WorldWideScience

Sample records for vhp lithium-ion li-ion

  1. SAFT Li-ion Technology for High Rate Applications

    National Research Council Canada - National Science Library

    Nechev, Kamen; Deveney, Bridget; Guseynov, Teymur; Erbacher, John; Vukson, Stephen

    2006-01-01

    SAFT will present an update of its state-of-the art Very High Power (VHP) Lithium-ion (Li-ion) technology. The VHP cells are currently being qualified for use in military aircraft applications as well as in future military hybrid vehicles...

  2. Physics of electron and lithium-ion transport in electrode materials for Li-ion batteries

    Science.gov (United States)

    Musheng, Wu; Bo, Xu; Chuying, Ouyang

    2016-01-01

    The physics of ionic and electrical conduction at electrode materials of lithium-ion batteries (LIBs) are briefly summarized here, besides, we review the current research on ionic and electrical conduction in electrode material incorporating experimental and simulation studies. Commercial LIBs have been widely used in portable electronic devices and are now developed for large-scale applications in hybrid electric vehicles (HEV) and stationary distributed power stations. However, due to the physical limits of the materials, the overall performance of today’s LIBs does not meet all the requirements for future applications, and the transport problem has been one of the main barriers to further improvement. The electron and Li-ion transport behaviors are important in determining the rate capacity of LIBs. Project supported by the National High Technology Research and Development Program of China (Grant No. 2015AA034201), the National Natural Science Foundation of China (Grant Nos. 11234013 and 11264014), the Natural Science Foundation of Jiangxi Province, China (Grant Nos. 20133ACB21010 and 20142BAB212002), and the Foundation of Jiangxi Education Committee, China (Grant Nos. GJJ14254 and KJLD14024). C. Y. Ouyang is also supported by the “Gan-po talent 555” Project of Jiangxi Province, China.

  3. Ab initio molecular dynamics simulations of organic electrolytes, electrodes, and lithium ion transport for Li-ion batteries

    Science.gov (United States)

    Kent, P. R. C.; Ganesh, P.; Jiang, De-En; Borodin, O.

    2012-02-01

    Optimizing the choice of electrolyte in lithium ion batteries and an understanding of the solid-electrolyte interphase (SEI) is required to optimize the balance between high-energy storage, high rate capability, and lifetime. We perform accurate ab initio molecular-dynamics simulations of common cyclic carbonates and LiPF6 to build solvation models which explain available Neutron and NMR spectroscopies. Our results corroborate why ethylene carbonate is a preferred choice for battery applications over propylene carbonate and how mixtures with dimethyl carbonate improve Li-ion diffusion. We study the role of functionalization of graphite-anode edges on the reducibility of the electrolyte and the ease of Li-ion intercalation at the initial stages of SEI formation. We find that oxygen terminated edges readily act as strong reductive sites, while hydrogen terminated edges are less reactive and allow faster Li diffusion. Orientational ordering of the solvent molecules precedes reduction at the interphase. Inorganic reductive components are seen to readily migrate to the anode edges, leading to increased surface passivation of the anode. We are currently quantifying Li-intercalation barriers across realistic SEI models, and progress along these lines will be presented.

  4. NASA Aerospace Flight Battery Program: Generic Safety, Handling and Qualification Guidelines for Lithium-Ion (Li-Ion) Batteries; Availability of Source Materials for Lithium-Ion (Li-Ion) Batteries; Maintaining Technical Communications Related to Aerospace Batteries (NASA Aerospace Battery Workshop). Volume 1, Part 1

    Science.gov (United States)

    Manzo, Michelle A.; Brewer, Jeffrey C.; Bugga, Ratnakumar V.; Darcy, Eric C.; Jeevarajan, Judith A.; McKissock, Barbara I.; Schmitz, Paul C.

    2010-01-01

    This NASA Aerospace Flight Battery Systems Working Group was chartered within the NASA Engineering and Safety Center (NESC). The Battery Working Group was tasked to complete tasks and to propose proactive work to address battery related, agency-wide issues on an annual basis. In its first year of operation, this proactive program addressed various aspects of the validation and verification of aerospace battery systems for NASA missions. Studies were performed, issues were discussed and in many cases, test programs were executed to generate recommendations and guidelines to reduce risk associated with various aspects of implementing battery technology in the aerospace industry. This document contains Part 1 - Volume I: Generic Safety, Handling and Qualification Guidelines for Lithium-Ion (Li-Ion) Batteries, Availability of Source Materials for Lithium-Ion (Li-Ion) Batteries, and Maintaining Technical Communications Related to Aerospace Batteries (NASA Aerospace Battery Workshop).

  5. Advanced technology development program for lithium-ion batteries : thermal abuse performance of 18650 Li-ion cells.

    Energy Technology Data Exchange (ETDEWEB)

    Crafts, Chris C.; Doughty, Daniel Harvey; McBreen, James. (Bookhaven National Lab, Upton, NY); Roth, Emanuel Peter

    2004-03-01

    Li-ion cells are being developed for high-power applications in hybrid electric vehicles currently being designed for the FreedomCAR (Freedom Cooperative Automotive Research) program. These cells offer superior performance in terms of power and energy density over current cell chemistries. Cells using this chemistry are the basis of battery systems for both gasoline and fuel cell based hybrids. However, the safety of these cells needs to be understood and improved for eventual widespread commercial application in hybrid electric vehicles. The thermal behavior of commercial and prototype cells has been measured under varying conditions of cell composition, age and state-of-charge (SOC). The thermal runaway behavior of full cells has been measured along with the thermal properties of the cell components. We have also measured gas generation and gas composition over the temperature range corresponding to the thermal runaway regime. These studies have allowed characterization of cell thermal abuse tolerance and an understanding of the mechanisms that result in cell thermal runaway.

  6. High Rate and Stable Li-Ion Insertion in Oxygen-Deficient LiV3O8 Nanosheets as a Cathode Material for Lithium-Ion Battery.

    Science.gov (United States)

    Song, Huanqiao; Luo, Mingsheng; Wang, Aimei

    2017-01-25

    Low performance of cathode materials has become one of the major obstacles to the application of lithium-ion battery (LIB) in advanced portable electronic devices, hybrid electric vehicles, and electric vehicles. The present work reports a versatile oxygen-deficient LiV3O8 (D-LVO) nanosheet that was synthesized successfully via a facile oxygen-deficient hydrothermal reaction followed by thermal annealing in Ar. When used as a cathode material for LIB, the prepared D-LVO nanosheets display remarkable capacity properties at various current densities (a capacity of 335, 317, 278, 246, 209, 167, and 133 mA h g-1 at 50, 100, 200, 500, 1000, 2000, and 4000 mA g-1, respectively) and excellent lithium-ion storage stability, maintaining more than 88% of the initial reversible capacity after 200 cycles at 1000 mA g-1. The outstanding electrochemical properties are believed to arise largely from the introduction of tetravalent V (∼15% V4+) and the attendant oxygen vacancies into LiV3O8 nanosheets, leading to intrinsic electrical conductivity more than 1 order of magnitude higher and lithium-ion diffusion coefficient nearly 2 orders of magnitude higher than those of LiV3O8 without detectable V4+ (N-LVO) and thus contributing to the easy lithium-ion diffusion, rapid phase transition, and the excellent electrochemical reversibility. Furthermore, the more uniform nanostructure, as well as the larger specific surface area of D-LVO than N-LVO nanosheets may also improve the electrolyte penetration and provide more reaction sites for fast lithium-ion diffusion during the discharge/charge processes.

  7. Effect of Acetylene Black Content to Half Cells Li-ion Battery Performance Based on Li4Ti5O12 using Li2CO3 as Lithium Ion Source with Hydrothermal Mechanochemical Process

    Science.gov (United States)

    Priyono, B.; Faizah; Syahrial, A. Z.; Subhan, A.

    2017-07-01

    Lithium titanate (Li4Ti5O12)/LTO is a promising candidate to be used as anode electrode in Li-ion battery, to replace graphite in Li-ion battery application. Crystal structure of lithium titanate/LTO is more stable or undergoes less strain than graphite during intercalation and de-intercalation process Li+ ions. However, although lithium titanate has good stability, the material has low electrical conductivity and lithium ion diffusion. The purpose of this research is to synthesis the spinel LTO using combinated hydrothermal and mechanochemical processes from xerogel TiO2. Then, to increase the conductivity, in the half-cell battery assembly process it was added acetylene black conductive (AB) additive with various from 10%, to 15% in wt. The LTO obtained were characterized using scanning electron microscope (SEM), X-Ray Diffraction (XRD) and Brunauer-Emmett-Teller (BET). The XRD showed a rutile as minor phase, while SEM showed homogeneous distribution of particle with an average particle size of 0.35 μm. The BET showed that the surface area of LTO formed is 2.26 m2/g. The assembled coin half cells used this Li4Ti5O12 as a cathode and lithium metal foil as the anode were tested using electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV) and charge discharge (CD). The conductivity value obtained from EIS corresponds to the contents of AB. Meanwhile, the CV and CD testing showed that higher percentage of AB causing the decrease of battery specific capacity. The highest specific capacity at the rate of 10C is obtained at the mixture of 10wt% AB with the value of 40.91 mAh/g.

  8. Phase I Advanced Battery Materials for Rechargeable Advanced Space-Rated Li-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Lithium-ion (Li-ion) batteries are attractive candidates for use as power sources in aerospace applications because they have high specific energy (up to 200 Wh/kg),...

  9. Advanced Cathode for Ultra-High Energy Li-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Advanced lithium-ion (Li-ion) batteries are currently under development for Extravehicular Activity Suits, Altair Lunar Landers, and Lunar Mobility Systems. However,...

  10. Nano-Engineered Materials for Rapid Rechargeable Space Rated Advanced Li-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Lithium-ion (Li-ion) batteries are attractive candidates for use as power sources in aerospace applications because they have high specific energy, energy density...

  11. Nano-Composite Cathodes for High Performance Lithium Ion Microbatteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — TPL Inc. proposes to develop a novel, high performance, nanostructured cathode material for lithium ion (Li-ion) batteries. The proposed approach will modify lithium...

  12. A Phase I Program to Improve Low Temperature Performance of Lithium-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Lithium-ion (Li-ion) batteries are attractive candidates for use as power sources in aerospace applications because they have high specific energy ( up to 200 Wh/kg)...

  13. International Space Station Lithium-Ion Battery

    Science.gov (United States)

    Dalton, Penni J.; Schwanbeck, Eugene; North, Tim; Balcer, Sonia

    2016-01-01

    The International Space Station (ISS) primary Electric Power System (EPS) currently uses Nickel-Hydrogen (Ni-H2) batteries to store electrical energy. The electricity for the space station is generated by its solar arrays, which charge batteries during insolation for subsequent discharge during eclipse. The Ni-H2 batteries are designed to operate at a 35 depth of discharge (DOD) maximum during normal operation in a Low Earth Orbit. Since the oldest of the 48 Ni-H2 battery Orbital Replacement Units (ORUs) has been cycling since September 2006, these batteries are now approaching their end of useful life. In 2010, the ISS Program began the development of Lithium-Ion (Li-Ion) batteries to replace the Ni-H2 batteries and concurrently funded a Li-Ion ORU and cell life testing project. When deployed, they will be the largest Li-Ion batteries ever utilized for a human-rated spacecraft. This paper will include an overview of the ISS Li-Ion battery system architecture, the Li-Ion battery design and development, controls to limit potential hazards from the batteries, and the status of the Li-Ion cell and ORU life cycle testing.

  14. Lithium Ion Battery Chemistries from Renewable Energy Storage to Automotive and Back-up Power Applications

    DEFF Research Database (Denmark)

    Stan, Ana-Irina; Swierczynski, Maciej Jozef; Stroe, Daniel Ioan

    2014-01-01

    Lithium ion (Li-ion) batteries have been extensively used in consumer electronics because of their characteristics, such as high efficiency, long life, and high gravimetric and volumetric energy. In addition, Li-ion batteries are becoming the most attractive candidate as electrochemical storage...

  15. New Horizons for Conventional Lithium Ion Battery Technology.

    Science.gov (United States)

    Erickson, Evan M; Ghanty, Chandan; Aurbach, Doron

    2014-10-02

    Secondary lithium ion battery technology has made deliberate, incremental improvements over the past four decades, providing sufficient energy densities to sustain a significant mobile electronic device industry. Because current battery systems provide ∼100-150 km of driving distance per charge, ∼5-fold improvements are required to fully compete with internal combustion engines that provide >500 km range per tank. Despite expected improvements, the authors believe that lithium ion batteries are unlikely to replace combustion engines in fully electric vehicles. However, high fidelity and safe Li ion batteries can be used in full EVs plus range extenders (e.g., metal air batteries, generators with ICE or gas turbines). This perspective article describes advanced materials and directions that can take this technology further in terms of energy density, and aims at delineating realistic horizons for the next generations of Li ion batteries. This article concentrates on Li intercalation and Li alloying electrodes, relevant to the term Li ion batteries.

  16. ALIDISSI, a Research Program to Evaluate Electrochemical Impedance Spectroscopy as a SoC and SoH Diagnosis Tool for Li-ion Batteries ALIDISSI, un programme de recherche destiné à évaluer la spectroscopie d’impédance électrochimique comme outil de détermination de l’état de charge et de l’état de santé des batteries lithium-ion

    Directory of Open Access Journals (Sweden)

    Sauvant-Moynot V.

    2009-11-01

    Full Text Available ALIDISSI is a French research project aiming at evaluating Electrochemical Impedance Spectroscopy (EIS as a diagnosis tool for Li-ion batteries to be used in future Hybrid Electric Vehicles (HEV and on-grid photovoltaic (PV systems. This paper describes the project methodology. A review of ageing mechanisms in lithium-ion batteries is proposed first to point out the main processes reported in the literature and their related accelerating factors. The accelerating ageing profiles developed in this project to accelerate ageing in lithium-ion batteries are described next for both applications. Preliminary results obtained on 3-electrode prototype pouch cells made with traditional electrode couple like LiNiCoAlO2/LiC6 and a promising electrode couple (LiFePO4/Li4Ti5O12 are also presented in the last part of this work. ALIDISSI est un projet de recherche français dont l’objectif est d’évaluer l’utilité de la Spectroscopie d’Impédance Électrochimique (SIE comme outil de diagnostic pour les batteries Li-ion. Cet outil pourra être utilisé pour le diagnostic des batteries de véhicules hybrides et des systèmes de stockage de l’énergie d’origine photovoltaïque. Cet article a pour objectif de présenter le projet ALIDISSI. Il décrit la méthodologie mise en place et les procédures originales définies pour accélérer le vieillissement d’éléments de batteries Li-ion. Les profils de vieillissement ont été définis pour être représentatifs de l’application et font suite à une étude bibliographique des mécanismes de vieillissement et des facteurs influençant le vieillissement. Les premiers résultats d’impédance obtenus à partir d’un couple d’électrodes conventionnel (LiNiCoAlO2/graphite et d’un couple émergent (LiFePO4/Li4Ti5O12 sont présentés ici. Ils ont été obtenus sur des éléments prototypes ensachés de petite capacité incluant une électrode de référence.

  17. Adaptation of an Electrochemistry-based Li-Ion Battery Model to Account for Deterioration Observed Under Randomized Use

    Science.gov (United States)

    2014-10-02

    a lithium - ion battery is presented here. An unscented Kalman filtering algorithm is shown to enable the production of internal bat- tery state...electrically isolated by a micro- porous polymer separator film that is permeable to Li ions. The electrolyte enables lithium ions (Li+) to diffuse...Power Sources, 146(1-2), 90-96. Dai, H., Wei, X., & Sun, Z. (2006). Online soc estimation of high-power Lithium -Ion batteries used on HEVs. In IEEE

  18. Twin boundary-assisted lithium-ion transport

    KAUST Repository

    Nie, Anmin

    2015-01-14

    With the increased need for high-rate Li-ion batteries, it has become apparent that new electrode materials with enhanced Li-ion transport should be designed. Interfaces, such as twin boundaries (TBs), offer new opportunities to navigate the ionic transport within nanoscale materials. Here, we demonstrate the effects of TBs on the Li-ion transport properties in single crystalline SnO2 nanowires. It is shown that the TB-assisted lithiation pathways are remarkably different from the previously reported lithiation behavior in SnO2 nanowires without TBs. Our in situ transmission electron microscopy study combined with direct atomic-scale imaging of the initial lithiation stage of the TB-SnO2 nanowires prove that the lithium ions prefer to intercalate in the vicinity of the (101¯) TB, which acts as conduit for lithium-ion diffusion inside the nanowires. The density functional theory modeling shows that it is energetically preferred for lithium ions to accumulate near the TB compared to perfect neighboring lattice area. These findings may lead to the design of new electrode materials that incorporate TBs as efficient lithium pathways, and eventually, the development of next generation rechargeable batteries that surpass the rate performance of the current commercial Li-ion batteries.

  19. Guidelines on Lithium-ion Battery Use in Space Applications

    Science.gov (United States)

    Mckissock, Barbara; Loyselle, Patricia; Vogel, Elisa

    2009-01-01

    This guideline discusses a standard approach for defining, determining, and addressing safety, handling, and qualification standards for lithium-ion (Li-Ion) batteries to help the implementation of the technology in aerospace applications. Information from a variety of other sources relating to Li-ion batteries and their aerospace uses has been collected and included in this document. The sources used are listed in the reference section at the end of this document. The Li-Ion chemistry is highly energetic due to its inherent high specific energy and its flammable electrolyte. Due to the extreme importance of appropriate design, test, and hazard control of Li-ion batteries, it is recommended that all Government and industry users and vendors of this technology for space applications, especially involving humans, use this document for appropriate guidance prior to implementing the technology.

  20. International Space Station Lithium-Ion Battery Start-Up

    Science.gov (United States)

    Dalton, Penni J.; North, Tim; Bowens, Ebony; Balcer, Sonia

    2017-01-01

    International Space Station Lithium-Ion Battery Start-Up.The International Space Station (ISS) primary Electric Power System (EPS) was originally designed to use Nickel-Hydrogen (Ni-H2) batteries to store electrical energy. The electricity for the space station is generated by its solar arrays, which charge batteries during insolation for subsequent discharge during eclipse. The Ni-H2 batteries are designed to operate at a 35 depth of discharge (DOD) maximum during normal operation in a Low Earth Orbit. As the oldest of the 48 Ni-H2 battery Orbital Replacement Units (ORUs) has been cycling since September 2006, these batteries are now approaching their end of useful life. In 2010, the ISS Program began the development of Lithium-Ion (Li-ion) batteries to replace the Ni-H2 batteries and concurrently funded a Li-Ion ORU and cell life testing project. The first set of 6 Li-ion battery replacements were launched in December 2016 and deployed in January 2017. This paper will discuss the Li-ion battery on-orbit start-up and the status of the Li-Ion cell and ORU life cycle testing.

  1. Comparative Issues of Cathode Materials for Li-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Christian M. Julien

    2014-03-01

    Full Text Available After an introduction to lithium insertion compounds and the principles of Li-ion cells, we present a comparative study of the physical and electrochemical properties of positive electrodes used in lithium-ion batteries (LIBs. Electrode materials include three different classes of lattices according to the dimensionality of the Li+ ion motion in them: olivine, layered transition-metal oxides and spinel frameworks. Their advantages and disadvantages are compared with emphasis on synthesis difficulties, electrochemical stability, faradaic performance and security issues.

  2. Lithium-ion batteries

    CERN Document Server

    Yoshio, Masaki; Kozawa, Akiya

    2010-01-01

    This book is a compilation of up-to-date information relative to Li-Ion technology. It provides the reader with a single source covering all important aspects of Li-Ion battery operations. It fills the gap between the old original Li-Ion technology and present state of the technology that has developed into a high state of practice. The book is designed to provide a single source for an up-to-date description of the technology associated with the Li-Ion battery industry. It will be useful to researchers interested in energy conversion for the direct conversion of chemical energy into electrica

  3. Recent Progress in Advanced Materials for Lithium Ion Batteries

    OpenAIRE

    Jiajun Chen

    2013-01-01

    The development and commercialization of lithium ion batteries is rooted in material discovery. Promising new materials with high energy density are required for achieving the goal toward alternative forms of transportation. Over the past decade, significant progress and effort has been made in developing the new generation of Li-ion battery materials. In the review, I will focus on the recent advance of tin- and silicon-based anode materials. Additionally, new polyoxyanion cathodes, such as ...

