutritional value of peas, faba beans and lupins

    Directory of Open Access Journals (Sweden)

    Filippo Rossi

    2010-01-01

    Full Text Available An assessment was made of the effect that different treatments (toasting, expansion, extrusion have on the nutritionalvalue of protein plants (pea, faba bean, lupin. In a randomized block design, feeds were screened for enzymaticdigestibility of starch and protein, N solubility and in vitro protein degradability. Expansion and extrusion cause increasedstarch enzymatic degradability while toasting produced virtually no effects. In peas this value increased from 11.80% inmeal to 39.70% in the extruded product; 85.37% is the percentage for the expanded product, while 10.90% is the starchdigestibility value for toasted peas. In faba beans the extrusion process increased starch digestibility from 11.39% to85.05%, while in extruded lupins a complete starch hydrolysis was obtained, while in the meal the polysaccharide digestionwas 54.48%.The expansion and extrusion processes significantly decreased rumen degradability during the first 8 hours of incubation.Toasted peas had lower degradability if compared with controls but not with the other treatments. The onlypotentially alternative source to soybean is the extruded faba bean. In spite of its lower protein content, this feed ischaracterized by a considerably lower in vitro protein degradability than soybean. This implies that the digestible foodprotein content is comparable (124.90 g/kg DM to that of soybean (109.78 g/kg DM and definitely higher than thatof all other protein plants.

  16. Faba bean in dairy cow diet: effect on milk production and quality

    Directory of Open Access Journals (Sweden)

    Rosanna Scipioni

    2010-01-01

    Full Text Available Two consecutive trials were carried out to test flaked faba beans as a partial substitute for soybean meal (SBM in the diet of Reggiana breed dairy cows. In both trials a “Control” concentrate (12% dehulled SBM was compared to a “Faba” concentrate (7.5% dehulled SBM; 10% flaked faba beans. Forages fed to animals included hay (mixed grass and alfalfa plus green mixed grass in trial 1, hay only in trial 2. Concentrate intake, faecal scores, milk yield and quality were similar between feeding groups. The milk urea content was lower in the “Faba” group (“Control” vs. “Faba”: 34.6 vs. 32.9mg/dl in trial 1, P<0.1; 27.4 vs. 23.4mg/dl in trial 2, P<0.01. The plasma urea was different only in trial 2 (“Control” vs. “Faba”: 3.9 vs. 3.0mmol/l, P<0.01. The inclusion of faba beans within the allowed limit of the Parmigiano-Reggiano Consortium for diet formulation could represent a feasible opportunity for a partial substitution of SBM.

  17. Effects of Intercropping (Canola-Faba Bean on Density and Diversity of Weeds

    Directory of Open Access Journals (Sweden)

    Mohamad Hossain GHARINEH

    2010-03-01

    Full Text Available In order to evaluate the biological effect and interference of crop and weed in canola-faba bean intercropping in comparison with mono culture, an experiment was conducted in randomize completely blocks design with three replication at Ramin Agriculture and Natural Resources, University. In this experiment treatments were different compositions of canola (Brassica napus L. var. haylo and faba bean (local cultivar. Plant densities (0, 20 and 40 plants per m2 for canola and four levels include (0, 20, 40 and 60 plants per m2 for faba bean in accordance with additive form mixed culture system respectively. Weed dry weight was affected by culture system and different levels of plant densities in mixed culture and there were significant difference 1%. Lowest weed dry weight was obtained in 20-60 and 40-60 plants m-2 canola-bean intercropping. In the intercropping parts only two species was observed while in the sole culture more than three species were exist. Results showed that with increasing in bean diversity, weed dry weight declines. According to our results, it is possible to control weed effectively by using intercropping system, but more studied is required. Diversity of weeds had been clearly affected. Results showed that only Beta and Malva species were existed in intercropping comparing to sole cultures that Brassica, Beta, Rumex and Malva were existed.

  18. Stem anatomy of annual legume intercropping components: white lupin (Lupinus albus L., narbonne (Vicia narbonensis L. and common (Vicia sativa L. vetches

    Directory of Open Access Journals (Sweden)

    Lana Zoric

    2015-06-01

    Full Text Available The effect of intercropping on stem anatomy of both supporting (Lupinus albus and supported (Vicia narbonnensis and V. sativa annual forage legumes was investigated using stereological method. Intercropped plants showed minimal differences in volume densities (Vv of stem tissues and forage chemical composition compared to sole crops. The proportions of lignin and NDF (Neutral Detergent Fiber positively correlated with xylem Vv. The proportions of ADF (Acid Detergent Fiber, cellulose and ash in intercropped plants were increased or decreased mostly by less than 10% compared to those in pure stands. The Anatomical Equivalent Ratio (AER defined as the ratio based on anatomical quality-determining parameters, can assist in the evaluation of the benefits of specific intercropping systems. Intercropping of the legume species studied in this work, especially L. albus with V. sativa, showed encouraging results from anatomical perspective since it would not cause a decline of forage quality.

  19. Evaluation of Agricultural Use of Vicia sativa L. in Mercury Contaminated Soils; Evaluacion del Uso Agricola de Vicia sativa L. en Suelos Contaminados con Mercurio

    Energy Technology Data Exchange (ETDEWEB)

    Andres, A.; Millan, R.; Esteban, E.

    2010-03-08

    This study is framed in the project Recuperation de suelos contaminados por mercurio: recomendaciones de uso de suelos y plantas en la comarca minera de Almaden (REUSA), funded by Spanish Ministry of Education and Science. Moreover, this article is the result of the work carried out by Andres Andres for his Bachelors dissertation. Soils from the Almaden mining district are contaminated with high mercury concentrations, due to the extraction activities of that metal through the years. After the end of mining exploitation, which was the main source of wealth in the region, alternative uses of soils are needed in order to promote the socio-economic development of the studied area. The project here intends to evaluate the viability of the common vetch (Vicia sativa L.) crop in a substrate under similar conditions to the ones observed in the Almaden soils, by studying the mercury absorption capacity of the above mentioned species. (Author) 20 refs.

  20. Identification of protein secretion systems and novel secreted proteins in Rhizobium leguminosarum bv. viciae

    Directory of Open Access Journals (Sweden)

    Krehenbrink Martin

    2008-01-01

    Full Text Available Abstract Background Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Results Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP, a twin-arginine translocase (TAT secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP were generated, but only mutations affecting the PrsDE (Type I and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. Conclusion None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V is required for establishing the symbiosis with legumes. The PrsDE (Type I system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to

  1. Identification of protein secretion systems and novel secreted proteins in Rhizobium leguminosarum bv. viciae.

    Science.gov (United States)

    Krehenbrink, Martin; Downie, J Allan

    2008-01-29

    Proteins secreted by bacteria play an important role in infection of eukaryotic hosts. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. Proteins secreted during the infection process by some rhizobial strains can influence infection and modify the plant defence signalling pathways. The aim of this study was to systematically analyse protein secretion in the recently sequenced strain Rhizobium leguminosarum bv. viciae 3841. Similarity searches using defined protein secretion systems from other Gram-negative bacteria as query sequences revealed that R. l. bv. viciae 3841 has ten putative protein secretion systems. These are the general export pathway (GEP), a twin-arginine translocase (TAT) secretion system, four separate Type I systems, one putative Type IV system and three Type V autotransporters. Mutations in genes encoding each of these (except the GEP) were generated, but only mutations affecting the PrsDE (Type I) and TAT systems were observed to affect the growth phenotype and the profile of proteins in the culture supernatant. Bioinformatic analysis and mass fingerprinting of tryptic fragments of culture supernatant proteins identified 14 putative Type I substrates, 12 of which are secreted via the PrsDE, secretion system. The TAT mutant was defective for the symbiosis, forming nodules incapable of nitrogen fixation. None of the R. l. bv. viciae 3841 protein secretion systems putatively involved in the secretion of proteins to the extracellular space (Type I, Type IV, Type V) is required for establishing the symbiosis with legumes. The PrsDE (Type I) system was shown to be the major route of protein secretion in non-symbiotic cells and to secrete proteins of widely varied size and predicted function. This is in contrast to many Type I systems from other bacteria, which typically secrete specific substrates encoded by genes often localised in close proximity to the genes encoding the secretion system itself.

  2. DmeRF system is required for nickel and cobalt resistance in Rhizobium leguminosarum bv. viciae.

    OpenAIRE

    Rubio Sanz, Laura; Prieto Carbajo, Rosa Isabel; Palacios Alberti, Jose Manuel; Brito Lopez, Maria Belen

    2013-01-01

    A member of the Cation Diffusion Facilitator (CDF) family with high sequence similarity to DmeF (Divalent metal efflux) from Cupridavirus metallidurans was identified in Rhizobium leguminosarum bv. viciae UPM1137. The R. leguminosarum dmeF mutant strain was highly sensitive to Co2+ and moderately sensitive to Ni2+, but its tolerance to other metals such as Zn2+, Cu2+ or Mn2+ was unaffected. An open reading frame located upstream of R. leguminosarum dmeF, designated dmeR, encodes a protein hom...

  3. SYMBIOTIC EFFECTIVENESS OF RHIZOBIUM LEGUMINOSARUM BV. VICIAE WITH PEA PLANTS AS INFLUENCED BY AZOTOBACTER CHROOCOCCUM

    OpenAIRE

    Stefan Martyniuk; Monika Kozieł; Anna Gałązka

    2015-01-01

    The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv) in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv) i...

  4. Fermentation of rapeseed meal, sunflower meal and faba beans in combination with wheat bran increases solubility of protein and phosphorus

    DEFF Research Database (Denmark)

    Poulsen, Hanne Damgaard; Blaabjerg, Karoline

    2017-01-01

    BACKGROUND To increase self-supply of protein and phosphorus (P) in European pig and poultry diets and reduce nitrogen (N) and P excretion, attention is directed to approaches increasing protein and P digestibility of rapeseed, sunflower and faba beans. Wheat bran is rich in enzymes degrading...... and solubilizing protein and phytate. Herein, solubilization of protein, N and P was investigated when increasing ratios of wheat bran were fermented with rapeseed meal (RSM), sunflower meal (SFM), faba beans (FB) or a combination of these (RSM/SFM/FB). RESULTS Protein, N and P solubility was greater, for all...

  5. A novel beta-glucosidase in Uromyces fabae : feast or fight?

    OpenAIRE

    Haerter, Ariane C.; Voegele, Ralf T.

    2004-01-01

    Efficient nutrient mobilization is a key element for biotrophic plant parasites such as the rust fungi. In the course of a cDNA library screen for elements involved in sugar utilization in Uromyces fabae, we identified a sequence with homology to beta-glucosidases. Full-length genomic and cDNA clones of the gene, termed BGL1, were isolated and sequenced. The BGL1 gene comprises 3,372 nucleotides, including nine introns. The open reading frame encompasses 2,532 bases and codes for a polypeptid...

  6. Laboratory invesitgations of variability of Ascochyta fabae Speg. isolates obtained from horse bean

    Directory of Open Access Journals (Sweden)

    Antoni Józef Filipowicz

    2014-08-01

    Full Text Available Fifty five isolates of Ascochyta fabae Speg. were investigated. They were selected from 1650 isolates of this fungus obtained from horse bean seeds in 1974-1976. All the isolates grew and sporulated on Potato Dextrose Agar, Malt Agar and Horse Bean Agar. The rate of their growth amounted to 1-4 mm per 24 hours. The variability of isolates in size of pycnidia and conidia and number of sepia was noticed. A few spores with untypical shapes were observed as well.

  7. Leaving liza.

    Science.gov (United States)

    Futcher, Jane

    2004-01-01

    Abstract This is Chapter Thirteen of Leaving Liza, a novel about life, death, love, friendship, jealousy and lesbian ex-lovers. In the novel, six women are spending the weekend at a beach house in Long Island's Hamptons, where they have gathered to be with their friend Liza, who is battling terminal ovarian cancer. Liza's lover, Jill, has agreed to the house party and helped plan the guest list. But, as she smolders with resentment at the attention Liza is getting and the depth of the women's friendships, she begins to come unraveled. After a severe asthma attack that requires an emergency room visit the day before, Jill conducts a seance, purporting to have contacted another of Liza's ex-lovers, who died a few months earlier. Now, on this last night of the house party, she lets Liza and her friends know what she's really feeling. The editors have asked me to add some "commentary" on the questions this story raises about the roles of ex-lovers. I would hope the scene reflects some of the tensions that can occur when ex-lovers choose to remain friends, particularly when those bonds provoke profound jealousy in both current and ex-lovers. For many of us, the job of assuaging and reassuring the current lover while maintaining intimate friendships with an ex-lover is simply too exhausting and prickly to endure. For others, it is worth the struggle. Liza and her friends clearly think it is. But at what point, they all wonder at this house party, does their hunger for honesty and their anger at being insulted and manipulated become more important than keeping the peace, and possibly their friendship with Liza? Perhaps only Liza's death will free them from this compromising coexistence.

  8. Mapping of quantitative trait loci controlling Orobanche foetida Poir ...

    African Journals Online (AJOL)

    Mapping of quantitative trait loci controlling Orobanche foetida Poir. resistance in faba bean (Vicia faba L.) R Díaz-Ruiz, A Torres, MV Gutierrez, D Rubiales, JI Cubero, M Kharrat, Z Satovic, B Román ...

  9. Efectos combinados del estres por salinidad y la nicotinamida sobre parametros bioquimicos y fisiologicos en plantas de haba

    National Research Council Canada - National Science Library

    Abdelhamid, Magdi T; Sadak, Mervat Sh; Schmidhalter, Urs; Saady, Abdel-Kareem M. El

    2013-01-01

    .... One of these compounds is nicotinamide (vitamin B3/niacin). The effect of exogenous application of nicotinamide with different concentrations (0, 200 or 400 mg [l.sup.-1]) on faba bean (Vicia faba L...

  10. The effect of endogenous hydrogen peroxide induced by cold treatment in the improvement of tissue regeneration efficiency

    NARCIS (Netherlands)

    Szechynska-Hebda, M.; Skrzypek, E.; Dabrowska, G.; Wedzony, M.; Lammeren, van A.A.M.

    2012-01-01

    We propose that oxidative stress resulting from an imbalance between generation and scavenging hydrogen peroxide contributes to tissue regeneration efficiency during somatic embryogenesis of hexaploid winter wheat (Triticum aestivum cv. Kamila) and organogenesis of faba bean (Vicia faba ssp. minor

  11. Effects of Rhizobium inoculation, organic and chemical fertilizers on yield and physical properties of faba bean seeds.

    Science.gov (United States)

    Elsheikh, E A; Elzidany, A A

    1997-01-01

    A field experiment was carried out to investigate the effect of Rhizobium inoculation, sulphur, nitrogen and chicken manure on yield, 100-seed weight, cookability, non-soakers, total defects and hydration coefficient of faba bean. The results showed that sulphur, nitrogen and chicken manure treatments significantly (p manure not only increased plant growth and yield, but also improved seed quality and nutritional value.

  12. Granular formulation of Fusarium oxysporum for biological control of faba bean and tomato Orobanche.

    Science.gov (United States)

    Nemat Alla, Mamdouh M; Shabana, Yasser M; Serag, Mamdouh M; Hassan, Nemat M; El-Hawary, Mohamed M

    2008-12-01

    Orobanche spp. represent a serious threat to a wide range of crops. They are difficult targets for herbicides, and biological control could provide a possible solution. This work therefore aimed to formulate mycoherbicides of Fusarium with adequate shelf life and virulence against Orobanche but safe to faba bean and tomato. Only two isolates of Fusarium oxysporum Schlecht. (Foxy I and Foxy II) obtained from diseased Orobanche shoots were found to be pathogenic to Orobanche crenata Forsk. and Orobanche ramosa L. Conidial suspension of both isolates significantly decreased germination, attachments and tubercles of Orobanche. Microconidia and chlamydospores of both isolates were formulated as mycoherbicides encapsulated in a wheat flour-kaolin matrix (four different formulations). All formulations greatly diminished Orobanche emerged shoots, total shoot number, shoot height, attachment of emerged shoots, the germinated seeds that succeeded in emerging above the soil surface and dry weight. Meanwhile, disease incidence and disease severity of emerged shoots were enhanced. The shelf life was adequate, particularly for coarse, freshly prepared, low-temperature-stored, microconidia-rich formulations. The induced growth reduction of Orobanche-infected host plants seemed to be nullified by formulations, particularly at the highest dose. These formulations seemed to destroy Orobanche but appeared harmless to host plants. Hence, they could be efficiently used as mycoherbicides for biological control of Orobanche in faba bean and tomato.

  13. Rhubarb leaves poisoning

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002876.htm Rhubarb leaves poisoning To use the sharing features on this page, please enable JavaScript. Rhubarb leaves poisoning occurs when someone eats pieces of leaves ...

  14. An increase in renal dopamine does not stimulate natriuresis after fava bean ingestion123

    OpenAIRE

    Garland, Emily M; Cesar, Tericka S; Lonce, Suzanna; Ferguson, Marcus C; Robertson, David

    2013-01-01

    Background: Fava beans (Vicia faba) contain dihydroxyphenylalanine (dopa), and their ingestion may increase dopamine stores. Renal dopamine regulates blood pressure and blood volume via a natriuretic effect.

  15. Influence of faba bean and peas combination on per­for­man­ce parameters of broilers

    Directory of Open Access Journals (Sweden)

    Pavla Kratochvílová

    2009-01-01

    Full Text Available Influence of two varieties of peas and faba bean on performance was observed in grow experiment. Varieties of legumes were different in antinutritive factors levels. ZEKON (peas and MISTRAL (faba bean are low tannin varieties, GOTIK (peas and MERKUR (faba bean are traditional varieties with high level of antinutritive substances. Experiment was finished in 40 days of age. There were used 900 broilers allotted to 9 groups (100 animals in group. Peas and faba bean was dose to feed mixture on level adequate to 30 g of crude protein per kilogram of feed mixture, the rest of crude protein needed in feed mixture was covered by soya bean meal. The best results in final weight achieved group with GOTIK (2476.7 ± 270.8 g, the second was group ZEKON (2456.7 ± 247.2 g, than MISTRAL in combination with peas (2454.7 ± 268.5 g, MERKUR (2416.9 ± 266.1 g, ZEKON in combination with faba bean (2410,7 ± 297.8 g and MISTRAL group achieved 2405.6 ± 336.4 g of final weight. The rest of groups was belong 2400 g of body weight: control group 2370.1 ± 249.2 g, GOTIK in combination with peas 2302.9 ± 253.1 g and the worst result had group MERKUR in combination with peas (2258.8 ± 259.4 g. The differences were significant.

  16. Changes Germination, Growth and Anatomy Vicia ervilia in Response to Light Crude Oil Stress

    Directory of Open Access Journals (Sweden)

    Bahareh Lorestani

    2014-05-01

    Full Text Available Thepetroleum concentrations are contaminant important sources in the environment. Hydrocarbon’s contaminants depend on their type and concentration can cause variable toxicity in soils, on the other hand, different kinds of plants also response concentration of contaminant differently, because of the diversity of physiological and morphological characteristics. In this study the effect of different concentrations of light crude oil was investigated on stem length, germination and anatomical of Vicia ervilia. A factorial experiment was used with a randomized complete block design (RCBD with three replications. The results showed that the germination and stem lengths decreased significantly (p≤ 0.05 with increasing concentrations of petroleum. Anatomical studies the changes of parenchyma, vascular bundles, epidermal and increase crack showed.

  17. Parental Leave in Denmark

    DEFF Research Database (Denmark)

    Rostgaard, Tine; Christoffersen, Mogens; Weise, Hanne

    This artcle considders the political aims for different leave schemes and reviews studies af these schemes. The use of parental leave is sensitive to the financial loss involved in taking leave: a decrease in the benefit payments has had a significant influence on take-up, while, in general......, families'' loss of income is less if leave is taken up by the mothers. Only few fathers participate in parental leave....

  18. Improving Tolerance of Faba Bean during Early Growth Stages to Salinity through Micronutrients Foliar Spray

    Directory of Open Access Journals (Sweden)

    Mohamed M. EL FOULY

    2010-06-01

    Full Text Available Salinity, either of soil or of irrigation water, causes disturbances in plant growth and nutrient balance. Previous work indicates that applying nutrients by foliar application increases tolerance to salinity. A pot experiment with three replicates was carried out in the green house of NRC, Cairo, Egypt, to study the effect of micronutrients foliar application on salt tolerance of faba bean. Two concentrations of a micronutrient compound (0.1% and 0.15% were sprayed in two different treatments prior to or after the salinity treatments. Levels of NaCl (0.00-1000-2000-5000 ppm were supplied to irrigation water. Results indicated that 2000 and 5000 ppm NaCl inhibited growth and nutrient uptake. Spraying micronutrients could restore the negative effect of salinity on dry weight and nutrients uptake, when sprayed either before or after the salinity treatments. It is suggested that micronutrient foliar sprays could be used to improve plant tolerance to salinity.

  19. Host preference between symbiotic and aposymbiotic Aphis fabae, by the aphid parasitoid, Lysiphlebus ambiguus.

    Science.gov (United States)

    Cheng, Rui-Xia; Meng, Ling; Mills, Nickolas J; Li, Baoping

    2011-01-01

    Few empirical studies have directly explored the association between Buchnera aphidicola (Enterobacteriales: Enterobacteriaceae), the primary endosymbiont of aphids, and the life history strategies of aphid parasitoids. A series of paired-choice experiments were conducted to explore the preference of the parasitoid Lysiphlebus ambiguus Halliday (Hymenoptera: Aphididae) for symbiotic and aposymbiotic Aphis fabae Scopoli (Hemiptera: Aphididae) and the suitability of these hosts for parasitoid development. When given a choice between symbiotic and aposymbiotic aphids of the same instar, the parasitoid significantly preferred symbiotic over aposymbiotic aphids only during the later instars (L(4) and adult). The suitability of aposymbiotic aphids for parasitoid development was equal to that of symbiotic aphids in terms of survivorship and sex ratio, but was significantly lower than that of symbiotic aphids for L(4) and adult instars in development rate and/or female adult size. When given a choice between similar-sized symbiotic L(2) and aposymbiotic L(4) aphids, the parasitoid preferred the former. No significant differences in preference or host suitability were demonstrated when the parasitoid was given a choice between different instars of aposymbiotic aphids. While parasitoid lifetime fecundity increased with aphid instar at the time of oviposition, there was no significant influence of previous development from symbiotic versus aposymbiotic aphids. These results suggest that while L. ambiguus can discriminate between symbiotic and aposymbiotic A. fabae during later instars and when the aphids are of a similar size, the primary endosymbiont is not needed for successful parasitoid development; and its absence only compromises parasitoid growth reared from later instar aposymbiotic host.

  20. Efficiency of propolis extract on faba bean plants and its role against nematode infection.

    Science.gov (United States)

    Noweer, E M A; Dawood, Mona G

    2009-01-01

    Propolis is a resinous substances collected by honey bees, It cannot be used as a raw material, so it must be purified by extraction with solvent. This work aimed to study the physiological influence of propolis extract as foliar application or soil drench on faba bean plants and its role against nematode infection. Propolis samples were extracted by using three different solvents (distilled water or 70% ethanol or acetone) (750 and 1000 mg/l). Qualitative tests of the propolis extracts proved that these extracts contain sterols, flavonoids and phenolic compounds. Moreover, few numbers of phenolic acids (coumaric, ferulic, salicylic and benzoic acid) were also detected on TLC plates. All treatments of propolis extract (as foliar application or soil drench) increased total chlorophyll and carotenoid and the magnitude of increase was more pronounced by applying the higher concentration (1000 mg/l). Moreover, alll propolis extracts increased shoot height; root dry weight; number of branches and pods/plant; number of seeds/pod as well as seed index. Acetonic extract was the most effective particularly at higher concentration. Applying propolis extracts as foliar application or soil drench caused an increase in carbohydrate content of the yielded seeds accompanied by a decrease in phytic acid and vicine content. In addition, foliar application of all propolis extracts caused an increasing in protein content and phenolic compounds of the yielded seeds, whereas, soil drench with ethanolic or acetonic extract only at 1000 mg/L increased protein content. The data revealed that the propolis extract as soil drench reduced the juvenile-Meloidogyne sp.-population density per one kg soil and number of root-galls per one gm roots specially at the higher concentration (1000 mg/l). It is worthy to mention that faba bean plants treated with propolis extract either as foliar application or soil drench could overcome the inhibitory influence of nematode infection.

  1. Using deficit irrigation with treated wastewater to improve crop water productivity of sweet corn, chickpea, faba bean and quinoa

    Directory of Open Access Journals (Sweden)

    Abdelaziz HIRICH

    2014-07-01

    Full Text Available Several experiments were conducted in the south of Morocco (IAV-CHA, Agadir during two seasons 2010 and 2011 in order to evaluate the effect of deficit irrigation with treated wastewater on several crops (quinoa, sweet corn, faba bean and chickpeas. During the first season (2010 three crops were tested, quinoa, chickpeas and sweet corn applying 6 deficit irrigation treatments during all crop stages alternating 100% of full irrigation as non-stress condition and 50% of full irrigation as water deficit condition applied during vegetative growth, flowering and grain filling stage. For all crops, the highest water productivity and yield were obtained when deficit irrigation was applied during the vegetative growth stage. During the second season (2011 two cultivars of quinoa, faba bean and sweet corn have been cultivated applying 6 deficit irrigation treatments (rainfed, 0, 25, 50, 75 and 100% of full irrigation only during the vegetative growth stage, while in the rest of crop cycle full irrigation was provided except for rainfed treatment. For quinoa and faba bean, treatment receiving 50% of full irrigation during vegetative growth stage recorded the highest yield and water productivity, while for sweet corn applying 75% of full irrigation was the optimal treatment in terms of yield and water productivity.

  2. Leaving home in Denmark

    DEFF Research Database (Denmark)

    Nielsen, Rikke Skovgaard

    2015-01-01

    The paper focuses on ethnic differences in the timing and patterns of leaving the parental home. Leaving home is a key transition in the life course of the individual, and extensive research has been conducted on the timing and patterns of leaving it. However, ethnic differences in these patterns...... of leaving home. Results showed that while some differences disappeared when controlling for covariates, others persisted, thus indicating ethnic differences in home-leaving patterns. A strong link between leaving home and marriage was substantiated for Turks, but not for Somalis. The home-leaving patterns...... of Somalis were much more similar to those of Danes. Overall, Turkish descendants were similar to Turkish immigrants but with some differentiation. The analyses identified the existence of ethnic differences in home-leaving patterns but also found evidence of a shift towards less traditional patterns, i...