  4. Mitigating Thermal Runaway Risk in Lithium Ion Batteries

    Science.gov (United States)

    Darcy, Eric; Jeevarajan, Judy; Russell, Samuel

    2014-01-01

    The JSC/NESC team has successfully demonstrated Thermal Runaway (TR) risk reduction in a lithium ion battery for human space flight by developing and implementing verifiable design features which interrupt energy transfer between adjacent electrochemical cells. Conventional lithium ion (li-Ion) batteries can fail catastrophically as a result of a single cell going into thermal runaway. Thermal runaway results when an internal component fails to separate electrode materials leading to localized heating and complete combustion of the lithium ion cell. Previously, the greatest control to minimize the probability of cell failure was individual cell screening. Combining thermal runaway propagation mitigation design features with a comprehensive screening program reduces both the probability, and the severity, of a single cell failure.

  5. Use of lithium-ion batteries in electric vehicles

    Science.gov (United States)

    Kennedy, B.; Patterson, D.; Camilleri, S.

    An account is given of the lithium-ion (Li-ion) battery pack used in the Northern Territory University's solar car, Fuji Xerox Desert Rose, which competed in the 1999 World Solar Challenge (WSC). The reasons for the choice of Li-ion batteries over silver-zinc batteries are outlined, and the construction techniques used, the management of the batteries, and the battery protection boards are described. Data from both pre-race trialling and race telemetry, and an analysis of both the coulombic and the energy efficiencies of the battery are presented. It is concluded that Li-ion batteries show a real advantage over other commercially available batteries for traction applications of this kind.

  6. Lithium Ion Batteries Ageing Analysis when used in a PV Power Plants

    DEFF Research Database (Denmark)

    Beltran, H.; Swierczynski, Maciej Jozef; Aparicio, N.

    2012-01-01

    This paper analyzes the integration of lithium ion (Li-ion) batteries into large scale grid-connected PV plants. It performs a systematic analysis on both the operation improvement obtained by a PV+ES power plant and the ageing experienced by the Li-ion batteries used as Energy Storage (ES) system...... when operating under different energy management strategies (EMS). In this paper, the PV+ES power plant structure is presented and the selection of Li-on batteries as ES system (ESS) is justified. Moreover, the simulation model used for studying the Li-ion battery ageing is explained and tested...

  7. Fundamental Investigation of Si Anode in Li-Ion Cells

    Science.gov (United States)

    Wu, James J.; Bennett, William R.

    2012-01-01

    Silicon is a promising and attractive anode material to replace graphite for high capacity lithium ion cells since its theoretical capacity is approximately 10 times of graphite and it is an abundant element on earth. However, there are challenges associated with using silicon as Li-ion anode due to the significant first cycle irreversible capacity loss and subsequent rapid capacity fade during cycling. In this paper, cyclic voltammetry and electrochemical impedance spectroscopy are used to build a fundamental understanding of silicon anodes. The results show that it is difficult to form the SEI film on the surface of Si anode during the first cycle, the lithium ion insertion and de-insertion kinetics for Si are sluggish, and the cell internal resistance changes with the state of lithiation after electrochemical cycling. These results are compared with those for extensively studied graphite anodes. The understanding gained from this study will help to design better Si anodes.

  8. Toxic fluoride gas emissions from lithium-ion battery fires.

    Science.gov (United States)

    Larsson, Fredrik; Andersson, Petra; Blomqvist, Per; Mellander, Bengt-Erik

    2017-08-30

    Lithium-ion battery fires generate intense heat and considerable amounts of gas and smoke. Although the emission of toxic gases can be a larger threat than the heat, the knowledge of such emissions is limited. This paper presents quantitative measurements of heat release and fluoride gas emissions during battery fires for seven different types of commercial lithium-ion batteries. The results have been validated using two independent measurement techniques and show that large amounts of hydrogen fluoride (HF) may be generated, ranging between 20 and 200 mg/Wh of nominal battery energy capacity. In addition, 15-22 mg/Wh of another potentially toxic gas, phosphoryl fluoride (POF3), was measured in some of the fire tests. Gas emissions when using water mist as extinguishing agent were also investigated. Fluoride gas emission can pose a serious toxic threat and the results are crucial findings for risk assessment and management, especially for large Li-ion battery packs.

  9. Membranes in Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Junbo Hou

    2012-07-01

    Full Text Available Lithium ion batteries have proven themselves the main choice of power sources for portable electronics. Besides consumer electronics, lithium ion batteries are also growing in popularity for military, electric vehicle, and aerospace applications. The present review attempts to summarize the knowledge about some selected membranes in lithium ion batteries. Based on the type of electrolyte used, literature concerning ceramic-glass and polymer solid ion conductors, microporous filter type separators and polymer gel based membranes is reviewed.

  10. Membranes in Lithium Ion Batteries

    Science.gov (United States)

    Yang, Min; Hou, Junbo

    2012-01-01

    Lithium ion batteries have proven themselves the main choice of power sources for portable electronics. Besides consumer electronics, lithium ion batteries are also growing in popularity for military, electric vehicle, and aerospace applications. The present review attempts to summarize the knowledge about some selected membranes in lithium ion batteries. Based on the type of electrolyte used, literature concerning ceramic-glass and polymer solid ion conductors, microporous filter type separators and polymer gel based membranes is reviewed. PMID:24958286

  11. Recent Progress in Advanced Materials for Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Jiajun Chen

    2013-01-01

    Full Text Available The development and commercialization of lithium ion batteries is rooted in material discovery. Promising new materials with high energy density are required for achieving the goal toward alternative forms of transportation. Over the past decade, significant progress and effort has been made in developing the new generation of Li-ion battery materials. In the review, I will focus on the recent advance of tin- and silicon-based anode materials. Additionally, new polyoxyanion cathodes, such as phosphates and silicates as cathode materials, will also be discussed.

  12. Development and testing of a lithium ion source and injector

    Directory of Open Access Journals (Sweden)

    P. A. Seidl

    2012-04-01

    Full Text Available We report on the development and testing of an intense lithium ion source and injector for an ion induction accelerator designed for warm, dense matter target heating experiments. The source is a 10.9-cm diameter aluminosilicate emitter on a porous tungsten substrate. For an injector voltage pulse of 120 kV, pulse duration of 1.0-μs FWHM, and an operating temperature of 1250°C, the source emits 35 mA of Li^{+} ions. The results follow experimental studies with much smaller sources. The key challenges included beam quality, source lifetime, and heat management.

  13. Electrolytes for lithium and lithium-ion batteries

    CERN Document Server

    Jow, T Richard; Borodin, Oleg; Ue, Makoto

    2014-01-01

    Electrolytes for Lithium and Lithium-ion Batteries provides a comprehensive overview of the scientific understanding and technological development of electrolyte materials in the last?several years. This book covers key electrolytes such as LiPF6 salt in mixed-carbonate solvents with additives for the state-of-the-art Li-ion batteries as well as new electrolyte materials developed recently that lay the foundation for future advances.?This book also reviews the characterization of electrolyte materials for their transport properties, structures, phase relationships, stabilities, and impurities.

  14. Manganese type lithium ion battery for PEV and HEV use

    Energy Technology Data Exchange (ETDEWEB)

    Horiba, H.; Hironaka, K.; Matsumura, T.; Kai, T.; Koseki, M. [Shin-Kobe Electric Machinery Co. Ltd., Saitama (Japan); Muranaka, Y. [Hitachi Ltd., Ibaraki (Japan)

    2000-07-01

    The development of a manganese type lithium-ion (Li-ion) battery for use in pure electric vehicles (PEVs) and hybrid electric vehicles (HEVs) was discussed. The development was made possible by extending the life cycle of the battery because manganese is known to have a short life cycle under conventional technology. In this study, a 90 Ah single cell was developed for PEV use. It was then applied to an integrated 8-cell module with an energy density of 93 Wh/kg and 114 Wh/dm{sup 3} and power density of 350 W/kg. The depth of discharge was 85 per cent. The Mn type Li-ion cell for PEV was modified to give it a high power density. The 48-cell module for HEV has an output density of 1350 W/kg at 50 per cent depth of discharge. The batteries are currently in commercial use and have demonstrated excellent performance. refs., tabs., figs.

  15. A High Capacity Li-Ion Cathode: The Fe(III/VI Super-Iron Cathode

    Directory of Open Access Journals (Sweden)

    Stuart Licht

    2010-05-01

    Full Text Available A super-iron Li-ion cathode with a 3-fold higher reversible capacity (a storage capacity of 485 mAh/g is presented. One of the principle constraints to vehicle electrification is that the Li-ion cathode battery chemistry is massive, and expensive. Demonstrated is a 3 electron storage lithium cathodic chemistry, and a reversible Li super-iron battery, which has a significantly higher capacity than contemporary Li-ion batteries. The super-iron Li-ion cathode consists of the hexavalent iron (Fe(VI salt, Na2FeO4, and is formed from inexpensive and clean materials. The charge storage mechanism is fundamentally different from those of traditional lithium ion intercalation cathodes. Instead, charge storage is based on multi-electron faradaic reduction, which considerably enhances the intrinsic charge storage capacity.

  16. A review on prognostics approaches for remaining useful life of lithium-ion battery

    Science.gov (United States)

    Su, C.; Chen, H. J.

    2017-11-01

    Lithium-ion (Li-ion) battery is a core component for various industrial systems, including satellite, spacecraft and electric vehicle, etc. The mechanism of performance degradation and remaining useful life (RUL) estimation correlate closely to the operating state and reliability of the aforementioned systems. Furthermore, RUL prediction of Li-ion battery is crucial for the operation scheduling, spare parts management and maintenance decision for such kinds of systems. In recent years, performance degradation prognostics and RUL estimation approaches have become a focus of the research concerning with Li-ion battery. This paper summarizes the approaches used in Li-ion battery RUL estimation. Three categories are classified accordingly, i.e. model-based approach, data-based approach and hybrid approach. The key issues and future trends for battery RUL estimation are also discussed.

  17. A closed loop process for recycling spent lithium ion batteries

    Science.gov (United States)

    Gratz, Eric; Sa, Qina; Apelian, Diran; Wang, Yan

    2014-09-01

    As lithium ion (Li-ion) batteries continue to increase their market share, recycling Li-ion batteries will become mandatory due to limited resources. We have previously demonstrated a new low temperature methodology to separate and synthesize cathode materials from mixed cathode materials. In this study we take used Li-ion batteries from a recycling source and recover active cathode materials, copper, steel, etc. To accomplish this the batteries are shredded and processed to separate the steel, copper and cathode materials; the cathode materials are then leached into solution; the concentrations of nickel, manganese and cobalt ions are adjusted so NixMnyCoz(OH)2 is precipitated. The precipitated product can then be reacted with lithium carbonate to form LiNixMnyCozO2. The results show that the developed recycling process is practical with high recovery efficiencies (∼90%), and 1 ton of Li-ion batteries has the potential to generate 5013 profit margin based on materials balance.

  18. Lifetime and economic analyses of lithium-ion batteries for balancing wind power forecast error

    DEFF Research Database (Denmark)

    Swierczynski, Maciej Jozef; Stroe, Daniel Ioan; Stroe, Ana-Irina

    2015-01-01

    is considered. In this paper, the economic feasibility of lithium-ion batteries for balancing the wind power forecast error is analysed. In order to perform a reliable assessment, an ageing model of lithium-ion battery was developed considering both cycling and calendar life. The economic analysis considers two......, it was found that for total elimination of the wind power forecast error, it is required to have a 25-MWh Li-ion battery energy storage system for the considered 2 MW WT....

  19. Power System Electronics Accommodation for a Lithium Ion Battery on the Space Technology 5 (ST5) Mission

    Science.gov (United States)

    Castell, Karen; Day, John H. (Technical Monitor)

    2001-01-01

    ST5 mission requirements include validation of Lithium-ion battery in orbit. Accommodation in the power system for Li-ion battery can be reduced with smaller amp-hour size, highly matched cells when compared to the larger amp-hour size approach. Result can be lower system mass and increased reliability.

  20. Ultrathin SnO2 nanosheets: Oriented attachment mechanism, nonstoichiometric defects and enhanced Lithium-ion battery performances

    DEFF Research Database (Denmark)

    Wang, Cen; Du, Gaohui; Ståhl, Kenny

    2012-01-01

    investigations of tin oxides as well as their intertransition processes. Finally, we investigated the lithium-ion storage of the SnO2 NSs as compared to SnO2 hollow spheres and NPs. The results showed superior performance of SnO2 NSs sample over its two counterparts. This greatly enhanced Li-ion storage...

  1. Lithium-ion battery dynamic model for wide range of operating conditions

    DEFF Research Database (Denmark)

    Stroe, Ana-Irina; Stroe, Daniel-Ioan; Swierczynski, Maciej Jozef

    2017-01-01

    In order to analyze the dynamic behavior of a Lithium-ion (Li-ion) battery and to determine their suitability for various applications, battery models are needed. An equivalent electrical circuit model is the most common way of representing the behavior of a Li-ion battery. There are different...... characterization tests performed for a wide range of operating conditions (temperature, load current and state-of-charge) on a commercial available 13Ah high-power lithium titanate oxide battery cell. The obtained results were used to parametrize the proposed dynamic model of the battery cell. To assess...

  2. Degradation Behavior of Lithium-Ion Batteries Based on Lifetime Models and Field Measured Frequency Regulation Mission Profile

    DEFF Research Database (Denmark)

    Stroe, Daniel Loan; Swierczynski, Maciej Jozef; Stroe, Ana-Irina

    2016-01-01

    Energy storage systems based on Lithium-ion (Li-ion) batteries have been proposed as an environmentally friendly alternative to traditional conventional generating units for providing grid frequency regulation. One major challenge regarding the use of Lithium-ion batteries in such applications...... of the Li-ion battery and its degradation behavior is required. Thus, this paper aims to investigate, based on a laboratory developed lifetime model, the degradation behavior of the performance parameters (i.e., capacity and power capability) of a Li-ion battery cell when it is subjected to a field measured...... is their higher cost—in comparison with other storage technologies or with the traditional frequency regulation methods—combined with performance-degradation uncertainties. In order to surpass this challenge and to allow for optimal sizing and proper operation of the battery, accurate knowledge about the lifetime...

  3. Selection and impedance based model of a lithium ion battery technology for integration with virtual power plant

    DEFF Research Database (Denmark)

    Swierczynski, Maciej Jozef; Stroe, Daniel Ioan; Stan, Ana-Irina

    2013-01-01

    is to integrate lithium-ion batteries into virtual power plants; thus, the power system stability and the energy quality can be increased. The selection of the best lithium-ion battery candidate for integration with wind power plants is a key aspect for the economic feasibility of the virtual power plant...... investment. This paper presents a methodology for selection, between three candidates, of a Li-ion battery which offers long cycle lifetime at partial charge/discharge (required by many grid support applications) while providing a low cost per cycle also. For the selected Li-ion battery an impedance......-based diagnostic tool for lifetime estimation was developed and verified. This diagnostic tool can be extended into an impedance-based lifetime model that will be able to predict the remaining useful lifetime of Li-ion batteries for specific grid support applications....

  4. A chemo-mechanical model coupled with thermal effect on the hollow core–shell electrodes in lithium-ion batteries

    Directory of Open Access Journals (Sweden)

    Bin Hu

    2017-07-01

    Full Text Available Electrode is a key component to remain durability and safety of lithium-ion (Li-ion batteries. Li-ion insertion/removal and thermal expansion mismatch may induce high stress in electrode during charging and discharging processes. In this paper, we present a continuum model based on COMSOL Multiphysics software, which involves thermal, chemical and mechanical behaviors of electrodes. The results show that, because of diffusion-induced stress and thermal mismatch, the electrode geometry plays an important role in diffusion kinetics of Li-ions. A higher local compressive stress results in a lower Li-ion concentration and thus a lower capacity when a particle is embedded another, which is in agreement with experimental observations. Keywords: Lithium-ion battery, Diffusion-induced stress, COMSOL, Chemo-mechanical, Electrode

  5. Fundamental Investigation of Silicon Anode in Lithium-Ion Cells

    Science.gov (United States)

    Wu, James J.; Bennett, William R.

    2012-01-01

    Silicon is a promising and attractive anode material to replace graphite for high capacity lithium ion cells since its theoretical capacity is 10 times of graphite and it is an abundant element on Earth. However, there are challenges associated with using silicon as Li-ion anode due to the significant first cycle irreversible capacity loss and subsequent rapid capacity fade during cycling. Understanding solid electrolyte interphase (SEI) formation along with the lithium ion insertion/de-insertion kinetics in silicon anodes will provide greater insight into overcoming these issues, thereby lead to better cycle performance. In this paper, cyclic voltammetry and electrochemical impedance spectroscopy are used to build a fundamental understanding of silicon anodes. The results show that it is difficult to form the SEI film on the surface of a Si anode during the first cycle; the lithium ion insertion and de-insertion kinetics for Si are sluggish, and the cell internal resistance changes with the state of lithiation after electrochemical cycling. These results are compared with those for extensively studied graphite anodes. The understanding gained from this study will help to design better Si anodes, and the combination of cyclic voltammetry with impedance spectroscopy provides a useful tool to evaluate the effectiveness of the design modifications on the Si anode performance.

  6. Modeling the Lithium Ion Battery

    Science.gov (United States)

    Summerfield, John

    2013-01-01

    The lithium ion battery will be a reliable electrical resource for many years to come. A simple model of the lithium ions motion due to changes in concentration and voltage is presented. The battery chosen has LiCoO[subscript 2] as the cathode, LiPF[subscript 6] as the electrolyte, and LiC[subscript 6] as the anode. The concentration gradient and…

  7. In-operando high-speed tomography of lithium-ion batteries during thermal runaway

    Science.gov (United States)

    Finegan, Donal P.; Scheel, Mario; Robinson, James B.; Tjaden, Bernhard; Hunt, Ian; Mason, Thomas J.; Millichamp, Jason; Di Michiel, Marco; Offer, Gregory J.; Hinds, Gareth; Brett, Dan J.L.; Shearing, Paul R.

    2015-01-01

    Prevention and mitigation of thermal runaway presents one of the greatest challenges for the safe operation of lithium-ion batteries. Here, we demonstrate for the first time the application of high-speed synchrotron X-ray computed tomography and radiography, in conjunction with thermal imaging, to track the evolution of internal structural damage and thermal behaviour during initiation and propagation of thermal runaway in lithium-ion batteries. This diagnostic approach is applied to commercial lithium-ion batteries (LG 18650 NMC cells), yielding insights into key degradation modes including gas-induced delamination, electrode layer collapse and propagation of structural degradation. It is envisaged that the use of these techniques will lead to major improvements in the design of Li-ion batteries and their safety features. PMID:25919582

  8. Current and Prospective Li-Ion Battery Recycling and Recovery Processes

    Science.gov (United States)

    Heelan, Joseph; Gratz, Eric; Zheng, Zhangfeng; Wang, Qiang; Chen, Mengyuan; Apelian, Diran; Wang, Yan

    2016-10-01

    The lithium ion (Li-ion) battery industry has been growing exponentially since its initial inception in the late 20th century. As battery materials evolve, the applications for Li-ion batteries have become even more diverse. To date, the main source of Li-ion battery use varies from consumer portable electronics to electric/hybrid electric vehicles. However, even with the continued rise of Li-ion battery development and commercialization, the recycling industry is lagging; approximately 95% of Li-ion batteries are landfilled instead of recycled upon reaching end of life. Industrialized recycling processes are limited and only capable of recovering secondary raw materials, not suitable for direct reuse in new batteries. Most technologies are also reliant on high concentrations of cobalt to be profitable, and intense battery sortation is necessary prior to processing. For this reason, it is critical that a new recycling process be commercialized that is capable of recovering more valuable materials at a higher efficiency. A new technology has been developed by the researchers at Worcester Polytechnic Institute which is capable of recovering LiNi x Mn y Co z O2 cathode material from a hydrometallurgical process, making the recycling system as a whole more economically viable. By implementing a flexible recycling system that is closed-loop, recycling of Li-ion batteries will become more prevalent saving millions of pounds of batteries from entering the waste stream each year.

  9. Analytical modeling and simulation of porous electrodes: Li-ion distribution and diffusion-induced stress

    Science.gov (United States)

    Ji, Liang; Guo, Zhansheng

    2017-08-01

    A new model of porous electrodes based on the Gibbs free energy is developed, in which lithium-ion (Li-ion) diffusion, diffusion-induced stress (DIS), Butler-Volmer (BV) reaction kinetics, and size polydispersity of electrode particles are considered. The influence of BV reaction kinetics and concentration-dependent exchange current density (ECD) on concentration profile and DIS evolution are numerically investigated. BV reaction kinetics leads to a decrease in Li-ion concentration and DIS. In addition, concentration-dependent ECD results in a decrease in Li-ion concentration and an increase in DIS. Size polydispersity of electrode particles significantly affects the concentration profile and DIS. Optimal macroscopic state of charge (SOC) should consider the influence of the microscopic SOC values and mass fractions of differently sized particles.