  3. Leaving an Abusive Relationship

    Science.gov (United States)

    ... restraining order Leaving an abusive relationship Effects of domestic violence on children Sexual assault and rape Sexual assault Rape Sexual ... restraining order Leaving an abusive relationship Effects of domestic violence on children Sexual assault and rape Other types of violence ...

  4. SAVED LEAVE BONUS

    CERN Multimedia

    Division des ressources humaines

    2000-01-01

    Staff members participating in the RSL programme are entitled to one additional day of saved leave for each full period of 20 days remaining in their saved leave account on 31 December 1999.Allowing some time for all concerned to make sure that their periods of leave taken in 1999 are properly registered, HR division will proceed with the crediting of the appropriate number of days in the saved leave accounts from 25 January 2000.Human Resources DivisionTel.73359

  5. Taxonomic relationships in some Vicia species from Egypt, based on seed morphology and SDS-PAGE of seed proteins - doi: 10.4025/actascibiolsci.v35i4.19345

    Directory of Open Access Journals (Sweden)

    Kadry Nabeh Abdel Khalik

    2013-07-01

    Full Text Available The seed morphology and seed proteins of 11 Vicia taxa from Egypt were studied. Macro- and micro-morphological characters, including seed shape, color, size, hilum shape and seed sculpture were described and analyzed. The secondary sculpture of the cell wall varies from papillose in nearly all Vicia species to lophate in V. hirsuta. Further, the seed proteins of studied taxa were investigated by SDS-PAGE and 39 different bands were scored. The similarity analysis based on the SDS-PAGE profile and seed morphology was found to be a useful characteristic for the discrimination of Vicia species both on the subgeneric and the sectional levels. The present study did not acknowledge V. tetrasperma and V. hirsuta as subgenus Ervum. As a result, division of Vicia into two subgenera i.e. Vicia and Cracca, is supported.

  6. Metabolic responses in root nodules of Phaseolus vulgaris and Vicia sativa exposed to the imazamox herbicide.

    Science.gov (United States)

    García-Garijo, A; Tejera, N A; Lluch, C; Palma, F

    2014-05-01

    Alterations on growth, amino acids metabolism and some antioxidant enzyme activities as result of imazamox treatment were examined in determinate and indeterminate nodules, formed by Phaseolus vulgaris and Vicia sativa, respectively. Young seedlings of both legumes were inoculated with their respective microsymbionts and grown under controlled conditions. At vegetative growth, plants were treated with imazamox (250μM) in the nutrient solution and harvested 7days after. Imazamox was mainly accumulated in V. sativa where concentrations were more than six fold higher than those detected in P. vulgaris. Nodule dry weight and total nitrogen content were reduced by the herbicide treatment: the highest decrease of nodule biomass (50%) and nitrogen content (40%) were registered in V. sativa and P. vulgaris, respectively. The concentration of branched-chain amino acids (BCAA) did not change in neither determinate nor indeterminate nodules even though the acetohydroxyacid synthase activity decreased in root and nodules of both symbioses with the herbicide application. Based on this last result and taking into account that total free amino acids increased in roots but not in nodules of common vetch, a possible BCAA translocation from root to nodule could occur. Our results suggest that the maintenance of BCAA balance in nodule become a priority for the plant in such conditions. The involvement of activities glutathione-S-transferase, guaiacol peroxidase and superoxide dismutase in the response of the symbioses to imazamox are also discussed. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. SYMBIOTIC EFFECTIVENESS OF RHIZOBIUM LEGUMINOSARUM BV. VICIAE WITH PEA PLANTS AS INFLUENCED BY AZOTOBACTER CHROOCOCCUM

    Directory of Open Access Journals (Sweden)

    Stefan Martyniuk

    2015-09-01

    Full Text Available The aim of this work was to examine the effects of A. chroococcum on the proliferation of R. leguminosarum bv. viciae (Rlv in a solid-carrier inoculant and on symbiotic effectiveness of Rlv with pea plants grown under laboratory and field conditions. In a laboratory experiment it was found that proliferation of both bacterial species, Rlv and A. chroococcum, in the dual-culture inoculants was efficient, and that A. chroococcum had no adverse effects on the development of the rhizobia (Rlv in the solid-carrier inoculant. In a pot experiment the highest number of nodules was detected on roots of pea plants inoculated with the dual-culture inoculant containing Rlv and A. chroococcum, slightly lower numbers on pea roots inoculated with the mono-culture inoculum of Rlv and almost no nodules were found on the roots of pea un-inoculated (control treatment with the bacteria. In the micro-plot experiment conducted in the years 2011–2012 pre-sowing inoculation of pea seeds with the mono-culture inoculant of Rlv or with the mixed inoculant of Rlv and A. chroococcum slightly increased nodule numbers/plant, pod numbers/plant and seed numbers/pod, as compared to the un-inoculated control, but these differences were not reflected in pea seed yields/m2, which were similar in all treatments.

  8. Negative leave balances

    CERN Multimedia

    Human Resources Department

    2005-01-01

    Members of the personnel entitled to annual leave and, where appropriate, saved leave and/or compensatory leave are requested to take note of the new arrangements described below, which were recommended by the Standing Concertation Committee (SCC) at its meeting on 1Â September 2005 and subsequently approved by the Director-General. The changes do not apply to members of the personnel participating in the Progressive Retirement Programme (PRP) or the Part-time Work as a pre-retirement measure, for whom the specific provisions communicated at the time of joining will continue to apply. Â Negative balances in annual leave, saved leave and/or compensatory leave accounts at the end of the leave year (30th September) and on the date on which bonuses are credited to the saved leave account (31st December): Where members of the personnel have a leave account with a negative balance on 30Â September and/or 31Â December, leave will automatically be transferred from one account to another on the relevant dates i...

  9. Negative leave balances

    CERN Multimedia

    Human Resources Department

    2005-01-01

    Members of the personnel entitled to annual leave and, where appropriate, saved leave and/or compensatory leave are requested to take note of the new arrangements described below, which were recommended by the Standing Concertation Committee (SCC) at its meeting on 1 September 2005 and subsequently approved by the Director-General. The changes do not apply to members of the personnel participating in the Progressive Retirement Programme (PRP) or the Part-time Work as a pre-retirement measure, for whom the specific provisions communicated at the time of joining will continue to apply.  Negative balances in annual leave, saved leave and/or compensatory leave accounts at the end of the leave year (30th September) and on the date on which bonuses are credited to the saved leave account (31st December): Where members of the personnel have a leave account with a negative balance on 30 September and/or 31 December, leave will automatically be transferred from one account to another on the relevant dates in or...

  10. The Temporary Leave Dilemma -

    DEFF Research Database (Denmark)

    Amilon, Anna

    2010-01-01

    Lone mothers have to take care of a sick child with little or no help from the child’s other parent and have to carry all costs connected to leave-taking. This paper empirically tests whether lone mothers take more temporary parental leave to care for sick children than partnered mothers...... and whether parental leave is associated with a signaling cost. The results from this study of Swedish mothers show that lone mothers use more temporary parental leave than partnered mothers. Further, within the group of lone mothers, those with higher socioeconomic status take less temporary parental leave...... than those with lower socioeconomic status, whereas no such differences are found within the group of partnered mothers. One possible interpretation is that signaling costs negatively influence the utilization of temporary parental leave for lone mothers....

  11. A putative amino acid transporter is specifically expressed in haustoria of the rust fungus Uromyces fabae.

    Science.gov (United States)

    Hahn, M; Neef, U; Struck, C; Göttfert, M; Mendgen, K

    1997-05-01

    A cDNA library constructed from haustoria of the rust fungus Uromyces fabae was screened for clones that are differentially expressed in haustoria. One family of cDNAs (in planta-induced gene 2 [PIG2] was isolated and found to encode a protein with high homologies to fungal amino acid transporters. A cDNA clone containing the complete coding region of PIG2 and the corresponding genomic clone were isolated and sequenced, revealing the presence of 17 introns in the PIG2 gene. Expression of PIG2 mRNA appeared to be restricted to haustoria. With antibodies raised against synthetic peptides, the PIG2-encoded protein was found in membranes fractions of isolated haustoria but not of germinated rust spores. With immunofluorescence microscopy, the putative amino acid transporter was localized to plasma membranes of the haustorial bodies, but not detected in the haustorial neck, haustorial mother cells, or intercellular fungal hyphae growing within infected leaf tissue. These data present for the first time molecular evidence that the rust haustorium plays a special role in the uptake of nutrients from an infected host cell.

  12. Systemic granulomatous disease in cattle in Rio Grande do Sul, Brazil, associated with grazing vetch (Vicia spp)

    OpenAIRE

    Barros, Claudio S.L.; Rafael A. Fighera; Daniela B. Rozza; Raquel R. Rech; Simone V. Sallis; Langohr, Ingeborg M.

    2001-01-01

    Dois surtos de uma doença associada ao pastoreio de duas espécies de ervilhaca (predominantemente Vicia villosa e, em menor grau, V. sativa) foram observados em agosto-setembro de 2001, em vacas Holandesas adultas de duas propriedades rurais do Rio Grande do Sul. Foram afetadas, em uma das propriedades, quatro de 42 vacas (9,5%) e, na outra, uma de oito vacas (12,5%). Os sinais clínicos incluíam, embora não em todos os casos, febre, prurido, espessamento e enrugamento da pele com placas multi...

  13. Effect of Egyptian cooking methods of faba beans on its nutritive value, dietary protein utilization and iron deficiency anemia. 1. The role of main technological pretreatments.

    Science.gov (United States)

    Bakr, A A

    1996-01-01

    In order to study the effects of main technological pretreatments practised for preparing Egyptian faba bean products, i.e. decortication as well as soaking and germination followed by dehulling on the nutritional value, series of experiments were carried out. Such pretreatments had a significant effect on the changes in the chemical composition of faba beans. The proportion of the removed hulls reached generally about 14%. Data revealed also pronounced improvements on the nutritive value as a result of all studied pretreatments, especially germination being the most effective. Chemical scoring of all determined essential amino acids was > 60, except methionine and cystine showed the lowest score (content.

  14. Effects of Wheat and Faba Bean Intercropping on Microorganism Involved in Nitrogen Transformation in the Rhizosphere Soils

    Directory of Open Access Journals (Sweden)

    TANG Yan-fen

    2016-09-01

    Full Text Available Soil microorganism is one of the key factors that affects soil ecological activity. It is an important symbol of soil health, and the soil nitrogen cycle is closely related to the microorganisms. The relationship between nitrogen and microorganisms under the intercropping is im-portant for the farmland ecosystem. In this paper, phospholipid fatty acids(PLFA analysis was used to determine soil microbial communi-ties, e.g., biomasses of anaerobic bacteria, aerobic bacteria, bacteria, fungi and actinobacteria. The abundance of nitrifying genes(AOB, AOA and three denitrifying genes (nirK, norB, nosZ were measured using real-time quantitative polymerase chain reaction. The enzymes, nitrate and ammonium concentrations were measured using conventional methods. The results showed that along with the growth period, the TPLFAs(total phospholipid fatty acids increased and the bacterias, fungus, actinomyces and aerobic bacterias significantly(P<0.05 dif-fered between intercropping and monoculture. The greater abundance of AOB than AOA and the variation range of 105~106 were observed in all samples. The gene copies of norB and nosZ were pronounced by intercropping in the rhizosphere of faba bean at elongation and heading stages, respectively. The abundance of nirK remarkably(P<0.05differed between intercropping and monoculture. In intercropping rhizo-sphere, the contents of NO3--N were lower than monoculture, while the NH4+-N contents were converse (P<0.05. Conclusively, wheat and fa-ba bean intercropping system could change rhizosphere microenvironment, and then the microbial community structure in the soils, which would facilitate the conservation and supplying of soil nitrogen and reduce the nitrogen loss and pollution under the intercropping conditions to some extent. This might be the nitrogen nutrition mechanism for the overyielding of wheat and faba bean intercropping system.

  15. Characterization of a developmentally regulated amino acid transporter (AAT1p) of the rust fungus Uromyces fabae

    OpenAIRE

    Struck, Christine; Ernst, Michael; Hahn, Matthias

    2002-01-01

    In the rust fungus Uromyces fabae, invasion of the host plant and haustorium formation are accompanied by the activation of many genes (PIGs = in planta induced genes). In addition to the previously described AAT2 (PIG2), AAT1 (PIG27) was found to encode a protein with a high similarity to fungal amino acid permeases. AAT1 transcripts are present in germinated hyphae and throughout the mycelium later in the infection process, but occur at the highest levels in haustoria. Expression of AAT1p i...

  16. Competitive nodulation blocking of cv. Afghanistan pea is related to high levels of nodulation factors made by some strains of Rhizobium leguminosarum bv. viciae

    NARCIS (Netherlands)

    Hogg, B.; Davies, A.E.; Wilson, K.E.; Bisseling, T.; Downie, J.A.

    2002-01-01

    Cultivar Afghanistan peas are resistant to nodulation by many strains of Rhizobium leguminosarum bv. viciae but are nodulated by strain TOM, which carries the host specificity gene nodX. Some strains that lack nodX can inhibit nodulation of cv. Afghanistan by strain TOM. We present evidence that

  17. potential antagonistic fungal species from ethiopia for biological ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Chocolate spot disease (Botrytis fabae Sard) is one of most yield limiting constraints of faba bean (Vicia faba). There is promise in using biological control agents to control chocolate spot diseases, nevertheless, this strategy has not been fully exploited. The objective of this study was to assess the prevalence of different ...

  18. Publications | Page 493 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4921 - 4930 of 6364 ... Estimation genetic variation in faba bean (Vicia faba L.) landraces in Yemen : a thesis (restricted access). The study investigates genetic variations between and within Yemeni faba bean landraces, estimates correlations and coefficients for the most important traits, and characterizes phenotypic ...

  19. Potential antagonistic fungal species from Ethiopia for biological ...

    African Journals Online (AJOL)

    Chocolate spot disease (Botrytis fabae Sard) is one of most yield limiting constraints of faba bean (Vicia faba). There is promise in using biological control agents to control chocolate spot diseas`es, nevertheless, this strategy has not been fully exploited. The objective of this study was to assess the prevalence of different ...

  20. East African Journal of Sciences - Vol 10, No 2 (2016)

    African Journals Online (AJOL)

    Efficacy of Pepper Tree (Schinus molle) Extracts to Suppress Growth of Botrytis fabae and Manage Chocolate Spot Severity on Faba Bean (Vicia faba) at Sinana, Bale Zone, Southeastern Ethiopia · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Addisu Tegegn, Meseret ...

  1. Author Details

    African Journals Online (AJOL)

    Egigu, Meseret Chimdessa. Vol 10, No 2 (2016) - Articles Efficacy of Pepper Tree (Schinus molle) Extracts to Suppress Growth of Botrytis fabae and Manage Chocolate Spot Severity on Faba Bean (Vicia faba) at Sinana, Bale Zone, Southeastern Ethiopia Abstract. ISSN: 1992-0407. AJOL African Journals Online. HOW TO ...

  2. Influence of partial replacement of soya bean meal by faba beans or peas in heavy pigs diet on meat quality, residual anti-nutritional factors and phytoestrogen content.

    Science.gov (United States)

    Gatta, Domenico; Russo, Claudia; Giuliotti, Lorella; Mannari, Claudio; Picciarelli, Piero; Lombardi, Lara; Giovannini, Luca; Ceccarelli, Nello; Mariotti, Lorenzo

    2013-06-01

    The study evaluated the partial substitution of soybean meal by faba beans (18%) or peas (20%) as additional protein sources in diets destined for typical Italian heavy pig production. It compared animal performances, meat quality, the presence of residual anti-nutritional factors (ANF) and phytoestrogens in plasma and meat and the possible effects on pig health, by evaluating oxidative, inflammatory and pro-atherogenic markers. The results showed that the productive performances, expressed as body weight and feed conversion ratio, of pigs fed with faba bean and pea diets were similar to those of pigs fed only the soybean meal. Meat quality of pigs fed with the three diets was similar in colour, water-holding capacity, tenderness and chemical composition. Despite the higher levels of phytoestrogen in the plasma of pigs fed only the soybean meal, phytoestrogen concentration in the muscle was equivalent to that of animals fed diets with faba beans, whereas pigs fed a diet with peas showed a lower concentration. Inflammation and pro-atherogenic parameters did not show significant differences among the three diets. Overall, the partial substitution of soybean meal by faba beans appears more interesting than with peas, particularly in relation to the higher amount of polyphenols in the diet and the highest concentration of phytoestrogens found in the plasma and muscle of animals, while the pyrimidine anti-nutritional compounds present in the diet did not appear to accumulate and had no effect on the growth performance of animals.

  3. In vitro evaluation of whole faba bean and its seed coat as a potential source of functional food components.

    Science.gov (United States)

    Çalışkantürk Karataş, Selen; Günay, Demet; Sayar, Sedat

    2017-09-01

    In vitro studies were conducted to evaluate the particular nutritional benefits of whole faba bean seed (WFB) and fava bean seed coat (FBSC). Total dietary fiber contents of WFB and FBSC were 27.5% and 82.3%, respectively. FBSC were contained much higher total phenolic substances, condensed tannins, and total antioxidant activity than WFB. Bile acid (BA)-binding capacities of in vitro digested samples and nutritionally important products produced by in vitro fermentation of digestion residues were also studied. The BA-binding capacities of WFB and FBSC were 1.94 and 37.50μmol/100mg, respectively. Total BA bound by FBSC was even higher than the positive standard cholestyramine. Lignin and other constituents of the Klason residue were found to influence BA-binding properties. Moreover, the extent of the in vitro fermentation process showed that, fermentability of FBSC residue was significantly lower than that of WFB residue. Overall, faba bean, especially its seed coat, has great potential as a functional food. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Fermentation of rapeseed meal, sunflower meal and faba beans in combination with wheat bran increases solubility of protein and phosphorus.

    Science.gov (United States)

    Poulsen, Hanne Damgaard; Blaabjerg, Karoline

    2017-01-01

    To increase self-supply of protein and phosphorus (P) in European pig and poultry diets and reduce nitrogen (N) and P excretion, attention is directed to approaches increasing protein and P digestibility of rapeseed, sunflower and faba beans. Wheat bran is rich in enzymes degrading and solubilizing protein and phytate. Herein, solubilization of protein, N and P was investigated when increasing ratios of wheat bran were fermented with rapeseed meal (RSM), sunflower meal (SFM), faba beans (FB) or a combination of these (RSM/SFM/FB). Protein, N and P solubility was greater, for all mixtures, the more wheat bran was included and the longer the mixtures were fermented. The increase in N (FB > RSM/SFM/FB > SFM > RSM) and protein solubility (RSM/SFM/FB > RSM > SFM > FB) was greatest from day 0 to day 3 and thereafter limited, whereas P solubility increased during the whole period (5 days; FB > RSM/SFM/FB > SFM > RSM). In general, FB showed the highest solubility and highest increase in N and P solubility, while RSM showed the highest protein solubility and RSM/SFM/FB the highest increase in protein solubility. Fermentation of RSM, SFM, FB and RSM/SFM/FB without or with wheat bran uncovers a potential for increased protein and P digestibility and thereby reduced N and P excretion from pigs and poultry. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  5. [Effect of the same amount of faba bean fresh straw returning with different ratios of chemi- cal fertilizer on single cropping late rice].

    Science.gov (United States)

    Wang, Jian-hong; Zhang, Xian; Cao, Kai; Hua, Jin-wei

    2015-05-01

    A field experiment was conducted on paddy soil derived from alluvial materials at Bihu Town, Lishui City, Zhejiang Province, China to explore the effects of combined application of faba bean fresh straw and different-rate chemical fertilizer on nutrient uptake, nutrient use efficiencies, and yields of single cropping late rice and to determine the optimal rate of chemical fertilizer under the condition of application of faba bean fresh straw at the rate of 15 t · hm(-2) (GM15) in 2012, April to December. The experiments consisted of 7 treatments: CK (no fertilizers) , CF (conventional chemical fertilizer rate) , and combined application of 15 t · hm(-2) of faba bean fresh straw and 0%, 20%, 40%, 60% and 80% of the conventional chemical fertilizer rate. The results showed that the highest total uptake amounts of N, P and K by the aboveground part were obtained from the treatments of GM15 + 60%CF and GM15 + 80% CF, but the highest nutrient agronomy use efficiencies of N, P and K in rice grains were obtained from the treatments of GM15 + 60% CF and GM15 + 40% CF. The agronomy use efficiencies and physiological use efficiencies of N, P, and K were significantly correlated with rice grain yields, thus they could be used for accurate comprehensive evaluation of fertilizer efficiencies of N, P, and K. Compared with no fertilizer treatment, the treatments of 100% CF and combined application of faba bean fresh straw and different-rate chemical fertilizer increased rice gain yields by 25.0% and 6.1%-29.2%, respectively. In the cropping system of faba bean-single cropping late rice, returning of 15 t · hm2 faba bean fresh straw to the paddy field did not result in the runt seedling of rice. From the point of improving fertilizer use efficiency and reducing environmental risk perspective, the optimum rate of chemical fertilizer was 60% of the conventional chemical fertilizer rate when 15 t · h(-2) of faba bean fresh straw was applied.

  6. Granulomatous myelitis associated with hemorrhagic syndrome due to consumption of Vicia villosa by cattle Mielite granulomatosa associada à síndrome hemorrágica devido ao consumo de Vicia villosa em um bovino

    Directory of Open Access Journals (Sweden)

    Luciana Sonne

    2010-08-01

    Full Text Available An unusual case of spontaneous Vicia villosa poisoning affected a 6-year-old Holstein cow. Although the most striking findings included a generalized hemorrhagic condition associated with granulomatous myelitis, histological lesions typically seen with the vetch-associated systemic granulomatous syndrome were also present. Prominent gross findings were bloody nasal and oral discharges, disseminated hemorrhages, and bloody feces. Generalized hemorrhages associated with infiltration of numerous organs by lymphocytes, plasma cells, macrophages, multinucleated giants cells, and eosinophils were the main microscopic findings. Anti-CD68 immunostaining confirmed the presence of moderate histiocytic infiltrate and multinucleated giant cells in the bone marrow. These changes in the bone marrow probably caused the generalized hemorrhagic changes described here.Um bovino Holandês de seis anos naturalmente intoxicado pela Vicia villosa apresentou lesões não comumente encontradas nessa intoxicação. Embora a lesão mais evidente fosse hemorragia generalizada associada à mielite granulomatosa, as lesões granulomatosas típicas da intoxicação pela ervilhaca também estavam presentes histologicamente. Os principais achados macroscópicos foram hemorragias nasal e oral, hemorragias generalizadas e fezes com sangue. Lesões hemorrágicas generalizadas associadas com infiltrado inflamatório de linfócitos, plasmócitos, macrófagos, células gigantes multinucleadas e eosinófilos foram os principais achados microscópicos encontrados. O teste imuno-histoquímico anti-CD68 confirmou a presença de infiltrado moderado de macrófagos e de células gigantes multinucleadas na medula óssea. As alterações na medula óssea provavelmente constituem a causa da hemorragia generalizada descrita nesse caso.

  7. Ecogeographic variability and genetic diversity associated with seed albumins, globulins and prolamins patterns in Vicia taxa from Algeria.

    Science.gov (United States)

    Bechkri, Sakina; Medoukali, Imane; Khelifi, Douadi

    2017-12-01

    Genetic variability was studied in 78 populations of locally collected Vicia L. taxa for seed albumins, globulins and prolamins patterns by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) along with an ecogeographic characterization of sites investigated. 131, 119 and 98 bands were respectively used for albumin, globulin and prolamin cluster analysis. Dendrograms based on the Jaccard index and the UPGMA method were generated and the degree of genetic diversity between and within taxa was evaluated. Five clusters were generated from albumins, six from globulins and four from prolamins patterns. The results reflect the great diversity of storage proteins and a high correlation was obtained between the three studied fractions. Several accessions present specific bands which could be used as a discriminatory marker both on intra and interspecific levels. No clear relationships were seen between the groups according to their geographical origin. Data obtained from ecogeographic investigation can be used for future collecting missions.

  8. Impact of bee pollinators on seed set and yield of Vicia villosa spp. dasycarpa (Leguminosae grown under semiarid conditions

    Directory of Open Access Journals (Sweden)

    Shahera Zaitoun

    2010-01-01

    Full Text Available A field experiment was conducted during 2005/2006 at Jordan University of Science and Technology campus (32°30” N, 35°59” E, Irbid, Jordan, to study the role of bee visitors on seed set and production of Vicia villosa spp. dasycarpa grown under semiarid conditions. Two treatments were imposed on Vicia villosa plants before flowering: 1 Plants were covered in cages (control or 2 Plants were left uncovered to permit bee visiting. The results of this experiment showed that V. villosa flowers were very attractive to worker honeybees as well as to few numbers of wild bees. The most frequent visitor species were A. mellifera and Anthophora albigena of family Apidae. V. villosa flowers attracted most of the bee visitors in the early hours of the day. The duration of their visit on the flowers also peaked early in the day and decreased toward the end of the day. The percentage of pod set of the un-covered plants averaged 14% out of the total florets on the plants, which was significantly higher than the covered plants (2%. These results indicated that the percentage of flower abscission was high and averaged more than 86%. Plant covering significantly reduced seed yield by reducing seed and pod number per plant and seed number per pod, but had no effect on individual seed weight. In conclusion, preventing bees from visiting during flowering of V. villosa spp. dasycarpa decreased seed set, seed yield and yield components. Further studies are needed to understand the high flower abscission and failure of seed set in this species.

  9. TRAVEL AND HOME LEAVE

    CERN Multimedia

    Human Resources Division

    2002-01-01

    Administrative procedures for : Travel to the home station and home leave (hl) Additional travel to the home station (at) Travel to the home station and home leave for family reasons (hlf) As part of the process of simplifying administrative procedures, HR and AS Divisions have devised a new, virtually automatic procedure for payment of travel expenses to the home station. The changes are aimed at rationalising administrative procedures and not at reducing benefits. The conditions of eligibility are unchanged. The new procedure, which will be operational with effect from 1st June 2002, will greatly simplify the administrative processing of claims for travel expenses and the recording of home leaves. Currently, requests for payment are introduced manually into the Advances and Claims system (AVCL) by divisional secretariats. All travel to the home station starting prior to 1st June 2002 will be processed according to the existing system whereas that starting on 1st June and after will be processed accordi...

  10. Aerosol deposition on plant leaves

    Science.gov (United States)

    James B. Wedding; Roger W. Carlson; James J. Stukel; Fakhri A. Bazzaz

    1976-01-01

    An aerosol generator and wind tunnel system designed for use in aerosol deposition is described. Gross deposition on rough pubescent leaves was nearly 7 times greater than on smooth, waxy leaves. Results suggest that aerosol deposition, on a per unit area basis, for single horizontal streamlining leaves is similar to that for arrays of leaves under similar flow...

  11. Leaves: Nature's Solar Collectors

    Science.gov (United States)

    Isabelle, Aaron D.; de Groot, Cornelis

    2009-01-01

    One of the most captivating things about plants is the way they capture the Sun's energy, but this can be a difficult topic to cover with elementary students. Therefore, to help students to make a concrete connection to this abstract concept, this series of solar-energy lessons focuses on leaves and how they act as "solar collectors." As students…

  12. Does Leave Work?

    NARCIS (Netherlands)

    Heleen van Luijn; Saskia Keuzenkamp

    2004-01-01

    More and more people have to combine work and care responsibilities, and work part-time or use daycare and after-school care facilities to help them do so. The Work and Care Act, which came into force on 1 December 2001, combined all the existing schemes - such as parental and maternity leave -

  13. REMINDER: Saved Leave Scheme (SLS)

    CERN Multimedia

    2003-01-01

    Transfer of leave to saved leave accounts Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'* annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No 22B) can be transferred to the saved leave account at the end of the leave year (30 September). We remind you that unused leave of all those taking part in the saved leave scheme at the closure of the leave year accounts is transferred automatically to the saved leave account on that date. Therefore, staff members have no administrative steps to take. In addition, the transfer, which eliminates the risk of omitting to request leave transfers and rules out calculation errors in transfer requests, will be clearly shown in the list of leave transactions that can be consulted in EDH from October 2003 onwards. Furthermore, this automatic leave transfer optimizes staff members' chances of benefiting from a saved leave bonus provided that they ar...

  14. VsENOD5, VsENOD12 and VsENOD40 expression during Rhizobium-induced nodule formation on Vicia sativa roots

    DEFF Research Database (Denmark)

    Vijn, I; Yang, W C; Pallisgård, N

    1995-01-01

    We isolated ENOD5, ENOD12 and ENOD40 homologues from Vicia sativa and studied their expression pattern during Rhizobium-induced nodule formation. Comparison of the VsENOD40 nucleotide sequence with the pea, soybean and alfalfa ENOD40 sequences showed that the sequences contain two conserved regions...... the expression pattern of VsENOD5, VsENOD12 and VsENOD40 during Rhizobium-induced nodule formation. Although the expression of these genes is largely similar to that of the pea counterparts, differences where found for the expression of VsENOD12 and VsENOD40 in Vicia. VsENOD12 is expressed in the whole...

  15. High-quality permanent draft genome sequence of Rhizobium leguminosarum bv. viciae strain GB30; an effective microsymbiont of Pisum sativum growing in Poland.

    Science.gov (United States)

    Mazur, Andrzej; De Meyer, Sofie E; Tian, Rui; Wielbo, Jerzy; Zebracki, Kamil; Seshadri, Rekha; Reddy, Tbk; Markowitz, Victor; Ivanova, Natalia N; Pati, Amrita; Woyke, Tanja; Kyrpides, Nikos C; Reeve, Wayne

    2015-01-01

    Rhizobium leguminosarum bv. viciae GB30 is an aerobic, motile, Gram-negative, non-spore-forming rod that can exist as a soil saprophyte or as a legume microsymbiont of Pisum sativum. GB30 was isolated in Poland from a nodule recovered from the roots of Pisum sativum growing at Janow. GB30 is also an effective microsymbiont of the annual forage legumes vetch and pea. Here we describe the features of R. leguminosarum bv. viciae strain GB30, together with sequence and annotation. The 7,468,464 bp high-quality permanent draft genome is arranged in 78 scaffolds of 78 contigs containing 7,227 protein-coding genes and 75 RNA-only encoding genes, and is part of the GEBA-RNB project proposal.

  16. Effect on Some Characteristics of M2 Generation of Three Hungarian Vetch (Vicia pannonica Crantz.) The Application of Different Doses of Gamma Irradiation

    OpenAIRE

    BAĞCI, Muhittin; Mutlu, Hüseyin

    2014-01-01

    This study covers M2 generation of the mutation breeding Project with practice of gamma irradiation on Hungarian vetch (Vicia pannonica Crantz.). The study was counducted, with the purpose of determine and contrast control dose have effects on some properties of vegetational. In the study, M1 plant seeds of three Hungarian vetch cultivars (Tarmbeyazı-98, Anadolupembesi-2002 and Oğuz-2002) were planted. It was examined that morphological, biological and agricultural characteristics obtained M2...

  17. The prevalence of sick leave

    DEFF Research Database (Denmark)

    Backhausen, Mette; Damm, Peter; Bendix, Jane

    2018-01-01

    Objective We aimed to investigate the prevalence of sick leave and self-reported reasons given for sick leave during pregnancy. Furthermore, we aimed to estimate the frequency of long-term sick leave during pregnancy in relation to pre-baseline maternal characteristics and to identify predictors...... on sick leave and the associated reasons. Descriptive statistics and logistic regression analysis were applied. Results The prevalence of sick leave was 56% of employed pregnant women in the first 32 weeks of gestation and more than one in four reported long-term sick leave (>20 days, continuous...... was a negative predictor. Conclusions The prevalence of sick leave was 56% in the first 32 weeks of gestation and more than one in four women reported long-term sick leave. The majority of reasons for sick leave were pregnancy-related and low back pain was the most frequently given reason....

  18. Effects of plant based organic fertilizer (faba bean meal) compared to farmyard manure on yield and quality of potatoes and soil organic matter levels

    OpenAIRE

    Raupp, Dr Joachim; Oltmanns, Meike

    2006-01-01

    Whereas the positive effects of farmyard manure on soil biological properties have been shown in several long-term experiments, no comparable information was available for plant based organic fertilizers. Since 1996 such materials were applied with the same amount of total nitrogen as farmyard manure (100 (kg ha-1) on a poor sandy soil. In 2005 it was found that faba bean meal application caused the same potato yield, and tubers with the same phosphorus content, but lower potassium and sligh...

  19. A comparative study of nutrients utilization, alkaline phosphatase activity and creatinine concentration in the serum of sheep and goats fed diets based on olive leaves.

    Science.gov (United States)

    Yáñez-Ruiz, D R; Molina-Alcaide, E

    2008-04-01

    The aim of this study was to compare, in goats and wethers, the nutritive utilization of diets including olive leaves (OL) and the possible detrimental effect of that by-product. Three different diets were studied: OL, OL plus polyethylene glycol (PEG) (OLP) and OL supplemented with barley [164 g/kg dry matter (DM)] and faba beans (59 g/kg DM) (OLSUP). Apparent digestibility of nutrients and energy and nitrogen balances were determined along with creatinine concentrations and alkaline phosphatase (ALP) activity in the serum. The apparent digestibility of OL was low and similar in goats and wethers (54.4% and 53.5%, 22.2% and 21.6% and, 47.7% and 46.6% for DM, crude protein and neutral detergent fibre in goats and wethers, respectively). The addition of PEG did not improve (p > 0.05) digestibility of OL, although a slightly beneficial effect on the digestion of structural carbohydrates was observed (up to 8.4% and 7.10% in goats and wethers, respectively). The supplementation of OL with barley and faba beans increased (p value. The consumption of the OL led to high ALP activity in the serum. Despite the higher sensitivity of wethers to Cu levels, our results show a similar digestive use of OL by wethers and goats and suggest the need of further comparative investigations focusing on the effect of the presence of high Cu levels in the by-product on the animal health.

  20. [Poisoning with oleander leaves].

    Science.gov (United States)

    Romano, G A; Mombelli, G

    1990-04-21

    After ingestion of seven leaves of oleander (Nerium oleander) in a suicide attempt, a 37-year-old woman was admitted to hospital with symptoms of digitalis intoxication. The serum digoxin level on arrival was 5.69 nmol/l. The course was uneventful. The usefulness of digoxin radioimmunoassay to demonstrate poisoning with oleander (but not to predict the degree of toxicity) and the potential use of digoxin-specific Fab-antibody fragments in this situation are discussed.

  1. Stomata prioritize their responses to multiple biotic and abiotic signal inputs.

    Directory of Open Access Journals (Sweden)

    Xiaobin Ou

    Full Text Available Stomata are microscopic pores in leaf epidermis that regulate gas exchange between plants and the environment. Being natural openings on the leaf surface, stomata also serve as ports for the invasion of foliar pathogenic bacteria. Each stomatal pore is enclosed by a pair of guard cells that are able to sense a wide spectrum of biotic and abiotic stresses and respond by precisely adjusting the pore width. However, it is not clear whether stomatal responses to simultaneously imposed biotic and abiotic signals are mutually dependent on each other. Here we show that a genetically engineered Escherichia coli strain DH5α could trigger stomatal closure in Vicia faba, an innate immune response that might depend on NADPH oxidase-mediated ROS burst. DH5α-induced stomatal closure could be abolished or disguised under certain environmental conditions like low [CO2], darkness, and drought, etc. Foliar spraying of high concentrations of ABA could reduce stomatal aperture in high humidity-treated faba bean plants. Consistently, the aggressive multiplication of DH5α bacteria in Vicia faba leaves under high humidity could be alleviated by exogenous application of ABA. Our data suggest that a successful colonization of bacteria on the leaf surface is correlated with stomatal aperture regulation by a specific set of environmental factors.

  2. REMINDER Saved Leave Scheme (SLS) : Transfer of leave to saved leave accounts

    CERN Multimedia

    HR Division

    2002-01-01

    Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'*) annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No. 22B) can be transferred to the saved leave account at the end of the leave year (30 September). We remind you that, since last year, unused leave of all those taking part in the saved leave scheme at the closure of the leave-year accounts is transferred automatically to the saved leave account on that date. Therefore, staff members have no administrative steps to take. In addition, the transfer, which eliminates the risk of omitting to request leave transfers and rules out calculation errors in transfer requests, will be clearly shown in the list of leave transactions that can be consulted in EDH from October 2002 onwards. Furthermore, this automatic leave transfer optimizes staff members' chances of benefiting from a saved leave bonus provided that they are still participants in the schem...

  3. Saved Leave Scheme (SLS) : Simplified procedure for the transfer of leave to saved leave accounts

    CERN Multimedia

    HR Division

    2001-01-01

    As part of the process of streamlining procedures, the HR and AS Divisions have jointly developed a system whereby annual and compensatory leave will henceforth be automatically transferred1) to saved leave accounts. Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'2) annual and compensatory leave (excluding saved leave accumulated in accordance with the provisions of Administrative Circular No. 22 B) can be transferred to the saved leave account at the end of the leave year (30 September). Previously, every person taking part in the scheme has been individually issued with a form for the purposes of requesting the transfer of leave to the leave account and the transfer has then had to be done manually by HR Division. To streamline the procedure, unused leave of all those taking part in the saved leave scheme at the closure of of the leave-year accounts will henceforth be transferred automatically to the saved leave account on that date. This simplification is in the ...

  4. Sabbatical Leaves in Higher Education.

    Science.gov (United States)

    Eberle, August W.; Thompson, Robert E.

    This document presents a status report of various sabbatical leave policies and plans at 386 higher education institutions across the U.S. The report provides information that can serve as a guide for institutions that do not presently provide sabbatical leaves of absence or that can be compared with existing sabbatical leave plans. It was found…

  5. Characterization of the nutritional value of air-classified protein and starch fractions of field pea and zero-tannin faba bean in grower pigs.

    Science.gov (United States)

    Gunawardena, C K; Zijlstra, R T; Beltranena, E

    2010-02-01

    Most pulse (nonoilseed legume) seed flours can be fractionated rapidly and economically by air classification into protein and starch concentrates. The nutritional value of air-classified field pea and faba bean concentrates requires characterization to assess the feeding opportunity for pigs. Thus, the objectives were to characterize the apparent total tract digestibility (ATTD) of DM, OM, energy, starch, CP, fat, and ash; apparent ileal digestibility of CP and starch; standardized ileal digestibility (SID) of AA; and the SID AA, DE, and NE content of air-classified zero-tannin faba bean and field pea protein and starch concentrates in grower pigs. Pulse protein and starch concentrates were compared with soy protein concentrate and corn starch, respectively, as corresponding standards. The corn starch diet served as an N-free diet to correct for basal endogenous AA losses. In a Youden square design, 8 ileal-cannulated barrows (24.9 +/- 2.3 kg of BW) were fed 6 diets over 7 periods at 3 times the maintenance DE requirement. Periods encompassed a 5-d diet acclimation, 3-d feces collection, and 3-d ileal digesta collection. The ATTD of GE was 2% greater (P bean than soy and was intermediate for field pea protein (95.6, 93.7, and 94.9%, respectively). The ATTD of GE was 3.6% greater (P bean starch (96.2, 95.1, and 92.3%, respectively). The DE content of faba bean was 5.0% greater (P content of faba bean and field pea was 1.7% greater (P content was 5% greater (P bean than field pea and soy protein (3.08, 2.94, and 2.92 Mcal/kg, respectively). The NE content for field pea starch was 2.0% greater (P bean starch (2.68, 2.63, and 2.61 Mcal/kg, respectively). Protein concentrates had a 14 and 11% greater (P content, respectively, than starch concentrates. The SID of Lys was 6.0% greater (P bean and field pea protein than soy protein (95.5, 92.6, and 88.7%, respectively). The SID of Lys was 6.0% greater (P bean than field pea starch. Nutrient digestibility and digestible

  6. Estimation of the effect of radionuclide contamination on Vicia sativa L. induction of chlorophyll fluorescence parameters using "Floratest" optical biosensor

    Science.gov (United States)

    Ruban, Yu.; Illienko, V.; Nesterova, N.; Pareniuk, O.; Shavanova, K.

    2017-12-01

    The presented research was aimed to determine the parameters of chlorophyll fluorescence (IChH) curve induction for Vicia sativa L. that were grown on radionuclide contaminated soils by using "Floratest" fluorometer. Plants were inoculated with 5 species of bacteria that might potentially block radionuclide uptake (Agrobacterium radiobacter IMBB-7246, Azotobacter chroococcum UKMB-6082, A. chroococcum UKMB-6003, Bacillus megaterium UKMB-5724, Rhizobium leguminosarum bv. viceae) and grown in sod-podzolic, chernozem and peat-bog soils, contaminated with 137Cs (4000±340 Bq/kg). As a result of research, it was determined that the most stressful factors for vetch plants are combination of soil radionuclide and presence of Bacillus megaterium UKM B-5724, as the number of inactive chlorophyll increased. In addition, the vetch plants significantly increased fixed level of fluorescence (Fst) under the influence of radioactive contamination in presence of Bacillus megaterium UKM B-5724, indicating inhibition of photosynthetic reactions. Other bacteria showed radioprotective properties in almost all types of soil.

  7. Detection of common vetch (Vicia sativa L.) in Lentil (Lens culinaris L.) using unique chemical fingerprint markers.

    Science.gov (United States)

    Thavarajah, Pushparajah; Thavarajah, Dil; Premakumara, G A S; Vandenberg, Albert

    2012-12-15

    Detection of adulteration of split red lentil (Lens culinaris L.) seeds with low level addition of split common vetch (Vicia sativa L.) is hampered by a lack of reliable detection methods. An analytical method was developed using high performance liquid chromatography with diode array detection (HPLC-DAD) based on two unique chemical markers found in common vetch: ß-cyanoalanine (BCA) and γ-glutamyl-ß-cyanoalanine (GCA). These two markers were present in samples of common vetch seed grown in Canada and Serbia. Authentic lentil samples grown in Canada, Australia, USA, Turkey, Syria, and Morocco had no detectable levels of these chemical markers. Commercial lentil samples for export from lentil processing plants in Saskatchewan, Canada, also had no detectable levels of GCA and BCA. The presence of vetch in intentionally adulterated lentil samples could be determined via chemical markers with a detection limit of 5% (w/w). The proposed method is a simple sample extraction and rapid HPLC analysis that could be widely used to detect intentional adulteration of lentils with common vetch. Copyright © 2012 Elsevier Ltd. All rights reserved.

  8. A note on the earliest distribution, cultivation and genetic changes in bitter vetch (Vicia ervilia in ancient Europe

    Directory of Open Access Journals (Sweden)

    Mikić Aleksandar

    2015-01-01

    Full Text Available Bitter vetch (Vicia ervilia (L. Willd. was a part of the everyday diet of the Eurasian Neanderthal population and the modern human Palaeolithic hunter-gatherers at the end of the last Ice Age. The major criteria to determine the domestication in bitter vetch and other ancient grain legumes are non-dehiscent pods, larger seed size and smooth seed testa. Bitter vetch seeds were found among the earliest findings of cultivated crops at the site of Tell El-Kerkh, Syria, from 10th millennium BP. Along with cereals, pea and lentil, bitter vetch has become definitely associated with the start of the 'agricultural revolution' in the Old World. Bitter vetch entered Europe in its south-east regions and progressed into its interior via Danube. Its distribution was rapid, since the available evidence reveals its presence in remote places at similar periods. Recently the first success has been obtained in the extraction of ancient DNA from charred bitter vetch seeds. The linguistic evidence supports the fact that most of Eurasian peoples have their own words denoting bitter vetch, meaning that its cultivation preceded the diversification of their own proto-languages. [Projekat Ministarstva nauke Republike Srbije, br. TR-31024 i br. 173005

  9. Inhibition of raffinose family oligosaccharides and galactosyl pinitols breakdown delays germination of winter vetch (Vicia villosa Roth. seeds

    Directory of Open Access Journals (Sweden)

    Lesław B. Lahuta

    2011-01-01

    Full Text Available Beside RFOs, which are commonly present in legume seeds, seeds of some species contain galactosyl pinitols (GPs. These carbohydrates, like RFOs, have been hypothesized to constitute an important energy and carbon skeletal source during germination. To test this hypothesis we have applied a specific α-galactosidase inhibitor (1-deoxygalactonojirimycin, DGJ to germinating winter vetch (Vicia villosa Roth. seeds, containing more galactosyl pinitols than RFOs. The breakdown of RFOs but not that of GPs was completely blocked in both embryonic axes and cotyledons tissues, during the first 18 h of imbibition in DGJ. The inhibitor only decreased the rate of GPs degradation. The inhibitory effect of DGJ on GPs degradation was partially alleviated by addition of sucrose or galactose to DGJ solutions. After three days of germination in water, RFOs and GPs disappeared in axial tissues of seeds imbibed in water, galactose or sucrose. Eighteen-hour imbibition of seeds in DGJ drastically reduced germination, by ca 50%, during the first three days. The inhibitory effect of DGJ decreased during the next seven days of germination. The presence of galactose or sucrose in imbibition solution initially stimulated seed germination, but later this effect was not statistically significant. Our study provides clear evidence that galactosyl pinitols play an important role in early winter vetch seeds germination. Additionally, we suggest that galactosyl pinitols can replace RFOs as reserve material necessary for early germination.

  10. Characterisation of SalRAB a salicylic acid inducible positively regulated efflux system of Rhizobium leguminosarum bv viciae 3841.

    Directory of Open Access Journals (Sweden)

    Adrian J Tett

    Full Text Available Salicylic acid is an important signalling molecule in plant-microbe defence and symbiosis. We analysed the transcriptional responses of the nitrogen fixing plant symbiont, Rhizobium leguminosarum bv viciae 3841 to salicylic acid. Two MFS-type multicomponent efflux systems were induced in response to salicylic acid, rmrAB and the hitherto undescribed system salRAB. Based on sequence similarity salA and salB encode a membrane fusion and inner membrane protein respectively. salAB are positively regulated by the LysR regulator SalR. Disruption of salA significantly increased the sensitivity of the mutant to salicylic acid, while disruption of rmrA did not. A salA/rmrA double mutation did not have increased sensitivity relative to the salA mutant. Pea plants nodulated by salA or rmrA strains did not have altered nodule number or nitrogen fixation rates, consistent with weak expression of salA in the rhizosphere and in nodule bacteria. However, BLAST analysis revealed seventeen putative efflux systems in Rlv3841 and several of these were highly differentially expressed during rhizosphere colonisation, host infection and bacteroid differentiation. This suggests they have an integral role in symbiosis with host plants.

  11. Cd-induced oxidative stress and lignification in the roots of two Vicia sativa L. varieties with different Cd tolerances.

    Science.gov (United States)

    Rui, Haiyun; Chen, Chen; Zhang, Xingxing; Shen, Zhenguo; Zhang, Fenqin

    2016-01-15

    We examined the effects of Cd on growth, lipid peroxidation, reactive oxygen species (ROS) accumulation, antioxidant enzymatic activity, and lignin content in the roots of two varieties of Vicia sativa. Treatment with Cd decreased plant growth and increased ROS and lipid peroxidation levels to a greater extent in the Cd-sensitive variety ZM than in the Cd-tolerant variety L3. Most hydrogen peroxide (H2O2) and superoxide anion (O2(•-)) were accumulated in the cell walls and extracellular spaces in response to Cd treatments. Chemical assays and experiments using inhibitors showed that larger increases in H2O2 and O2(•-) production in ZM than in L3 were probably attributed to elevated Cd-induced nicotinamide adenine dinucleotide-peroxidase (NADH-POD) activity. Cd treatment increased the accumulation of lignin and the guaiacol peroxidase (GPOD) activities in the apoplast more significantly in ZM root than in L3. Howerver, root laccase activity was higher in L3 than in ZM. Thus Cd toxicity induced significant lignification in the roots of V. sativa, and increases in H2O2 accumulation and apoplastic GPOD activity were likely responsible for this effect. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Characterization of a developmentally regulated amino acid transporter (AAT1p) of the rust fungus Uromyces fabae.

    Science.gov (United States)

    Struck, Christine; Ernst, Michael; Hahn, Matthias

    2002-01-01

    summary In the rust fungus Uromyces fabae, invasion of the host plant and haustorium formation are accompanied by the activation of many genes (PIGs =in planta induced genes). In addition to the previously described AAT2 (PIG2), AAT1 (PIG27) was found to encode a protein with a high similarity to fungal amino acid permeases. AAT1 transcripts are present in germinated hyphae and throughout the mycelium later in the infection process, but occur at the highest levels in haustoria. Expression of AAT1p in a histidine uptake-defective yeast mutant revealed energy-dependent transport of (14)C-histidine, with a K(M) value of 25.8 microm. In addition, complementation analysis revealed AAT1-dependent transport for lysine. Using Xenopus oocytes as expression system, AAT1p-dependent symport of protons with a broad spectrum of amino acids was observed, with the highest activities obtained with histidine and lysine. These results confirm that in rust fungi, the expression of amino acid transporters is developmentally regulated and occurs preferentially in the parasitic phase of development.

  13. Lesões de pele em bovinos com doença granulomatosa sistêmica associada ao pastoreio de ervilhaca (Vicia spp. Skin lesions in cattle with systemic granulomatous disease associated to pasturing vetch (Vicia spp.

    Directory of Open Access Journals (Sweden)

    Rafael Almeida Fighera

    2005-04-01

    Full Text Available Descrevem-se as lesões cutâneas macroscópicas em 10 e histológicas em 8 vacas afetadas por doença granulomatosa sistêmica associada ao pastoreio de ervilhaca (Vicia spp.. Em todos os casos, as lesões cutâneas eram caracterizadas por múltiplas áreas coalescentes de alopecia, liquenificação e descamação. Os locais mais atingidos pela lesão de pele foram: cabeça e pescoço (10/10, tronco (4/10, períneo (3/10 e mama (2/10. Em todos os 8 casos avaliados histologicamente, as lesões se caracterizavam por dermatite perivascular superficial granulomatosa de intensidade variável. Outros achados histológicos incluíram dermatite perivascular profunda (1/8, perifoliculite (2/8, foliculite mural (3/8, hiperqueratose ortoqueratótica compacta (6/8, erosões (1/8, úlceras (2/8, microabscessos de Munro (8/8, crostas serocelulares (1/8, espongiose (4/8, degeneração hidrópica (5/8, acantólise (1/8, corpúsculos de Civatte (2/8, exocitose linfoplasmocitária (6/8, edema superficial (6/8, incontinência pigmentar (2/8, basofilia (6/8 e mineralização distrófica do colágeno (2/8, tumefação do núcleo das células endoteliais (8/8 e ectasia de glândulas sudoríparas (8/8.Gross and histopathological lesions in the skin of respectively 10 and 8 cows affected with systemic granulomatous disease associated with pasturing vetch (Vicia spp. are described. In all cases, the cutaneous lesions were characterized by multiple coalescent areas of alopecia, lichenification and desquamation. More frequently affected sites were the skin covering the head and neck (10/10, trunk (4/10, escutcheon (3/10 and mammary gland (2/10. In all 8 histologically examined cases the lesions were characterized by superficial perivascular granulomatous dermatitis of varying intensity. Other histological findings included deep perivascular dermatitis (1/8, perifoliculitis (2/8, mural foliculitis (3/8, compact orthokeratotic hyperkeratosis (6/8, erosions (1/8, ulcers (2

  14. [Effect of post-treatment with dry extract from vicia truncatula on NADPH-GSH dependent system of rat liver during chronic alcohol intoxication].

    Science.gov (United States)

    Dorkina, E G

    2010-04-01

    Experiments on white female rats showed that chronic ethanol consumption leads to activation of the NADPH - GSH dependent system of the liver, which provides protection against ethanol-induced oxidative stress. Post-treatment administration of dry extract from Vicia truncatula Fish ex Bieb. (300 mg/kg body weight) on the background of 40% ethanol increased this adaptive reaction without depletion in the system, in contrast to what was observed in rats treated with carsil. These results suggest a significant hepatoprotective effect of the dry extract during the chronic alcohol-induced injury of the liver.

  15. Leave and professional development benefits

    National Research Council Canada - National Science Library

    Martyniak, Cathleen; Keith, Brian

    2009-01-01

    ...; and professional development leaves such as dedicated research time and sabbaticals. Other professional development topics include financial support and relief from duties for conference attendance...

  16. Verteerbaarheid en voederwaarde van eiwitrijke grondstoffen bij biologische biggen = Digestibility and nutritive value of protein-rich raw materials in organically housed piglets

    NARCIS (Netherlands)

    Peet-Schwering, van der C.M.C.; Binnendijk, G.P.; Diepen, van J.T.M.