  10. Paraffin Nanocomposites for Heat Management of Lithium-Ion Batteries: A Computational Investigation

    Directory of Open Access Journals (Sweden)

    A. H. N. Shirazi

    2016-01-01

    Full Text Available Lithium-ion (Li-ion batteries are currently considered as vital components for advances in mobile technologies such as those in communications and transport. Nonetheless, Li-ion batteries suffer from temperature rises which sometimes lead to operational damages or may even cause fire. An appropriate solution to control the temperature changes during the operation of Li-ion batteries is to embed batteries inside a paraffin matrix to absorb and dissipate heat. In the present work, we aimed to investigate the possibility of making paraffin nanocomposites for better heat management of a Li-ion battery pack. To fulfill this aim, heat generation during a battery charging/discharging cycles was simulated using Newman’s well established electrochemical pseudo-2D model. We couple this model to a 3D heat transfer model to predict the temperature evolution during the battery operation. In the later model, we considered different paraffin nanocomposites structures made by the addition of graphene, carbon nanotubes, and fullerene by assuming the same thermal conductivity for all fillers. This way, our results mainly correlate with the geometry of the fillers. Our results assess the degree of enhancement in heat dissipation of Li-ion batteries through the use of paraffin nanocomposites. Our results may be used as a guide for experimental set-ups to improve the heat management of Li-ion batteries.

  11. Generalized Characterization Methodology for Performance Modelling of Lithium-Ion Batteries

    DEFF Research Database (Denmark)

    Stroe, Daniel Loan; Swierczynski, Maciej Jozef; Stroe, Ana-Irina

    2016-01-01

    Lithium-ion (Li-ion) batteries are complex energy storage devices with their performance behavior highly dependent on the operating conditions (i.e., temperature, load current, and state-of-charge (SOC)). Thus, in order to evaluate their techno-economic viability for a certain application, detailed...... information about Li-ion battery performance behavior becomes necessary. This paper proposes a comprehensive seven-step methodology for laboratory characterization of Li-ion batteries, in which the battery’s performance parameters (i.e., capacity, open-circuit voltage (OCV), and impedance) are determined...... and their dependence on the operating conditions are obtained. Furthermore, this paper proposes a novel hybrid procedure for parameterizing the batteries’ equivalent electrical circuit (EEC), which is used to emulate the batteries’ dynamic behavior. Based on this novel parameterization procedure, the performance model...

  12. Internal Short Circuits in Lithium-Ion Cells for PHEVs

    Energy Technology Data Exchange (ETDEWEB)

    Sriramulu, Suresh [Tiax LLC, Lexington, MA (United States); Stringfellow, Richard [Tiax LLC, Lexington, MA (United States)

    2013-05-25

    Development of Plug-in Hybrid Electric Vehicles (PHEVs) has recently become a high national priority because of their potential to enable significantly reduced petroleum consumption by the domestic transportation sector in the relatively near term. Lithium-ion (Li-ion) batteries are a critical enabling technology for PHEVs. Among battery technologies with suitable operating characteristics for use in vehicles, Li-ion batteries offer the best combination of energy, power, life and cost. Consequently, worldwide, leading corporations and government agencies are supporting the development of Li-ion batteries for PHEVs, as well as the full spectrum of vehicular applications ranging from mild hybrid to all-electric. In this project, using a combination of well-defined experiments, custom designed cells and simulations, we have improved the understanding of the process by which a Li-ion cell that develops an internal short progresses to thermal runaway. Using a validated model for thermal runaway, we have explored the influence of environmental factors and cell design on the propensity for thermal runaway in full-sized PHEV cells. We have also gained important perspectives about internal short development and progression; specifically that initial internal shorts may be augmented by secondary shorts related to separator melting. Even though the nature of these shorts is very stochastic, we have shown the critical and insufficiently appreciated role of heat transfer in influencing whether a developing internal short results in a thermal runaway. This work should lead to enhanced perspectives on separator design, the role of active materials and especially cathode materials with respect to safety and the design of automotive cooling systems to enhance battery safety in PHEVs.

  13. The Second Life Ageing of the NMC/C Electric Vehicle Retired Li-Ion Batteries in the Stationary Applications

    DEFF Research Database (Denmark)

    Swierczynski, Maciej Jozef; Stroe, Daniel Loan; Martinez-Laserna, Egoitz

    2016-01-01

    Despite the cost of li-ion batteries is gradually falling, the price for li-ion batteries is still too high in order to significantly impact the mass market adoption of e-mobility and household battery applications. It is expected that it might take another several years before lithium-ion batter......-ion batteries obtain grid parity and Electric Vehicles (EVs) will become competitive in cost with conventional vehicles (Figure 1). In consequence, a different approach for battery cost reduction can be investigated....

  14. Anthracite as a candidate for lithium ion battery anode

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Y.J.; Yang, H.J.; Yoon, S.H.; Korai, Y.; Mochida, I.

    2003-07-01

    Four kinds of anthracites from different regions were investigated as anodic materials of Li ion secondary battery by varying their calcination temperatures. Hon-gye anthracite calcined at 1000-1150 {sup o}C showed a high reversible capacity at low potential region of 0-0.12 V, which is typical with hard carbon. The highest capacity of 370 mAh/g was obtained with the Hon-gye among anthracites calcined at 1100{sup o}C. The graphitization started with the anthracite above 1600{sup o}C to provide capacity at ca. 0.2 V which reflects the intercalation of graphitic carbon. The anthracite calcined at 1000-1150{sup o}C was indicated to carry the largest d(002) and smallest Lc(002). The large capacity of the anthracite as hard carbon is ascribed to its many micropores among the smallest graphite units which can accommodate highly reduced lithium ions.

  15. Modeling Diffusion Induced Stresses for Lithium-Ion Battery Materials

    Science.gov (United States)

    Chiu Huang, Cheng-Kai

    rate (C-rate) during charging/discharging affects diffusion induced stresses inside electrode materials. For the experimental part we first conduct charging/discharging under different C-rates to observe the voltage responses for commercial LiFePO4 batteries. Then Time-of-Flight Secondary Ion Mass Spectrometry technique is applied to measure the lithium ion intensities in different C-rate charged/discharged samples. These experimental results could be used to support that a more significant voltage fluctuation under high C-rates is due to different lithium insertion mechanisms, rather than the amount of lithium ions intercalated into electrode materials. Thus the investigation of C-rate-dependent stress evolution is required for the development of a more durable lithium ion battery. In this dissertation, we extend the single particle finite element model to investigate the C-rate-dependent diffusion induced stresses in a multi-particle system. Concentration dependent anisotropic material properties, C-rate-dependent volume misfits and concentration dependent Li-ion diffusivity are incorporated in the model. The concentration gradients, diffusion induced stresses, and strain energies under different C-rates are discussed in this study. Particle fractures have been observed in many experimental results, in this study we further discuss the effect of the crack surface orientation on the lithium concentration profile and stress level in cathode materials. The results of this dissertation provide a better understanding of diffusion induced stresses in electrode materials and contribute to our fundamental knowledge of interplay between lithium intercalations, stress evolutions, particle fractures and the capacity fade in lithium-ion batteries.

  16. Assessment of Various Low Temperature Electrolytes in Prototype Li-Ion Cells Developed for ESMD Applications

    Science.gov (United States)

    Smart, M. C.; Ratnakumar, B. V.; Whitcanack, L. D.

    2008-01-01

    Due to their attractive properties and proven success, Li-ion batteries have become identified as the battery chemistry of choice for a number of future NASA missions. A number of these applications would be greatly benefited by improved performance of Li-ion technology over a wider operating temperature range, especially at low temperatures, such as future ESMD missions. In many cases, these technology improvements may be mission enabling, and at the very least mission enhancing. In addition to aerospace applications, the DoE has interest in developing advanced Li-ion batteries that can operate over a wide temperature range to enable terrestrial HEV applications. Thus, our focus at JPL in recent years has been to extend the operating temperature range of Li-ion batteries, especially at low temperatures. To accomplish this, the main focus of the research has been devoted to developing improved lithium-ion conducting electrolytes. In the present paper, we would like to present some of the results we have obtained with six different ethylene carbonate-based electrolytes optimized for low temperature. In addition to investigating the behavior in experimental cells initially, the performance of these promising low temperature electrolytes was demonstrated in large capacity, aerospace quality Li-ion prototype cells, manufactured by Yardney Technical Products and Saft America, Inc. These cells were subjected to a number of performance tests, including discharge rate characterization, charge rate characterization, cycle life performance at various temperatures, and power characterization tests.

  17. Online estimation of lithium-ion battery capacity using sparse Bayesian learning

    Science.gov (United States)

    Hu, Chao; Jain, Gaurav; Schmidt, Craig; Strief, Carrie; Sullivan, Melani

    2015-09-01

    Lithium-ion (Li-ion) rechargeable batteries are used as one of the major energy storage components for implantable medical devices. Reliability of Li-ion batteries used in these devices has been recognized as of high importance from a broad range of stakeholders, including medical device manufacturers, regulatory agencies, patients and physicians. To ensure a Li-ion battery operates reliably, it is important to develop health monitoring techniques that accurately estimate the capacity of the battery throughout its life-time. This paper presents a sparse Bayesian learning method that utilizes the charge voltage and current measurements to estimate the capacity of a Li-ion battery used in an implantable medical device. Relevance Vector Machine (RVM) is employed as a probabilistic kernel regression method to learn the complex dependency of the battery capacity on the characteristic features that are extracted from the charge voltage and current measurements. Owing to the sparsity property of RVM, the proposed method generates a reduced-scale regression model that consumes only a small fraction of the CPU time required by a full-scale model, which makes online capacity estimation computationally efficient. 10 years' continuous cycling data and post-explant cycling data obtained from Li-ion prismatic cells are used to verify the performance of the proposed method.

  18. Graphene-Based Materials for Lithium-Ion Hybrid Supercapacitors.

    Science.gov (United States)

    Ma, Yanfeng; Chang, Huicong; Zhang, Miao; Chen, Yongsheng

    2015-09-23

    Lithium-ion hybrid supercapacitors (LIHSs), also called Li-ion capacitors, have attracted much attention due to the combination of the rapid charge-discharge and long cycle life of supercapacitors and the high energy-storage capacity of lithium-ion batteries. Thus, LIHSs are expected to become the ultimate power source for hybrid and all-electric vehicles in the near future. As an electrode material, graphene has many advantages, including high surface area and porous structure, high electric conductivity, and high chemical and thermal stability, etc. Compared with other electrode materials, such as activated carbon, graphite, and metal oxides, graphene-based materials with 3D open frameworks show higher effective specific surface area, better control of channels, and higher conductivity, which make them better candidates for LIHS applications. Here, the latest advances in electrode materials for LIHSs are briefly summarized, with an emphasis on graphene-based electrode materials (including 3D graphene networks) for LIHS applications. An outlook is also presented to highlight some future directions. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. A Survey of Low-Temperature Operational Boundaries of Navy and Marine Corps Lithium and Lithium-Ion Batteries

    Science.gov (United States)

    2016-09-29

    Love 1 INTRODUCTION The U.S. Navy and Marine Corps depend on lithium (Li) and lithium-ion (Li-ion) batteries as mission- enabling power sources...Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6110--16-9695 A Survey of Low-Temperature Operational Boundaries of Navy and Marine Corps... Chemistry Branch Chemistry Division oLga a. Baturina Corey t. Love Chemical Dynamics and Diagnostics Branch Chemistry Division i REPORT

  20. A study of the effects of external pressure on the electrical performance of a lithium-ion pouch cell

    OpenAIRE

    Barai, Anup; Guo, Yue; McGordon, Andrew; Jennings, P.A.

    2013-01-01

    The introduction of lithium-ion batteries for vehicle powertrain electrification has increased in recent years. They feature high energy density, high power density, long cycle life, and is also environmentally friendly compared with other types of batteries. A large number of Li-ion cells are usually required to meet the demand in capacity and power for automotive applications. Pouch cells have been favored by many manufacturers because of the high packaging efficiency and, therefore, a high...

  1. Feasibility of Cathode Surface Coating Technology for High-Energy Lithium-ion and Beyond-Lithium-ion Batteries.

    Science.gov (United States)

    Kalluri, Sujith; Yoon, Moonsu; Jo, Minki; Liu, Hua Kun; Dou, Shi Xue; Cho, Jaephil; Guo, Zaiping

    2017-12-01

    Cathode material degradation during cycling is one of the key obstacles to upgrading lithium-ion and beyond-lithium-ion batteries for high-energy and varied-temperature applications. Herein, we highlight recent progress in material surface-coating as the foremost solution to resist the surface phase-transitions and cracking in cathode particles in mono-valent (Li, Na, K) and multi-valent (Mg, Ca, Al) ion batteries under high-voltage and varied-temperature conditions. Importantly, we shed light on the future of materials surface-coating technology with possible research directions. In this regard, we provide our viewpoint on a novel hybrid surface-coating strategy, which has been successfully evaluated in LiCoO2 -based-Li-ion cells under adverse conditions with industrial specifications for customer-demanding applications. The proposed coating strategy includes a first surface-coating of the as-prepared cathode powders (by sol-gel) and then an ultra-thin ceramic-oxide coating on their electrodes (by atomic-layer deposition). What makes it appealing for industry applications is that such a coating strategy can effectively maintain the integrity of materials under electro-mechanical stress, at the cathode particle and electrode- levels. Furthermore, it leads to improved energy-density and voltage retention at 4.55 V and 45 °C with highly loaded electrodes (≈24 mg.cm-2 ). Finally, the development of this coating technology for beyond-lithium-ion batteries could be a major research challenge, but one that is viable. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Development of an Experimental Testbed for Research in Lithium-Ion Battery Management Systems

    Directory of Open Access Journals (Sweden)

    Mehdi Ferdowsi

    2013-10-01

    Full Text Available Advanced electrochemical batteries are becoming an integral part of a wide range of applications from household and commercial to smart grid, transportation, and aerospace applications. Among different battery technologies, lithium-ion (Li-ion batteries are growing more and more popular due to their high energy density, high galvanic potential, low self-discharge, low weight, and the fact that they have almost no memory effect. However, one of the main obstacles facing the widespread commercialization of Li-ion batteries is the design of reliable battery management systems (BMSs. An efficient BMS ensures electrical safety during operation, while increasing battery lifetime, capacity and thermal stability. Despite the need for extensive research in this field, the majority of research conducted on Li-ion battery packs and BMS are proprietary works conducted by manufacturers. The available literature, however, provides either general descriptions or detailed analysis of individual components of the battery system, and ignores addressing details of the overall system development. This paper addresses the development of an experimental research testbed for studying Li-ion batteries and their BMS design. The testbed can be configured in a variety of cell and pack architectures, allowing for a wide range of BMS monitoring, diagnostics, and control technologies to be tested and analyzed. General considerations that should be taken into account while designing Li-ion battery systems are reviewed and different technologies and challenges commonly encountered in Li-ion battery systems are investigated. This testbed facilitates future development of more practical and improved BMS technologies with the aim of increasing the safety, reliability, and efficiency of existing Li-ion battery systems. Experimental results of initial tests performed on the system are used to demonstrate some of the capabilities of the developed research testbed. To the authors

  3. Preparation of 3D nanoporous copper-supported cuprous oxide for high-performance lithium ion battery anodes.

    Science.gov (United States)

    Liu, Dequan; Yang, Zhibo; Wang, Peng; Li, Fei; Wang, Desheng; He, Deyan

    2013-03-07

    Three-dimensional (3D) nanoporous architectures can provide efficient and rapid pathways for Li-ion and electron transport as well as short solid-state diffusion lengths in lithium ion batteries (LIBs). In this work, 3D nanoporous copper-supported cuprous oxide was successfully fabricated by low-cost selective etching of an electron-beam melted Cu(50)Al(50) alloy and subsequent in situ thermal oxidation. The architecture was used as an anode in lithium ion batteries. In the first cycle, the sample delivered an extremely high lithium storage capacity of about 2.35 mA h cm(-2). A high reversible capacity of 1.45 mA h cm(-2) was achieved after 120 cycles. This work develops a promising approach to building reliable 3D nanostructured electrodes for high-performance lithium ion batteries.

  4. Lithium-Ion Battery Program Status

    Science.gov (United States)

    Surampudi, S.; Huang, C. K.; Smart, M.; Davies, E.; Perrone, D.; Distefano, S.; Halpert, G.

    1996-01-01

    The objective of this program is to develop rechargeable Li-ion cells for future NASA missions. Applications that would benefit from this project are: new millenium spacecraft; rovers; landers; astronaut equipment; and planetary orbiters. The approach of this program is: select electrode materials and electrolytes; identify failure modes and mechanisms and enhance cycle life; demonstrate Li-ion cell technology with liquid electrolyte; select candidate polymer electrolytes for Li-ion polymer cells; and develop Li-ion polymer cell technology.

  5. Electrolytes for lithium ion batteries

    Science.gov (United States)

    Vaughey, John; Jansen, Andrew N.; Dees, Dennis W.

    2014-08-05

    A family of electrolytes for use in a lithium ion battery. The genus of electrolytes includes ketone-based solvents, such as, 2,4-dimethyl-3-pentanone; 3,3-dimethyl 2-butanone(pinacolone) and 2-butanone. These solvents can be used in combination with non-Lewis Acid salts, such as Li.sub.2[B.sub.12F.sub.12] and LiBOB.

  6. Mechanochemical approaches to employ silicon as a lithium-ion battery anode

    Directory of Open Access Journals (Sweden)

    Norihiro Shimoi

    2015-05-01

    Full Text Available Silicon is essential as an active material in lithium-ion batteries because it provides both high-charge and optimal cycle characteristics. The authors attempted to realize a composite by a simple mechanochemical grinding approach of individual silicon (Si particles and copper monoxide (CuO particles to serve as an active material in the anode and optimize the charge-discharge characteristics of a lithium-ion battery. The composite with Si and CuO allowed for a homogenous dispersion with nano-scale Si grains, nano-scale copper-silicon alloy grains and silicon monoxide oxidized the oxide from CuO. The authors successfully achieved the synthesis of an active composite unites the structural features of an active material based on silicon composite as an anode in Li-ion battery with high capacity and cyclic reversible charge properties of 3256 mAh g−1 after 200 cycles.

  7. Lithium-Ion Electrolytes Containing Flame Retardant Additives for Increased Safety Characteristics

    Science.gov (United States)

    Smart, Marshall C. (Inventor); Smith, Kiah A. (Inventor); Bugga, Ratnakumar V. (Inventor); Prakash, Surya G. (Inventor); Krause, Frederick Charles (Inventor)

    2014-01-01

    The invention discloses various embodiments of Li-ion electrolytes containing flame retardant additives that have delivered good performance over a wide temperature range, good cycle life characteristics, and improved safety characteristics, namely, reduced flammability. In one embodiment of the invention there is provided an electrolyte for use in a lithium-ion electrochemical cell, the electrolyte comprising a mixture of an ethylene carbonate (EC), an ethyl methyl carbonate (EMC), a fluorinated co-solvent, a flame retardant additive, and a lithium salt. In another embodiment of the invention there is provided an electrolyte for use in a lithium-ion electrochemical cell, the electrolyte comprising a mixture of an ethylene carbonate (EC), an ethyl methyl carbonate (EMC), a flame retardant additive, a solid electrolyte interface (SEI) film forming agent, and a lithium salt.

  8. Mechanochemical approaches to employ silicon as a lithium-ion battery anode

    Energy Technology Data Exchange (ETDEWEB)

    Shimoi, Norihiro, E-mail: shimoi@mail.kankyo.tohoku.ac.jp; Bahena-Garrido, Sharon; Tanaka, Yasumitsu [Graduate School of Environmental Studies, Tohoku University 6-6-20 Aoba, Aramaki, Aoba-ku, Sendai 980-8579 (Japan); Qiwu, Zhang [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan)

    2015-05-15

    Silicon is essential as an active material in lithium-ion batteries because it provides both high-charge and optimal cycle characteristics. The authors attempted to realize a composite by a simple mechanochemical grinding approach of individual silicon (Si) particles and copper monoxide (CuO) particles to serve as an active material in the anode and optimize the charge-discharge characteristics of a lithium-ion battery. The composite with Si and CuO allowed for a homogenous dispersion with nano-scale Si grains, nano-scale copper-silicon alloy grains and silicon monoxide oxidized the oxide from CuO. The authors successfully achieved the synthesis of an active composite unites the structural features of an active material based on silicon composite as an anode in Li-ion battery with high capacity and cyclic reversible charge properties of 3256 mAh g{sup −1} after 200 cycles.

  9. Lithium-ion batteries fundamentals and applications

    CERN Document Server

    Wu, Yuping

    2015-01-01

    Lithium-Ion Batteries: Fundamentals and Applications offers a comprehensive treatment of the principles, background, design, production, and use of lithium-ion batteries. Based on a solid foundation of long-term research work, this authoritative monograph:Introduces the underlying theory and history of lithium-ion batteriesDescribes the key components of lithium-ion batteries, including negative and positive electrode materials, electrolytes, and separatorsDiscusses electronic conductive agents, binders, solvents for slurry preparation, positive thermal coefficient (PTC) materials, current col

  10. Large-scale production of paper-based Li-ion cells

    CERN Document Server

    Zolin, Lorenzo

    2017-01-01

    This book describes in detail the use of natural cellulose fibers for the production of innovative, low-cost, and easily recyclable lithium-ion (Li-ion) cells by means of fast and reliable papermaking procedures that employ water as a solvent. In addition, it proposes specific methods to optimize the safety features of these paper-based cells and to improve the electronic conductivity of the electrodes by means of a carbonization process– an interesting novel technology that enables higher current rate capabilities to be achieved. The in-depth descriptions of materials, methods, and techniques are complemented by the inclusion of a general overview of electrochemical devices and, in particular, of different Li-ion battery configurations. Presenting the outcomes of this important research, the work is of wide interest to electrochemical engineers in both research institutions and industry.

  11. Li Ion Conducting Polymer Gel Electrolytes Based on Ionic Liquid/PVDF-HFP Blends

    Science.gov (United States)

    Ye, Hui; Huang, Jian; Xu, Jun John; Khalfan, Amish; Greenbaum, Steve G.

    2009-01-01

    Ionic liquids thermodynamically compatible with Li metal are very promising for applications to rechargeable lithium batteries. 1-methyl-3-propylpyrrolidinium bis(trifluoromethanesulfonyl)imide (P13TFSI) is screened out as a particularly promising ionic liquid in this study. Dimensionally stable, elastic, flexible, nonvolatile polymer gel electrolytes (PGEs) with high electrochemical stabilities, high ionic conductivities and other desirable properties have been synthesized by dissolving Li imide salt (LiTFSI) in P13TFSI ionic liquid and then mixing the electrolyte solution with poly(vinylidene-co-hexafluoropropylene) (PVDF-HFP) copolymer. Adding small amounts of ethylene carbonate to the polymer gel electrolytes dramatically improves the ionic conductivity, net Li ion transport concentration, and Li ion transport kinetics of these electrolytes. They are thus favorable and offer good prospects in the application to rechargeable Li batteries including open systems like Li/air batteries, as well as more “conventional” rechargeable lithium and lithium ion batteries. PMID:20354587

  12. Artificial Fish Swarm Algorithm-Based Particle Filter for Li-Ion Battery Life Prediction

    Directory of Open Access Journals (Sweden)

    Ye Tian

    2014-01-01

    Full Text Available An intelligent online prognostic approach is proposed for predicting the remaining useful life (RUL of lithium-ion (Li-ion batteries based on artificial fish swarm algorithm (AFSA and particle filter (PF, which is an integrated approach combining model-based method with data-driven method. The parameters, used in the empirical model which is based on the capacity fade trends of Li-ion batteries, are identified dependent on the tracking ability of PF. AFSA-PF aims to improve the performance of the basic PF. By driving the prior particles to the domain with high likelihood, AFSA-PF allows global optimization, prevents particle degeneracy, thereby improving particle distribution and increasing prediction accuracy and algorithm convergence. Data provided by NASA are used to verify this approach and compare it with basic PF and regularized PF. AFSA-PF is shown to be more accurate and precise.

  13. Lithium ion battery energy storage system for augmented wind power plants

    DEFF Research Database (Denmark)

    Swierczynski, Maciej Jozef

    Future large Wind Power Plants (WPP) will be intended to function like today's conventional power plants seen from the transmission system point of view, by complying with future, more stringent, grid codes and providing ancillary services. This is possible to achieve by integrating WPPs...... with Battery Energy Storage Systems (BESSs) into the so called Virtual Power Plants (VPP). Relatively new energy storage technologies based on Lithium ion (Li-ion) batteries are constantly improving their performance and are becoming attractive for stationary energy storage applications due...... to their characteristics such as high power, high efficiency, low self-discharge, and long lifetime. The family of the Li-ion batteries is wide and the selection of the most appropriate Liion chemistries for VPPs is one of the topics of this thesis, where different chemistries are compared and the most suitable ones...

  14. Lithium-ion Battery Charge Methodologies Observed with Portable Electronic Equipment

    Science.gov (United States)

    Jeevarajan, Judith

    2009-01-01

    Commercial lithium-ion batteries in portable electronic equipment has been used by NASA for space applications since 1999. First battery that was certified for flight and flown for Shuttle use was the Canon BP 927 (2.7 Ah) battery pack. Since then, numerous portable equipment with li-ion batteries have been certified and flown and remain on-orbit for crew usage. Laptops (two generations with third one being worked on now) Camcorder Camera PDA 2 versions (second one being li-ion polymer cells) Satellite Phone Due to expense and time, certified batteries are used with different equipment with the help of adapters or by working with the manufacturer of the equipment to build the appropriate battery compartment and connector. Certified and dedicated chargers are available on Shuttle and on the ISS for safe charging.

  15. High Rate Performing Li-ion Battery

    Science.gov (United States)

    2015-02-09

    permeable to lithium ions and efficient in transferring the electrons into/from the LVP surface to the corresponding current collector. a) b) c) d) e...PO4)3/C for High Rate Lithium-ion Battery Applications”, Lee Hwang Sheng, Nail Suleimanov, Vishwanathan Ramar, Mangayarkarasi Murugan, Kuppan

  16. Saft Li-Ion VES140S Battery Flight Experience Return on TAS Space Bus Platforms

    Science.gov (United States)

    Borthomieu, Yannick; Gambini, Didier

    2014-08-01

    Starting 1996, the Lithium-ion (Li-ion) battery has been used several years ago with the support of ESA and CNES in the frame of the Stentor program. Following the development and qualification this very promising technology in terms of technical, industrial and cost aspects has been used on-board Space Bus plate-forms dedicated to telecommunications satellite for payload power from 3 up to 20 kW.The aim of the article is to present the in-orbit data from the Saft VES140 Li-Ion batteries on board the Thales Alenia Space Spacebus satellite. The first TAS satellite using Li-Ion batteries has been successfully launched in October 2005 after a first attempt in 2002 with Stentor. Since that date, 20 satellites are in operation with Li-Ion batteries. The battery performances have mainly been reviewed mainly on the oldest satellite. No deviation, versus the initial specification, has been analysed. The performances are equal or much better than the life projection done at the start of the projects. Battery energies and voltages telemetries have been checked and compared to the prediction model SLIM. They are in line with the life trend given by the model.

  17. Generalized Characterization Methodology for Performance Modelling of Lithium-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Daniel-Ioan Stroe

    2016-12-01

    Full Text Available Lithium-ion (Li-ion batteries are complex energy storage devices with their performance behavior highly dependent on the operating conditions (i.e., temperature, load current, and state-of-charge (SOC. Thus, in order to evaluate their techno-economic viability for a certain application, detailed information about Li-ion battery performance behavior becomes necessary. This paper proposes a comprehensive seven-step methodology for laboratory characterization of Li-ion batteries, in which the battery’s performance parameters (i.e., capacity, open-circuit voltage (OCV, and impedance are determined and their dependence on the operating conditions are obtained. Furthermore, this paper proposes a novel hybrid procedure for parameterizing the batteries’ equivalent electrical circuit (EEC, which is used to emulate the batteries’ dynamic behavior. Based on this novel parameterization procedure, the performance model of the studied Li-ion battery is developed and its accuracy is successfully verified (maximum error lower than 5% and a mean error below 8.5 mV for various load profiles (including a real application profile, thus validating the proposed seven-step characterization methodology.

  18. Charge Localization in the Lithium Iron Phosphate Li3Fe2(PO4)3at High Voltages in Lithium-Ion Batteries

    DEFF Research Database (Denmark)

    Younesi, Reza; Christiansen, Ane Sælland; Loftager, Simon

    2015-01-01

    Possible changes in the oxidation state of the oxygen ion in the lithium iron phosphate Li3Fe2(PO4)3 at high voltages in lithium-ion (Li-ion) batteries are studied using experimental and computational analysis. Results obtained from synchrotron-based hard X-ray photoelectron spectroscopy and dens...

  19. Lithium ion storage between graphenes

    Directory of Open Access Journals (Sweden)

    Chan Yue

    2011-01-01

    Full Text Available Abstract In this article, we investigate the storage of lithium ions between two parallel graphene sheets using the continuous approximation and the 6-12 Lennard-Jones potential. The continuous approximation assumes that the carbon atoms can be replaced by a uniform distribution across the surface of the graphene sheets so that the total interaction potential can be approximated by performing surface integrations. The number of ion layers determines the major storage characteristics of the battery, and our results show three distinct ionic configurations, namely single, double, and triple ion forming layers between graphenes. The number densities of lithium ions between the two graphenes are estimated from existing semi-empirical molecular orbital calculations, and the graphene sheets giving rise to the triple ion layers admit the largest storage capacity at all temperatures, followed by a marginal decrease of storage capacity for the case of double ion layers. These two configurations exceed the maximum theoretical storage capacity of graphite. Further, on taking into account the charge-discharge property, the double ion layers are the most preferable choice for enhanced lithium storage. Although the single ion layer provides the least charge storage, it turns out to be the most stable configuration at all temperatures. One application of the present study is for the design of future high energy density alkali batteries using graphene sheets as anodes for which an analytical formulation might greatly facilitate rapid computational results.

  20. Analysis of heat generation of lithium ion rechargeable batteries used in implantable battery systems for driving undulation pump ventricular assist device.

    Science.gov (United States)

    Okamoto, Eiji; Nakamura, Masatoshi; Akasaka, Yuhta; Inoue, Yusuke; Abe, Yusuke; Chinzei, Tsuneo; Saito, Itsuro; Isoyama, Takashi; Mochizuki, Shuichi; Imachi, Kou; Mitamura, Yoshinori

    2007-07-01

    We have developed internal battery systems for driving an undulation pump ventricular assist device using two kinds of lithium ion rechargeable batteries. The lithium ion rechargeable batteries have high energy density, long life, and no memory effect; however, rise in temperature of the lithium ion rechargeable battery is a critical issue. Evaluation of temperature rise by means of numerical estimation is required to develop an internal battery system. Temperature of the lithium ion rechargeable batteries is determined by ohmic loss due to internal resistance, chemical loss due to chemical reaction, and heat release. Measurement results of internal resistance (R(cell)) at an ambient temperature of 37 degrees C were 0.1 Omega in the lithium ion (Li-ion) battery and 0.03 Omega in the lithium polymer (Li-po) battery. Entropy change (DeltaS) of each battery, which leads to chemical loss, was -1.6 to -61.1 J/(mol.K) in the Li-ion battery and -9.6 to -67.5 J/(mol.K) in the Li-po battery depending on state of charge (SOC). Temperature of each lithium ion rechargeable battery under a discharge current of 1 A was estimated by finite element method heat transfer analysis at an ambient temperature of 37 degrees C configuring with measured R(cell) and measured DeltaS in each SOC. Results of estimation of time-course change in the surface temperature of each battery coincided with results of measurement results, and the success of the estimation will greatly contribute to the development of an internal battery system using lithium ion rechargeable batteries.

  1. Hybrid Lithium-ion Capacitor / Lithium-ion Battery System for Extended Performance Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The work focused on testing the Li-ion supercapacitors to confirm their performance and safety.  The li-ion supercaps were found to be safe under several...

  2. Lithium-ion batteries advances and applications

    CERN Document Server

    Pistoia, Gianfranco

    2014-01-01

    Lithium-Ion Batteries features an in-depth description of different lithium-ion applications, including important features such as safety and reliability. This title acquaints readers with the numerous and often consumer-oriented applications of this widespread battery type. Lithium-Ion Batteries also explores the concepts of nanostructured materials, as well as the importance of battery management systems. This handbook is an invaluable resource for electrochemical engineers and battery and fuel cell experts everywhere, from research institutions and universities to a worldwi

  3. Ionic Liquids in Lithium-Ion Batteries.

    Science.gov (United States)

    Balducci, Andrea

    2017-04-01

    Lithium-ion batteries are among the most widespread energy storage devices in our society. In order to introduce these devices in new key applications such as transportation, however, their safety and their operative temperature range need to be significantly improved. These improvements can be obtained only by developing new electrolytes. Ionic liquids are presently considered among the most attractive electrolytes for the development of advanced and safer lithium-ion batteries. In this manuscript, the use of various types of ionic liquids, e.g. aprotic and protic, in lithium-ion batteries is considered. The advantages and the limits associated to the use of these innovative electrolytes are critically analysed.

  4. Dicty_cDB: VHP531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP531 (Link to dictyBase) - - - Contig-U12899-1 VHP531P (Link to Original site) VHP531F 691 VHP531Z...VHP531Z 706 VHP531P 1377 - - Show VHP531 Library VH (Link to library) Clone ID VHP531 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP531Q.Seq.d/ Representative seq. ID VHP531P (Link to Original site) Representative...Representative DNA sequence >VHP531 (VHP531Q) /CSM/VH/VHP5-B/VHP531Q.Seq.d/ GTACAACCCTAATGGATAGCACATTGG...significant alignments: (bits) Value VHP531 (VHP531Q) /CSM/VH/VHP5-B/VHP531Q.Seq.d/ 2666 0.0 VHP595 (VHP595Q)

  5. Lead-acid and lithium-ion batteries for the Chinese electric bike market and implications on future technology advancement

    Science.gov (United States)

    Weinert, Jonathan X.; Burke, Andrew F.; Wei, Xuezhe

    China has been experiencing a rapid increase in battery-powered personal transportation since the late 1990s due to the strong growth of the electric bike and scooter (i.e. e-bike) market. Annual sales in China reached 17 million bikes year -1 in 2006. E-bike growth has been in part due to improvements in rechargeable valve-regulated lead-acid (VRLA) battery technology, the primary battery type for e-bikes. Further improvements in technology and a transition from VRLA to lithium-ion (Li-ion) batteries will impact the future market growth of this transportation mode in China and abroad. Battery performance and cost for these two types are compared to assess the feasibility of a shift from VRLA to Li-ion battery e-bikes. The requirements for batteries used in e-bikes are assessed. A widespread shift from VRLA to Li-ion batteries seems improbable in the near future for the mass market given the cost premium relative to the performance advantages of Li-ion batteries. As both battery technologies gain more real-world use in e-bike applications, both will improve. Cell variability is a key problematic area to be addressed with VRLA technology. For Li-ion technology, safety and cost are the key problem areas which are being addressed through the use of new cathode materials.

  6. Improving Ionic Conductivity and Lithium-Ion Transference Number in Lithium-Ion Battery Separators.

    Science.gov (United States)

    Zahn, Raphael; Lagadec, Marie Francine; Hess, Michael; Wood, Vanessa

    2016-12-07

    The microstructure of lithium-ion battery separators plays an important role in separator performance; however, here we show that a geometrical analysis falls short in predicting the lithium-ion transport in the electrolyte-filled pore space. By systematically modifying the surface chemistry of a commercial polyethylene separator while keeping its microstructure unchanged, we demonstrate that surface chemistry, which alters separator-electrolyte interactions, influences ionic conductivity and lithium-ion transference number. Changes in separator surface chemistry, particularly those that increase lithium-ion transference numbers can reduce voltage drops across the separator and improve C-rate capability.

  7. Thermal explosion hazards on 18650 lithium ion batteries with a VSP2 adiabatic calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    Jhu, Can-Yong [Doctoral Program, Graduate School of Engineering Science and Technology, National Yunlin University of Science and Technology (NYUST), 123, University Rd., Sec. 3, Douliou, Yunlin 64002, Taiwan, ROC (China); Wang, Yih-Wen, E-mail: g9410825@yuntech.edu.tw [Department of Occupational Safety and Health, Jen-Teh Junior College of Medicine, Nursing and Management, 79-9, Sha-Luen-Hu, Xi-Zhou-Li, Houlong, Miaoli 35664, Taiwan, ROC (China); Shu, Chi-Min [Doctoral Program, Graduate School of Engineering Science and Technology, National Yunlin University of Science and Technology (NYUST), 123, University Rd., Sec. 3, Douliou, Yunlin 64002, Taiwan, ROC (China); Chang, Jian-Chuang; Wu, Hung-Chun [Material and Chemical Research Laboratories, Industrial Technology Research Institute (ITRI), Rm. 222, Bldg. 77, 2F, 195, Sec. 4, Chung Hsing Rd., Chutung, Hsinchu 31040, Taiwan, ROC (China)

    2011-08-15

    Thermal abuse behaviors relating to adiabatic runaway reactions in commercial 18650 lithium ion batteries (LiCoO{sub 2}) are being studied in an adiabatic calorimeter, vent sizing package 2 (VSP2). We select four worldwide battery producers, Sony, Sanyo, Samsung and LG, and tested their Li-ion batteries, which have LiCoO{sub 2} cathodes, to determine their thermal instabilities and adiabatic runaway features. The charged (4.2 V) and uncharged (3.7 V) 18650 Li-ion batteries are tested using a VSP2 with a customized stainless steel test can to evaluate their thermal hazard characteristics, such as the initial exothermic temperature (T{sub 0}), the self-heating rate (dT/dt), the pressure rise rate (dP/dt), the pressure-temperature profiles and the maximum temperature (T{sub max}) and pressure (P{sub max}). The T{sub max} and P{sub max} of the charged Li-ion battery during the runaway reaction reach 903.0 {sup o}C and 1565.9 psig (pound-force per square inch gauge), respectively. This result leads to a thermal explosion, and the heat of reaction is 26.2 kJ. The thermokinetic parameters of the reaction of LiCoO{sub 2} batteries are also determined using the Arrhenius model. The thermal reaction mechanism of the Li-ion battery (pack) proved to be an important safety concern for energy storage. Additionally, use of the VSP2 to classify the self-reactive ratings of the various Li-ion batteries demonstrates a new application of the adiabatic calorimetric methodology.