    2011-01-01

    At the Experimental Farm Raalte, the nutrient composition, digestibiltiy and energy value of canola protein concentrate, pea protein concentrate, wheat gluten meal and vicia faba protein concentrate were investigated in organically housed piglets. The results are described in this report.

  17. A comparison of different legume seeds as protein supplement to optimise the use of low quality forages by ruminants

    DEFF Research Database (Denmark)

    Yánez-Ruiz, David R; Martin-Garcia, Antonio I; Weisbjerg, Martin Riis

    2009-01-01

    The potential of different legume seeds species, including recently new developed varieties (Vicia faba: a commercial variety and varieties Alameda, Palacio and Baraka; Lupinus angustifolius; Pisum sativum and Cicer arietinum: varieties Fardon and Zegr ) as protein supplements to low quality...

  18. Author Details

    African Journals Online (AJOL)

    Uromyces viciae-fabae) with Environmental Factors and Cultural Practices in the Hararghe Highlands, Eastern Ethiopia Abstract. ISSN: 1992-0407. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

  19. Parental Leave Policies and Parents' Employment and Leave-Taking

    Science.gov (United States)

    Han, Wen-Jui; Ruhm, Christopher; Waldfogel, Jane

    2009-01-01

    We describe trends in maternal employment and leave-taking after birth of a newborn and analyze the extent to which these behaviors are influenced by parental leave policies. Data are from the June Current Population Survey (CPS) Fertility Supplements, merged with other months of the CPS, and cover the period 1987 to 1994. This time span is one…

  20. Characterization and functional analysis of seven flagellin genes in Rhizobium leguminosarum bv. viciae. Characterization of R. leguminosarum flagellins

    Directory of Open Access Journals (Sweden)

    Tambalo Dinah D

    2010-08-01

    Full Text Available Abstract Background Rhizobium leguminosarum bv. viciae establishes symbiotic nitrogen fixing partnerships with plant species belonging to the Tribe Vicieae, which includes the genera Vicia, Lathyrus, Pisum and Lens. Motility and chemotaxis are important in the ecology of R. leguminosarum to provide a competitive advantage during the early steps of nodulation, but the mechanisms of motility and flagellar assembly remain poorly studied. This paper addresses the role of the seven flagellin genes in producing a functional flagellum. Results R. leguminosarum strains 3841 and VF39SM have seven flagellin genes (flaA, flaB, flaC, flaD, flaE, flaH, and flaG, which are transcribed separately. The predicted flagellins of 3841 are highly similar or identical to the corresponding flagellins in VF39SM. flaA, flaB, flaC, and flaD are in tandem array and are located in the main flagellar gene cluster. flaH and flaG are located outside of the flagellar/motility region while flaE is plasmid-borne. Five flagellin subunits (FlaA, FlaB, FlaC, FlaE, and FlaG are highly similar to each other, whereas FlaD and FlaH are more distantly related. All flagellins exhibit conserved amino acid residues at the N- and C-terminal ends and are variable in the central regions. Strain 3841 has 1-3 plain subpolar flagella while strain VF39SM exhibits 4-7 plain peritrichous flagella. Three flagellins (FlaA/B/C and five flagellins (FlaA/B/C/E/G were detected by mass spectrometry in the flagellar filaments of strains 3841 and VF39SM, respectively. Mutation of flaA resulted in non-motile VF39SM and extremely reduced motility in 3841. Individual mutations of flaB and flaC resulted in shorter flagellar filaments and consequently reduced swimming and swarming motility for both strains. Mutant VF39SM strains carrying individual mutations in flaD, flaE, flaH, and flaG were not significantly affected in motility and filament morphology. The flagellar filament and the motility of 3841 strains

  1. Quorum-sensing-regulated transcriptional initiation of plasmid transfer and replication genes in Rhizobium leguminosarum biovar viciae.

    Science.gov (United States)

    McAnulla, Craig; Edwards, Anne; Sanchez-Contreras, Maria; Sawers, R Gary; Downie, J Allan

    2007-07-01

    Transfer of the Rhizobium leguminosarum biovar viciae symbiosis plasmid pRL1JI is regulated by a cascade of gene induction involving three LuxR-type quorum-sensing regulators, TraR, BisR and CinR. TraR induces the plasmid transfer traI-trb operon in a population-density-dependent manner in response to N-acylhomoserine lactones (AHLs) made by TraI. Expression of the traR gene is primarily induced by BisR in response to AHLs made by CinI, and expression of cinI is induced by CinR and repressed by BisR. Analysis of transcription initiation of cinI, traR and traI identified potential regulatory domains recognized by the CinR, BisR and TraR regulators. Deletion and mutation of the cinI promoter identified potential recognition motifs for activation by CinR and repression by BisR. Analysis of the DNA sequence upstream of traI and expression of transcriptional gene fusions revealed a predicted TraR-binding (tra-box) domain. Two transcript initiation sites were identified upstream of the plasmid replication gene repA, which is divergently transcribed from traI; one of these repA transcripts requires the quorum-sensing cascade mediated via BisR and TraR, showing that the pRL1JI plasmid replication genes are co-regulated with the plasmid transfer genes.

  2. The effects of nitrogen form on root morphological and physiological adaptations of maize, white lupin and faba bean under phosphorus deficiency.

    Science.gov (United States)

    Liu, Haitao; Tang, Caixian; Li, Chunjian

    2016-01-01

    Root morphological/physiological modifications are important for phosphorus (P) acquisition of plants under P deficiency, but strategies differ among plant species. Detailed studies on the response of maize roots to P deficiency are limited. Nitrogen (N) form influences root morphology/physiology, and thus may influence root responses to P deficiency. This work investigated adaptive mechanisms of maize roots to low P by comparison with white lupin and faba bean supplied with two N forms. Plants were grown for 7-16 days in hydroponics with sufficient (250 µmol L(-1)) and deficient P supply (1 µmol L(-1)) under supply of NH4NO3 or Ca(NO3)2 Plant growth and P uptake were measured, and release of protons and organic acid anions, and acid phosphatase activity in the root were monitored. The results showed that P deficiency significantly decreased shoot growth while increased root growth and total root length of maize and faba bean, but not white lupin. It enhanced the release of protons and organic acid anions, and acid phosphatase activity, from the roots of both legumes but not maize. Compared with Ca(NO3)2, NH4NO3 dramatically increased proton release by roots but did not alter root morphology or physiology of the three species in response to low P. It is concluded that the N form did not fundamentally change root morphological/physiological responses of the three species to P deficiency. Morphological variation in maize and morpho-physiological modifications in white lupin and faba bean were the main adaptive strategies to P deficiency. © The Authors 2016. Published by Oxford University Press on behalf of the Annals of Botany Company.

  3. REMINDER Saved Leave Scheme (SLS) : Simplified procedure for the transfer of leave to saved leave accounts

    CERN Multimedia

    HR Division

    2001-01-01

    As part of the process of streamlining procedures, the HR and AS Divisions have jointly developed a system whereby annual and compensatory leave will henceforth be automatically transferred1) to saved leave accounts. Under the provisions of the voluntary saved leave scheme (SLS), a maximum total of 10 days'2)Previously, every person taking part in the scheme has been individually issued with a form for the purposes of requesting the transfer of leave to the leave account and the transfer has then had to be done manually by HR Division. To streamline the procedure, unused leave of all those taking part in the saved leave scheme at the closure of the leave-year accounts will henceforth be transferred automatically to the saved leave account on that date. This simplification is in the interest of all parties concerned. This automatic transfer procedure has a number of advantages for participants in the SLS scheme. First, staff members will no longer have to take any administrative steps. Secondly, the new proced...

  4. The Plasma Membrane H+-ATPase from the Biotrophic Rust Fungus Uromyces fabae : molecular Characterization of the Gene (PMA1) and Functional Expression of the Enzyme in Yeast

    OpenAIRE

    Struck, Christine; Siebels, Claudia; Rommel, Oliver; Wernitz, Marcus; Hahn, Matthias

    1998-01-01

    To study the molecular basis of biotrophic nutrient uptake by plant parasitic rust fungi, the gene (Uf-PMA1) encoding the plasma membrane H+-ATPase from Uromyces fabae was isolated. Uf-PMA1 exists probably as a single gene. However, two nearly identical sequences were identified; the similarity apparently is due to two Uf-PMA1 alleles in the dikaryotic hyphae. Multiple Uf-PMA1 transcripts were observed during early rust development, and reduced amounts of a single Uf-PMA1 mRNA were observed i...

  5. Family Leave: It's the Law.

    Science.gov (United States)

    Arnold, Jean B.

    1993-01-01

    The Family and Medical Leave Act (FMLA) gives employees the right to take up to 12 weeks of unpaid leave a year for medical or family reasons. Provides key provisions of FMLA as they apply to schools and advises districts to consult school attorneys to help ensure compliance with the act and with the interim regulations issued last summer. (MLF)

  6. The development rhythm of the flower-bud in some Papilionaceae species. III. Macrosporogenesis, microsporogenesis and early gametogenesis in several species of the Vicieae tribe

    Directory of Open Access Journals (Sweden)

    Wanda Wojciechowska

    2014-01-01

    Full Text Available Each of the examined species of the tribe Vicieae (Vicia faba, V. sativa, V, villosa, Lathyrus silvester, L. pratensis and Pisum sativum has its peculiar characteristic development rhythm of the bud. A similarity has been demonstrated between the development rhythms of flower buds of Vicia faba and Pisum sativum. It was found that mature flowers of autogamous species had long calyces, whereas those of the allogamous species were short as compared with the petals of the corolla.

  7. 5 CFR 630.1003 - Establishing leave banks and leave bank boards.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Establishing leave banks and leave bank... REGULATIONS ABSENCE AND LEAVE Voluntary Leave Bank Program § 630.1003 Establishing leave banks and leave bank boards. (a) Each agency that participates in the voluntary leave bank program shall, in accordance with...

  8. Bacillus simplex—A Little Known PGPB with Anti-Fungal Activity—Alters Pea Legume Root Architecture and Nodule Morphology When Coinoculated with Rhizobium leguminosarum bv. viciae

    Directory of Open Access Journals (Sweden)

    Ann M. Hirsch

    2013-09-01

    Full Text Available Two strains, 30N-5 and 30VD-1, identified as Bacillus simplex and B. subtilis, were isolated from the rhizospheres of two different plants, a Podocarpus and a palm, respectively, growing in the University of California, Los Angeles (UCLA Mildred E. Mathias Botanical Garden. B. subtilis is a well-known plant-growth promoting bacterial species, but B. simplex is not. B. simplex 30N-5 was initially isolated on a nitrogen-free medium, but no evidence for nitrogen fixation was found. Nevertheless, pea plants inoculated with B. simplex showed a change in root architecture due to the emergence of more lateral roots. When Pisum sativum carrying a DR5::GUSA construct, an indicator for auxin response, was inoculated with either B. simplex 30N-5 or its symbiont Rhizobium leguminosarum bv. viciae 128C53, GUS expression in the roots was increased over the uninoculated controls. Moreover, when pea roots were coinoculated with either B. simplex 30N-5 or B. subtilis 30VD-1 and R. leguminosarum bv. viciae 128C53, the nodules were larger, clustered, and developed more highly branched vascular bundles. Besides producing siderophores and solubilizing phosphate, the two Bacillus spp., especially strain 30VD-1, exhibited anti-fungal activity towards Fusarium. Our data show that combining nodulating, nitrogen-fixing rhizobia with growth-promoting bacteria enhances plant development and strongly supports a coinoculation strategy to improve nitrogen fixation, increase biomass, and establish greater resistance to fungal disease.

  9. Analysis of rhizobial endosymbionts of Vicia, Lathyrus and Trifolium species used to maintain mountain firewalls in Sierra Nevada National Park (South Spain).

    Science.gov (United States)

    Villadas, Pablo J; Lasa, Ana V; Martínez-Hidalgo, Pilar; Flores-Félix, José David; Martínez-Molina, Eustoquio; Toro, Nicolás; Velázquez, Encarna; Fernández-López, Manuel

    2017-03-01

    Forest fires lead to the annual disappearance of many natural formations that require the creation of firewall areas. They can be maintained by enriching their pastures with attractive plants for grazing livestock, mainly legumes, which have a high protein content and low dependence on N fertilizers due to their ability to establish nitrogen-fixing symbiosis with rhizobia. In this study, the rhizobia isolated from the nodules of six legumes from the genera Vicia, Lathyrus and Trifolium were analysed in a firewall zone established in Lanjarón (Granada) close to the Sierra Nevada National Park (Spain). The results showed a high genetic diversity of the isolated strains that had 3, 16, 14 and 13 different types of rrs, recA, atpD and glnII genes, respectively. All strains were phylogenetically close to the species from the Rhizobium leguminosarum group, although they were not identified as any of them. The isolated strains belonged to the symbiovars viciae and trifolii but high phylogenetic diversity was found within both symbiovars, since there were 16 and 14 nodC gene types, respectively. Some of these strains clustered with strains isolated in other countries and continents, but others formed atpD, recA, glnII and nodC clusters and lineages only found to date in this study. Copyright © 2016 Elsevier GmbH. All rights reserved.

  10. New statement of leave format

    CERN Multimedia

    HR Department

    2009-01-01

    Following the communication of the Standing Concertation Committee published in Weekly Bulletin No. 18-19 of 27 April 2009, the current statement of leave on monthly pay slips has been replaced with the EDH Leave Transactions report that displays the up-to-date situation of individual leave balances at all times. The report is available on EDH. Additionally, the layout of the pay slip has been modernised. The new version of the pay slip will be send out from September 2009 onwards. Finance and Purchasing Department, Personnel Accounting Human Resources Department, Organisation and Procedures General Infrastructure Services Department, Administrative Information Services

  11. Key Obama officials leave administration

    Science.gov (United States)

    Showstack, Randy

    2013-01-01

    Secretary of the Interior Ken Salazar is one of the latest members of the Obama administration to announce that he is leaving his position near the start of President Obama's second term in office. Salazar, who has served as interior secretary since January 2009, intends to leave the department by the end of March, the department noted on 16 January. Salazar joins a number of other key officials who are planning to leave the administration. They include Environmental Protection Agency administrator Lisa Jackson, National Oceanic and Atmospheric Administration administrator Jane Lubchenco, and U.S. Geological Survey director Marcia McNutt.

  12. Mutualisme pucerons – fourmis : étude des bénéfices retirés par les colonies d'Aphis fabae en milieu extérieur

    Directory of Open Access Journals (Sweden)

    Verheggen F.

    2009-01-01

    Full Text Available Aphid – ant mutualism: an outdoor study of the benefits for Aphis fabae. Aphid – ant relationships are common examples of mutualism. Aphids are indeed submitted to predation and therefore require protection, while ants are continuously looking for new sugar sources. The present work aimed to study the benefits that a mutualistic relationship with Lasius niger (Hymenoptera, Formicidae could bring to the black bean aphid Aphis fabae (Homoptera, Aphididae. Several parameters were observed in the field, on broad bean plants infested with an initial amount of 100 A. fabae and in presence or not of a L. niger colony. More aphids were observed on plants being visited by ants as well as a higher proportion of winged individuals. One explanation is that fewer predators were observed on plants being visited by ants, demonstrating their protective role. However, the number of parasitized aphids was not reduced in presence of L. niger. On the other hand, fewer different aphid species were present on plants foraged by ants, what suggests that they could exert a predation on unattended aphids. Our observations do not allow to conclude on any impact of L. niger on the fitness of the aphid host plant, although fewer exuvia and honeydew spots were observed when they were present. All these results confirm that L. niger increase the fitness of A. fabae colonies mainly by decreasing the number of predators and by reducing competition from aphid species unattended by ants.

  13. Enrichment of pasta with faba bean does not impact glycemic or insulin response but can enhance satiety feeling and digestive comfort when dried at very high temperature.

    Science.gov (United States)

    Greffeuille, Valérie; Marsset-Baglieri, Agnès; Molinari, Nicolas; Cassan, Denis; Sutra, Thibault; Avignon, Antoine; Micard, Valérie

    2015-09-01

    Enrichment of durum wheat pasta with legume flour enhances their protein and essential amino acid content, especially lysine content. However, despite its nutritional potential, the addition of a legume alters the rheological properties of pasta. High temperature drying of pasta reduces this negative effect by strengthening its protein network. The aim of our study was to determine if these changes in the pasta structure alter its in vitro carbohydrate digestibility, in vivo glycemic, insulin and satiety responses. We also investigated if high temperature drying of pasta can reduce the well-known digestive discomfort associated with the consumption of legume grains. Fifteen healthy volunteers consumed three test meals: durum wheat pasta dried at a low temperature (control), and pasta enriched with 35% faba bean dried at a low and at a very high temperature. When enriched with 35% legume flour, pasta maintained its nutritionally valuable low glycemic and insulin index, despite its weaker protein network. Drying 35% faba bean pasta at a high temperature strengthened its protein network, and decreased its in vitro carbohydrate digestion with no further decrease in its in vivo glycemic or insulin index. Drying pasta at a very high temperature reduced digestive discomfort and enhanced self-reported satiety, and was not associated with a modification of energy intake in the following meal.

  14. Identification of a conserved protein involved in anaerobic unsaturated fatty acid synthesis in Neiserria gonorrhoeae: implications for facultative and obligate anaerobes that lack FabA.

    Science.gov (United States)

    Isabella, Vincent M; Clark, Virginia L

    2011-10-01

    Transcriptome analysis of the facultative anaerobe, Neisseria gonorrhoeae, revealed that many genes of unknown function were induced under anaerobic conditions. Mutation of one such gene, NGO1024, encoding a protein belonging to the 2-nitropropane dioxygenase-like superfamily of proteins, was found to result in an inability of gonococci to grow anaerobically. Anaerobic growth of an NG1024 mutant was restored upon supplementation with unsaturated fatty acids (UFA), but not with the saturated fatty acid palmitate. Gonococcal fatty acid profiles confirmed that NGO1024 was involved in UFA synthesis anaerobically, but not aerobically, demonstrating that gonococci contain two distinct pathways for the production of UFAs, with a yet unidentified aerobic mechanism, and an anaerobic mechanism involving NGO1024. Expression of genes involved in classical anaerobic UFA synthesis, fabA, fabM and fabB, was toxic in gonococci and unable to complement a NGO1024 mutation, suggesting that the chemistry involved in gonococcal anaerobic UFA synthesis is distinct from that of the classical pathway. NGO1024 homologues, which we suggest naming UfaA, form a distinct lineage within the 2-nitropropane dioxygenase-like superfamily, and are found in many facultative and obligate anaerobes that produce UFAs but lack fabA, suggesting that UfaA is part of a widespread pathway involved in UFA synthesis. © 2011 Blackwell Publishing Ltd.

  15. Microvirga ossetica sp. nov., a species of rhizobia isolated from root nodules of the legume species Vicia alpestris Steven.

    Science.gov (United States)

    Safronova, Vera I; Kuznetsova, Irina G; Sazanova, Anna L; Belimov, Andrey A; Andronov, Evgeny E; Chirak, Elizaveta R; Osledkin, Yuri S; Onishchuk, Olga P; Kurchak, Oksana N; Shaposhnikov, Alexander I; Willems, Anne; Tikhonovich, Igor A

    2017-01-01

    Gram-stain-negative strains V5/3MT, V5/5K, V5/5M and V5/13 were isolated from root nodules of Vicia alpestris plants growing in the North Ossetia region (Caucasus). Sequencing of the partial 16S rRNA gene (rrs) and four housekeeping genes (dnaK, gyrB, recA and rpoB) showed that the isolates from V. alpestris were most closely related to the species Microvirga zambiensis (order Rhizobiales, family Methylobacteriaceae) which was described for the single isolate from root nodule of Listia angolensis growing in Zambia. Sequence similarities between the Microvirga-related isolates and M. zambiensis WSM3693T ranged from 98.5 to 98.7 % for rrs and from 79.7 to 95.8 % for housekeeping genes. Cellular fatty acids of the isolates V5/3MT, V5/5K, V5/5M and V5/13 included important amounts of C18 : 1ω7c (54.0-67.2 %), C16 : 0 (6.0-7.8 %), C19 : 0 cyclo ω8c (3.1-10.2 %), summed feature 2 (comprising one or more of iso-C16 : 1 I, C14 : 0 3-OH and unknown ECL 10.938, 5.8-22.5 %) and summed feature 3 (comprising C16 : 1ω7c and/or iso-C15 : 02-OH, 2.9-4.0 %). DNA-DNA hybridization between the isolate V5/3MT and M. zambiensis WSM3693T revealed DNA-DNA relatedness of 35.3 %. Analysis of morphological and physiological features of the novel isolates demonstrated their unique phenotypic profile in comparison with reference strains from closely related species of the genus Microvirga. On the basis of genotypic and phenotypic analysis, a novel species named Microvirga ossetica sp. nov. is proposed. The type strain is V5/3MT (=LMG 29787T=RCAM 02728T). Three additional strains of the species are V5/5K, V5/5M and V5/13.

  16. 29 CFR 825.202 - Intermittent leave or reduced leave schedule.

    Science.gov (United States)

    2010-07-01

    ... and Medical Leave Act § 825.202 Intermittent leave or reduced leave schedule. (a) Definition. FMLA... period of six months, such as for chemotherapy. A pregnant employee may take leave intermittently for...

  17. 8Wambi heritability.pmd

    African Journals Online (AJOL)

    ACSS

    as a percentage of the mean (GAM) and heritability were estimated using variance components. Phenotypic. Coefficient of Variation ... exhibited moderate GCV values. Broad and narrow sense heritability estimates for GRD disease score ..... in some faba bean genotypes (Vicia faba L.) grown in Northwestern Ethiopia.

  18. Santé et diversité alimentaire au Yémen | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Review report : health and dietary diversity in Yemen; traditional Yemeni rural diets and local food systems: enhancing contributions to health and environment. Studies. Estimation genetic variation in faba bean (Vicia faba L.) landraces in Yemen : a thesis. Reports. Health and dietary diversity in Yemen : traditional Yemeni ...

  19. Effect of Environment on Protein, Mineral and Fat Composition of ...

    African Journals Online (AJOL)

    BACKGROUND: Faba bean (Vicia faba L.) is one of the most important high land pulse crops of Ethiopia. It is an excellent source of protein supplement for the majority of the population, used in various popular Ethiopian dishes. It also contains fat and appreciable amount of minerals. Data on the effect of environment on the ...

  20. South African Journal of Animal Science - Vol 25, No 2 (1995)

    African Journals Online (AJOL)

    Evaluation of faba beans (Vicia faba cv. Fiord) and sweet lupins (Lupizus albus cv. Kiev) as protein sources for growing pigs · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.S Brand, R.C. Olckers, J.P. van der Merwe, 31-35 ...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 106 of 106 ... Vol 27, No 2 (2017), Vermicompost application as affected by Rhizobium inoculation on nodulation and yield of Faba bean (Vicia Faba L.) Abstract PDF. Anteneh Argaw, Abere Mnalku. Vol 27, No 2 (2017), Vulnerability of smallholder farmers to climate change in the central rift valley of Ethiopia: a ...

  2. Download this PDF file

    African Journals Online (AJOL)

    sunflower genotypes (Helianthus annuus L.) to different concentrations of sodium chloride, Helia,. Vol. 22 (30) ... Ion uptake, osmoregulation and plant-water relations in faba beans (Vicia faba L.) under salt stress, Die ... assimilates by wheat as affected by nitrogen source and salinity, Agronomy Journal, Vol. 85, 1044-1049.

  3. The use of reproductive vigor descriptors in studying genetic ...

    African Journals Online (AJOL)

    A collection of nine Tunisian faba bean (Vicia faba) populations belonging to three botanical classes (Var. minor, var. equina and var. major) was evaluated using twenty seven agro-morphological traits. Analysis of variance, correlation coefficients and principal components analysis (PCA) were performed based on MVSP ...

  4. Nutritional, eco-physiological and symbiotic characteristics of ...

    African Journals Online (AJOL)

    Characterization of root nodule bacteria is used for selecting and using them as inoculants to improve legume production. To this end, faba bean (Vicia faba L.) rhizobia were isolated from nodules collected from acidic soils of Central and Southern-Western parts of Ethiopia. A total of hundred rhizobial isolates were ...

  5. 5 CFR 630.1204 - Intermittent leave or reduced leave schedule.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Intermittent leave or reduced leave schedule. 630.1204 Section 630.1204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ABSENCE AND LEAVE Family and Medical Leave § 630.1204 Intermittent leave or reduced leave schedule...

  6. [Disability leave and sick leave in Spain. 2016 legislative update].

    Science.gov (United States)

    Vicente-Herrero, María Teófila; Terradillos-García, María Jesús; Capdevila-García, Luisa M; Ramírez-Íñiguez de la Torre, María Victoria; Aguilar-Jiménez, Encarna; Aguado-Benedí, María José; López-González, Angel Arturo; Torres-Alberich, José Ignacio

    2018-01-01

    In Spanish, the concepts of discapacidad (disability leave) and incapacidad (sick leave) jointly refer to the impairment of a person due to injuries, diseases or deficiencies that limit their activity in a social, personal or occupational field. However, this common link does not imply that both concepts are the same. Statistical data from INE (Instituto Nacional de Estadística: Statistic National Institute) show that Spain had in 2015 3.85 million persons with a disability (59.8% were women). Statistical data from 2015 from INSS (Instituto Nacional de Seguridad Social: Social Security National Institute) show high levels in the number of processes and in workers affected by temporary sick leave, with social costs to the social security system. Both concepts have been updated: about disability leave, Law 39/2006 adjusted terminology by avoiding the use of concepts with discriminating or pejorative connotation. Regarding sick leave, the Ley General de Seguridad Social (General Social Security Law)has been amended and came into effect in January, 2016. It is necessary to know and distinguish these aspects for a better administrative management, and a more oriented information to the affected patient.

  7. evaluation of pathogenic isolates in ethiopia for the control of ...

    African Journals Online (AJOL)

    Administrator

    Key Words: Bacillus spp., Biocontrol, Botrytis fabae, Ethiopia. RÉSUMÉ. Le haricot faba (Vicia faba L.) est l'un des premiers domestiqués légumineuses alimentaires en Ethiopie et en est maintenant cultivé sur de grandes superficies dans de nombreux pays. La production de plant est toutefois limitée par des infections de ...

  8. Why People Leave Their Jobs?

    Directory of Open Access Journals (Sweden)

    Luis R. Domínguez A.