  8. Lithium Ion Battery Anode Aging Mechanisms

    Science.gov (United States)

    Agubra, Victor; Fergus, Jeffrey

    2013-01-01

    Degradation mechanisms such as lithium plating, growth of the passivated surface film layer on the electrodes and loss of both recyclable lithium ions and electrode material adversely affect the longevity of the lithium ion battery. The anode electrode is very vulnerable to these degradation mechanisms. In this paper, the most common aging mechanisms occurring at the anode during the operation of the lithium battery, as well as some approaches for minimizing the degradation are reviewed. PMID:28809211

  9. Dicty_cDB: VHP624 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP624 (Link to dictyBase) - - - Contig-U15307-1 VHP624P (Link to Original site) VHP...624F 449 VHP624Z 724 VHP624P 1153 - - Show VHP624 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP6-A/VHP624Q.Seq.d/ Representative seq. ID VHP...624P (Link to Original site) Representative DNA sequence >VHP624 (VHP624Q) /CSM/VH/VHP6-A/VHP...TRXLNRXYFVLXAGHGS MFLYSWLHLSGYDVSIEXXKNFXQLNSXTPGHPKFHDXPGVEATTGPLGQGIANAVGIAS PCKMAXGKFNTEQHQXFNQKVVVLV---

  10. Dicty_cDB: VHP870 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP870 (Link to dictyBase) - - - Contig-U16260-1 VHP870P (Link to Original site) VHP...870F 646 VHP870Z 763 VHP870P 1389 - - Show VHP870 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP8-C/VHP870Q.Seq.d/ Representative seq. ID VHP...870P (Link to Original site) Representative DNA sequence >VHP870 (VHP870Q) /CSM/VH/VHP8-C/VHP...*rffrw cfpmghqrrccl**kherypfqsl*chpph*chpqrwwsnhpncssctlcc*inclpnsl rtnllsrnycprkrywwyllctqss*rycyw*rtsyrfpi

  11. Dicty_cDB: VHP521 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP521 (Link to dictyBase) - - - Contig-U13887-1 VHP521P (Link to Original site) VHP...521F 677 VHP521Z 726 VHP521P 1383 - - Show VHP521 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-A/VHP521Q.Seq.d/ Representative seq. ID VHP...521P (Link to Original site) Representative DNA sequence >VHP521 (VHP521Q) /CSM/VH/VHP5-A/VHP...yhsfnq*nhs nstfiwylqrmvrn*pnqrfir*cw*fshfclcrsiqkrstq--- ---qekv*pmns*rlpskrkvvcklpif*plkppkrrtpskvtsmicvqnynhp

  12. Dicty_cDB: VHP458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP458 (Link to dictyBase) - - - Contig-U15962-1 VHP458P (Link to Original site) VHP...458F 607 VHP458Z 785 VHP458P 1372 - - Show VHP458 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-C/VHP458Q.Seq.d/ Representative seq. ID VHP...458P (Link to Original site) Representative DNA sequence >VHP458 (VHP458Q) /CSM/VH/VHP4-C/VHP...: *fskvik*vlliksqkvlfqs*mtlein*nhskvqliivqrlgf*vqkqkilny**lssk eqlmlifnqesistkkmhqfskiltkkilytsmqqkt*pkklmkf*is*ntlfhihp

  13. Dicty_cDB: VHP461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP461 (Link to dictyBase) - - - Contig-U16260-1 VHP461P (Link to Original site) VHP...461F 575 VHP461Z 767 VHP461P 1322 - - Show VHP461 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-C/VHP461Q.Seq.d/ Representative seq. ID VHP...461P (Link to Original site) Representative DNA sequence >VHP461 (VHP461Q) /CSM/VH/VHP4-C/VHP...SPGHVDF SSEVTAALRVTDGALVVIDCVEGVCVQTETVLRQAVAERIKPVLFVNKVDRFLLELQLNT EEAYLSFR--- ---hp

  14. Dicty_cDB: VHP283 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP283 (Link to dictyBase) - - - Contig-U16473-1 VHP283P (Link to Original site) VHP...283F 564 VHP283Z 762 VHP283P 1306 - - Show VHP283 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-D/VHP283Q.Seq.d/ Representative seq. ID VHP...283P (Link to Original site) Representative DNA sequence >VHP283 (VHP283Q) /CSM/VH/VHP2-D/VHP...iqnfiktkkfryfrreilgcfitkirklw*ifikrrn*fncctitkrc*scc*lvn*q wfike*ndrsl*fhps*nqcw*sfnfirnficsllikpycs*en*scrs

  15. Dicty_cDB: VHP571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP571 (Link to dictyBase) - - - Contig-U16441-1 VHP571P (Link to Original site) VHP...571F 582 VHP571Z 765 VHP571P 1327 - - Show VHP571 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-C/VHP571Q.Seq.d/ Representative seq. ID VHP...571P (Link to Original site) Representative DNA sequence >VHP571 (VHP571Q) /CSM/VH/VHP5-C/VHP...qyqmmqvkhfqpqqffhiklyqfhhi*ilrv**lhvpiisf*lvkilv*hgtmh hpmvmfyshq--- ---**rmnmisvk*lvli*qmychllamipqcnliplvv

  16. Dicty_cDB: VHP622 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP622 (Link to dictyBase) - - - Contig-U16379-1 VHP622P (Link to Original site) VHP...622F 640 VHP622Z 775 VHP622P 1395 - - Show VHP622 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP6-A/VHP622Q.Seq.d/ Representative seq. ID VHP...622P (Link to Original site) Representative DNA sequence >VHP622 (VHP622Q) /CSM/VH/VHP6-A/VHP...VLALAPKEELVEKALNFALSPSVRSQD SYMVFFTLPNRVRQFAWAYLTKNFNQINETFKNSPLFGRIIGSCLTSKMDDSQYNEVVNF FKDHP

  17. Dicty_cDB: VHP703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP703 (Link to dictyBase) - - - Contig-U15307-1 VHP703P (Link to Original site) VHP...703F 445 VHP703Z 700 VHP703P 1125 - - Show VHP703 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP7-A/VHP703Q.Seq.d/ Representative seq. ID VHP...703P (Link to Original site) Representative DNA sequence >VHP703 (VHP703Q) /CSM/VH/VHP7-A/VHP...0.25 Translated Amino Acid sequence NETRGLSMDAVAKAAXGHLGLPLGSAEIGAALFGNSLIYNPKDTRXLNRXYFVLXAGHGS MFLYSWLHLSGYDVSIEXXKNFXQLNSXTPGHP

  18. Dicty_cDB: VHP435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP435 (Link to dictyBase) - - - Contig-U16260-1 VHP435P (Link to Original site) VHP...435F 601 VHP435Z 688 VHP435P 1269 - - Show VHP435 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-B/VHP435Q.Seq.d/ Representative seq. ID VHP...435P (Link to Original site) Representative DNA sequence >VHP435 (VHP435Q) /CSM/VH/VHP4-B/VHP...IDCVEGVCVQTETVLRQAVAERIKPVLFVNKVDRFLLELQLNTE EAYLSFRRAIESVNVIV--- ---srr*rcqsprqchqrcsife*n*rffrwcfpmghqrrccx**kherypfqsl*chpp h*chp

  19. Dicty_cDB: VHP758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP758 (Link to dictyBase) - - - Contig-U11426-1 VHP758P (Link to Original site) VHP...758F 624 VHP758Z 707 VHP758P 1311 - - Show VHP758 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP7-C/VHP758Q.Seq.d/ Representative seq. ID VHP...758P (Link to Original site) Representative DNA sequence >VHP758 (VHP758Q) /CSM/VH/VHP7-C/VHP...lnqmkw*mmvff*n lthlkilvy*iamlnlk*fqsmilm*tcy*i*nylmlekipx**skfikffly*i Frame B: ftnyqimkivnslnfkqwiklvclyhwfikplpieivivsiiplnsshp

  20. Dicty_cDB: VHP546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP546 (Link to dictyBase) - - - Contig-U11694-1 VHP546P (Link to Original site) VHP...546F 546 VHP546Z 712 VHP546P 1238 - - Show VHP546 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-B/VHP546Q.Seq.d/ Representative seq. ID VHP...546P (Link to Original site) Representative DNA sequence >VHP546 (VHP546Q) /CSM/VH/VHP5-B/VHP...SNLPAXLFTKQSQALIYNYKEAAXQRXLXFDNVSQRDTPSXGGLIHPGSDGGMYKA FFGFKELVIPVYNSVSXACXQCPN

  1. Dicty_cDB: VHP335 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP335 (Link to dictyBase) - - - Contig-U16260-1 VHP335P (Link to Original site) VHP...335F 609 VHP335Z 766 VHP335P 1355 - - Show VHP335 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP3-B/VHP335Q.Seq.d/ Representative seq. ID VHP...335P (Link to Original site) Representative DNA sequence >VHP335 (VHP335Q) /CSM/VH/VHP3-B/VHP...r*skssc*lsr*xprmg*k*chehlvfrsrr*rcqsprqchqrcsife*n*rffr wcfpmghqrrccl**kherypfqsl*chpph*chpqrwwsnhpncssctlcc

  2. Dicty_cDB: VHP132 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP132 (Link to dictyBase) - - - Contig-U16260-1 VHP132P (Link to Original site) VHP...132F 548 VHP132Z 636 VHP132P 1164 - - Show VHP132 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-B/VHP132Q.Seq.d/ Representative seq. ID VHP...132P (Link to Original site) Representative DNA sequence >VHP132 (VHP132Q) /CSM/VH/VHP1-B/VHP...tslirqqsrsflixtpik-- - ---rr*rcqsprqchqrcsife*n*rffrwcfpmghqrrccl**kherypfqsl*chpph *chpqrwwsnhpncssctlcc*in

  3. Dicty_cDB: VHP267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP267 (Link to dictyBase) - - - Contig-U16260-1 VHP267P (Link to Original site) VHP...267F 528 VHP267Z 724 VHP267P 1232 - - Show VHP267 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-C/VHP267Q.Seq.d/ Representative seq. ID VHP...267P (Link to Original site) Representative DNA sequence >VHP267 (VHP267Q) /CSM/VH/VHP2-C/VHP...e*n*rffrwcfpmghqrrccl** kherypfqsl*chpph*chpqrwwsnhpncssctlcc*inclpnslrtnllsrnycprkr ywwyllctqss*rycyw*rtsyr

  4. Dicty_cDB: VHP284 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP284 (Link to dictyBase) - - - Contig-U12327-1 VHP284P (Link to Original site) VHP...284F 549 VHP284Z 759 VHP284P 1288 - - Show VHP284 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-D/VHP284Q.Seq.d/ Representative seq. ID VHP...284P (Link to Original site) Representative DNA sequence >VHP284 (VHP284Q) /CSM/VH/VHP2-D/VHP...IGDERKILNNKLSNQYYEFCSLLSLKLNPSDTELLSLAYYLLLQDRFDESIKIMKRI GKHPVSIPKLISSSTTTDSKSTHSSVISSSSSSNLSTTTDSSKDKKKLKK

  5. Dicty_cDB: VHP230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP230 (Link to dictyBase) - - - Contig-U16260-1 VHP230P (Link to Original site) VHP...230F 531 VHP230Z 681 VHP230P 1192 - - Show VHP230 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-B/VHP230Q.Seq.d/ Representative seq. ID VHP...230P (Link to Original site) Representative DNA sequence >VHP230 (VHP230Q) /CSM/VH/VHP2-B/VHP...frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsfli--- ---rmg*k*chehlvfrsrr*rcqsxrqchqrcsife*n*rffrwcfpmghqrrccl**k herypfqsl*chp

  6. Dicty_cDB: VHP157 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP157 (Link to dictyBase) - - - Contig-U16260-1 VHP157P (Link to Original site) VHP...157F 617 VHP157Z 723 VHP157P 1320 - - Show VHP157 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-C/VHP157Q.Seq.d/ Representative seq. ID VHP...157P (Link to Original site) Representative DNA sequence >VHP157 (VHP157Q) /CSM/VH/VHP1-C/VHP...h*r--- ---prmg*k*chehlvfrsrr*rcqsprqchqrcsife*n*rffrwcfpmghqrrccl** kherypfqsl*chpph*chpqrwwsnhpncssctlcc*in

  7. Dicty_cDB: VHP494 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP494 (Link to dictyBase) - - - Contig-U16433-1 VHP494P (Link to Original site) VHP...494F 539 VHP494Z 816 VHP494P 1335 - - Show VHP494 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-D/VHP494Q.Seq.d/ Representative seq. ID VHP...494P (Link to Original site) Representative DNA sequence >VHP494 (VHP494Q) /CSM/VH/VHP4-D/VHP...r--- ---qlqsiqlwsimvmvhmmlnlnqkkpvtmlsisl*mvttsmvsqrllplnqphplntl mlkvkv*skylimpqlnslfspltlkvllvpmvmihlkslsm

  8. Dicty_cDB: VHP592 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP592 (Link to dictyBase) - - - Contig-U16315-1 VHP592P (Link to Original site) VHP...592F 640 VHP592Z 778 VHP592P 1398 - - Show VHP592 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-D/VHP592Q.Seq.d/ Representative seq. ID VHP...592P (Link to Original site) Representative DNA sequence >VHP592 (VHP592Q) /CSM/VH/VHP5-D/VHP...tnnnnki Frame C: *ktvitkvilyfylfqylcistpyiyi*yiiifvisaiiitieiviqflgf*n*nkknny knckid*qtqkeyfkn*plfysniinhpyi

  9. Dicty_cDB: VHP496 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP496 (Link to dictyBase) - - - Contig-U15962-1 VHP496P (Link to Original site) VHP...496F 594 VHP496Z 809 VHP496P 1383 - - Show VHP496 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-D/VHP496Q.Seq.d/ Representative seq. ID VHP...496P (Link to Original site) Representative DNA sequence >VHP496 (VHP496Q) /CSM/VH/VHP4-D/VHP...tsmqqkt*pkklmkf*is*ntlfhihpl dikdi*hlmllllv*lvplllfytiqtm*qfkqvq*phllkwqlvmilpvwlvgnfqkkf qslitdmkrnflki---

  10. Dicty_cDB: VHP877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP877 (Link to dictyBase) - - - Contig-U10840-1 VHP877P (Link to Original site) VHP...877F 597 VHP877Z 696 VHP877P 1273 - - Show VHP877 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP8-D/VHP877Q.Seq.d/ Representative seq. ID VHP...877P (Link to Original site) Representative DNA sequence >VHP877 (VHP877Q) /CSM/VH/VHP8-D/VHP...sifnsfilsitl*kcys*i*sif*l*inn iscsrrfl*ffklv**ksmvsirtycrwynlprfngnskfsslviefieyys*y*kcmci vitmvcikysngnl*--- ---xtlsivlgslvkpthlhp

  11. Dicty_cDB: VHP409 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP409 (Link to dictyBase) - - - Contig-U16531-1 VHP409P (Link to Original site) VHP...409F 620 VHP409Z 750 VHP409P 1350 - - Show VHP409 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-A/VHP409Q.Seq.d/ Representative seq. ID VHP...409P (Link to Original site) Representative DNA sequence >VHP409 (VHP409Q) /CSM/VH/VHP4-A/VHP...cifhi*nsflgyslhlycnssifnsksll*erlcl*ilflvsichfnchc*it fccsrwnnlfllffldsryllqw*i*flflynfhplpfhlcftwsscicllfqc

  12. Dicty_cDB: VHP791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP791 (Link to dictyBase) - - - Contig-U16508-1 VHP791P (Link to Original site) VHP...791F 672 VHP791Z 427 VHP791P 1079 - - Show VHP791 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP7-D/VHP791Q.Seq.d/ Representative seq. ID VHP...791P (Link to Original site) Representative DNA sequence >VHP791 (VHP791Q) /CSM/VH/VHP7-D/VHP...w*lvvilcqvvdlnnwlmt--- ---shpllpmftxtqqxskrlefsisrclltidfsltxtkwfkdsnxtmvr*sr*yhtft yxkylsn*wsrftrstgvsl*ifq

  13. Dicty_cDB: VHP478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP478 (Link to dictyBase) - - - Contig-U16260-1 VHP478P (Link to Original site) VHP...478F 646 VHP478Z 748 VHP478P 1374 - - Show VHP478 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-D/VHP478Q.Seq.d/ Representative seq. ID VHP...478P (Link to Original site) Representative DNA sequence >VHP478 (VHP478Q) /CSM/VH/VHP4-D/VHP...fnqsyrfprsr*fq frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflirtpikh* rslslfp*sy*irqchcw*h*r*gir*chci--- ---shp

  14. Dicty_cDB: VHP621 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP621 (Link to dictyBase) - - - Contig-U16260-1 VHP621P (Link to Original site) VHP...621F 616 VHP621Z 746 VHP621P 1342 - - Show VHP621 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP6-A/VHP621Q.Seq.d/ Representative seq. ID VHP...621P (Link to Original site) Representative DNA sequence >VHP621 (VHP621Q) /CSM/VH/VHP6-A/VHP...kpklyyvkpslnvsnqsysstksivsy*nsn*tl kklislsvellnpsmsllvtlk--- ---shpkmiqklvltislit

  15. Dicty_cDB: VHP206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP206 (Link to dictyBase) - - - Contig-U16260-1 VHP206P (Link to Original site) VHP...206F 616 VHP206Z 744 VHP206P 1340 - - Show VHP206 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-A/VHP206Q.Seq.d/ Representative seq. ID VHP...206P (Link to Original site) Representative DNA sequence >VHP206 (VHP206Q) /CSM/VH/VHP2-A/VHP...rqqsrsflirtpikh* rslslfp*sy*irqchcw*h*--- ---hpkmiqklvltislittngikmmp*tfglsvqkvtvpisssmspkvfni*mklkils lvlsn

  16. Dicty_cDB: VHP523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP523 (Link to dictyBase) - - - Contig-U13021-1 VHP523P (Link to Original site) VHP...523F 645 VHP523Z 783 VHP523P 1408 - - Show VHP523 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-A/VHP523Q.Seq.d/ Representative seq. ID VHP...523P (Link to Original site) Representative DNA sequence >VHP523 (VHP523Q) /CSM/VH/VHP5-A/VHP...hsmiimkc vcqlihkiqlfsihhrlitlhihykftmlvrglpsilcisyrkfqlpilvnkmvgtimli fiqvv*klvclqhpinynilkfvvimligwhlenlmly

  17. Dicty_cDB: VHP429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP429 (Link to dictyBase) - - - Contig-U13887-1 VHP429P (Link to Original site) VHP...429F 597 VHP429Z 678 VHP429P 1255 - - Show VHP429 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-B/VHP429Q.Seq.d/ Representative seq. ID VHP...429P (Link to Original site) Representative DNA sequence >VHP429 (VHP429Q) /CSM/VH/VHP4-B/VHP...SFSSEAILGMLFGKLKKTTEAFVNNPVRDVVISVPVFWNDYQRRAILNAGSIAGLNIIRL INETTATALSYGIYK--- ---vvcklpif*plkppkrrtpskvtsmicvqnynhp

  18. Dicty_cDB: VHP670 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP670 (Link to dictyBase) - - - Contig-U12327-1 VHP670P (Link to Original site) VHP...670F 588 VHP670Z 780 VHP670P 1348 - - Show VHP670 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP6-C/VHP670Q.Seq.d/ Representative seq. ID VHP...670P (Link to Original site) Representative DNA sequence >VHP670 (VHP670Q) /CSM/VH/VHP6-C/VHP...YYEFCSLLSLKLNPSDTELLSLA YYLLLQDRFDESIKIMKRIGKHPVSIPKLISSSTTTDSKSTHSSVISSSSSSNLSTT

  19. Dicty_cDB: VHP405 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP405 (Link to dictyBase) - - - Contig-U16260-1 VHP405P (Link to Original site) VHP...405F 574 VHP405Z 733 VHP405P 1287 - - Show VHP405 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-A/VHP405Q.Seq.d/ Representative seq. ID VHP...405P (Link to Original site) Representative DNA sequence >VHP405 (VHP405Q) /CSM/VH/VHP4-A/VHP...irtpikh* rslslfp--- ---sr**prmg*k*chehlvfrsrr*rcqsprqchqrcsife*n*rffrwcfpmghqrrc cl**kherypfqsl*chpph*chp

  20. Dicty_cDB: VHP820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP820 (Link to dictyBase) - - - Contig-U16379-1 VHP820P (Link to Original site) VHP...820F 243 VHP820Z 756 VHP820P 979 - - Show VHP820 Library VH (Link to library) Clone ID VHP... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP8-A/VHP820Q.Seq.d/ Representative seq. ID VHP...820P (Link to Original site) Representative DNA sequence >VHP820 (VHP820Q) /CSM/VH/VHP8-A/VHP8...AYLTKNFNQINETFKNSPLFGRIIGSCLTSKMDDSQYNEVVNF FKDHPVPIADRSIKQDLEMVTINSNWFKAFNQDLSNWIQSK*k*nllqgkifvlixix*k kid

  1. Dicty_cDB: VHP357 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP357 (Link to dictyBase) - - - Contig-U16260-1 VHP357P (Link to Original site) VHP...357F 617 VHP357Z 764 VHP357P 1361 - - Show VHP357 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP3-C/VHP357Q.Seq.d/ Representative seq. ID VHP...357P (Link to Original site) Representative DNA sequence >VHP357 (VHP357Q) /CSM/VH/VHP3-C/VHP...prqchqrcsife*n*rffrw cfpmghqrrccl**kherypfqsl*chpph*chpqrwwsnhpncssctlcc*inclpnsl rtnllsrnycprkrywwyllctqss*

  2. Dicty_cDB: VHP589 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP589 (Link to dictyBase) - - - Contig-U16260-1 VHP589P (Link to Original site) VHP...589F 617 VHP589Z 690 VHP589P 1287 - - Show VHP589 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-D/VHP589Q.Seq.d/ Representative seq. ID VHP...589P (Link to Original site) Representative DNA sequence >VHP589 (VHP589Q) /CSM/VH/VHP5-D/VHP...r*rcqsprqchqrcsife*n*rffrwcfpmghqrrccl**kherypfqsl*chpph *chpqrwwsnhpncssctlcc*inclpnxxrtnxlsrnycprkrywwyllc