    2014-12-01

    Full Text Available This article aims to show the results of the review of literature of relevant studies of the causal elements of intention to leave in the last five years (2009-2013. The method used to evaluate the literature was based on the seven steps for research synthesis: problem formulation, literature search, obtaining information from studies, quality assessment studies, analysis and integration of results, interpretation of evidence and presentation of results. 48 studies from 15 different countries with a sample of 35804 employees of different companies were evaluated. The findings suggest the existence of 89 different variables influencing the intention to leave of employees in an organization. The results of this study will allow researchers to better understand the variables that can be studied to verify the impact of variables such as causal elements, but also see those that have a mediating effect between them for predicting intention to leave as an element of employee turnover. This study makes three important contributions to literature of turnover. First, in this study all the parameters associated with the intention to leave were checked. Second, this study categorizes and displays in proportion relevant interests to the scientific community whom studying employee turnover across the intention to leave. And thirdly provides clues organizations to improve some of its structural and contextual features to control turnover.

  9. Immobilization and Survival of Root Nodule Bacterium Rhizobium leguminosarum Biovar viciae / Gumiņbaktērijas Rhizobium leguminosarum biovar viciae imobilizācija un dzīvotspēja

    Directory of Open Access Journals (Sweden)

    Žvagiņa Signe

    2015-11-01

    Full Text Available Rhizobium leguminosarum biovar viciae ir augsnes baktērija, kas spēj veidot gumiņus uz zirņu, pupu, lēcu un vīķu saknēm un saistīt atmosfēras slāpekli simbiozē ar augiem. Gumiņbaktērijas izmanto lauksaimniecībā kā bioloģiskus mēslošanas līdzekļus augu augšanas veicināšanai. Komerciālos gumiņbaktēriju preparātus var iegādāties sausā, šķidrā vai liofilizētā formā. Parasti izmanto sausos sagatavotos mēslošanas līdzekļus uz kūdras bāzes. Šī pētījuma mērķis bija imobilizēt R. leguminosarum un noteikt tās dzīvotspēju šķidrumā un dažādos nesējmateriālos, lai izstrādātu uzlabotus gumiņbaktēriju preparātus. Imobilizēšanai izmantoja piecus sterilizētus materiālus: kūdru, māla pulveri, divu veidu ovālus šūnainās keramikas agregātus un cilindriskas keramikas granulas, kas izgatavotas no Planču depozīta Devona perioda māla. Imobilizāciju veica 2,5 stundu laikā 20 °C temperatūrā. Vēlāk kūdru, pulveri un granulas noberza un sasmalcināja ūdenī ar sterilu piestiņu, lai atdalītu pielipušās baktērijas. Baktēriju kolonijas veidojošo vienību skaitu noteica, izsējot iegūto suspensiju atšķaidījumus Petri traukos ar agarizētu barotni. Dzīvotspēju noteica arī ar LIVE/DEAD epifluorescences metodi. Iegūtie rezultāti parādīja, ka nesējmateriāls ietekmē imobilizācijas sekmes un ka uzglabāšanas temperatūra ietekmē R. leguminosarum dzīvotspēju. Vislabākos rezultātus ieguva, uzglabājot baktērijas suspensijā vai imobilizējot uz kūdras. Rekomendējam uzglabāt R. leguminosarum produktus −18 °C vai 4 °C temperatūrā.

  10. Maternity leave, what about Paternity leave?: child care and social ...

    African Journals Online (AJOL)

    However, it is noteworthy that in child development and care, the roles of both parents are important. Analysis of the paper is done with the review of literatures and interviews conducted randomly among working women and men in Abeokuta on their experiences and views about maternity and paternity leaves respectively.

  11. 76 FR 60701 - Absence and Leave; Qualifying Exigency Leave

    Science.gov (United States)

    2011-09-30

    ... parent-teacher conference to submit a signed statement of the need for the exigency leave, along with a... measures, parent-teacher conferences, or meetings with school counselors, for a child when such meetings... arise when the spouse, son, daughter, or parent of an employee is on covered active duty in the Armed...

  12. [Sick leave and nursing personnel management].

    Science.gov (United States)

    Estorce, Thiago Puliesi; Kurcgant, Paulina

    2011-10-01

    Sick leaves in the nursing team demand immediate managerial actions when health care has quality as a goal. This descriptive-exploratory, quantitative study was performed with the purpose of characterizing that phenomenon in a university hospital between 2003 and 2007. The medical leaves added up to 3,207 leaves and 32,022 days lost. Leaves lasting up to two days accounted for 54% of the total leaves and to 7% of the days lost; leaves of more than 15 days, 5% of the total, and 66% of the lost days. Hence, sick leaves consist of an important tool in nursing personnel management.

  13. Nutrient resorption from seagrass leaves

    NARCIS (Netherlands)

    Stapel, J.; Hemminga, M.A.

    1997-01-01

    The resorption of nutrients (C, N and P) from senescent leaves of six seagrass species from nine different locations in tropical (Indonesia and Kenya), Mediterranean (Spain) and temperate (The Netherlands) regions has been investigated. Resorption was quantitatively assessed by calculating the

  14. Watch out for the leaves!

    CERN Multimedia

    HSE Unit

    2013-01-01

    Now that autumn is here, dead leaves falling from the trees form a colourful carpet that is pleasing to the eye. However, the reality is less pleasant for pedestrians, since these leaves increase the risk of slipping and falling, especially when the ground is wet.   These conditions are also hazardous for two- and four-wheeled vehicles, whose grip on the ground can be severely reduced, thereby increasing the risk of them skidding out of control. Cyclists are among the most vulnerable road users when faced with these hazards. It is therefore essential to be alert to the dangers, which can be lessened by taking a few simple precautions such as moderating your speed and wearing suitable shoes. We also invite you to notify the Service Desk if you notice a road or pavement where there is a high concentration of dead leaves. The CERN Roads and Drainage Service will then ensure that the leaves are cleared in order to reduce the risk of accidents in the area.

  15. (Vicia sativa L.) - triticale

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... This study was carried to determine the best seed mixture of vetch and triticale for East Mediterranean rainfed conditions of Turkey. The experiments were conducted in two locations, Adana and Kozan, during the years of 2003 - 2005. The field trials were arranged in a randomised block design with three.

  16. PHYTOCHEMICAL SCREENING OF NERIUM OLEANDER LEAVES AND MOMORDICA CHARANTIA LEAVES

    OpenAIRE

    Santhi R; Lakshmi G; Priyadharshini A.M; Anandaraj L

    2011-01-01

    The developing countries mostly rely on traditional medicines. The traditional medicine involves the use of different plant extracts or the bioactive constituents. This type of study provides the health application at affordable cost. This study such as ethnomedicine keenly represents one of the best avenues in searching new economic plants for medicine. In keeping this view in mind the present investigation is carried out in Nerium oleander and Momordica charantia leaves. Qualitative ph...

  17. Prospeção da diversidade de fungos micorrízicos arbusculares em 2 espécies agrícolas (Phaseolus vulgaris L. e Vicia faba L.) e 2 espécies nativas (Teline maderensis Webb & Berthel e Genista tenera (Jacq. Ex Murray) Kuntze) da Madeira

    OpenAIRE

    Oliveira, Maria Cristina Ornelas

    2016-01-01

    Tese de mestrado, Microbiologia Aplicada, Universidade de Lisboa, Faculdade de Ciências, 2016 O Filo Glomeromycota compreende um grupo de fungos que se considera no geral serem biotróficos obrigatórios e que se associam a cerca de 80% das plantas. O fungo e a planta formam uma associação simbiótica conhecida como micorriza arbuscular. Desta associação, o fungo absorve entre 5 a 20% do carbono fotossintetizado pela planta e por outro lado a planta pode beneficiar do aumento da absorção de n...

  18. Carnivorous leaves from Baltic amber.

    Science.gov (United States)

    Sadowski, Eva-Maria; Seyfullah, Leyla J; Sadowski, Friederike; Fleischmann, Andreas; Behling, Hermann; Schmidt, Alexander R

    2015-01-06

    The fossil record of carnivorous plants is very scarce and macrofossil evidence has been restricted to seeds of the extant aquatic genus Aldrovanda of the Droseraceae family. No case of carnivorous plant traps has so far been reported from the fossil record. Here, we present two angiosperm leaves enclosed in a piece of Eocene Baltic amber that share relevant morphological features with extant Roridulaceae, a carnivorous plant family that is today endemic to the Cape flora of South Africa. Modern Roridula species are unique among carnivorous plants as they digest prey in a complex mutualistic association in which the prey-derived nutrient uptake depends on heteropteran insects. As in extant Roridula, the fossil leaves possess two types of plant trichomes, including unicellular hairs and five size classes of multicellular stalked glands (or tentacles) with an apical pore. The apices of the narrow and perfectly tapered fossil leaves end in a single tentacle, as in both modern Roridula species. The glandular hairs of the fossils are restricted to the leaf margins and to the abaxial lamina, as in extant Roridula gorgonias. Our discovery supports current molecular age estimates for Roridulaceae and suggests a wide Eocene distribution of roridulid plants.

  19. 20 CFR 638.532 - Annual leave.

    Science.gov (United States)

    2010-04-01

    ... regardless of the date of enrollment provided that the student was not AWOL or on administrative leave... shall be suspended only when the student is AWOL or on administrative leave without allowances. (c...

  20. Sugar beet leaves for functional ingredients

    NARCIS (Netherlands)

    Tamayo Tenorio, Angelica

    2017-01-01

    Plant leaves are recognised as a potential source for food applications based on their nutritional profile and interesting technological properties of leaf components, and based on the large availability of plant leaves in agricultural waste streams. Besides proteins, leaves have a rich nutritional

  1. Officer Sabbaticals. Analysis of Extended Leave Options

    Science.gov (United States)

    2003-01-01

    in a nonmilitary job market (e.g., working in a family business for a year). • Social service leaves, or longer leaves with a specific purpose, such...education or gain experience in a nonmilitary job market (e.g., work in a family business for a year). These leaves would be granted on an individual basis

  2. INFLUÊNCIA DO CULTIVO CONSORCIADO DE AVEIA PRETA (AVENA STRIGOSA SCHIEB. E ERVILHACA COMUM (VICIA SATIVA L. NA PRODUÇÃO DE FITOMASSA E NO APORTE DE NITROGÊNIO INFLUENCE OF INTERCROPPED COMMON VETCH (VICIA SATIVA L. AND NAKED OAT (AVENA STRIGOSA ON BIOMASS PRODUCTION AND NITROGEN ADDITION

    Directory of Open Access Journals (Sweden)

    R. Heinrichs

    1999-01-01

    Full Text Available Em um Podzólico Vermelho Amarelo e sob preparo convencional, foi avaliada a influência de proporções de sementes de ervilhaca (Vicia sativa L. e de aveia preta (Avena strigosa Schieb. cultivadas em consórcio, na produção de fitomassa e no aporte de nitrogênio no sistema. O experimento foi implantado em solo podzolico vermelho amarelo, de Santa Maria, RS. Os tratamentos foram casualizados em quatro blocos, constituindo-se de: 1- 100% Ervilhaca comum (E; 2- 90% E + 10% Aveia preta (A; 3- 75% E + 25% A; 4- 50% E + 50% A; 5- 25% E + 75% A; 6- 100% A; 7- pousio de inverno. A amostragem da fitomassa das coberturas verdes foi efetuada na ocasião do pleno florescimento em área de 0,8m2 por parcela. Os resultados evidenciaram que a aveia preta e a ervilhaca comum podem ser consorciadas, beneficiando assim, a produção de fitomassa e acúmulo de nitrogênio.The effect of intercropping common vetch (Vicia sativa L. with naked oat (Avena strigosa Schieb. at different seed proportions was evaluated. The trial was set up on a Red Yellow Podzolic soil of Santa Maria, RS, Brazil. The treatments were the following: 1- 100% E (common vetch; 2- 90% E + 10% A (naked oat; 3- 75% E + 25% A; 4- 50% E + 50% A; 5- 25% E + 75% A; 6- 100% A; 7- fall tillage organized in four randomized blocks. Biomass production was evaluated at the flowering stage in an area of 0.8 m2 per plot. Data show that both species can be intercropped which is beneficial to biomass production and nitrogen accumulation.

  3. Leaving a joint audit system

    DEFF Research Database (Denmark)

    Holm, Claus; Thinggaard, Frank

    2014-01-01

    with the auditors than in a equally shared joint audit, and that the auditors' incentives to offer an initial fee discount are bigger. Research limitations/implications: The number of observations is constrained by the small Danish capital market. Future research could take a more qualitative research approach...... deciding to switch to single auditors. Fee discounts do not seem to reflect long-lasting efficiency gains on the part of the audit firm. Orginality/value: Denmark is the first country to leave a mandatory joint audit system, so this is the first time that it is possible to study fee effects related to this....

  4. Resource capture by single leaves

    Energy Technology Data Exchange (ETDEWEB)

    Long, S.P.

    1992-05-01

    Leaves show a variety of strategies for maximizing CO{sub 2} and light capture. These are more meaningfully explained if they are considered in the context of maximizing capture relative to the utilization of water, nutrients and carbohydrates reserves. There is considerable variation between crops in their efficiency of CO{sub 2} and light capture at the leaf level. Understanding of these mechanisms indicate some ways in which efficiency of resource capture could be level cannot be meaningfully considered without simultaneous understanding of implications at the canopy level. 36 refs., 5 figs., 1 tab.

  5. On the Sharing of Temporary Parental Leave

    DEFF Research Database (Denmark)

    Amilon, Anna

    2007-01-01

    This paper views temporary parental leave (leave from work to take care of a sick child) as a household public good, produced with time inputs of the parents as the only input. Assuming equal productivities in the production of temporary parental leave and equal utility functions of the spouses......-point of the female is found to push the intra household allocation of temporary parental leave towards greater sharing between the spouses. In addition, an increase in the insurance ceiling will further sharing of temporary parental leave in some families, while reducing it in others....

  6. Phytic acid in green leaves.

    Science.gov (United States)

    Hadi Alkarawi, H; Zotz, G

    2014-07-01

    Phytic acid or phytate, the free-acid form of myo-inositolhexakiphosphate, is abundant in many seeds and fruits, where it represents the major storage form of phosphorus. Although also known from other plant tissues, available reports on the occurrence of phytic acid, e.g. in leaves, have never been compiled, nor have they been critically reviewed. We found 45 published studies with information on phytic acid content in leaves. Phytic acid was almost always detected when studies specifically tried to detect it, and accounted for up to 98% of total P. However, we argue that such extreme values, which rival findings from storage organs, are dubious and probably result from measurement errors. Excluding these high values from further quantitative analysis, foliar phytic acid-P averaged 2.3 mg·g(-1) , and represented, on average, 7.6% of total P. Remarkably, the ratio of phytic acid-P to total P did not increase with total P, we even detected a negative correlation of the two variables within one species, Manihot esculenta. This enigmatic finding warrants further attention. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.

  7. The Effects of Cropping Regimes on Fungal and Bacterial Communities of Wheat and Faba Bean in a Greenhouse Pot Experiment Differ between Plant Species and Compartment.

    Science.gov (United States)

    Granzow, Sandra; Kaiser, Kristin; Wemheuer, Bernd; Pfeiffer, Birgit; Daniel, Rolf; Vidal, Stefan; Wemheuer, Franziska

    2017-01-01

    Many bacteria and fungi in the plant rhizosphere and endosphere are beneficial to plant nutrient acquisition, health, and growth. Although playing essential roles in ecosystem functioning, our knowledge about the effects of multiple cropping regimes on the plant microbiome and their interactions is still limited. Here, we designed a pot experiment simulating different cropping regimes. For this purpose, wheat and faba bean plants were grown under controlled greenhouse conditions in monocultures and in two intercropping regimes: row and mixed intercropping. Bacterial and fungal communities in bulk and rhizosphere soils as well as in the roots and aerial plant parts were analyzed using large-scale metabarcoding. We detected differences in microbial richness and diversity between the cropping regimes. Generally, observed effects were attributed to differences between mixed and row intercropping or mixed intercropping and monoculture. Bacterial and fungal diversity were significantly higher in bulk soil samples of wheat and faba bean grown in mixed compared to row intercropping. Moreover, microbial communities varied between crop species and plant compartments resulting in different responses of these communities toward cropping regimes. Leaf endophytes were not affected by cropping regime but bacterial and fungal community structures in bulk and rhizosphere soil as well as fungal community structures in roots. We further recorded highly complex changes in microbial interactions. The number of negative inter-domain correlations between fungi and bacteria decreased in bulk and rhizosphere soil in intercropping regimes compared to monocultures due to beneficial effects. In addition, we observed plant species-dependent differences indicating that intra- and interspecific competition between plants had different effects on the plant species and thus on their associated microbial communities. To our knowledge, this is the first study investigating microbial communities in

  8. The Effects of Cropping Regimes on Fungal and Bacterial Communities of Wheat and Faba Bean in a Greenhouse Pot Experiment Differ between Plant Species and Compartment

    Directory of Open Access Journals (Sweden)

    Sandra Granzow

    2017-05-01

    Full Text Available Many bacteria and fungi in the plant rhizosphere and endosphere are beneficial to plant nutrient acquisition, health, and growth. Although playing essential roles in ecosystem functioning, our knowledge about the effects of multiple cropping regimes on the plant microbiome and their interactions is still limited. Here, we designed a pot experiment simulating different cropping regimes. For this purpose, wheat and faba bean plants were grown under controlled greenhouse conditions in monocultures and in two intercropping regimes: row and mixed intercropping. Bacterial and fungal communities in bulk and rhizosphere soils as well as in the roots and aerial plant parts were analyzed using large-scale metabarcoding. We detected differences in microbial richness and diversity between the cropping regimes. Generally, observed effects were attributed to differences between mixed and row intercropping or mixed intercropping and monoculture. Bacterial and fungal diversity were significantly higher in bulk soil samples of wheat and faba bean grown in mixed compared to row intercropping. Moreover, microbial communities varied between crop species and plant compartments resulting in different responses of these communities toward cropping regimes. Leaf endophytes were not affected by cropping regime but bacterial and fungal community structures in bulk and rhizosphere soil as well as fungal community structures in roots. We further recorded highly complex changes in microbial interactions. The number of negative inter-domain correlations between fungi and bacteria decreased in bulk and rhizosphere soil in intercropping regimes compared to monocultures due to beneficial effects. In addition, we observed plant species-dependent differences indicating that intra- and interspecific competition between plants had different effects on the plant species and thus on their associated microbial communities. To our knowledge, this is the first study investigating

  9. Nitrogen transfer from Lupinus albus L., Trifolium incarnatum L. and Vicia sativa L. contribute differently to rapeseed (Brassica napus L.) nitrogen nutrition.

    Science.gov (United States)

    Génard, Thaïs; Etienne, Philippe; Laîné, Philippe; Yvin, Jean-Claude; Diquélou, Sylvain

    2016-09-01

    Nitrogen (N) transfer is well documented in legume-cereal intercropping but this is less often reported for legume-Brassica intercrops even though Brassica crops require higher levels of N fertilizers. The present study was carried out to quantify N transfer from legumes (Lupinus albus L., Trifolium incarnatum L. or Vicia sativa L.) to rapeseed (Brassica napus L.) using the split-root (15)N-labelling method. After three months we observed that legumes did not alter the growth of rapeseed. Vetch showed the lowest growth and demonstrated low (15)N shoot to root translocation and no significant N transfer to rapeseed. In contrast, significant (15)N enrichment was found in lupine and clover and (15)N was transferred to the associated rapeseed plants (around 6 and 4 mg N plant(-1), respectively), which contributed 2 to 3% of the rapeseed total N. Additionally, the data revealed that N2 fixation dominated the N nutrition in lupine despite the high N level provided in the donor compartment, suggesting a greater niche segregation between companion plants. Based on the results of this study we suggest that intercropping can be a relevant contributor to rapeseed N nutrition. Among the three legumes tested, clover and lupine seemed to be the best intercropping candidates.

  10. Nitrogen transfer from Lupinus albus L., Trifolium incarnatum L. and Vicia sativa L. contribute differently to rapeseed (Brassica napus L. nitrogen nutrition

    Directory of Open Access Journals (Sweden)

    Thaïs Génard

    2016-09-01

    Full Text Available Nitrogen (N transfer is well documented in legume-cereal intercropping but this is less often reported for legume-Brassica intercrops even though Brassica crops require higher levels of N fertilizers. The present study was carried out to quantify N transfer from legumes (Lupinus albus L., Trifolium incarnatum L. or Vicia sativa L. to rapeseed (Brassica napus L. using the split-root 15N-labelling method. After three months we observed that legumes did not alter the growth of rapeseed. Vetch showed the lowest growth and demonstrated low 15N shoot to root translocation and no significant N transfer to rapeseed. In contrast, significant 15N enrichment was found in lupine and clover and 15N was transferred to the associated rapeseed plants (around 6 and 4 mg N plant−1, respectively, which contributed 2 to 3% of the rapeseed total N. Additionally, the data revealed that N2 fixation dominated the N nutrition in lupine despite the high N level provided in the donor compartment, suggesting a greater niche segregation between companion plants. Based on the results of this study we suggest that intercropping can be a relevant contributor to rapeseed N nutrition. Among the three legumes tested, clover and lupine seemed to be the best intercropping candidates.

  11. Exploiting Illumina Sequencing for the Development of 95 Novel Polymorphic EST-SSR Markers in Common Vetch (Vicia sativa subsp. sativa

    Directory of Open Access Journals (Sweden)

    Zhipeng Liu

    2014-05-01

    Full Text Available The common vetch (Vicia sativa subsp. sativa, a self-pollinating and diploid species, is one of the most important annual legumes in the world due to its short growth period, high nutritional value, and multiple usages as hay, grain, silage, and green manure. The available simple sequence repeat (SSR markers for common vetch, however, are insufficient to meet the developing demand for genetic and molecular research on this important species. Here, we aimed to develop and characterise several polymorphic EST-SSR markers from the vetch Illumina transcriptome. A total number of 1,071 potential EST-SSR markers were identified from 1025 unigenes whose lengths were greater than 1,000 bp, and 450 primer pairs were then designed and synthesized. Finally, 95 polymorphic primer pairs were developed for the 10 common vetch accessions, which included 50 individuals. Among the 95 EST-SSR markers, the number of alleles ranged from three to 13, and the polymorphism information content values ranged from 0.09 to 0.98. The observed heterozygosity values ranged from 0.00 to 1.00, and the expected heterozygosity values ranged from 0.11 to 0.98. These 95 EST-SSR markers developed from the vetch Illumina transcriptome could greatly promote the development of genetic and molecular breeding studies pertaining to in this species.

  12. The effects of nano-TiO{sub 2} on seed germination, development and mitosis of root tip cells of Vicia narbonensis L. and Zea mays L

    Energy Technology Data Exchange (ETDEWEB)

    Ruffini Castiglione, Monica, E-mail: mruffini@biologia.unipi.it [University of Pisa, Department of Biology (Italy); Giorgetti, Lucia; Geri, Chiara [Institute of Agricultural Biology and Biotechnology (IBBA/CNR), UOS Pisa (Italy); Cremonini, Roberto [University of Pisa, Department of Biology (Italy)

    2011-06-15

    This study aimed to provide new information about phyto-toxicology of nano-TiO{sub 2} on plant systems. To contribute to the evaluation of the potential harmful effects of the nanoparticles on monocots and dicots we considered their effects on seed germination and root elongation applying a concentration range from 0.2 to 4.0 Per-Mille-Sign in the plants Zea mays L. and Vicia narbonensis L. Moreover, we achieved a genotoxicity study at cytological level in root meristems by means of traditional cytogenetic approach, to evidence possible alterations in mitotic activity, chromosomal aberrations, and micronuclei release. From these analyses it comes out that nano-TiO{sub 2} particles, after short-term exposure and under our experimental conditions, delayed germination progression for the first 24 h in both materials. Root elongation was affected only after treatment with the higher nano-TiO{sub 2} concentration. Further significant effects were detected showing mitotic index reduction and concentration-dependent increase in the aberration emergence that evidenced a nano-TiO{sub 2}-induced genotoxic effect for both species.

  13. CYP94A1, a plant cytochrome P450-catalyzing fatty acid omega-hydroxylase, is selectively induced by chemical stress in Vicia sativa seedlings.

    Science.gov (United States)

    Benveniste, Irène; Bronner, Roberte; Wang, Yong; Compagnon, Vincent; Michler, Pierre; Schreiber, Lukas; Salaün, Jean-Pierre; Durst, Francis; Pinot, Franck

    2005-08-01

    CYP94A1 is a cytochrome P450 (P450) catalyzing fatty acid (FA) omega-hydroxylation in Vicia sativa seedlings. To study the physiological role of this FA monooxygenase, we report here on its regulation at the transcriptional level (Northern blot). Transcripts of CYP94A1, as those of two other P450-dependent FA hydroxylases (CYP94A2 and CYP94A3) from V. sativa, are barely detectable during the early development of the seedlings. CYP94A1 transcripts, in contrast to those of the two other isoforms, are rapidly (less than 20 min) and strongly (more than 100 times) enhanced after treatment by clofibrate, an hypolipidemic drug in animals and an antiauxin (p-chlorophenoxyisobutyric acid) in plants, by auxins (2,4-dichlorophenoxyacetic acid and indole-3-acetic acid), by an inactive auxin analog (2,3-dichlorophenoxyacetic acid), and also by salicylic acid. All these compounds activate CYP94A1 transcription only at high concentrations (50-500 microM range). In parallel, these high levels of clofibrate and auxins modify seedling growth and development. Therefore, the expression of CYP94A1 under these conditions and the concomitant morphological and cytological modifications would suggest the implication of this P450 in a process of plant defense against chemical injury.

  14. RECRUITMENT FINANCED BY SAVED LEAVE (RSL PROGRAMME)

    CERN Multimedia

    Division du Personnel; Tel. 73903

    1999-01-01

    Transfer to the saved leave account and saved leave bonusStaff members participating in the RSL programme may opt to transfer up to 10 days of unused annual leave or unused compensatory leave into their saved leave account, at the end of the leave year, i.e. 30 September (as set out in the implementation procedure dated 27 August 1997).A leave transfer request form, which you should complete, sign and return, if you wish to use this possibility, has been addressed you. To allow the necessary time for the processing of your request, you should return it without delay.As foreseen in the implementation procedure, an additional day of saved leave will be granted for each full period of 20 days remaining in the saved leave account on 31 December 1999, for any staff member participating in the RSL programme until that date.For part-time staff members participating in the RSL programme, the above-mentioned days of leave (annual, compensatory and saved) are adjusted proportionally to their contractual working week as...

  15. Dietary inclusion of raw faba bean instead of soybean meal and enzyme supplementation in laying hens: Effect on performance and egg quality

    Directory of Open Access Journals (Sweden)

    M.E. Abd El-Hack

    2017-02-01

    Full Text Available An experiment was conducted with 160 Hisex Brown laying hens to evaluate the effect of different inclusion levels of faba bean (FB and enzyme supplementation on productive performance and egg quality parameters. The experimental diets consisted of five levels of FB: 0% (control, 25%, 50%, 75% and 100%, substituting soybean meal (SBM, and two levels of enzyme supplementation (0 or 250 mg/kg. Each dietary treatment was assigned to four replicate groups and the experiment lasted 22 weeks. A positive relationship (P  0.05. The main effect of FB levels replacing for SBM affected (P < 0.05 yolk and shell percentages, yolk index, yolk to albumen ratio, shell thickness and egg shape index. It can be concluded that FB and enzyme supplementation could be included in hens diet at less than 50% instead of SBM to support egg productive performance, however higher raw FB levels negatively affected egg production indices and quality.

  16. Paid Sick Leave and Job Stability

    Science.gov (United States)

    Hill, Heather D.

    2013-01-01

    A compelling, but unsubstantiated, argument for paid sick leave legislation is that workers with leave are better able to address own and family member health needs without risking a voluntary or involuntary job separation. This study tests that claim using the Medical Expenditure Panel Survey and regression models controlling for a large set of worker and job characteristics, as well as with propensity score techniques. Results suggest that paid sick leave decreases the probability of job separation by at least 2.5 percentage points, or 25%. The association is strongest for workers without paid vacation leave and for mothers. PMID:24235780

  17. Fathers on Parental Leave in Denmark

    DEFF Research Database (Denmark)

    Reinicke, Kenneth; Cybulski, Franz Wilhelm; Drews, Lea Vedel

    2005-01-01

    In the article it is argued that contemporary fatherhood and masculinity differ increasingly from hegemonic masculinity according to which men are primarily responsible for ensuring the financial basis of the family. The article “Fathers on Parental Leave in Denmark”, based on interviews with 15......, parental leave and domestic affairs. The article also demonstrates that the issue of parental leave may cause a conflict of interest between an employer and en employee although the majority of employers in this study emphasize that parental leave is unproblematic for them....

  18. Labeling of Carbon Pools in Bradyrhizobium japonicum and Rhizobium leguminosarum bv viciae Bacteroids following Incubation of Intact Nodules with CO(2).

    Science.gov (United States)

    Salminen, S O; Streeter, J G

    1992-10-01

    The aim of the work reported here was to ascertain that the patterns of labeling seen in isolated bacteroids also occurred in bacteroids in intact nodules and to observe early metabolic events following exposure of intact nodules to (14)CO(2). Intact nodules of soybean (Glycine max L. Merr. cv Ripley) inoculated with Bradyrhizobium japonicum USDA 110 and pea (Pisum sativum L. cv Progress 9) inoculated with Rhizobium leguminosarum bv viciae isolate 128C53 were detached and immediately fed (14)CO(2) for 1 to 6 min. Bacteroids were purified from these nodules in 5 to 7 min after the feeding period. In the cytosol from both soybean and pea nodules, malate had the highest radioactivity, followed by citrate and aspartate. In peas, asparagine labeling equaled that of aspartate. In B. japonicum bacteroids, malate was the most rapidly labeled compound, and the rate of glutamate labeling was 67% of the rate of malate labeling. Aspartate and alanine were the next most rapidly labeled compounds. R. leguminosarum bacteroids had very low amounts of (14)C and, after a 1-min feeding, malate contained 90% of the radioactivity in the organic acid fraction. Only a trace of activity was found in aspartate, whereas the rate of glutamate and alanine labeling approached that of malate after 6 min of feeding. Under the conditions studied, malate was the major form of labeled carbon supplied to both types of bacteroids. These results with intact nodules confirm our earlier results with isolated bacteroids, which showed that a significant proportion of provided labeled substrate, such as malate, is diverted to glutamate. This supports the conclusion that microaerobic conditions in nodules influence carbon metabolism in bacteroids.

  19. [Dendritic arborization patterns of interneurons labeled with a lectin, Vicia villosa, in rat cerebral cortex: studies by intracellular injection of lucifer yellow using aldehyde-fixed slices].

    Science.gov (United States)

    Ojima, H

    1993-04-01

    In order to characterize the dendritic field of a number of interneurons in the cerebral cortex, the labeling of extracellular sugar chains which define a subset of interneurons was combined with the subsequent intracellular filling of dyes in aldehyde-fixed tissue. Neurons whose cell body had been outlined by a lectin, Vicia villosa (VVA), which recognizes terminal N-acetylgalactosamine, were intracellularly injected with a fluorescent tracer, Lucifer yellow (LY), in the rat parietal cortex under direct visualization. After immunohistochemical detection of LY, somal morphology and the dendritic fields of injected neurons were reconstructed from serial sections and characterized in each of the layers II/III, IV, V and VI. Multipolar, flask-shaped and bitufted somata were VVA-positive. Multipolar neurons with round soma and spherical dendritic field were found in layers II/III, IV and V, while those with vertically elongated dendritic fields were found in layer VI. Cell bodies were located roughly in the center of the spherical or cylindrical dendritic fields. Neurons with apparently multipolar but flask- or pear-shaped soma were found frequently in layer IV, and much less frequently in layer II/III and VI. The majority of the dendrites originated from the neck portion of flask and formed a roughly spherical dendritic field with the cell body located more or less eccentrically. Some neurons in layer IV had an oval, somewhat vertically elongated soma and displayed a typical bitufted dendritic arborization pattern with vertically elongated dendritic fields. The overall dendritic field sizes of the cells gradually increased at deeper layers of the cortex.(ABSTRACT TRUNCATED AT 250 WORDS)

  20. Developing an Alternative Sabbatical Leave Policy.

    Science.gov (United States)

    Holleman, John J.

    A study was conducted at Vista College to compare the sabbatical leave policy of the Peralta Community College District with those of other districts and to develop alternative policies that would permit a greater number of faculty to obtain sabbatical leaves. Policy statements were received from nine of the twelve districts surveyed, and…

  1. Resilience and Young People Leaving Care

    Science.gov (United States)

    Stein, Mike

    2008-01-01

    How do we promote the resilience of young people leaving care? This article explores this question by bringing together research findings on the resilience of young people from disadvantaged family backgrounds with research studies on young people leaving care. These findings are applied to young people during their journey to adulthood: their…

  2. Recovery of protein from green leaves

    NARCIS (Netherlands)

    Tamayo Tenorio, Angelica; Gieteling, Jarno; Jong, De Govardus A.H.; Boom, Remko M.; Goot, Van Der Atze J.

    2016-01-01

    Plant leaves are a major potential source of novel food proteins. Till now, leaf protein extraction methods mainly focus on the extraction of soluble proteins, like rubisco protein, leaving more than half of all protein unextracted. Here, we report on the total protein extraction from sugar beet

  3. INTRODUCTION OF A NEW LEAVE MANAGEMENT SYSTEM

    CERN Multimedia

    DIVISION HR

    2000-01-01

    The introduction of new leave rules (arising from the RSL, PRP and other programs) has made the present leave management system rather complicated and difficult to manage. It has therefore been decided to replace it with a more flexible and adaptable system, which will come into force on 1st October 2000. Henceforth, days of leave will be credited monthly instead of annually. Members of the personnel will have round-the-clock direct access to more detailed, confidential information regarding their various kinds of leave. They will also receive a personal monthly statement with their pay slips. The new system does not require any amendment of the regulations, except with respect to the frequency of leave calculations (monthly instead of annual). I. Main characteristics of the new leave system1. The main feature of the new system is the creation of accounts to which leave will be credited or debited as appropriate. Depending on their circumstances, members of the personnel may have up to four individual leave a...

  4. INTRODUCTION OF A NEW LEAVE MANAGEMENT SYSTEM

    CERN Multimedia

    HR Division

    2000-01-01

    The introduction of new leave rules (arising from the RSL, PRP and other programmes) has made the present leave management system rather complicated and difficult to manage. It has therefore been decided to replace it with a more flexible and adaptable system, which will come into force on 1st October 2000. Henceforth, days of leave will be credited monthly instead of annually. Members of the personnel will have round-the-clock direct access to more detailed, confidential information regarding their various kinds of leave.They will also receive a personal monthly statement with their pay slips. The new system does not require any amendment of the regulations, except with respect to the frequency of leave calculations (monthly instead of annual). I. Main characteristics of the new leave system 1. The main feature of the new system is the creation of accounts to which leave will be credited or debited as appropriate. Depending on their circumstances, members of the personnel may have up to four individual leave...

  5. A Feminist Perspective on Parental Leave Policies

    Science.gov (United States)

    Sallee, Margaret W.

    2008-01-01

    This article focuses on the ways that three feminist theories--liberal feminism, cultural feminism, and feminist poststructuralism--might be used to craft parental leave policies. After examining each theory in detail, the article concludes by offering one example of an ideal parental leave policy that combines the best features of each theory to…

  6. The effect of dietary faba bean and non-starch polysaccharide degrading enzymes on the growth performance and gut physiology of young turkeys.

    Science.gov (United States)

    Mikulski, D; Juskiewicz, J; Przybylska-Gornowicz, B; Sosnowska, E; Slominski, B A; Jankowski, J; Zdunczyk, Z

    2017-12-01

    The aim of this study was to investigate the effect of dietary replacement of soya bean meal (SBM) with faba bean (FB) and a blend of non-starch polysaccharide (NSP) degrading enzymes on the gastrointestinal function, growth performance and welfare of young turkeys (1 to 56 days of age). An experiment with a 2×2 factorial design was performed to compare the efficacy of four diets: a SBM-based diet and a diet containing FB, with and without enzyme supplementation (C, FB, CE and FBE, respectively). In comparison with groups C, higher dry matter content and lower viscosity of the small intestinal digesta were noted in groups FB. The content of short-chain fatty acids (SCFAs) in the small intestinal digesta was higher in groups FB, but SCFA concentrations in the caecal digesta were comparable in groups C and FB. In comparison with control groups, similar BW gains, higher feed conversion ratio (FCR), higher dry matter content of excreta and milder symptoms of footpad dermatitis (FPD) were noted in groups FB. Enzyme supplementation increased the concentrations of acetate, butyrate and total SCFAs, but it did not increase the SCFA pool in the caecal digesta. The enzymatic preparation significantly improved FCR, reduced excreta hydration and the severity of FPD in turkeys. It can be concluded that in comparison with the SBM-based diet, the diet containing 30% of FB enables to achieve comparable BW gains accompanied by lower feed efficiency during the first 8 weeks of rearing. Non-starch polysaccharide-degrading enzymes can be used to improve the nutritional value of diets for young turkeys, but more desirable results of enzyme supplementation were noted in the SBM-based diet than in the FB-based diet.

  7. Replacement of dietary soy- with air classified faba bean protein concentrate alters the hepatic transcriptome in Atlantic salmon (Salmo salar) parr.

    Science.gov (United States)

    De Santis, Christian; Crampton, Viv O; Bicskei, Beatrix; Tocher, Douglas R

    2015-12-01

    The production of carnivorous fish such as Atlantic salmon (Salmo salar) is dependent on the availability of high quality proteins for feed formulations. For a number of nutritional, strategic and economic reasons, the use of plant proteins has steadily increased over the years, however a major limitation is associated with the presence of anti-nutritional factors and the nutritional profile of the protein concentrate. Investigating novel raw materials involves understanding the physiological consequences associated with the dietary inclusion of protein concentrates. The primary aim of the present study was to assess the metabolic response of salmon to increasing inclusion of air-classified faba bean protein concentrate (BPC) in feeds as a replacement for soy protein concentrate (SPC). Specifically, we tested treatments with identical contents of fishmeal (222.4gkg(-1)) and progressively higher inclusion of BPC (0gkg(-1), 111.8gkg(-1), 223.6gkg(-1), 335.4gkg(-1), 447.2gkg(-1)) substituting SPC. This study demonstrated a dose-dependent metabolic response to a plant ingredient and was the first to compare the nutrigenomic transcriptional responses after substitution of terrestrial feed ingredients such as BPC and SPC without withdrawal of marine ingredients. It was found that after eight weeks a major physiological response in liver was only evident above 335.4gkg(-1) BPC and included decreased expression of metabolic pathways, and increased expression of genes regulating transcription and translation processes and the innate immune response. Furthermore, we showed that the nutritional stress caused by BPC resembled, at least at hepatic transcriptional level, that caused by soybean meal (included as a positive control in our experimental design). The outcomes of the present study suggested that Atlantic salmon parr might efficiently utilize moderate substitution of dietary SPC with BPC, with the optimum inclusion level being around 120gkg(-1)in the type of feeds

  8. Impact of legume protein type and location on lipid oxidation in fish oil-in-water emulsions: Lentil, pea, and faba bean proteins.

    Science.gov (United States)

    Gumus, Cansu Ekin; Decker, Eric Andrew; McClements, David Julian

    2017-10-01

    Emulsion-based delivery systems are being developed to incorporate ω-3 fatty acids into functional foods and beverages. There is interest in formulating these delivery systems from more sustainable and label-friendly ingredients. The aim of this study was therefore to examine the impact of plant-protein emulsifiers on the oxidative stability of 1wt% fish oil-in-water emulsions. Fish oil emulsions stabilized by three types of legume protein (lentil, pea, and faba bean) were produced using a high-pressure microfluidizer. The formation of primary (peroxides) and secondary (TBARS) lipid oxidation products was measured when the emulsions were stored at 37°C under accelerated (+100μM iron sulfate) or non-accelerated (no added iron) conditions for 21 or 33days, respectively. The particle size, charge and microstructure of the emulsions were monitored during storage using light scattering and microscopy to detect changes in physical stability. Emulsions stabilized by whey protein isolate, a commonly used animal-based protein, were utilized as a control. The emulsions formed using whey protein had smaller initial particle sizes, better physical stability, and slightly better stability to lipid oxidation than the ones formed using plant-based proteins. The impact of protein location (adsorbed versus non-adsorbed) on the oxidative stability of the emulsions was also investigated. The presence of non-adsorbed proteins inhibited lipid oxidation, presumably by binding transition metals and reducing their ability to interact with ω-3 fatty acids in the lipid droplets. Overall, these results have important implications for fabricating emulsion-based delivery systems for bioactive lipids, e.g., they indicate that including high levels of non-adsorbed proteins could improve oxidative stability. Copyright © 2017. Published by Elsevier Ltd.

  9. Faba Bean: Transcriptome Analysis from Etiolated Seedling and Developing Seed Coat of Key Cultivars for Synthesis of Proanthocyanidins, Phytate, Raffinose Family Oligosaccharides, Vicine, and Convicine

    Directory of Open Access Journals (Sweden)

    Heather Ray

    2015-03-01

    Full Text Available Faba bean ( L. has been little examined from a genetic or genomic perspective despite its status as an established food and forage crop with some key pharmaceutical factors such as vicine and convicine (VC, which provoke severe haemolysis in genetically susceptible humans. We developed next-generation sequencing libraries to maximize information to elucidate the VC pathway or relevant markers as well as other genes of interest for the species. One selected cultivar, A01155, lacks synthesis of the favism-provoking factors, VC, and is low in tannin, while two cultivars, SSNS-1 and CDC Fatima, are wild-type for these factors. Tissues (5- to 6-d-old root and etiolated shoot and developing seed coat were selected to maximize the utility and breadth of the gene expression profile. Approximately 1.2 × 10 expressed transcripts were sequenced and assembled into contigs. The synthetic pathways for phosphatidylinositol or phytate, the raffinose family oligosaccharides, and proanthocyanidin were examined and found to contain nearly a full complement of the synthetic genes for these pathways. A severe deficiency in anthocyanidin reductase expression was found in the low-tannin cultivar A01155. Approximately 5300 variants, including 234 variants specific to one of the three cultivars, were identified. Differences in expression and variants potentially related to VC synthesis were analyzed using strategies exploiting differences in expression between cultivars and tissues. These sequences should be of high utility for marker-assisted selection for the key traits vicine, convicine, and proanthocyanidin, and should contribute to the scant genetic maps available for this species.

  10. Influence of pesticides on yeasts colonizing leaves.

    Science.gov (United States)

    Vadkertiová, Renata; Sláviková, Elena

    2011-01-01

    The effect of nine different pesticides on the growth of yeasts isolated from the leaves of fruit and forest trees was investigated. Four insecticides (with the active ingredients: thiacloprid, deltamethrin, lambdacyhalothrin, and thiamethoxam) and five fungicides (with the effective substances: bitertanol, kresoxim-methyl, mancozeb, trifloxystrobin, and cupric oxychloride) were tested. The concentrations of chemicals were those recommended by the manufacturers for the spraying of trees. The yeast strains isolated from the leaves of fruit trees were not sensitive to any of the insecticides. The majority of yeast strains isolated from the leaves of forest trees were either not sensitive or only to a small extent. While Rhodotorula mucilaginosa and Pichia anomala were not affected by any insecticide, the strains of Cryptococcus laurentii and Rhodotorula glutinis showed the highest sensitivity. The effects of fungicides on the growth of isolated yeasts were more substantial. The fungicide Dithane DG (mancozeb) completely inhibited the growth of all yeasts. All strains isolated from fruit tree leaves were more resistant to the tested fungicides than those isolated from the leaves of forest trees. The most resistant strains from the leaves of fruit trees belonged to the species Metschnikowia pulcherrima, Pichia anomala, and Saccharomyces cerevisiae, whereas Cryptococcus albidus and C. laurentii, originating from the leaves of forest trees, showed the highest sensitivity to fungicides.

  11. 38 CFR 21.6340 - Leaves of absence.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Leaves of absence. 21... Recipients Leaves of Absence § 21.6340 Leaves of absence. (a) General. VA may approve leaves of absence under vertain conditions. During approved leaves of absence, a ceteran shall be considered to be pursuing...

  12. EFFECT OF WATER EXTRACT FROM MINT ON SELECTED CROP PESTS FEEDING AND SURVIVAL

    Directory of Open Access Journals (Sweden)

    Barbara Biniaś

    2017-03-01

    Full Text Available The aim of the study was to determine the effect of aqueous extracts of dried mint (Mentha piperita L. in concentrations of 2%, 5% and 10%, and fresh parts of this plant, in concentrations of 10%, 20% and 30% on feeding of pea leaf weevil (Sitona lineatus L. and survival of black bean aphid (Aphis fabae Scop. on the leaves of broad bean (Vicia faba L. variety "Bartek". In the studies of the effects of aqueous extracts of mint on the dynamics of Sitona lineatus feeding on the beans leaves, 9 laboratory’s observations in 12-hour intervals was made. Leaves injuries on their edge surface caused by adult individuals were measured. Observations were carried out in 6 replicates divided into males and females. In these researches on impact of water extracts from mint on mortality of wingless females and larvae of black bean aphids, 14 laboratory’s observations in the 8-hour intervals was made. Aqueous extracts of dry and fresh peppermint significantly limited the feeding of pea leaf weevil females, and the extracts from dried material were more effective. Extracts from peppermint to a greater extent caused mortality of black bean aphid larvae compared to wingless females, and the higher the concentration of the extract the more beneficial effect was observed. An extract from dried material at a concentration of 2% was too weak to effectively combat the larvae of A. fabae, while in the case of aphid females, an effectiveness was only demonstrated for the extracts at the highest concentrations, i.e., 10% of dried and 30% of fresh peppermint.

  13. A comparison of different legume seeds as protein supplement to optimise the use of low quality forages by ruminants.

    Science.gov (United States)

    Yáñez-Ruiz, David R; Martín-García, Antonio I; Weisbjerg, Martin R; Hvelplund, Torben; Molina-Alcaide, Eduarda

    2009-02-01

    The potential of different legume seeds species, including recently new developed varieties (Vicia faba: a commercial variety and varieties Alameda, Palacio and Baraka; Lupinus angustifolius; Pisum sativum and Cicer arietinum: varieties Fardon and Zegri) as protein supplements to low quality forages was evaluated. First, the chemical composition, in vitro digestibility, in situ degradability and in vitro/in situ intestinal digestibility of legume seeds were determined. The chemical composition was rather similar within genus. Vicia faba beans contained more condensed tannins (35.8-56.4 g/kg DM) and less ether extract (12.8-9.5 g/kg DM) than the other legumes. The rumen degradability and intestinal digestibility of the undegraded protein in the rumen was very similar among the seeds, with exception of lupins, having a much higher degradation rate than the rest. Second, the fermentation characteristics of diets, which were based on two low quality forages (olive leaves and barley straw) and feed blocks without or with supplementation of legume seeds or soybean meal, were investigated by using single-flow continuous culture fermenters. In this trial, the fermentation parameters (ammonia, pH and volatile fatty acids), the microbial protein synthesis and the degradation of olive leaves and barley straw promoted by the different diets were studied. Compared to soybean meal, beans and peas showed similar suitability as protein supplements for sustaining in vitro fermentation of low-quality forages. However, our results suggest a significant interaction between the type of legume used as supplement and the type of forage used, which need to be further studied in vivo.

  14. Anthelmintic activity of leaves of justicia beddomei.

    Science.gov (United States)

    Srinivasa, U; Rao, J Venkateshwara; Krupanidhi, A M; Shanmukhappa, S

    2007-01-01

    Ethanolic and Chloroform extract of leaves of Justicia beddomei were evaluated separately for anthelmintic activity on adult Indian earthworms Pheretima posthuma, using Piperazine citrate as reference standard. The results indicated that ethanolic extract was more potent than the chloroform extract.

  15. Occupational exposures and sick leave during pregnancy

    DEFF Research Database (Denmark)

    Hansen, Mette Lausten; Thulstrup, Ane Marie; Juhl, Mette

    2015-01-01

    OBJECTIVE: This study aimed to investigate associations between work postures, lifting at work, shift work, work hours, and job strain and the risk of sick leave during pregnancy from 10-29 completed pregnancy weeks in a large cohort of Danish pregnant women. METHODS: Data from 51 874 pregnancies...... episode of sick leave as the primary outcome. RESULTS: We found statistically significant associations between all the predictors and risk of sick leave; for non-sitting work postures (HRrange 1.55-2.79), cumulative lifting HRtrend 1.29, 95% CI 1.26-1.31, shift work (HRevening 1.90, 95% CI 1...... previous findings and suggest that initiatives to prevent sick leave during pregnancy could be based on work conditions. Preventive measures may have important implications for pregnant women and workplaces....

  16. Early School Leaving: Reasons and Consequences

    Directory of Open Access Journals (Sweden)

    Erika GYÖNÖS

    2011-11-01

    Full Text Available Early school leaving represents a loss of potential that has effects on both social and economic scale (reduced social cohesion, lower financial incomes, increase of social allocations. Early school leaving has various reasons that can be either social or economic. Due to the average statistics of the 27 countries of the European Union, in 2008 78,5% of the populations of these countries went to school regularly, whereas the same statistics applied for Romania showed an extent of 78,3%. The statistics of early school leaving showed some 14, 9% in the countries of the EU, whereas in Romania this index was higher (15, 9%. Sequel to some analyses we can state that there is a strong relationship between the variables named participation in education and early school leaving; more than that, there is a strong relationship between the extent of school studies completion and the rate of unemployment.

  17. Maternity Leave: Tips for Returning to Work

    Science.gov (United States)

    ... day your maternity leave ends? Don't despair. Working mothers face many challenges, but with some planning you ... there is no such thing as a perfect mother. Working outside the home doesn't make you a ...

  18. Auxin level and regeneration of Begonia leaves.

    Science.gov (United States)

    Heide, O M

    1968-06-01

    As previously found, both the level of ether-extractable auxin (presumably indole-3-acetic acid) and the root-forming ability of B.xcheimantha leaves are increased under long-day conditions by high temperature, whereas the capacity for adventitious bud formation is reduced. However, this relation is present under relatively high light intensity only. Under the low light intensities in late fall neither auxin level nor regeneration ability were significantly affected by temperature.Dark treatment of detached leaves for 2 to 16 days greatly counteracted the inhibitory effect of high temperature on bud formation and reduced both the auxin level and the root-forming ability of the leaves.The great seasonal changes in the regeneration ability of Begonia leaves seem to be the result of a complex interaction of temperature, day-length, and daily light energy on the level of endogenous auxin and other growth regulators.

  19. Recipient-induced transfer of the symbiotic plasmid pRL1JI in Rhizobium leguminosarum bv. viciae is regulated by a quorum-sensing relay.

    Science.gov (United States)

    Danino, Vittoria E; Wilkinson, Adam; Edwards, Anne; Downie, J Allan

    2003-10-01

    Analysis of the regulation of plasmid transfer genes on the symbiotic plasmid pRL1JI in Rhizobium leguminosarum bv. viciae has revealed a novel regulatory relay that is specifically poised to detect an N-acyl-homoserine lactone (AHL) made by different cells (potential recipients of pRL1JI). Adjacent to the traI-trbBCDEJKLFGHI plasmid transfer operon on pRL1JI are two regulatory genes, bisR and traR, which encode LuxR-type quorum-sensing regulators required for conjugation. Potential recipients of pRL1JI induce the traI-trb operon and plasmid transfer via a quorum-sensing relay involving BisR, TraR and the traI-trb operon in donor cells. BisR induces expression of traR in response to N-(3-hydroxy-7-cis-tetradecenoyl)-l-homoserine lactone (3-OH-C14:1-HSL), which is produced by CinI in potential recipient strains. In donor strains (carrying pRL1JI), BisR represses the expression of the chromosomal gene cinI; this repression results in a very low level of formation of 3-OH-C14:1-HSL and hence relatively low levels of expression of traR and the traI-trb operon in strains carrying pRL1JI. However, if 3-OH-C14:1-HSL from potential recipients is present, then traR and plasmid transfer are induced. The induction of traR occurs at very low concentrations of 3-OH-C14:1-HSL (around 1 nm). TraR then induces the traI-trb operon in a quorum-sensing dependent manner in re-sponse to the TraI-made AHLs, N-(3-oxo-octanoyl)-l-homoserine lactone and N-(octanoyl)-l-homoserine lactone. The resulting autoinduction results in high levels of expression of the traI-trb operon. Premature expression of the traI-trb operon is reduced by TraM, which probably titres out TraR preventing expression of traI when there are low levels of traR expression. Expression of traR in stationary phase cells is limited by feedback inhibition mediated by TraI-made AHLs.

  20. Evaluation of microbial biomass C and N content of the soils cultivated with vetch (Vicia sativa L. and alfalfa (Medicago sativa L.