  3. Dicty_cDB: VHP542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP542 (Link to dictyBase) - - - Contig-U16260-1 VHP542P (Link to Original site) VHP...542F 646 VHP542Z 729 VHP542P 1355 - - Show VHP542 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-B/VHP542Q.Seq.d/ Representative seq. ID VHP...542P (Link to Original site) Representative DNA sequence >VHP542 (VHP542Q) /CSM/VH/VHP5-B/VHP...cfpmghqrrccl**khe rypfqsl*chpph*chpqrwwsnhpncssctlcc*inclpnxxrtnxlsrnycprkryww yllctqss*rycyw*rtsyrfpiilcqss

  4. Dicty_cDB: VHP402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP402 (Link to dictyBase) - - - Contig-U16260-1 VHP402P (Link to Original site) VHP...402F 616 VHP402Z 747 VHP402P 1343 - - Show VHP402 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-A/VHP402Q.Seq.d/ Representative seq. ID VHP...402P (Link to Original site) Representative DNA sequence >VHP402 (VHP402Q) /CSM/VH/VHP4-A/VHP...aykpklyyvkpslnvsnqsysstksivsy*nsn*tl kklislsvellnpsmsllvtlk--- ---shpkmiqklvltisl

  5. Dicty_cDB: VHP179 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP179 (Link to dictyBase) - - - Contig-U16441-1 VHP179P (Link to Original site) VHP...179F 666 VHP179Z 631 VHP179P 1277 - - Show VHP179 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-D/VHP179Q.Seq.d/ Representative seq. ID VHP...179P (Link to Original site) Representative DNA sequence >VHP179 (VHP179Q) /CSM/VH/VHP1-D/VHP...mylinkeilfmvmqdiikemiilwl*ishlmekpkf qyqmmqvkhfqpqqffhiklyqfhhi*ilrv**lhvpiisf*lvkilv*hgtmhhpmvmf yshqvvqafq

  6. Dicty_cDB: VHP453 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP453 (Link to dictyBase) - - - Contig-U16441-1 VHP453P (Link to Original site) VHP...453F 636 VHP453Z 742 VHP453P 1358 - - Show VHP453 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP4-C/VHP453Q.Seq.d/ Representative seq. ID VHP...453P (Link to Original site) Representative DNA sequence >VHP453 (VHP453Q) /CSM/VH/VHP4-C/VHP...khfqpqqffhiklyqfhhi*ilrv**lhvpiisf*lvkilv*hgtmhhpmvmfyshq vvqafqpthygihqrnlqcfsqf

  7. Nuclear Magnetic Resonance Imaging of Li-ion Battery

    Directory of Open Access Journals (Sweden)

    D. Ohno

    2010-12-01

    Full Text Available Nuclear magnetic resonance (NMR imaging has high sensitivity to proton (1H and lithium (7Li. It is a useful measurement for electrolyte in Li-ion battery. 1H NMR images of lithium ion battery which is composed of LiMn2O4 / LiClO4 + propylene carbonate (PC / Li-metal have been studied. 1H NMR images of electrolyte near cathode material (LiMn2O4 showed anomalous intensity distribution, which was quite inhomogeneous. From NMR images as a function of repetition time (TR, it was concluded that the anomalous intensity distribution was not due to change of relaxation time but an indirect (spatial para-magnetization effect from cathode material. The paramagnetization induced by high magnetic field distorts linearity of magnetic gradient field, leading to apparent intensity variance. This functional image is an easy diagnostic measurement for magnetization of cathode material, which allows the possibility to check uniformity of cathode material and change of magnetization under electrochemical process.

  8. Anthracite as a candidate for lithium ion battery anode

    Science.gov (United States)

    Kim, Young-Jun; Yang, Hojung; Yoon, Seong-Ho; Korai, Yozo; Mochida, Isao; Ku, Cha-Hun

    Four kinds of anthracites from different regions were investigated as anodic materials of Li ion secondary battery by varying their calcination temperatures. Hon-gye anthracite calcined at 1000-1150 °C showed a high reversible capacity at low potential region of 0-0.12 V, which is typical with hard carbon. The highest capacity of 370 mAh/g was obtained with the Hon-gye among anthracites calcined at 1100 °C. The graphitization started with the anthracite above 1600 °C to provide capacity at ca. 0.2 V which reflects the intercalation of graphitic carbon. The anthracite calcined at 1000-1150 °C was indicated to carry the largest d002 and smallest Lc(002). And TEM observation showed micropores among the graphite clusters. The large capacity of the anthracite as hard carbon is ascribed to its many micropores among the smallest graphite units which can accommodate highly reduced lithium ions.

  9. Lithium ion irradiation of standard and oxygenated silicon diodes

    CERN Document Server

    Candelori, A; Bisello, D; Giubilato, P; Kaminski, A; Litovchenko, A P; Lozano, A; Petrie, J R; Rando, R; Ullán, M; Wyss, J

    2004-01-01

    The next generation silicon detectors for future very high luminosity colliders or a possible LHC upgrade scenario will require radiation- hard detectors for fluences up to 10/sup 16/ 1-MeV equivalent neutrons/cm/sup 2/. These high fluences present strong constraints because long irradiation times are required at the currently available proton irradiation facilities. Energetic (58 MeV) lithium ions present a non-ionizing energy loss approximately=27.3 times higher than 27 MeV protons, and could consequently be a new promising radiation source for investigating the radiation hardness of silicon detectors up to very high particle fluences. Starting from this premise, we have investigated the degradation, as measured by the leakage current density increase and depletion voltage variations in the short and long-term characteristics, induced by 58 MeV Li ions in state-of-the-art silicon diodes processed by two different manufacturers on standard and oxygenated silicon substrates. Finally, the correlation between t...

  10. Stress-induced Ageing of Lithium-Ion Batteries.

    Science.gov (United States)

    Held, Marcel; Sennhauser, Urs

    2015-01-01

    Lithium-ion batteries are well established for use in portable consumer products and are increasingly used in high power electro-mobility and photovoltaic storage applications. In hybrid and plug-in electric vehicles degradation and useful lifetime at standard operation conditions are critical parameters in addition to performance and safety. Here stress-induced ageing of commercially available high power battery cells of the type A123 AHR32113M1 Ultra-B, consisting of a LiFePO(4) cathode and a graphite anode have been investigated. A usually accepted capacity loss for electric vehicles of 20% was reached after 8560 stress profiles corresponding to a driving distance of almost 200'000 km. Cycling with a stress profile applying constant power corresponding to the average power and energy of a full stress profile and starting at 60% state of charge showed a much faster capacity loss. Electric impedance measurements show the dependence of the capacity loss and constant phase element at low frequency, indicating Li-ion diffusion blocking in the cathode. Microscopic analysis of anode, separator, and cathode, shows defect formation in bulk material and at interfaces.

  11. Life Prediction Model for Grid-Connected Li-ion Battery Energy Storage System: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Kandler A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Saxon, Aron R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Keyser, Matthew A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Lundstrom, Blake R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Cao, Ziwei [SunPower Corporation; Roc, Albert [SunPower Corp.

    2017-08-25

    Life Prediction Model for Grid-Connected Li-ion Battery Energy Storage System: Preprint Lithium-ion (Li-ion) batteries are being deployed on the electrical grid for a variety of purposes, such as to smooth fluctuations in solar renewable power generation. The lifetime of these batteries will vary depending on their thermal environment and how they are charged and discharged. To optimal utilization of a battery over its lifetime requires characterization of its performance degradation under different storage and cycling conditions. Aging tests were conducted on commercial graphite/nickel-manganese-cobalt (NMC) Li-ion cells. A general lifetime prognostic model framework is applied to model changes in capacity and resistance as the battery degrades. Across 9 aging test conditions from 0oC to 55oC, the model predicts capacity fade with 1.4 percent RMS error and resistance growth with 15 percent RMS error. The model, recast in state variable form with 8 states representing separate fade mechanisms, is used to extrapolate lifetime for example applications of the energy storage system integrated with renewable photovoltaic (PV) power generation.

  12. Contribution of Li-ion batteries to the environmental impact of electric vehicles.

    Science.gov (United States)

    Notter, Dominic A; Gauch, Marcel; Widmer, Rolf; Wäger, Patrick; Stamp, Anna; Zah, Rainer; Althaus, Hans-Jörg

    2010-09-01

    Battery-powered electric cars (BEVs) play a key role in future mobility scenarios. However, little is known about the environmental impacts of the production, use and disposal of the lithium ion (Li-ion) battery. This makes it difficult to compare the environmental impacts of BEVs with those of internal combustion engine cars (ICEVs). Consequently, a detailed lifecycle inventory of a Li-ion battery and a rough LCA of BEV based mobility were compiled. The study shows that the environmental burdens of mobility are dominated by the operation phase regardless of whether a gasoline-fueled ICEV or a European electricity fueled BEV is used. The share of the total environmental impact of E-mobility caused by the battery (measured in Ecoindicator 99 points) is 15%. The impact caused by the extraction of lithium for the components of the Li-ion battery is less than 2.3% (Ecoindicator 99 points). The major contributor to the environmental burden caused by the battery is the supply of copper and aluminum for the production of the anode and the cathode, plus the required cables or the battery management system. This study provides a sound basis for more detailed environmental assessments of battery based E-mobility.

  13. Unique aqueous Li-ion/sulfur chemistry with high energy density and reversibility.

    Science.gov (United States)

    Yang, Chongyin; Suo, Liumin; Borodin, Oleg; Wang, Fei; Sun, Wei; Gao, Tao; Fan, Xiulin; Hou, Singyuk; Ma, Zhaohui; Amine, Khalil; Xu, Kang; Wang, Chunsheng

    2017-06-13

    Leveraging the most recent success in expanding the electrochemical stability window of aqueous electrolytes, in this work we create a unique Li-ion/sulfur chemistry of both high energy density and safety. We show that in the superconcentrated aqueous electrolyte, lithiation of sulfur experiences phase change from a high-order polysulfide to low-order polysulfides through solid-liquid two-phase reaction pathway, where the liquid polysulfide phase in the sulfide electrode is thermodynamically phase-separated from the superconcentrated aqueous electrolyte. The sulfur with solid-liquid two-phase exhibits a reversible capacity of 1,327 mAh/(g of S), along with fast reaction kinetics and negligible polysulfide dissolution. By coupling a sulfur anode with different Li-ion cathode materials, the aqueous Li-ion/sulfur full cell delivers record-high energy densities up to 200 Wh/(kg of total electrode mass) for >1,000 cycles at ∼100% coulombic efficiency. These performances already approach that of commercial lithium-ion batteries (LIBs) using a nonaqueous electrolyte, along with intrinsic safety not possessed by the latter. The excellent performance of this aqueous battery chemistry significantly promotes the practical possibility of aqueous LIBs in large-format applications.

  14. An experimental study of lithium ion battery thermal management using flexible hydrogel films

    Science.gov (United States)

    Zhao, Rui; Zhang, Sijie; Gu, Junjie; Liu, Jie; Carkner, Steve; Lanoue, Eric

    2014-06-01

    Many portable devices such as soldier carrying devices are powered by low-weight but high-capacity lithium ion (Li-ion) batteries. An effective battery thermal management (BTM) system is required to keep the batteries operating within a desirable temperature range with minimal variations, and thus to guarantee their high efficiency, long lifetime and great safety. However, the rigorous constraints imposed by the budgets in weight and volume for this specific application eliminate the possible consideration of many existing classical cooling approaches and make the development of BTM system very challenging in this field. In this paper, a flexible hydrogel-based BTM system is developed to address this challenge. The proposed BTM system is based on cost-effective sodium polyacrylate and can be arbitrarily shaped and conveniently packed to accommodate any Li-ion stacks. This BTM system is tested through a series of high-intensity discharge and abnormal heat release processes, and its performance is compared with three classical BTM systems. The test results demonstrate that the proposed low-cost, space-saving, and contour-adaptable BTM system is a very economic and efficient approach in handling the thermal surge of Li-ion batteries.

  15. Pursuing two-dimensional nanomaterials for flexible lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Bin; Zhang, Ji-Guang; Shen, Guozhen

    2016-02-01

    Stretchable/flexible electronics provide a foundation for various emerging applications that beyond the scope of conventional wafer/circuit board technologies due to their unique features that can satisfy a broad range of applications such as wearable devices. Stretchable electronic and optoelectronics devices require the bendable/wearable rechargeable Li-ion batteries, thus these devices can operate without limitation of external powers. Various two-dimensional (2D) nanomaterials are of great interest in flexible energy storage devices, especially Li-ion batteries. This is because 2D materials exhibit much more exposed surface area supplying abundant Li-insertion channels and shortened paths for fast lithium ion diffusion. Here, we will review the recent developments on the flexible Li-ion batteries based on two dimensional nanomaterials. These researches demonstrated advancements in flexible electronics by incorporating various 2D nanomaterials into bendable batteries to achieve high electrochemical performance, excellent mechanical flexibility as well as electrical stability under stretching/bending conditions.

  16. Evaluation of Model Based State of Charge Estimation Methods for Lithium-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Zhongyue Zou

    2014-08-01

    Full Text Available Four model-based State of Charge (SOC estimation methods for lithium-ion (Li-ion batteries are studied and evaluated in this paper. Different from existing literatures, this work evaluates different aspects of the SOC estimation, such as the estimation error distribution, the estimation rise time, the estimation time consumption, etc. The equivalent model of the battery is introduced and the state function of the model is deduced. The four model-based SOC estimation methods are analyzed first. Simulations and experiments are then established to evaluate the four methods. The urban dynamometer driving schedule (UDDS current profiles are applied to simulate the drive situations of an electrified vehicle, and a genetic algorithm is utilized to identify the model parameters to find the optimal parameters of the model of the Li-ion battery. The simulations with and without disturbance are carried out and the results are analyzed. A battery test workbench is established and a Li-ion battery is applied to test the hardware in a loop experiment. Experimental results are plotted and analyzed according to the four aspects to evaluate the four model-based SOC estimation methods.

  17. Single-ion polymer electrolyte membranes enable lithium-ion batteries with a broad operating temperature range.

    Science.gov (United States)

    Cai, Weiwei; Zhang, Yunfeng; Li, Jing; Sun, Yubao; Cheng, Hansong

    2014-04-01

    Conductive processes involving lithium ions are analyzed in detail from a mechanistic perspective, and demonstrate that single ion polymeric electrolyte (SIPE) membranes can be used in lithium-ion batteries with a wide operating temperature range (25-80 °C) through systematic optimization of electrodes and electrode/electrolyte interfaces, in sharp contrast to other batteries equipped with SIPE membranes that display appreciable operability only at elevated temperatures (>60 °C). The performance is comparable to that of batteries using liquid electrolyte of inorganic salt, and the batteries exhibit excellent cycle life and rate performance. This significant widening of battery operation temperatures coupled with the inherent flexibility and robustness of the SIPE membranes makes it possible to develop thin and flexible Li-ion batteries for a broad range of applications. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Facile Synthesis of V2O5 Hollow Spheres as Advanced Cathodes for High-Performance Lithium-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Xingyuan Zhang

    2017-01-01

    Full Text Available Three-dimensional V2O5 hollow structures have been prepared through a simple synthesis strategy combining solvothermal treatment and a subsequent thermal annealing. The V2O5 materials are composed of microspheres 2–3 μm in diameter and with a distinct hollow interior. The as-synthesized V2O5 hollow microspheres, when evaluated as a cathode material for lithium-ion batteries, can deliver a specific capacity as high as 273 mAh·g−1 at 0.2 C. Benefiting from the hollow structures that afford fast electrolyte transport and volume accommodation, the V2O5 cathode also exhibits a superior rate capability and excellent cycling stability. The good Li-ion storage performance demonstrates the great potential of this unique V2O5 hollow material as a high-performance cathode for lithium-ion batteries.

  19. Conflicting Roles Of Nickel In Controlling Cathode Performance In Lithium-ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Gu, Meng; Belharouak, Ilias; Genc, Arda; Wang, Zhiguo; Wang, Dapeng; Amine, Khalil; Gao, Fei; Zhou, Guangwen; Thevuthasan, Suntharampillai; Baer, Donald R.; Zhang, Jiguang; Browning, Nigel D.; Liu, Jun; Wang, Chong M.

    2012-09-17

    A variety of approaches are being made to enhance the performance of lithium ion batteries. Incorporating multi-valence transition metal ions into metal oxide cathodes has been identified as an essential approach to achieve the necessary high voltage and high capacity. However, the fundamental mechanism that limits their power rate and cycling stability remains unclear. The power rate strongly depends on the lithium ion drift speed in the cathode. Crystallographically, these transition metal-based cathodes frequently have a layered structure. In the classic wisdom, it is accepted that lithium ion travels swiftly within the layers moving out/in of the cathode during the charge/discharge. Here, we report the unexpected discovery of a thermodynamically driven, yet kinetically controlled, surface modification in the widely explored lithium nickel manganese oxide cathode material, which may inhibit the battery charge/discharge rate. We found that during cathode synthesis and processing before electrochemical cycling in the cell nickel can preferentially move along the fast diffusion channels and selectively segregate at the surface facets terminated with a mix of anions and cations. This segregation essentially blocks the otherwise fast out/in pathways for lithium ions during the charge/discharge. Therefore, it appears that the transition metal dopant may help to provide high capacity and/or high voltage, but can be located in a “wrong” location that blocks or slows lithium diffusion, limiting battery performance. In this circumstance, limitations in the properties of Li-ion batteries using these cathode materials can be determined more by the materials synthesis issues than by the operation within the battery itself.

  20. Dicty_cDB: VHP530 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP530 (Link to dictyBase) - - - Contig-U11514-1 VHP530P (Link to Original site) VHP530F 643 VHP530Z...VHP530Z 783 VHP530P 1406 - - Show VHP530 Library VH (Link to library) Clone ID VHP530 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP530Q.Seq.d/ Representative seq. ID VHP530P (Link to Original site) Representative...Representative DNA sequence >VHP530 (VHP530Q) /CSM/VH/VHP5-B/VHP530Q.Seq.d/ GATTAGAAGAAGTTGGACCAAATGCAA...significant alignments: (bits) Value VHP530 (VHP530Q) /CSM/VH/VHP5-B/VHP530Q.Seq.d/ 2605 0.0 VHJ167 (VHJ167Q)

  1. Dicty_cDB: VHP539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP539 (Link to dictyBase) - - - Contig-U16438-1 VHP539P (Link to Original site) VHP539F 651 VHP539Z...VHP539Z 822 VHP539P 1453 - - Show VHP539 Library VH (Link to library) Clone ID VHP539 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP539Q.Seq.d/ Representative seq. ID VHP539P (Link to Original site) Representative...Representative DNA sequence >VHP539 (VHP539Q) /CSM/VH/VHP5-B/VHP539Q.Seq.d/ ATATACATAATTAAAATTTCATACAAT...significant alignments: (bits) Value VHP539 (VHP539Q) /CSM/VH/VHP5-B/VHP539Q.Seq.d/ 1980 0.0 VHM583 (VHM583Q)

  2. Dicty_cDB: VHP532 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP532 (Link to dictyBase) - - - Contig-U15611-1 VHP532P (Link to Original site) VHP532F 399 VHP532Z...VHP532Z 723 VHP532P 1102 - - Show VHP532 Library VH (Link to library) Clone ID VHP532 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP532Q.Seq.d/ Representative seq. ID VHP532P (Link to Original site) Representative...Representative DNA sequence >VHP532 (VHP532Q) /CSM/VH/VHP5-B/VHP532Q.Seq.d/ ATTTTATATATTTTAATTTGCATTTTT...significant alignments: (bits) Value VHP532 (VHP532Q) /CSM/VH/VHP5-B/VHP532Q.Seq.d/ 1844 0.0 VHI789 (VHI789Q)

  3. Dicty_cDB: VHP538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP538 (Link to dictyBase) - - - Contig-U15033-1 VHP538P (Link to Original site) VHP538F 670 VHP538Z...VHP538Z 795 VHP538P 1445 - - Show VHP538 Library VH (Link to library) Clone ID VHP538 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP538Q.Seq.d/ Representative seq. ID VHP538P (Link to Original site) Representative...Representative DNA sequence >VHP538 (VHP538Q) /CSM/VH/VHP5-B/VHP538Q.Seq.d/ ATAGTTACAAATAAATAATGAAATTGT...significant alignments: (bits) Value VHP538 (VHP538Q) /CSM/VH/VHP5-B/VHP538Q.Seq.d/ 2819 0.0 VHC878 (VHC878Q)

  4. Dicty_cDB: VHP536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP536 (Link to dictyBase) - - - Contig-U15690-1 VHP536P (Link to Original site) VHP536F 589 VHP536Z...VHP536Z 760 VHP536P 1329 - - Show VHP536 Library VH (Link to library) Clone ID VHP536 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP536Q.Seq.d/ Representative seq. ID VHP536P (Link to Original site) Representative...Representative DNA sequence >VHP536 (VHP536Q) /CSM/VH/VHP5-B/VHP536Q.Seq.d/ AATTAATTTTATTTTAATATAAAACTC...significant alignments: (bits) Value VHP536 (VHP536Q) /CSM/VH/VHP5-B/VHP536Q.Seq.d/ 2369 0.0 CHM205 (CHM205Q)

  5. Dicty_cDB: VHP537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP537 (Link to dictyBase) - - - Contig-U16708-1 VHP537P (Link to Original site) VHP537F 147 VHP537Z...VHP537Z 185 VHP537P 312 - - Show VHP537 Library VH (Link to library) Clone ID VHP537 (Link to dictyBase)...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP537Q.Seq.d/ Representative seq. ID VHP537P (Link to Original site) Representative...Representative DNA sequence >VHP537 (VHP537Q) /CSM/VH/VHP5-B/VHP537Q.Seq.d/ AGATTCGGTTTAAAGAAATTTTATTGG...significant alignments: (bits) Value VHP537 (VHP537Q) /CSM/VH/VHP5-B/VHP537Q.Seq.d/ 216 2e-55 VSE439 (VSE439Q)

  6. Tracking Lithium Ions via Widefield Fluorescence Microscopy for Battery Diagnostics.

    Science.gov (United States)

    Padilla, Nicolas A; Rea, Morgan T; Foy, Michael; Upadhyay, Sunil P; Desrochers, Kyle A; Derus, Tyler; Knapper, Kassandra A; Hunter, Nathanael H; Wood, Sharla; Hinton, Daniel A; Cavell, Andrew C; Masias, Alvaro G; Goldsmith, Randall H

    2017-07-28

    Direct tracking of lithium ions with time and spatial resolution can provide an important diagnostic tool for understanding mechanisms in lithium ion batteries. A fluorescent indicator of lithium ions, 2-(2-hydroxyphenyl)naphthoxazole, was synthesized and used for real-time tracking of lithium ions via widefield fluorescence microscopy. The fluorophore can be excited with visible light and was shown to enable quantitative determination of the lithium ion diffusion constant in a microfluidic model system for a plasticized polymer electrolyte lithium battery. The use of widefield fluorescence microscopy for in situ tracking of lithium ions in batteries is discussed.

  7. Performance Degradation of Thermal Parameters during Cycle Ageing of High Energy Density Ni-Mn-Co based Lithium-Ion Battery Cells

    DEFF Research Database (Denmark)

    Stanciu, Tiberiu; Stroe, Daniel Loan; Swierczynski, Maciej Jozef

    2016-01-01

    The accelerated demand for electrifying the transportation sector, coupled with the continuous improvement of rechargeable batteries’ characteristics, have made modern high-energy Lithium-ion (Li-ion) batteries the standard choice for hybrid and electric vehicles (EVs). Consequently, Li......-ion batteries’ electrochemical and thermal characteristics are very important topics, putting them at the forefront of the research. Along with the electrical performance of Li-ion battery cells, their thermal behavior needs to be accurately predicted during operation and over the lifespan of the application...... as well, since the thermal management of the battery is crucial for the safety of the EV driver. Moreover, the thermal management system can significantly lower the degradation rate of the battery pack and thus reduce costs. In this paper, the thermal characterization of a commercially available Nickel...

  8. Li-ion Battery Aging Datasets

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set has been collected from a custom built battery prognostics testbed at the NASA Ames Prognostics Center of Excellence (PCoE). Li-ion batteries were run...

  9. Internal cooling of a lithium-ion battery using electrolyte as coolant through microchannels embedded inside the electrodes

    Science.gov (United States)

    Mohammadian, Shahabeddin K.; He, Ya-Ling; Zhang, Yuwen

    2015-10-01

    Two and three dimensional transient thermal analysis of a prismatic Li-ion cell has been carried out to compare internal and external cooling methods for thermal management of Lithium Ion (Li-ion) battery packs. Water and liquid electrolyte have been utilized as coolants for external and internal cooling, respectively. The effects of the methods on decreasing the temperature inside the battery and also temperature uniformity were investigated. The results showed that at the same pumping power, using internal cooling not only decreases the bulk temperature inside the battery more than external cooling, but also decreases the standard deviation of the temperature field inside the battery significantly. Finally, using internal cooling decreases the intersection angle between the velocity vector and the temperature gradient which according to field synergy principle (FSP) causes to increase the convection heat transfer.

  10. Direct Visualization of Solid Electrolyte Interphase Formation in Lithium-Ion Batteries with In Situ Electrochemical Transmission Electron Microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Unocic, Raymond R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sun, Xiao-Guang [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sacci, Robert L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Adamczyk, Leslie A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Alsem, Daan Hein [Hummingbird Scientific, Lacey, WA (United States); Dai, Sheng [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dudney, Nancy J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); More, Karren Leslie [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    Complex, electrochemically driven transport processes form the basis of electrochemical energy storage devices. The direct imaging of electrochemical processes at high spatial resolution and within their native liquid electrolyte would significantly enhance our understanding of device functionality, but has remained elusive. In this work we use a recently developed liquid cell for in situ electrochemical transmission electron microscopy to obtain insight into the electrolyte decomposition mechanisms and kinetics in lithium-ion (Li-ion) batteries by characterizing the dynamics of solid electrolyte interphase (SEI) formation and evolution. Here we are able to visualize the detailed structure of the SEI that forms locally at the electrode/electrolyte interface during lithium intercalation into natural graphite from an organic Li-ion battery electrolyte. We quantify the SEI growth kinetics and observe the dynamic self-healing nature of the SEI with changes in cell potential.

  11. Novel Lithium Ion High Energy Battery Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Under this SBIR project a new chemistry for Li-ion cells will be developed that will enable a major advance in secondary battery gravimetric and volumetric energy...

  12. Dicty_cDB: VHP535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP535 (Link to dictyBase) - - - - VHP535P (Link to Original site) VHP535F 183 VHP535Z 688 VHP535P 851...851 - - Show VHP535 Library VH (Link to library) Clone ID VHP535 (Link to dictyBase) Atlas ID - NBRP...tsukuba.ac.jp/CSM/VH/VHP5-B/VHP535Q.Seq.d/ Representative seq. ID VHP535P (Link to Original site) Representative...Representative DNA sequence >VHP535 (VHP535Q) /CSM/VH/VHP5-B/VHP535Q.Seq.d/ TATAAAANGTTNTTAAATAAATAAATA...significant alignments: (bits) Value VHP535 (VHP535Q) /CSM/VH/VHP5-B/VHP535Q.Seq.d/ 1318 0.0 CFK127 (CFK127Q)

  13. Lithium-ion batteries having conformal solid electrolyte layers

    Science.gov (United States)

    Kim, Gi-Heon; Jung, Yoon Seok

    2014-05-27

    Hybrid solid-liquid electrolyte lithium-ion battery devices are disclosed. Certain devices comprise anodes and cathodes conformally coated with an electron insulating and lithium ion conductive solid electrolyte layer.

  14. Lithium ion batteries based on nanoporous silicon

    Science.gov (United States)

    Tolbert, Sarah H.; Nemanick, Eric J.; Kang, Chris Byung-Hwa

    2015-09-22

    A lithium ion battery that incorporates an anode formed from a Group IV semiconductor material such as porous silicon is disclosed. The battery includes a cathode, and an anode comprising porous silicon. In some embodiments, the anode is present in the form of a nanowire, a film, or a powder, the porous silicon having a pore diameters within the range between 2 nm and 100 nm and an average wall thickness of within the range between 1 nm and 100 nm. The lithium ion battery further includes, in some embodiments, a non-aqueous lithium containing electrolyte. Lithium ion batteries incorporating a porous silicon anode demonstrate have high, stable lithium alloying capacity over many cycles.

  15. NREL/NASA Internal Short-Circuit Instigator in Lithium Ion Cells; NREL (National Renewable Energy Laboratory)

    Energy Technology Data Exchange (ETDEWEB)

    Long, Dirk; Ireland, John; Pesaran, Ahmad; Darcy, Eric; Shoesmith, Mark; McCarthy, Ben

    2013-11-14

    NREL has developed a device to test one of the most challenging failure mechanisms of lithium-ion (Li-ion) batteries -- a battery internal short circuit. Many members of the technical community believe that this type of failure is caused by a latent flaw that results in a short circuit between electrodes during use. As electric car manufacturers turn to Li-ion batteries for energy storage, solving the short circuit problem becomes more important. To date, no reliable and practical method exists to create on-demand internal shorts in Li-ion cells that produce a response that is relevant to the ones produced by field failures. NREL and NASA have worked to establish an improved ISC cell-level test method that simulates an emergent internal short circuit, is capable of triggering the four types of cell internal shorts, and produces consistent and reproducible results. Internal short circuit device design is small, low-profile and implantable into Li-ion cells, preferably during assembly. The key component is an electrolyte-compatible phase change material (PCM). The ISC is triggered by heating the cell above PCM melting temperature (presently 40 degrees C – 60 degrees C). In laboratory testing, the activated device can handle currents in excess of 300 A to simulate hard shorts (< 2 mohms). Phase change from non-conducting to conducting has been 100% successful during trigger tests.

  16. Prediction of thermal behaviors of an air-cooled lithium-ion battery system for hybrid electric vehicles

    Science.gov (United States)

    Choi, Yong Seok; Kang, Dal Mo

    2014-12-01

    Thermal management has been one of the major issues in developing a lithium-ion (Li-ion) hybrid electric vehicle (HEV) battery system since the Li-ion battery is vulnerable to excessive heat load under abnormal or severe operational conditions. In this work, in order to design a suitable thermal management system, a simple modeling methodology describing thermal behavior of an air-cooled Li-ion battery system was proposed from vehicle components designer's point of view. A proposed mathematical model was constructed based on the battery's electrical and mechanical properties. Also, validation test results for the Li-ion battery system were presented. A pulse current duty and an adjusted US06 current cycle for a two-mode HEV system were used to validate the accuracy of the model prediction. Results showed that the present model can give good estimations for simulating convective heat transfer cooling during battery operation. The developed thermal model is useful in structuring the flow system and determining the appropriate cooling capacity for a specified design prerequisite of the battery system.

  17. A review of thermal performance improving methods of lithium ion battery: Electrode modification and thermal management system

    Science.gov (United States)

    Zhao, Rui; Zhang, Sijie; Liu, Jie; Gu, Junjie

    2015-12-01

    Lithium ion (Li-ion) battery has emerged as an important power source for portable devices and electric vehicles due to its superiority over other energy storage technologies. A mild temperature variation as well as a proper operating temperature range are essential for a Li-ion battery to perform soundly and have a long service life. In this review paper, the heat generation and dissipation of Li-ion battery are firstly analyzed based on the energy conservation equations, followed by an examination of the hazardous effects of an above normal operating temperature. Then, advanced techniques in respect of electrode modification and systematic battery thermal management are inspected in detail as solutions in terms of reducing internal heat production and accelerating external heat dissipation, respectively. Specifically, variable parameters like electrode thickness and particle size of active material, along with optimization methods such as coating, doping, and adding conductive media are discussed in the electrode modification section, while the current development in air cooling, liquid cooling, heat pipe cooling, and phase change material cooling systems are reviewed in the thermal management part as different ways to improve the thermal performance of Li-ion batteries.

  18. Application of Carbon Nanomaterials in Lithium-Ion Battery Electrodes

    Science.gov (United States)

    Jaber-Ansari, Laila

    situ and Ar-atmosphere Raman spectroscopy, a rapid increase in graphene defect level is detected for small increments in the number of lithiation/delithiation cycles until the I(D)/I(G) ratio reaches ˜1.5-2.0 and the 2D peak intensity drops by ˜50%, after which the Raman spectra show minimal changes upon further cycling. Using DFT, the interplay between graphene topological defects and chemical functionalization is explored, thus providing insight into the experimental results. In particular, the DFT results show that defects can act as active sites for species that are present in the electrochemical environment such as Li, O, and F. Furthermore, chemical functionalization with these species lowers subsequent defect formation energies, thus accelerating graphene degradation upon cycling. This positive feedback loop continues until the defect concentration reaches a level where lithium diffusion through the graphene can occur in a relatively unimpeded manner, with minimal further degradation upon extended cycling. Overall, this study provides mechanistic insight into graphene defect formation during lithiation, thus informing ongoing efforts to employ graphene in lithium ion battery technology. Having understood the electrochemical properties of graphene, we have used this to improve the performance of Li-ion cathodes. In particular, Spinel-structured LiMn2O4 (LMO) is a desirable cathode material for Li-ion batteries due to its low cost, thermal stability (safety) and high power capability. However, LMO suffers from a limited cycle life that is triggered by manganese dissolution into the electrolyte during electrochemical cycling. Here, we show that a single sheet of graphene can act effectively as a diffusion barrier for Mn2+ ions, thereby protecting the cathode surface and significantly reducing the dissolution process. Relative to lithium cells containing a sputtered and uncoated thin film LMO 'control' cathode, cells with a graphene-coated LMO cathode provide

  19. All silicon lithium-ion batteries

    OpenAIRE

    Xu, Chao

    2015-01-01

    Lithium-ion batteries have been widely used as power supplies for portable electronic devices due to their higher gravimetric and volumetric energy densities compared to other electrochemical energy storage technologies, such as lead-acid, Ni-Cd and Ni-MH batteries. Developing a novel battery chemistry, ‘‘all silicon lithium-ion batteries’’, using lithium iron silicate as the cathode and silicon as the anode, is the primary aim of this Ph.D project. This licentiate thesis is focused on improv...

  20. Facile synthesis of nanostructured transition metal oxides as electrodes for Li-ion batteries

    Science.gov (United States)

    Opra, Denis P.; Gnedenkov, Sergey V.; Sokolov, Alexander A.; Minaev, Alexander N.; Kuryavyi, Valery G.; Sinebryukhov, Sergey L.

    2017-09-01

    At all times, energy storage is one of the greatest scientific challenge. Recently, Li-ion batteries are under special attention due to high working voltage, long cycle life, low self-discharge, reliability, no-memory effect. However, commercial LIBs usage in medium- and large-scale energy storage are limited by the capacity of lithiated metal oxide cathode and unsafety of graphite anode at high-rate charge. In this way, new electrode materials with higher electrochemical performance should be designed to satisfy a requirement in both energy and power. As it known, nanostructured transition metal oxides are promising electrode materials because of their elevated specific capacity and high potential vs. Li/Li+. In this work, the perspective of an original facile technique of pulsed high-voltage plasma discharge in synthesis of nanostructured transition metal oxides as electrodes for lithium-ion batteries has been demonstrated.

  1. A Recovery Process of Active Cathode Paste from Spent Li-Ion Batteries

    Science.gov (United States)

    Toma, C. M.; Ghica, G. V.; Buzatu, M.; Petrescu, M. I.; Vasile, E.; Iacob, G.

    2017-06-01

    In this work, the depleted active paste from spent lithium-ion batteries was separated from cathode by means of ultrasonic vibration. First the unit cells were discharged in brine at room temperature, for safety reasons. Then anode, separator, electrolyte and cathode were separated. Spent Li-Ion batteries were introduced into a washing container to separate electrode materials from their support substrate: active paste (lithium cobalt oxide - LiCoO2) from cathode (Al foil) and graphite from anode (Cu foil). The Al foil and Cu foil were also recovered. A cleaning efficiency of 91% was achieved using a solution of 1.5 M acetic acid after a 6 minute time of exposure into an ultrasonic washing container with a frequency and electric power of 50 kHz and 50 W, respectively. The XRD patterns and the morphology of LiCoO2 powder were presented.

  2. Evaluation of Lithium-ion Battery Second Life Performance and Degradation

    DEFF Research Database (Denmark)

    Martinez-Laserna, Egoitz; Sarasketa-Zabala, Elixabet; Stroe, Daniel Loan

    2016-01-01

    Reusing electric vehicle batteries once they have been retired from the automotive application is stated as one of the possible solutions to reduce electric vehicle costs. Many publications in the literature have analyzed the economic viability of such a solution, and some car manufacturers have...... recently started running several projects to demonstrate the technical viability of the so-called battery second life. Nevertheless, the performance and degradation of second life batteries remain an unknown topic and one of the biggest gaps in the literature. The present work aims at evaluating...... the effects of lithium-ion (Li-ion) battery State of Health (SOH) and ageing history over the second life performance on two different applications: a residential demand management application and a power smoothing renewable integration application. The performance and degradation of second life batteries...

  3. NREL/NASA Internal Short-Circuit Instigator in Lithium Ion Cells

    Energy Technology Data Exchange (ETDEWEB)

    Keyser, Matthew; Long, Dirk; Pesaran, Ahmad; Darcy, Eric; Shoesmith, Mark; McCarthy, Ben

    2015-10-11

    Lithium-ion cells provide the highest specific energy (>280 Wh/kg) and energy density (>600 Wh/L) rechargeable battery building block to date with the longest life. Electrode/electrolyte thermal instability and flammability of the electrolyte of Li-ion cells make them prone to catastrophic thermal runaway under some rare internal short circuit conditions. Despite extensive QC/QA, standardized industry safety testing, and over 18 years of manufacturing experience, major recalls have taken place and incidents still occur. Many safety incidents that take place in the field originate due to an internal short that was not detectable or predictable at the point of manufacture. The Internal Short-Circuit Instigator can be used to study types of separators, non-flammable electrolytes, electrolyte additives, fusible tabs, propagation studies, and gas generation within a cell.

  4. A review of thermal management and safety for lithium ion batteries

    DEFF Research Database (Denmark)

    Saeed Madani, Seyed; Swierczynski, Maciej Jozef; Kær, Søren Knudsen

    2017-01-01

    Decreasing of fossil fuel sources and ecological worries has spurred global attention in the expansion of developing energy storing systems for electric vehicles (EVs). As a consequence of escalating appeal on new dependable power supplier for hybrid electric vehicles, lithium-ion (Li......-ion) batteries have obtained much considerations in the previous decade. Their highest production rate among other types of batteries is because of their superior characteristics. Greater energy efficiency, lesser self-discharge rate, more lifespan and the nonexistence of the memory effect are the main reasons...... that make them interesting for researchers and producers. Thermal problem related to electric vehicle (EV) battery packs has been a matter of contention and can considerably influence battery functioning and life cycle. Temperature variations from module to module in a battery pack could result in reduced...

  5. Hierarchical mesoporous/microporous carbon with graphitized frameworks for high-performance lithium-ion batteries

    Directory of Open Access Journals (Sweden)

    Yingying Lv

    2014-11-01

    Full Text Available A hierarchical meso-/micro-porous graphitized carbon with uniform mesopores and ordered micropores, graphitized frameworks, and extra-high surface area of ∼2200 m2/g, was successfully synthesized through a simple one-step chemical vapor deposition process. The commercial mesoporous zeolite Y was utilized as a meso-/ micro-porous template, and the small-molecule methane was employed as a carbon precursor. The as-prepared hierarchical meso-/micro-porous carbons have homogeneously distributed mesopores as a host for electrolyte, which facilitate Li+ ions transport to the large-area micropores, resulting a high reversible lithium ion storage of 1000 mA h/g and a high columbic efficiency of 65% at the first cycle.

  6. Bismuth oxyfluoride @ CMK-3 nanocomposite as cathode for lithium ion batteries

    Science.gov (United States)

    Ni, Dan; Sun, Wang; Xie, Liqiang; Fan, Qinghua; Wang, Zhenhua; Sun, Kening

    2018-01-01

    Bismuth oxyfluoride impregnated CMK-3 nanocomposite is synthesized by a facile nanocasting approach. Mesoporous carbon CMK-3 can suppress the aggregation and growth of bismuth oxyfluoride particles and offer rapid electron and Li ion passageways. Bismuth oxyfluoride nanoparticles are embedded in the mesoporous channels with particle size less than 20 nm. The bismuth oxyfluoride@CMK-3 nanocomposite maintains 148 mA h g-1 after 40 cycles with the capacity from both the bismuth oxyfluoride and the functional groups on the mesoporous carbon. The hybrid with confined bismuth oxyfluoride nanoparticles, conductive carbon network, and oxygen functional groups on the carbon matrix exhibits higher capacity and cycling stability than bulk bismuth oxyfluoride particles when used as lithium ion batteries cathode.