    Directory of Open Access Journals (Sweden)

    İlyas Bolat

    2016-01-01

    Full Text Available Legume forage crops have the ability of retaining free nitrogen in the air through symbiotic Rhizobium bacteria found in their roots. Additionally, microbial biomass (MB–an essential living component of soil and a significant factor influencing plant nutrient dynamics–is considered to be accurate indicator of soil’s biological condition. Given the aforementioned aspects, soil MB C (Cmic and MB N (Nmic of different legume forage crops were investigated in this study. Soil samples were taken in order to identify certain physical and chemical characteristics of the soil using volume cylinders (0 – 6.5 cm depth from Vicia sativa L. (VSP and Medicago sativa L. planted (MSP areas. To determine the Cmic and Nmic contents, topsoil samples were also taken from 0 – 6.5 cm depth. Cmic and Nmic contents were identified using chloroform – fumigation – extraction method. There was no statistical significance for particle density, bulk density, electrical conductivity, CaCO3 %, and decomposition ratio (Corg/Ntotal of the VSP and MSP soil (P > 0.05. However, some other soil characteristics such as temperature, porosity, sand, silt and clay contents, pH, organic C and total N differed significantly (P < 0.05. Compared to VSP soil, the Cmic contents were determined to be 27 % higher (P < 0.05 in MSP soil. In VSP soil, the soil Nmic content ranged from 83.38 µg g-1 to 124.67 µg g-1, while it ranged from 91.62 µg g-1 to 187.07 µg g-1 in MSP soil. The Nmic content of the MSP soil was observed to be approximately 35 % higher than VSP soil, and a statistically significant difference (P < 0.05 was noticed between the two. Moreover, a significant positive correlation was found not only between the Cmic and organic C contents (r = 0.667; P < 0.05 but also between the Nmic and total N contents of MSP and VSP soil (r = 0.881; P < 0.01. The results of the study revealed that soil Cmic and Nmic values differ as the types of planted legume forage crops

  1. Fathers, Parental Leave and Gender Norms

    OpenAIRE

    Unterhofer, Ulrike; Wrohlich, Katharina

    2017-01-01

    Social norms and attitudes towards gender roles have been shown to have a large effect on economic outcomes of men and women. Many countries have introduced policies that aim at changing gender stereotypes, for example fathers' quota in parental leave schemes. In this paper, we analyze whether the introduction of the fathers' quota in Germany in 2007, that caused a sharp increase in the take-up of parental leave by fathers, has changed the attitudes towards gender roles in the grandparents' g...

  2. Peer effects in parental leave decisions

    OpenAIRE

    Welteke, Clara; Wrohlich, Katharina

    2016-01-01

    This paper analyzes to what extent parental leave decisions of mothers with young children depend on the decisions made by their coworkers. The identification of peer effects, which are defined as indirect effects of the behavior of a social reference group on individual outcomes, bears various challenges due to correlated characteristics within social groups and endogenous group membership. We overcome these challenges by exploiting quasi-random variation in the costs of parental leave durin...

  3. Short-Term Saved Leave Scheme

    CERN Multimedia

    HR Department

    2007-01-01

    As announced at the meeting of the Standing Concertation Committee (SCC) on 26 June 2007 and in http://Bulletin No. 28/2007, the existing Saved Leave Scheme will be discontinued as of 31 December 2007. Staff participating in the Scheme will shortly receive a contract amendment stipulating the end of financial contributions compensated by save leave. Leave already accumulated on saved leave accounts can continue to be taken in accordance with the rules applicable to the current scheme. A new system of saved leave will enter into force on 1 January 2008 and will be the subject of a new im-plementation procedure entitled "Short-term saved leave scheme" dated 1 January 2008. At its meeting on 4 December 2007, the SCC agreed to recommend the Director-General to approve this procedure, which can be consulted on the HR Department’s website at the following address: https://cern.ch/hr-services/services-Ben/sls_shortterm.asp All staff wishing to participate in the new scheme ...

  4. Short-Term Saved Leave Scheme

    CERN Multimedia

    2007-01-01

    As announced at the meeting of the Standing Concertation Committee (SCC) on 26 June 2007 and in http://Bulletin No. 28/2007, the existing Saved Leave Scheme will be discontinued as of 31 December 2007. Staff participating in the Scheme will shortly receive a contract amendment stipulating the end of financial contributions compensated by save leave. Leave already accumulated on saved leave accounts can continue to be taken in accordance with the rules applicable to the current scheme. A new system of saved leave will enter into force on 1 January 2008 and will be the subject of a new implementation procedure entitled "Short-term saved leave scheme" dated 1 January 2008. At its meeting on 4 December 2007, the SCC agreed to recommend the Director-General to approve this procedure, which can be consulted on the HR Department’s website at the following address: https://cern.ch/hr-services/services-Ben/sls_shortterm.asp All staff wishing to participate in the new scheme a...

  5. A compositional study of Moringa stenopetala leaves.

    Science.gov (United States)

    Abuye, C; Urga, K; Knapp, H; Selmar, D; Omwega, A M; Imungi, J K; Winterhalter, P

    2003-05-01

    To investigate nutrient composition in moringa leaves and compare with those of kale (Brassica carinata) and Swiss chard (Beta vulgaris). Laboratory based study, nutrient composition of fresh and cooked leaves of M. stenopetala were analyzed. Gama-Gofa, south-western Ethiopia. Raw M. stenopetala leaves contain 9% dry matter as crude protein, about 3-fold lower than in kale and swiss chard. M. stenopetala leaves contain higher percentage of carbohydrate, crude fiber and calcium compared to both raw and cooked kale and swiss chard. Vitamins are present at nutritionally significant levels averaging 28 mg/100g of vitamin C and 160 microg/100g of beta-carotene. Minerals such as potassium, iron, zinc, phosphorus and calcium also exist in significant concentrations with the average values of 3.08 mg/100g iron and 792.8 mg/100g calcium. Although the nutrient composition of M. stenopetala leaves in most cases is lower compared to kale and swiss chard they can be a good source of nutrients in dry season potentially when other vegetables are scarce. However, the presence of small amount of cyanogenic glucosides in M. stenopetala leaves may have a health risk in areas of high incidence of endemic goitre as an exacerbating factor if consumed more for a long period of time.

  6. Office design's impact on sick leave rates.

    Science.gov (United States)

    Bodin Danielsson, Christina; Chungkham, Holendro Singh; Wulff, Cornelia; Westerlund, Hugo

    2014-01-01

    The effect of office type on sickness absence among office employees was studied prospectively in 1852 employees working in (1) cell-offices; (2) shared-room offices; (3) small, (4) medium-sized and (5) large open-plan offices; (6) flex-offices and (7) combi-offices. Sick leaves were self-reported two years later as number of (a) short and (b) long (medically certified) sick leave spells as well as (c) total number of sick leave days. Multivariate logistic regression analysis was used, with adjustment for background factors. A significant excess risk for sickness absence was found only in terms of short sick leave spells in the three open-plan offices. In the gender separate analysis, this remained for women, whereas men had a significantly increased risk in flex-offices. For long sick leave spells, a significantly higher risk was found among women in large open-plan offices and for total number of sick days among men in flex-offices. A prospective study of the office environment's effect on employees is motivated by the high rates of sick leaves in the workforce. The results indicate differences between office types, depending on the number of people sharing workspace and the opportunity to exert personal control as influenced by the features that define the office types.

  7. [Extraction and determination of essential oils in Indocalamus latifolius leaves and Indocalamus tessellatus leaves].

    Science.gov (United States)

    Li, Shuifang; Wen, Ruizhi; Zeng, Dong; Li, Zhonghai

    2007-01-01

    Indocalamus leaves are the generic name of the leaves of Indocalamus (Graminales) plants. The essential oils in Indocalamus latifolius leaves and Indocalamus tessellatus leaves were extracted by steam distillation method. Ether was used as the solvent to extract volatile compounds many times. Both the volatile compounds in Indocalamus latifolius leaves and Indocalamus tessellatus leaves were analyzed by gas chromatography-mass spectrometry (GC-MS). The results showed that thirty-seven compounds were identified for the essential oils extracted from Indocalamus latifolius leaves, and its main components were found to be 3-hexen-1-ol, (Z)-; 1-hexanol; benzyl alcohol; hexanal; furan, 2-ethyl-; 3-buten-2-one, 4-(2,6, 6-trimethyl-1-cyclohexen-1-yl), (E)-; etc. Forty-nine components were identified for the essential oils extracted from Indocalamus tessellatus leaves, and its main components were found to be 3-hexen-1-ol, (Z)-; benzyl alcohol; 3-buten-2-one, 4-(2,6,6-trimethyl-1-cyclohexen-1-yl)-, (E)-; 2-hexenal; phenylethyl alcohol, 2-methoxy-4-vinylphenol; furan, 2-ethyl-; etc. 3-Hexen-1-ol, (Z)- was the most abundant compound in the essential oils from both Indocalamus leaves. There were ketone, aldehyde, alcohol, phenol and ester in them. The contents of ketones, aldehydes, and alcohols were found higher than those of other compounds in the two essential oils.

  8. Amino acids and energy utilization in zero-tannin faba bean and co-fermented wheat and corn dried distillers grains with solubles fed to growing pigs.

    Science.gov (United States)

    Kiarie, E; Lopez, P; Furedi, C; Nyachoti, C M

    2013-04-01

    Application of alternative feedstuffs in swine diets will be dependent on characterization of their nutritive value. In 2 experiments, we determined the AA and energy utilization of Manitoba-grown zero-tannin faba beans (ZTFB) and co-fermented wheat and corn dried distillers grains with solubles (wcDDGS). Corn dried distillers grains with solubles (cDDGS) was also included for comparison. In Exp. 1, 6 ileal cannulated barrows (29.3 ± 1.3 kg) were fed 3 diets in a replicated 3 × 3 Latin square design to determine the apparent (AID) and standardized (SID) ileal digestibility of AA. The 3 diets contained ZTFB, wcDDGS, or cDDGS as the sole source of AA. The SID of N and AA were calculated using published values for ileal endogenous N and AA losses from our laboratory. In Exp. 2, 12 intact barrows (22.5 ± 1.1 kg) were fed 4 diets in a two 15-d period crossover design to determine DE and ME contents of the test ingredients by difference method. The diets were a basal corn-based diet or the basal diet with corn replaced by 46% ZTFB, wcDDGS, or cDDGS. The concentrations (DM basis) of GE (kcal/kg), CP (%), and Lys (%) in ZTFB were 4,144, 27, and 1.6, respectively, and corresponding values for wcDDGS were 5,112, 31, and 0.8. The ZTFB had greater (P content (g/kg DM) of Lys in ZTFB (13.5) was greater (P contents of sulfur AA (Met and Cys) compared with ZTFB. The ME content (kcal/kg DM) of ZTFB (3,548) was less (P content of wcDDGS (3,669) was similar to that of ZTFB or cDDGS. The results showed that ZTFB has greater digestible Lys whereas wcDDGS has greater digestible sulfur AA but both ingredients have comparable ME content. Therefore, a blend of these 2 ingredients can serve as an excellent source of AA and energy for swine.

  9. The extraction of characteristic wavebands for radish leaves and rice leaves based on LCTF imaging method

    Science.gov (United States)

    Cao, Peng-fei; Feng, Jie; Li, Hong-ning

    2013-08-01

    In order to identify and classify horticultural crops rapidly, it is great importance of selecting effective characteristic wavebands from a large number of imaging data. Extracting effective characteristic wavebands can nearly represent holistic information of the research target from rich imaging spectral data, mainly used for rapid characteristic identification, cluster analysis and establishing database, especially in high spectral sensing to recognize targets for a long distance. The experiment chooses radish leaves and rice leaves as research samples so as to obtain spectral information from the surface of samples by interval of 5nm based on LCTF imaging; then, the standard deviation and correlation coefficient of the gray images are calculated for these two kinds of leaves; next, we calculate the value of waveband index according to standard deviation and correlation coefficient, and extract the effective characteristic wavebands for radish leaves and rice leaves through the sorting of waveband index. By those, the experimental results show there are six ideal wavebands at 530nm, 550nm, 555nm, 715nm, 510nm and 565nm for radish leaves, 645nm, 675nm, 685nm, 670nm, 690nm and 660nm for rice leaves separately. Further, according to the principle of Euclidean distance, we also give an assessment of classification accuracy for these two samples by comparing characteristic wavebands with full wavebands, and the classification accuracy of radish leaves and rice leaves is 80.00% and 86.67% respectively. Therefore, choosing these wavebands can be used as effective characteristic wavebands for radish leaves and rice leaves.

  10. University Students Leaving Relationships (USLR): Scale Development and Gender Differences in Decisions to Leave Romantic Relationships

    Science.gov (United States)

    Hendy, Helen M.; Can, S. Hakan; Joseph, Lauren J.; Scherer, Cory R.

    2013-01-01

    The University Students Leaving Relationships scale was developed to identify student concerns when contemplating dissolution of romantic relationships. Participants included 1,106 students who rated the importance of issues when deciding to leave relationships. Factor analysis produced three dimensions: Missing the Relationship, Social…

  11. Leaving home and leaving the state: evidence from the United States

    NARCIS (Netherlands)

    Mulder, C.H.; Clark, W.A.V.

    2000-01-01

    Leaving the parental home is an important first step in a long-term housing career. We extend the previous research on this topic by examining the impact of housing market factors on the risks of leaving with or without a partner in the United States. We also re-examine the role of the income of the

  12. [Chemical Constituents from Leaves of Liquidambar formosana].

    Science.gov (United States)

    Liao, Yuan-yue; Fu, Hui-zheng; Zhou, Guo-ping; Zhong, Rui-jian; Yuan, Hui; Guo, Qing; Yan, Qing-wei

    2014-12-01

    To study the chemical constituents of the leaves of Liquidambarformosana. The chemical constituents were isolated and purified by column chromatography on silicagel, Sephadex LH-20 and MPLC. Their structures were elucidated on the basis of physicochemical properties and special analysis. Eight compounds were isolated from the leaves of Liquidambar formosana, whose structures were elucidated as gallic acid (1), p-hydroxy-benzoic acid (2), 3-methoxy-4-hydroxy-benzoic acid (3), 3,5-dihydroxy-4-methoxy-benzoic acid (4) kaempferol (5), 3,4-dihydroxy-benzoic acid (6), 3,4-dihydroxy-5-methoxy-benzoic acid (7) and 3β,23,29-trihydroxy-olean-12-en-28-oic acid-β-D-glucopyranosyl ester (8). Compounds 1-8 are isolated from the leaves of Liquidambar formosana for the first time.

  13. 38 CFR 21.8340 - Leaves of absence.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Leaves of absence. 21... Vietnam Veterans-Spina Bifida and Covered Birth Defects Leaves of Absence § 21.8340 Leaves of absence. (a... absence. The VR&E case manager may grant the child leaves of absence for periods during which the child...

  14. Research and Literature on the Sabbatical Leave: A Review.

    Science.gov (United States)

    Boening, Carl H.; Miller, Michael T.

    This paper reviews the literature on college faculty sabbatical leave and sabbatical leave programs often described as 'paid vacations' with no accountability. The literature indicates that sabbatical leave was an important part of any faculty development program. Those who took sabbatical leaves overwhelmingly reported the experience as a…

  15. Constituents of Kawal , fermented Cassia obtusifolia leaves, a ...

    African Journals Online (AJOL)

    Examination of the protein fraction from leaves indicated 20.2% in the crude leaves and 12.9% in the fermented leaves. The participation of 10 g of fermented C. obtusifolia leaves to the daily requirements in essential amino acids of an adult is from 13 to 25% of needed amount. Moreover this traditional food had a high ...

  16. 38 CFR 21.342 - Leave accounting policy.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Leave accounting policy. 21.342 Section 21.342 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS.... Chapter 31 Leaves of Absence § 21.342 Leave accounting policy. (a) Amount of leave. A veteran pursuing one...

  17. [Considerations on a room for leave taking].

    Science.gov (United States)

    Drlicek, M; Kraml, P

    2006-05-01

    Many patients die in hospitals and care centers. It is therefore necessary to create an environment for the dying person, as well as for relatives, which allows death to occur with dignity while also permitting a dignified farewell. A special room should be available for taking leave of the loved one and for the mourning of the relatives. This room should, as far as possible, be neutrally decorated while at the same time it should be appropriate for various cultures and religious requirements. In order to be able to take leave symbolically, it is necessary to place the departed in the light, for example from a window.

  18. Paid maternity and paternity leave: rights and choices.

    Science.gov (United States)

    Jordan, Claire

    2007-01-01

    From April 2007 onwards, maternity leave will be raised to nine months Paid maternity leave is associated with significant health benefits for babies, including reduced infant mortality The Government proposes to increase paid maternity leave to one year and introduce additional paternity leave by around 2009 The U.K's provision for maternity leave and child care is more generous than the U.S.A. or Australia but less than in the Scandinavian countries

  19. Characterization of non-host resistance in broad bean to the wheat stripe rust pathogen

    Directory of Open Access Journals (Sweden)

    Cheng Yulin

    2012-06-01

    Full Text Available Abstract Background Non-host resistance (NHR confers plant species immunity against the majority of microbial pathogens and represents the most robust and durable form of plant resistance in nature. As one of the main genera of rust fungi with economic and biological importance, Puccinia infects almost all cereals but is unable to cause diseases on legumes. Little is known about the mechanism of this kind of effective defense in legumes to these non-host pathogens. Results In this study, the basis of NHR in broad bean (Vicia faba L. against the wheat stripe rust pathogen, Puccinia striiformis f. sp. tritici (Pst, was characterized. No visible symptoms were observed on broad bean leaves inoculated with Pst. Microscopic observations showed that successful location of stomata and haustoria formation were significantly reduced in Pst infection of broad bean. Attempted infection induced the formation of papillae, cell wall thickening, production of reactive oxygen species, callose deposition and accumulation of phenolic compounds in plant cell walls. The few Pst haustoria that did form in broad bean cells were encased in reactive oxygen and callose materials and those cells elicited cell death. Furthermore, a total of seven defense-related genes were identified and found to be up-regulated during the Pst infection. Conclusions The results indicate that NHR in broad bean against Pst results from a continuum of layered defenses, including basic incompatibility, structural and chemical strengthening of cell wall, posthaustorial hypersensitive response and induction of several defense-related genes, demonstrating the multi-layered feature of NHR. This work also provides useful information for further determination of resistance mechanisms in broad bean to rust fungi, especially the adapted important broad bean rust pathogen, Uromyces viciae-fabae, because of strong similarity and association between NHR of plants to unadapted pathogens and basal

  20. GRAPE LEAVES AND METHODS OF CONSERVATION

    Directory of Open Access Journals (Sweden)

    G. N. Terentyeva

    2014-01-01

    Full Text Available The article presents the results of a study of different varieties of grape leaves showing its morphological data and physico-chemical parameters. Studying shows canned grape leaf in various ways for the food industry.

  1. ELEMENTAL ANALYSIS OF THE LEAVES OF VERNONIA ...

    African Journals Online (AJOL)

    Elemental analysis of the leaves of Vernonia amygdalina Del., revealed adequate concentrations of some elements, such as iron (1500+111 ppm) and calcium 10100+895 ppm) that are believed to be essential for normal growth. The plant was evaluated in relation to tissue damage, in sixteen male rats (Wistar strains) with ...

  2. Tomato leaves methanol extract possesses anti- inflammatory ...

    African Journals Online (AJOL)

    GREGORY

    2011-12-16

    Dec 16, 2011 ... and antioxidant (lycopene) (Junichiro, 2006). Since S. lycopersicum has long been used for the treatment of variety of disease, the present study aimed to investigate the inhibitory activity of tomato leaves against PGE2 using. RAW264.7 macrophages cells and introduce a new potential of anti-inflammatory ...

  3. How does Phytophthora ramorum infect Rhododendron leaves?

    Science.gov (United States)

    Sabine Werres; Marko Riedel

    2013-01-01

    In most parts of Europe, rhododendron is the most important host for the spread of Phytophthora ramorum. To get a better knowledge of leaf infection and capacity for sporulation, infection studies were carried out. Detached leaves of the Rhododendron cultivar 'Catawbiense Grandiflorum' (CG) and the R. insigne hybrid `...

  4. Pharmacognostic standardisation of the leaves of Sansevieria ...

    African Journals Online (AJOL)

    Chromatographic fingerprints of both water and ethanol extracts of the leaves were obtained using analytical thin-layer chromatography (TLC) and the retardation factors (Rf-values) of the individual spots were calculated. Macroscopic examination showed dark green coloration on the upper surface and pale green on the ...

  5. Leaving the hospital - your discharge plan

    Science.gov (United States)

    ... medlineplus.gov/ency/patientinstructions/000867.htm Leaving the hospital - your discharge plan To use the sharing features on this ... need any special equipment or supplies, such as: Hospital bed Wheelchair Walker or cane Shower ... Checklist Your discharge planner will give you a ...

  6. Utilization of bitter vegetable leaves ( Gongronema latifolium ...

    African Journals Online (AJOL)

    Utilization of bitter vegetable leaves ( Gongronema latifolium , Vernonia amygdalina ) and Garcinia kola extracts as substitutes for hops in sorghum beer production. ... titratable acidity (0.107 - 0.328%), volatile acidity (0.003 - 0.103%), soluble solids (0.12 - 0.97%), moisture content (95.71 - 98.37%), protein (0.17 - 0.85%), ...

  7. Sabbatical Leave: Who Gains and How Much?

    Science.gov (United States)

    Davidson, Oranit B.; Eden, Dov; Westman, Mina; Cohen-Charash, Yochi; Hammer, Leslie B.; Kluger, Avraham N.; Krausz, Moshe; Maslach, Christina; O'Driscoll, Michael; Perrewe, Pamela L.; Quick, James Campbell; Rosenblatt, Zehava; Spector, Paul E.

    2010-01-01

    A rigorous quasi-experiment tested the ameliorative effects of a sabbatical leave, a special case of respite from routine work. We hypothesized that (a) respite increases resource level and well-being and (b) individual differences and respite features moderate respite effects. A sample of 129 faculty members on sabbatical and 129 matched controls…

  8. Early school leaving and lifelong guidance

    DEFF Research Database (Denmark)

    Plant, Peter; Oomen, Annemarie

    Early school leaving (ESL) is costly for the individual, for society and for the economy. Not just in economic terms, but also in terms of low self esteem, and the risk of social exclusion. More, and, in particular, better education can lead to positive outcomes, in relation to employment, level...

  9. Comparative morphology on leaves of Daphniphyllum (Daphniphyllaceae)

    NARCIS (Netherlands)

    Tang, M.-S.; Yang, Y.-P.; Sheue, C.-R.

    2009-01-01

    A comparative anatomical study on the leaves of nine out of 29 species of the genus Daphniphyllum was performed to seek support for the present infrageneric classification. Daphniphyllum is composed of two sections, Lunata (with one subsection Lunata) and Daphniphyllum (with two subsections,

  10. Institutional Practices and Faculty Who Leave.

    Science.gov (United States)

    Patton, Carl V.

    1983-01-01

    A variety of incentives offered to faculty to leave an institution in difficult financial circumstances are outlined. They include: liberalizing the actuarial pension reduction, lump-sum severance payments, annuity enhancements, phased retirement, retirement perquisites, retraining for outplacement, paid retraining, and earnings supplements during…

  11. Paid Educational Leave in Five European Countries.

    Science.gov (United States)

    Luttringer, Jean-Marie; Pasquier, Bernard

    1980-01-01

    Examining and comparing the features of paid educational leave in Belgium, France, Germany, Italy, and Sweden, the authors conclude that it remains a marginal institution. But as a means of achieving social justice and industrial change, it deserves an adequate financing system and institutional base. (Author/SK)

  12. Leaving Care: The Need to Make Connections

    Science.gov (United States)

    Coyle, Deirdre; Pinkerton, John

    2012-01-01

    For too many years the phrase "after care, an after thought" summed up the lack of attention given to preparing young people in care for adult life and to the development of leaving-care and aftercare services. That stance has changed in the United Kingdom, however, and indeed has shifted positively and dramatically over the last decade.…

  13. Thaumatococcus daniellii leaves: its chemical compositions ...

    African Journals Online (AJOL)

    Methanol extract of the plant exhibited low 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging activity with IC50 of 615.14 μg/ml. Gas chromatography-mass spectrometry (GC-MS) characterization of n-hexane, ethylacetate and methanol extracts of T. daniellii leaves identified , thirteen and fifteen compounds, with ...

  14. Isolation of chlorophyll a from spinach leaves

    Directory of Open Access Journals (Sweden)

    E.D. Dikio

    2008-08-01

    Full Text Available An efficient method for separating chlorophyll a from spinach leaves by column chromatography and solvent extraction techniques has been developed. The purity and identity of the chlorophyll a have been confirmed by UV-Vis, IR and mass spectrometry. Yields from 100 g of freeze-dried spinach were 23 – 24 mg of chlorophyll a.

  15. Antinociceptive effect of Hyptis pectinata leaves extracts.

    Science.gov (United States)

    Lisboa, Ana C C D; Mello, Iderjane C M; Nunes, Rogeria S; Dos Santos, Marquês A; Antoniolli, Angelo R; Marçal, Rosilene M; Cavalcanti, Sócrates C de H

    2006-09-01

    Oral administration of hexanes, chloroform, and ethyl acetate extracts of the leaves of Hyptis pectinata significantly reduced the number of writhing induced by acetic acid and increased the response to thermal stimuli in hot-plate test. Such effect was completely reversed by the opioid antagonist naloxone.

  16. Fathers' Leave, Fathers' Involvement and Child Development

    DEFF Research Database (Denmark)

    del Carmen Huerta, Maria; Lausten, Mette; Baxter, Jennifer

    Previous research has shown that fathers taking some time off work around childbirth, especially periods of leave of 2 or more weeks, are more likely to be involved in childcare related activities than fathers who do not do so. Furthermore, evidence suggests that children with fathers who are ‘mo...

  17. Anbautelegramm Saatwicke (Vicia sativa L.)

    OpenAIRE

    Böhm, Herwart; Weissmann, Elmar

    2013-01-01

    Für den Anbau von Saatwicken werden in einem kurzgefassten Anbautelegramm die Stärken und Schwächen sowie grundlegende Kennwerte zu Standortansprüchen, Aussaat, Unkrautregulierung, Nährstoffbedarf und Schaderregern beschrieben.

  18. Causes and Consequences of a Father's Child Leave: Evidence from a Reform of Leave Schemes

    DEFF Research Database (Denmark)

    Nielsen, Helena Skyt

    are the most progressive when it comes to family-friendly policies. An extensive reform of child leave schemes in Denmark affected couples differently depending on whether the parents where employed in the same or in different parts of the public sector. Based on a difference-in-differences strategy, I find...... that economic incentives are very important for intra-household leave-sharing. Increasing the couples' after tax income by $9 per day of leave which is transferred from the mother to the father is found to lead to a one day transfer. This corresponds to a supply elasticity close to unity....

  19. The responses of guard and mesophyll cell photosynthesis to CO2, O2, light, and water stress in a range of species are similar.

    Science.gov (United States)

    Lawson, Tracy; Oxborough, Kevin; Morison, James I L; Baker, Neil R

    2003-07-01

    High resolution chlorophyll a fluorescence imaging was used to compare the photosynthetic efficiency of PSII electron transport (estimated by Fq'/Fm') in guard cell chloroplasts and the underlying mesophyll in intact leaves of six different species: Commelina communis, Vicia faba, Amaranthus caudatus, Polypodium vulgare, Nicotiana tabacum, and Tradescantia albifora. While photosynthetic efficiency varied between the species, the efficiencies of guard cells and mesophyll cells were always closely matched. As measurement light intensity was increased, guard cells from the lower leaf surfaces of C. communis and V. faba showed larger reductions in photosynthetic efficiency than those from the upper surfaces. In these two species, guard cell photosynthetic efficiency responded similarly to that of the mesophyll when either light intensity or CO2 concentration during either measurement or growth was changed. In all six species, reducing the O2 concentration from 21% to 2% reduced guard cell photosynthetic efficiency, even for the C4 species A. caudatus, although the mesophyll of the C4 species did not show any O2 modulation of photosynthetic efficiency. This suggests that Rubisco activity is significant in the guard cells of these six species. When C. communis plants were water-stressed, the guard cell photosynthetic efficiency declined in parallel with that of the mesophyll. It was concluded that the photosynthetic efficiency in guard cells is determined by the same factors that determine it in the mesophyll.

  20. Women's Reasons for Leaving the Engineering Field.

    Science.gov (United States)

    Fouad, Nadya A; Chang, Wen-Hsin; Wan, Min; Singh, Romila

    2017-01-01

    Among the different Science, Technology, Engineering, and Math fields, engineering continues to have one of the highest rates of attrition (Hewlett et al., 2008). The turnover rate for women engineers from engineering fields is even higher than for men (Frehill, 2010). Despite increased efforts from researchers, there are still large gaps in our understanding of the reasons that women leave engineering. This study aims to address this gap by examining the reasons why women leave engineering. Specifically, we analyze the reasons for departure given by national sample of 1,464 women engineers who left the profession after having worked in the engineering field. We applied a person-environment fit theoretical lens, in particular, the Theory of Work Adjustment (TWA) (Dawis and Lofquist, 1984) to understand and categorize the reasons for leaving the engineering field. According to the TWA, occupations have different "reinforcer patterns," reflected in six occupational values, and a mismatch between the reinforcers provided by the work environment and individuals' needs may trigger departure from the environment. Given the paucity of literature in this area, we posed research questions to explore the reinforcer pattern of values implicated in women's decisions to leave the engineering field. We used qualitative analyses to understand, categorize, and code the 1,863 statements that offered a glimpse into the myriad reasons that women offered in describing their decisions to leave the engineering profession. Our results revealed the top three sets of reasons underlying women's decision to leave the jobs and engineering field were related to: first, poor and/or inequitable compensation, poor working conditions, inflexible and demanding work environment that made work-family balance difficult; second, unmet achievement needs that reflected a dissatisfaction with effective utilization of their math and science skills, and third, unmet needs with regard to lack of recognition

  1. Don’t leave your baggage unattended

    CERN Multimedia

    2016-01-01

    “Don’t leave your baggage unattended” is a familiar request to anyone who travels by air, but it’s good advice wherever you may be.    At CERN, if an unattended bag is found anywhere on the site, the Fire and Rescue service will be called to evacuate the area, maintain a security perimeter for as long as necessary, and attempt to identify the owner. If the owner cannot be found in a reasonable amount of time, there’s a very strong chance that the bag will be destroyed. You can take two simple steps to avoid this fate: Don’t leave your baggage unattended;   Make sure that your contact details are clearly visible on the bag or suitcase so that, should you find yourself separated from it, you can easily be reunited.

  2. 'Dew nucleation' by hygroscopic particles on leaves

    Science.gov (United States)

    Burkhardt, J.; Hunsche, M.; Pariyar, S.

    2010-07-01

    Theoretical explanations of dew formation usually consider a pure, plain surface and do not include any contributions of hygroscopic material present on this surface. A significant amount of hygroscopic material, however, is present on most real leaves, due to accumulated deposited aerosols, salt exudations, leached ions, or agricultural sprays. Similarly to cloud nucleation, hygroscopic material on leaves leads to a significant reduction of saturation vapor pressure and enables 'dew nucleation', where the condensation of minute amounts of water is still too small to be visible without a microscope. This may happen at humidities far below saturation, dependent on the composition and deliquescence point of the particles; additionally plant transpiration often raises the humidity on the leaf surface. While the amounts of water involved are not significant in terms of the energy or water balance, the ecological consequences of such condensation mechanisms on leaves may be considerable. Highly concentrated but mobile solutions are formed by the deliquescence of hygroscopic particles, which may provide important nutrients for the plant. Their chemistry differs considerably from dilute solutions. When viewed by an environmental scanning electron microscope (ESEM), oscillating humidity led to the expansion of salts even on hydrophobic leaf surfaces. This may lead to the ’hydraulic activation of stomata (HAS)’, a process leading to the extension of liquid water films into the plant and subsequent transport of liquid water and solutes on the stomatal pathway, a meanwhile well-proven contradiction to previous concepts. Apart from the nutritional aspects, hygroscopic substances on leaves will interact with plant water relations. Depending on the degree of stomatal activation, this may trigger useful hydraulic signaling or provoke deleterious wicking and reduced drought tolerance of the plant.

  3. The Antidiabetic Potential Of Jatropha tanjorensis Leaves ...

    African Journals Online (AJOL)

    In Southwest Nigeria, infusion of Jatropha tanjorensisi leaves is taken orally for the treatment of diabetic symptoms. The hypoglycemic effect of EtOH/H2O (1:1) leaf extract was evaluated in fasted and glucose-loaded rats at the doses of 1 and 2g/kg in-vivo, while three fractions of the extract were assessed for their ...

  4. A new sesquiterpene lactone from yacon leaves.

    Science.gov (United States)

    Yuan, Ying; Win Aung, Khin Khin; Ran, Xiao-Ku; Wang, Xiao-Tong; Dou, De-Qiang; Dong, Feng

    2017-01-01

    The chemical constituents of 60% EtOH extract of yacon leaves were separated to yield a new compound, together with four known compounds, which were isolated for the first time from yacon. The new compound was characterised and named as chlorodalin (1) on the basis of NMR (1D and 2D), HR-MS and other spectral methods. The cytotoxic activities of 1-5 were evaluated on two human tumour cell lines and the new compound showed significant cytotoxic activity.

  5. Research of photoinduced potentials of pepper leaves

    OpenAIRE

    D. V. Chernetchenko; MOTSNYJ M.P.; N. P. Botsva; О. V. Elina

    2015-01-01

    Bioelectrical potentials of the plants during photostimulation with various intensity values and wave lengths are studied. Such stimulation provides light-dependent reactions of photosynthesis. The universal scheme of registration of bioelectric potentials, which allows to carry out the experimental study of light stimuli effect on the plant is proposed. All registrations of potentials are observed on the pepper leaves. Photoinduced stimuli are different with intensity changed from 150 to 450...

  6. Newbouldia laevis leaves extract: Nutritive value, Phytochemical ...

    African Journals Online (AJOL)

    Data were collected on weekly performance and faecal egg count of experimental rams. The Newbouldia laevis leaves extract contained 55% moisture, 5.68% crude protein, 5.61% crude fat, 10.54% crude fibre, 2.15% total ash, 21.02% NFE and 20.22% NDF. It also had 0.00015 %, 0.00229 %, 39.2 %, 2.5 %, 0.00296 % ...

  7. Acute Toxicity of Justicia gendarussa Burm. Leaves

    Directory of Open Access Journals (Sweden)

    Juheini Amin

    2010-11-01

    Full Text Available Acute Toxicity of Justicia gendarussa Burm. Leaves. Preminelary experiment showed that ethanolic extract ofgandarusa leaves (Justicia gendarussa Burm. could decreased uric acid blood level on rats. The aim of this experimentwas to determine of the value LD50 and liver function based on activities of aminotransferase. Animals test which wereused in this experiment were 50 males and 50 females white mice. They were divided into 5 groups. Group 1 as controlgroup was given aquadest. Group 2-5 were treated by ethanolic extract of gandarusa leaves with dosage 4, 8, 16, and 32g/kg bw. The LD50 value was determined by the amount of death in group during 24 hours after giving a single dose oftest substance. The result showed that the highest dose was practically non toxic with LD50 value of 31.99 g/kg bw(male groups and 27.85 g/kg bw (female groups. Measurement of aminotransferase activity was done by usingcolorimetric method. The result of ANOVA analysis for liver function showed that the giving test substance 4 g/kg bw–16 g/kg bw was not significantly different between treated groups and control group.

  8. Why Patients Leave the Hospital Against Doctor's Orders

    Science.gov (United States)

    ... medlineplus.gov/news/fullstory_166746.html Why Patients Leave the Hospital Against Doctor's Orders It's a growing ... are much more likely than older patients to leave the hospital against the advice of their doctor. ...

  9. Identification of markers associated with genes for rust resistance in lens culinaris medik

    Science.gov (United States)

    Lentil rust caused by Uromyces vicia-fabae (Pers.) Schroet is one of the most important diseases of lentil in South Asia, North Africa and East Africa. This disease is usually observed during late flowering and early podding stages. Early infection accompanied by favorable environmental conditions c...

  10. Of mice and men

    CERN Multimedia

    1973-01-01

    At the end of March , sixty mice were irradiated at the synchro-cyclotron in the course of an experimental programme studying radiation effects on mice and plants (Vicia faba bean roots) being carried out by the CERN Health Physics Group.

  11. EJST V9N2

    African Journals Online (AJOL)

    aestivum) horse beans (Vicia faba), peas (Pisum sativum), potato (Solanum tubersoum,), teff. (Eragrostis tef), and maize (Zea mays) crops grown under rain fed ...... He, Z.L., Alva, A.K., Calvert, D.V., Li Y.C and Banks, D.J (1999). Effects of nitrogen fertilization of grapefruit trees on soil acidification and nutrient availability in.

  12. Nieuwe eiwitgewassen voor de voeding van varkens in de biologische houderij

    NARCIS (Netherlands)

    Balkema, A.

    2004-01-01

    Voor biologische veehouders geldt vanaf 2005 de eis dat alle voeders van biologische oorsprong dienen te zijn. In deze deskstudie worden de eigenschappen en potentie van alternatieve eiwitgewassen beschreven. Zaden van in ons land passendeleguminosen (erwt ( Pisum sativum), veldboon ( Vicia faba),

  13. Arabidopsis CDS blastp result: AK103075 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103075 J033118C16 At3g17020.1 universal stress protein (USP) family protein simil...ar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 2e-42 ...

  14. Arabidopsis CDS blastp result: AK063611 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063611 001-118-D04 At3g17020.1 universal stress protein (USP) family protein simi...lar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 6e-38 ...

  15. Arabidopsis CDS blastp result: AK108499 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108499 002-143-H02 At3g03270.2 universal stress protein (USP) family protein / ea...rly nodulin ENOD18 family protein contains Pfam profile PF00582: universal stress protein family; similar to early nodulin ENOD18 (GI:11602747) [Vicia faba] 2e-52 ...

  16. Arabidopsis CDS blastp result: AK065771 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065771 J013041K03 At3g17020.1 universal stress protein (USP) family protein simil...ar to early nodulin ENOD18 [Vicia faba] GI:11602747; contains Pfam profile PF00582: universal stress protein family 2e-42 ...

  17. Environmental, genetic and cellular toxicity of tenuazonic acid ...

    African Journals Online (AJOL)

    Alternaria alternata, an important pathogen of many plants, produces tenuazonic acid (TeA) with bioactivity to microbes, plants and animals. TeA is one of the main mycotoxin to humans and other organisms. Using Chlamydomonas reinhardtii, Vicia faba root tip and three mammalian normal cell lines as target materials, ...

  18. Resistance source to cowpea aphid (Aphis craccivora Koch) in ...

    African Journals Online (AJOL)

    The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854. These landraces from the region of Biskra (in the south of Algeria) were selected in an initial field trial and subjected to further testing in the greenhouse. Landrace V51 proved to be the ...

  19. AcEST: BP919185 [AcEST

    Lifescience Database Archive (English)

    Full Text Available its) Value sp|P42653|1433A_VICFA 14-3-3-like protein A OS=Vicia faba PE=2 SV=1 31 3.6 sp|Q6C443|OXR1_YARLI Oxidation... 158 YKSAQDIANTELPPTHP-IRLGLALNFSVFYYEILNSPDRAC 198 >sp|Q6C443|OXR1_YARLI Oxidation resistance protein 1 OS=

  20. Environmental, genetic and cellular toxicity of tenuazonic acid ...

    African Journals Online (AJOL)

    SERVER

    2008-04-17

    Apr 17, 2008 ... Alternaria alternata, an important pathogen of many plants, produces tenuazonic acid (TeA) with bioactivity to microbes, plants and animals. TeA is one of the main mycotoxin to humans and other organisms. Using Chlamydomonas reinhardtii, Vicia faba root tip and three mammalian normal cell lines.

  1. Correlation between carbohydrate structures on the envelope glycoprotein gp120 of HIV-1 and HIV-2 and syncytium inhibition with lectins

    DEFF Research Database (Denmark)

    Hansen, J E; Nielsen, C M; Nielsen, C

    1989-01-01

    The binding of 13 different lectins to gp120 partially purified from two HIV-1 isolates and one HIV-2 isolate was studied by in situ staining on electrophoretically separated and electroblotted HIV antigens. The lectins concanavalin A, wheat germ agglutinin, Lens culinaris agglutinin, Vicia faba...

  2. Municipal landfill leachates induced chromosome aberrations in rat ...

    African Journals Online (AJOL)

    user

    2006-11-16

    Nov 16, 2006 ... leachate induced chromosome aberration in rat. Other reports on leachate induced genotoxicity in Allium cepa. (Cabrera and Rodriguez, 1999; Bakare and Wale-. Adeyemo, 2004; Chandra et al., 2005.), Vicia faba. (Radetski et al., 2004; Sang and Li, 2004), Drosophila melanogaster (Siddique et al., 2005) ...

  3. Effect of municipal sewage effluent on soil and crops cultivated on a ...

    African Journals Online (AJOL)

    The effects of sewage effluent from Sebha Municipal Area in the Fezzan region of Libya on certain physicochemical properties of a hyper-arid zone sandy soil and growth of two plants were studied. The soil had been treated daily with 25, 50, 75 and 100% effluent; and barley (Hordeum vulgare) and broad beans (Vicia faba) ...

  4. Formulation of a complementary food fortified with broad beans ...

    African Journals Online (AJOL)

    Sixty percent of mothers did not provide bean-based food for their children, with the most frequently reported reason being lack of knowledge of its nutrient value for young children. To a typical complementary food of barley-maize porridge, 10, 20 and 30% of cereal was replaced by processed broad beans (Vicia faba), ...

  5. Resistance source to cowpea aphid (Aphis craccivora Koch) in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... ²INRA Centre de Biologie et de Gestion des Populations (CBGP), Campus International de Baillarguet, 34988,. Montferrier / Lez cedex, France. Accepted 3 June, 2008. The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854.

  6. South African Journal of Animal Science - Vol 22, No 5 (1992)

    African Journals Online (AJOL)

    An evaluation of fababean (Vicia faba) and lupin (Lupinus albus) stubble and seed for sheep · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.S. Brand, F Franck, A.A. Brand, A Durand, J Coetzee, 170-174 ...

  7. Pulse diversity for polyphenolic secondary metabolites

    Science.gov (United States)

    The pulse species including guar (Cyamopsis tetragonoloba L. Taub.), Lablab purpureus L. Sweet, Macrotyloma uniflorum (Lam.) Verdc., Teramnus labialis (L.f.) Spreng, alfalfa (Medicago sativa ssp. sativa), green beans (Phaseolus vulgaris L.), fava beans (Vicia faba L.), blackeye pea (Vigna unguiculat...

  8. Can elemental composition data of crop leaves be used to estimate radionuclide transfer to tree leaves?

    Science.gov (United States)

    Tagami, Keiko; Uchida, Shigeo

    2010-11-01

    Estimation of radionuclide concentrations in trees may be required to estimate their radiation exposure. However, concentration ratios of radionuclides from soil to tree species are limited for many radionuclide-tree combinations. To fill this gap, it is investigated in the present paper whether stable element concentration data for leafy vegetables are representative of those for wild tree leaves, and consequently, if these stable element data for leafy vegetables can be used as analogues to describe radionuclides transfer from soil to trees. Data for stable elements in leafy vegetables collected in Japan were compared with those in leaves of about 20 tree species worldwide. The correlation coefficients of element concentrations between leafy vegetables and tree leaves were higher than 0.90 with p elements were within the range of data for leafy vegetables. Thus, transfer parameters derived from stable element data for leafy vegetables could generally be used to estimate concentrations in tree leaves if data for the latter are not available. However, some trees accumulate a few elements (e.g., Al, Co, Mn and Si) in their leaves to higher concentrations than observed for leafy vegetables.

  9. 78 FR 8833 - The Family and Medical Leave Act

    Science.gov (United States)

    2013-02-06

    ... leave to family members of members of the Regular Armed Forces for qualifying exigencies arising out of... leave provision to include leave for eligible family members of members of the Regular Armed Forces and... FY 2008 NDAA, is expanded to include family members of members of the Regular Armed Forces. The...

  10. Early School Leaving and the Cultural Geography of High Schools.

    Science.gov (United States)

    Smyth, John; Hattam, Robert

    2002-01-01

    States early school leaving is a protracted educational problem throughout the world. Examines early school leaving from the position of young Australians (n=209) who left school or were considering leaving. Provides tentative theorizing traversing aspects of the cultural geography of high school as partial explanation of what is occurring. (BT)

  11. Determinants of sick-leave duration : A tool for managers?

    NARCIS (Netherlands)

    Flach, P.A.; Krol, B.; Groothoff, J.W.

    AIMS: To provide managers with tools to manage episodes of sick-leave of their employees, the influence of factors such as age, gender, duration of tenure, working full-time or part-time, cause and history of sick-leave, salary and education on sick-leave duration was studied. METHOD: In a

  12. Utilization of Cassava Leaves as a Vegetable in Rwanda ...

    African Journals Online (AJOL)

    Prices of leaves at farm gate and retail levels were highly different (p= 0.0016), averaging 32 and 65 Frw by bunch in the rainy season, respectively. Despite the high consumption and trade of cassava leaves, post-harvest losses were high, especially in the rainy season. Cassava leaves were mainly cooked fresh, but 15.4 ...

  13. Utilisation of vegetable leaves for carp production

    OpenAIRE

    Roy, A.K.; Rai, S.P.; Datta, A.K.; Das, C.R.; Ghosh, J.K.

    1996-01-01

    The results of two sets of experiments on mono-culture of grass carp (Ctenopharyngodon idella) and mixed culture of carps (grass carp 50 : catla 20 : rohu 15 : mrigal 15) fed exclusively with vegetable leaves are reported. The experiments were conducted with two replicates each in 0.02 ha ponds of Wastewater Aquaculture Division of the Central Institute of Freshwater Aquaculture, Rahara during 1991-93. Monoculture of grass carp stocked at 1000/ha demonstrated an average net production of 21.0...

  14. [Xanthones from leaves of Calophyllum inophyllum Linn].

    Science.gov (United States)

    Li, Yuan; Li, Zhan-Lin; Liu, Ming-Sheng; Li, Dan-Yi; Zhang, Hui; Hua, Hui-Ming

    2009-02-01

    To study the xanthones from the leaves of Calophyllum inophyllum Linn., several chromatography methods were employed to isolate the constituents. Investigation on the CHCl3 extract led to the isolation of a new xanthone named inophyxanthone A (1) and four known compounds, which were pancixanthone A (2), gerontoxanthone B (3), jacareubin (4) and pyranojacareubin (5). Among them, compound 2 was obtained from this plant firstly, and compound 3 was obtained for the first time from this genus. The structure of inophyxanthone A (1) was identified as 1, 3, 5-trihydroxy-2-(1, 1-dimethylallyl)xanthone by spectral analysis.

  15. IS POLARIS LEAVING THE CEPHEID INSTABILITY STRIP?

    OpenAIRE

    Turner, D. G.

    2017-01-01

    Although Polaris is generally regarded as an overtone pulsator that may soon switch to pulsation in the fundamental mode, it is argued that the variable is actually crossing the instability strip for the first time and is in the process of leaving the instability strip altogether. The luminosity of Polaris inferred from its optical F3 V companion, as well as from A, F, and G-type stars lying within a few degrees of it and populating a group main sequence coincident with that for Polaris B...

  16. Take It, Leave It, Fold It

    DEFF Research Database (Denmark)

    Elias, Camelia

    2008-01-01

    This introduction to the volume sets the tone for a reading experience of Federman's works. Since the early 60s, Raymond Federman has been one of the most important American writers. In his highly experimental fictions, in works that bear such titles as Take It or Leave It, Double or Nothing......, and The Twofold Vibrations, he has explored cultural and personal memory, invented intricate narrative strategies, and above all has given readers an experience that exceeds the ordinary. Creating situations that make one really think and really laugh is a tall order for any writer. But Federman did it. He is one...

  17. Gender codes why women are leaving computing

    CERN Document Server

    Misa, Thomas J

    2010-01-01

    The computing profession is facing a serious gender crisis. Women are abandoning the computing field at an alarming rate. Fewer are entering the profession than anytime in the past twenty-five years, while too many are leaving the field in mid-career. With a maximum of insight and a minimum of jargon, Gender Codes explains the complex social and cultural processes at work in gender and computing today. Edited by Thomas Misa and featuring a Foreword by Linda Shafer, Chair of the IEEE Computer Society Press, this insightful collection of essays explores the persisting gender imbalance in computing and presents a clear course of action for turning things around.

  18. Chemical constituents of Breynia glauca leaves

    Directory of Open Access Journals (Sweden)

    Butsarakham Supudompol

    2005-08-01

    Full Text Available From the leaves of Breynia glauca, eight compounds including friedelin (1, 3-oxo- 4,5-sitosterone (2, friedelan-3β-ol (3, β-sitosterol (4, kaempferol (5, arbutin (6, kaempferol-3-O-rutinoside (7 and quercetion-3-O-glucoside (8 were isolated. The presence of these compounds supports the traditional use of this plant as a detoxifying agent. In addition, all of these chemical constituents were tested for antiviral potential against herpes simplex virus types 1 and 2, but were found to be inactive at 50 μg/ml.

  19. Impact of Ozone Gradient on Grapevine Leaves

    Science.gov (United States)

    Alebic-Juretic, Ana; Bokan-Vucelic, Itana; Mifka, Boris; Zatezalo, Marija; Zubak, Velimir

    2017-04-01

    Due to complex orography and air mass circulation, the Rijeka Bay area is characterized by O3 gradient, with concentrations risen with the altitude (1). Therefore AOT40 values were often exceeded and should result in harmful effects on vegetation. Based on previous controlled experiments (2), we examined the possible effect of atmospheric ozone on grape leaves under natural O3 gradient. Grapevine leaves (2-5) were collected from May to September 2016 at two sampling points in the proximity of two AQM stations: Site 1 in the city centre (20m asl) and Site 2 (186m asl) in the suburban settlement. Subsequent to weighing and determination of surface area, the leaves (0,5 g) were extracted in 95% ethanol and analysed on chlorophyl a (Chla), chlorophyl b (Chlb) and carotene (Car) content by UV-VIS spectrometry on 3 wavelengths (664, 649, 470 nm) (3) In summer 2016 O3 gradient was not that pronounced as usual (1), but stil the concentrations differed by approx. 20%, exceeding national AOT40 value at both sites (22.360 and 28.061 μg m-3 h, respectively, at Sites 1 and 2). The concentrations of other pollutants were bellow limit values (LV). The Cha and Chb in a sample leaves collected at the end of May at Site 2 are equal to that with filtered O3 in control experiment (2), i.e. without damage caused by ozone, while the Car content is lower approx. 50% and is kept at the same level. The con-centrations of pigments obtained in July prooved the possible damage by O3, while in subsequent months could speed up natural ageing. This is the first evidence of O3 damage on plants in the Rijeka Bay area, in spite of weaker O3 gradient and lacking visible signs of damage. Preliminary results indicate the need for more frequent sampling, particularly in the period included in AOT40 (May-July). References: 1. Alebić-Juretić A (2012) Int J Remote Sensing, 33(2): 335-345 2. Britvec M, Reichenauer T, Soja G., Ljubešić N, Pećina M (2001) Biologia (Bratislava),56/4: 417-424 3. Sumanata

  20. Terpenoid constituents from leaves of Guarea kunthiana

    Energy Technology Data Exchange (ETDEWEB)

    Garcez, Fernanda R.; Garcez, Walmir S.; Bazzo, Rita de Cassia [Mato Grosso do Sul Univ., Campo Grande, MS (Brazil). Dept. de Quimica]. E-mail: frgarcez@nin.ufms.br; Silva, Ana Francisca G. da [Universidade Estadual de Mato Grosso do Sul, Mundo Novo, MS (Brazil). Unidade Universitaria de Mundo Novo; Resende, Ubirazilda M. [Mato Grosso do Sul Univ., Campo Grande, MS (Brazil). Dept. de Biologia

    2004-10-01

    From leaves of Guarea kunthiana one new kaurene diterpene (ent-kaur-16-en-2-one) was isolated along with eight known diterpenes (ent-kaur-16-ene, ent-3{alpha}- and 3{beta}-hydroxykaur-16-ene, kolavelool, kolavenol, kolavenal, ent-13-epi-manoyloxide and (-)-nephthenol), four sesquiterpenes (alismol, alismoxide, spathulenol and 4{beta},10{alpha}-aromadendranediol), polyprenol-12 and {alpha}- and {delta}-tocopherols. Kolavenal is reported for the first time as a natural product, as well as the occurrence of cembrane- and ent-kaurane-type diterpenes in the Meliaceae. (author)