  7. Silicon Based Anodes for Li-Ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jiguang; Wang, Wei; Xiao, Jie; Xu, Wu; Graff, Gordon L.; Yang, Zhenguo; Choi, Daiwon; Li, Xiaolin; Wang, Deyu; Liu, Jun

    2012-06-15

    Silicon is environmentally benign and ubiquitous. Because of its high specific capacity, it is considered one of the most promising candidates to replace the conventional graphite negative electrode used in today's Li ion batteries. Silicon has a theoretical specific capacity of nearly 4200 mAh/g (Li21Si5), which is 10 times larger than the specific capacity of graphite (LiC6, 372 mAh/g). However, the high capacity of silicon is associated with huge volume changes (more than 300 percent) when alloyed with lithium, which can cause severe cracking and pulverization of the electrode and lead to significant capacity loss. Significant scientific research has been conducted to circumvent the deterioration of silicon based anode materials during cycling. Various strategies, such as reduction of particle size, generation of active/inactive composites, fabrication of silicon based thin films, use of alternative binders, and the synthesis of 1-D silicon nanostructures have been implemented by a number of research groups. Fundamental mechanistic research has also been performed to better understand the electrochemical lithiation and delithiation process during cycling in terms of crystal structure, phase transitions, morphological changes, and reaction kinetics. Although efforts to date have not attained a commercially viable Si anode, further development is expected to produce anodes with three to five times the capacity of graphite. In this chapter, an overview of research on silicon based anodes used for lithium-ion battery applications will be presented. The overview covers electrochemical alloying of the silicon with lithium, mechanisms responsible for capacity fade, and methodologies adapted to overcome capacity degradation observed during cycling. The recent development of silicon nanowires and nanoparticles with significantly improved electrochemical performance will also be discussed relative to the mechanistic understanding. Finally, future directions on the

  8. Lithium-ion battery models: a comparative study and a model-based powerline communication

    Directory of Open Access Journals (Sweden)

    F. Saidani

    2017-09-01

    Full Text Available In this work, various Lithium-ion (Li-ion battery models are evaluated according to their accuracy, complexity and physical interpretability. An initial classification into physical, empirical and abstract models is introduced. Also known as white, black and grey boxes, respectively, the nature and characteristics of these model types are compared. Since the Li-ion battery cell is a thermo-electro-chemical system, the models are either in the thermal or in the electrochemical state-space. Physical models attempt to capture key features of the physical process inside the cell. Empirical models describe the system with empirical parameters offering poor analytical, whereas abstract models provide an alternative representation. In addition, a model selection guideline is proposed based on applications and design requirements. A complex model with a detailed analytical insight is of use for battery designers but impractical for real-time applications and in situ diagnosis. In automotive applications, an abstract model reproducing the battery behavior in an equivalent but more practical form, mainly as an equivalent circuit diagram, is recommended for the purpose of battery management. As a general rule, a trade-off should be reached between the high fidelity and the computational feasibility. Especially if the model is embedded in a real-time monitoring unit such as a microprocessor or a FPGA, the calculation time and memory requirements rise dramatically with a higher number of parameters. Moreover, examples of equivalent circuit models of Lithium-ion batteries are covered. Equivalent circuit topologies are introduced and compared according to the previously introduced criteria. An experimental sequence to model a 20 Ah cell is presented and the results are used for the purposes of powerline communication.

  9. Lithium-ion battery models: a comparative study and a model-based powerline communication

    Science.gov (United States)

    Saidani, Fida; Hutter, Franz X.; Scurtu, Rares-George; Braunwarth, Wolfgang; Burghartz, Joachim N.

    2017-09-01

    In this work, various Lithium-ion (Li-ion) battery models are evaluated according to their accuracy, complexity and physical interpretability. An initial classification into physical, empirical and abstract models is introduced. Also known as white, black and grey boxes, respectively, the nature and characteristics of these model types are compared. Since the Li-ion battery cell is a thermo-electro-chemical system, the models are either in the thermal or in the electrochemical state-space. Physical models attempt to capture key features of the physical process inside the cell. Empirical models describe the system with empirical parameters offering poor analytical, whereas abstract models provide an alternative representation. In addition, a model selection guideline is proposed based on applications and design requirements. A complex model with a detailed analytical insight is of use for battery designers but impractical for real-time applications and in situ diagnosis. In automotive applications, an abstract model reproducing the battery behavior in an equivalent but more practical form, mainly as an equivalent circuit diagram, is recommended for the purpose of battery management. As a general rule, a trade-off should be reached between the high fidelity and the computational feasibility. Especially if the model is embedded in a real-time monitoring unit such as a microprocessor or a FPGA, the calculation time and memory requirements rise dramatically with a higher number of parameters. Moreover, examples of equivalent circuit models of Lithium-ion batteries are covered. Equivalent circuit topologies are introduced and compared according to the previously introduced criteria. An experimental sequence to model a 20 Ah cell is presented and the results are used for the purposes of powerline communication.

  10. Advanced Electrode Materials for High Energy Next Generation Li ion Batteries

    Science.gov (United States)

    Hayner, Cary Michael

    Lithium ion batteries are becoming an increasingly ubiquitous part of modern society. Since their commercial introduction by Sony in 1991, lithium-ion batteries have grown to be the most popular form of electrical energy storage for portable applications. Today, lithium-ion batteries power everything from cellphones and electric vehicles to e-cigarettes, satellites, and electric aircraft. Despite the commercialization of lithium-ion batteries over twenty years ago, it remains the most active field of energy storage research for its potential improvement over current technology. In order to capitalize on these opportunities, new materials with higher energy density and storage capacities must be developed. Unfortunately, most next-generation materials suffer from rapid capacity degradation or severe loss of capacity when rapidly discharged. In this dissertation, the development of novel anode and cathode materials for advanced high-energy and high-power lithium-ion batteries is reported. In particular, the application of graphene-based materials to stabilize active material is emphasized. Graphene, a unique two-dimensional material composed of atomically thin carbon sheets, has shown potential to address unsatisfactory rate capability, limited cycling performance and abrupt failure of these next-generation materials. This dissertation covers four major subjects: development of silicon-graphene composites, impact of carbon vacancies on graphene high-rate performance, iron fluoride-graphene composites, and ternary iron-manganese fluoride synthesis. Silicon is considered the most likely material to replace graphite as the anode active material for lithium-ion batteries due to its ability to alloy with large amounts of lithium, leading to significantly higher specific capacities than the graphite standard. However, Si also expands in size over 300% upon lithiation, leading to particle fracture and isolation from conductive support, resulting in cell failure within a few

  11. Flexible Aqueous Li-Ion Battery with High Energy and Power Densities.

    Science.gov (United States)

    Yang, Chongyin; Ji, Xiao; Fan, Xiulin; Gao, Tao; Suo, Liumin; Wang, Fei; Sun, Wei; Chen, Ji; Chen, Long; Han, Fudong; Miao, Ling; Xu, Kang; Gerasopoulos, Konstantinos; Wang, Chunsheng

    2017-11-01

    A flexible and wearable aqueous symmetrical lithium-ion battery is developed using a single LiVPO4 F material as both cathode and anode in a "water-in-salt" gel polymer electrolyte. The symmetric lithium-ion chemistry exhibits high energy and power density and long cycle life, due to the formation of a robust solid electrolyte interphase consisting of Li2 CO3 -LiF, which enables fast Li-ion transport. Energy densities of 141 Wh kg-1 , power densities of 20 600 W kg-1 , and output voltage of 2.4 V can be delivered during >4000 cycles, which is far superior to reported aqueous energy storage devices at the same power level. Moreover, the full cell shows unprecedented tolerance to mechanical stress such as bending and cutting, where it not only does not catastrophically fail, as most nonaqueous cells would, but also maintains cell performance and continues to operate in ambient environment, a unique feature apparently derived from the high stability of the "water-in-salt" gel polymer electrolyte. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. A Sulfur Heterocyclic Quinone Cathode and a Multifunctional Binder for a High-Performance Rechargeable Lithium-Ion Battery.

    Science.gov (United States)

    Ma, Ting; Zhao, Qing; Wang, Jianbin; Pan, Zeng; Chen, Jun

    2016-05-23

    We report a rational design of a sulfur heterocyclic quinone (dibenzo[b,i]thianthrene-5,7,12,14-tetraone=DTT) used as a cathode (uptake of four lithium ions to form Li4 DTT) and a conductive polymer [poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate)= PSS) used as a binder for a high-performance rechargeable lithium-ion battery. Because of the reduced energy level of the lowest unoccupied molecular orbital (LUMO) caused by the introduced S atoms, the initial Li-ion intercalation potential of DTT is 2.89 V, which is 0.3 V higher than that of its carbon analog. Meanwhile, there is a noncovalent interaction between DTT and PSS, which remarkably suppressed the dissolution and enhanced the conductivity of DTT, thus leading to the great improvement of the electrochemical performance. The DTT cathode with the PSS binder displays a long-term cycling stability (292 mAh g(-1) for the first cycle, 266 mAh g(-1) after 200 cycles at 0.1 C) and a high rate capability (220 mAh g(-1) at 1 C). This design strategy based on a noncovalent interaction is very effective for the application of small organic molecules as the cathode of rechargeable lithium-ion batteries. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Novel Carbon-Encapsulated Porous SnO2 Anode for Lithium-Ion Batteries with Much Improved Cyclic Stability.

    Science.gov (United States)

    Huang, Bin; Li, Xinhai; Pei, Yi; Li, Shuang; Cao, Xi; Massé, Robert C; Cao, Guozhong

    2016-04-13

    Porous SnO2 submicrocubes (SMCs) are synthesized by annealing and HNO3 etching of CoSn(OH)6 SMCs. Bare SnO2 SMCs, as well as bare commercial SnO2 nanoparticles (NPs), show very high initial discharge capacity when used as anode material for lithium-ion batteries. However, during the following cycles most of the Li ions previously inserted cannot be extracted, resulting in considerable irreversibility. Porous SnO2 cubes have been proven to possess better electrochemical performance than the dense nanoparticles. After being encapsulated by carbon shell, the obtained yolk-shell SnO2 SMCs@C exhibits significantly enhanced reversibility for lithium-ions storage. The reversibility of the conversion between SnO2 and Sn, which is largely responsible for the enhanced capacity, has been discussed. The porous SnO2 SMCs@C shows much increased capacity and cycling stability, demonstrating that the porous SnO2 core is essential for better lithium-ion storage performance. The strategy introduced in this paper can be used as a versatile way to fabrication of various metal-oxide-based composites. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Life Prediction Model for Grid-Connected Li-ion Battery Energy Storage System

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Kandler A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Saxon, Aron R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Keyser, Matthew A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Lundstrom, Blake R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Cao, Ziwei [SunPower Corporation; Roc, Albert [SunPower Corporation

    2017-09-06

    Lithium-ion (Li-ion) batteries are being deployed on the electrical grid for a variety of purposes, such as to smooth fluctuations in solar renewable power generation. The lifetime of these batteries will vary depending on their thermal environment and how they are charged and discharged. To optimal utilization of a battery over its lifetime requires characterization of its performance degradation under different storage and cycling conditions. Aging tests were conducted on commercial graphite/nickel-manganese-cobalt (NMC) Li-ion cells. A general lifetime prognostic model framework is applied to model changes in capacity and resistance as the battery degrades. Across 9 aging test conditions from 0oC to 55oC, the model predicts capacity fade with 1.4% RMS error and resistance growth with 15% RMS error. The model, recast in state variable form with 8 states representing separate fade mechanisms, is used to extrapolate lifetime for example applications of the energy storage system integrated with renewable photovoltaic (PV) power generation.

  15. Li-Ion Electrolytes with Improved Safety and Tolerance to High-Voltage Systems

    Science.gov (United States)

    Smart, Marshall C.; Bugga, Ratnakumar V.; Prakash, Surya; Krause, Frederick C.

    2013-01-01

    Given that lithium-ion (Li-ion) technology is the most viable rechargeable energy storage device for near-term applications, effort has been devoted to improving the safety characteristics of this system. Therefore, extensive effort has been devoted to developing nonflammable electrolytes to reduce the flammability of the cells/battery. A number of promising electrolytes have been developed incorporating flame-retardant additives, and have been shown to have good performance in a number of systems. However, these electrolyte formulations did not perform well when utilizing carbonaceous anodes with the high-voltage materials. Thus, further development was required to improve the compatibility. A number of Li-ion battery electrolyte formulations containing a flame-retardant additive [i.e., triphenyl phosphate (TPP)] were developed and demonstrated in high-voltage systems. These electrolytes include: (1) formulations that incorporate varying concentrations of the flame-retardant additive (from 5 to 15%), (2) the use of mono-fluoroethylene carbonate (FEC) as a co-solvent, and (3) the use of LiBOB as an electrolyte additive intended to improve the compatibility with high-voltage systems. Thus, improved safety has been provided without loss of performance in the high-voltage, high-energy system.

  16. Progress in Materials and Component Development for Advanced Lithium-ion Cells for NASA's Exploration Missions

    Science.gov (United States)

    Reid, Concha, M.; Reid, Concha M.

    2011-01-01

    Vehicles and stand-alone power systems that enable the next generation of human missions to the Moon will require energy storage systems that are safer, lighter, and more compact than current state-of-the- art (SOA) aerospace quality lithium-ion (Li-ion) batteries. NASA is developing advanced Li-ion cells to enable or enhance the power systems for the Altair Lunar Lander, Extravehicular Activities spacesuit, and rovers and portable utility pallets for Lunar Surface Systems. Advanced, high-performing materials are required to provide component-level performance that can offer the required gains at the integrated cell level. Although there is still a significant amount of work yet to be done, the present state of development activities has resulted in the synthesis of promising materials that approach the ultimate performance goals. This report on interim progress of the development efforts will elaborate on the challenges of the development activities, proposed strategies to overcome technical issues, and present performance of materials and cell components.

  17. Flexible Aqueous Lithium-Ion Battery with High Safety and Large Volumetric Energy Density.

    Science.gov (United States)

    Dong, Xiaoli; Chen, Long; Su, Xiuli; Wang, Yonggang; Xia, Yongyao

    2016-06-20

    A flexible and wearable aqueous lithium-ion battery is introduced based on spinel Li1.1 Mn2 O4 cathode and a carbon-coated NASICON-type LiTi2 (PO4 )3 anode (NASICON=sodium-ion super ionic conductor). Energy densities of 63 Wh kg(-1) or 124 mWh cm(-3) and power densities of 3 275 W kg(-1) or 11.1 W cm(-3) can be obtained, which are seven times larger than the largest reported till now. The full cell can keep its capacity without significant loss under different bending states, which shows excellent flexibility. Furthermore, two such flexible cells in series with an operation voltage of 4 V can be compatible with current nonaqueous Li-ion batteries. Therefore, such a flexible cell can potentially be put into practical applications for wearable electronics. In addition, a self-chargeable unit is realized by integrating a single flexible aqueous Li-ion battery with a commercial flexible solar cell, which may facilitate the long-time outdoor operation of flexible and wearable electronic devices. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Quinone Derivatives for Lithium-Ion Batteries: First-Principles Density Functional Theory Modeling

    Science.gov (United States)

    Jang, Seung Soon; Kim, Ki Chul; Liu, Tianyuan; Lee, Seung Woo

    The Li binding thermodynamics and redox potentials of seven different quinone derivatives are investigated as positive electrode candidates for lithium-ion batteries. First, using the density functional theory (DFT) calculations on the interactions between the quinone derivatives and Li ions, it is found that Li ions are dominantly bound with carbonyl groups of the molecules. Second, it is revealed that the redox chemistry of the quinone derivatives can be tuned by the modification of their chemical structures. Further DFT-based investigations on the redox potentials of the Li-bound quinone derivatives provide an insight on the change in their redox chemistry during the discharging processes. The redox potential and charge capacity are improved by modifying the quinone derivatives with electron-withdrawing carboxylic groups. Through this study, it is also found that the cathodic activity of a quinone derivative during the discharging processes strongly relies on the solvation free energy effect as well as the number of available carbonyl groups for further Li binding. To the best of our knowledge, the changes in the redox potential of the redox-active molecules during the discharging processes is reported for the first time.

  19. An Online SOC and SOH Estimation Model for Lithium-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Shyh-Chin Huang

    2017-04-01

    Full Text Available The monitoring and prognosis of cell degradation in lithium-ion (Li-ion batteries are essential for assuring the reliability and safety of electric and hybrid vehicles. This paper aims to develop a reliable and accurate model for online, simultaneous state-of-charge (SOC and state-of-health (SOH estimations of Li-ion batteries. Through the analysis of battery cycle-life test data, the instantaneous discharging voltage (V and its unit time voltage drop, V′, are proposed as the model parameters for the SOC equation. The SOH equation is found to have a linear relationship with 1/V′ times the modification factor, which is a function of SOC. Four batteries are tested in the laboratory, and the data are regressed for the model coefficients. The results show that the model built upon the data from one single cell is able to estimate the SOC and SOH of the three other cells within a 5% error bound. The derived model is also proven to be robust. A random sampling test to simulate the online real-time SOC and SOH estimation proves that this model is accurate and can be potentially used in an electric vehicle battery management system (BMS.

  20. Electrochemical stiffness in lithium-ion batteries

    Science.gov (United States)

    Tavassol, Hadi; Jones, Elizabeth M. C.; Sottos, Nancy R.; Gewirth, Andrew A.

    2016-11-01

    Although lithium-ion batteries are ubiquitous in portable electronics, increased charge rate and discharge power are required for more demanding applications such as electric vehicles. The high-rate exchange of lithium ions required for more power and faster charging generates significant stresses and strains in the electrodes that ultimately lead to performance degradation. To date, electrochemically induced stresses and strains in battery electrodes have been studied only individually. Here, a new technique is developed to probe the chemomechanical response of electrodes by calculating the electrochemical stiffness via coordinated in situ stress and strain measurements. We show that dramatic changes in electrochemical stiffness occur due to the formation of different graphite-lithium intercalation compounds during cycling. Our analysis reveals that stress scales proportionally with the lithiation/delithiation rate and strain scales proportionally with capacity (and inversely with rate). Electrochemical stiffness measurements provide new insights into the origin of rate-dependent chemomechanical degradation and the evaluation of advanced battery electrodes.

  1. High-discharge-rate lithium ion battery

    Science.gov (United States)

    Liu, Gao; Battaglia, Vincent S; Zheng, Honghe

    2014-04-22

    The present invention provides for a lithium ion battery and process for creating such, comprising higher binder to carbon conductor ratios than presently used in the industry. The battery is characterized by much lower interfacial resistances at the anode and cathode as a result of initially mixing a carbon conductor with a binder, then with the active material. Further improvements in cycleability can also be realized by first mixing the carbon conductor with the active material first and then adding the binder.

  2. Energetics of lithium ion battery failure

    Energy Technology Data Exchange (ETDEWEB)

    Lyon, Richard E., E-mail: richard.e.lyon@faa.gov; Walters, Richard N.

    2016-11-15

    Highlights: • First measure of anaerobic failure energy of lithium ion batteries. • Novel and simple bomb calorimeter method developed and demonstrated. • Four different cathode chemistries examined. • Full range of charged capacity used as independent variable. • Failure energy identified as primary safety hazard. - Abstract: The energy released by failure of rechargeable 18-mm diameter by 65-mm long cylindrical (18650) lithium ion cells/batteries was measured in a bomb calorimeter for 4 different commercial cathode chemistries over the full range of charge using a method developed for this purpose. Thermal runaway was induced by electrical resistance (Joule) heating of the cell in the nitrogen-filled pressure vessel (bomb) to preclude combustion. The total energy released by cell failure, ΔH{sub f}, was assumed to be comprised of the stored electrical energy E (cell potential × charge) and the chemical energy of mixing, reaction and thermal decomposition of the cell components, ΔU{sub rxn}. The contribution of E and ΔU{sub rxn} to ΔH{sub f} was determined and the mass of volatile, combustible thermal decomposition products was measured in an effort to characterize the fire safety hazard of rechargeable lithium ion cells.

  3. An Outlook on Lithium Ion Battery Technology.

    Science.gov (United States)

    Manthiram, Arumugam

    2017-10-25

    Lithium ion batteries as a power source are dominating in portable electronics, penetrating the electric vehicle market, and on the verge of entering the utility market for grid-energy storage. Depending on the application, trade-offs among the various performance parameters-energy, power, cycle life, cost, safety, and environmental impact-are often needed, which are linked to severe materials chemistry challenges. The current lithium ion battery technology is based on insertion-reaction electrodes and organic liquid electrolytes. With an aim to increase the energy density or optimize the other performance parameters, new electrode materials based on both insertion reaction and dominantly conversion reaction along with solid electrolytes and lithium metal anode are being intensively pursued. This article presents an outlook on lithium ion technology by providing first the current status and then the progress and challenges with the ongoing approaches. In light of the formidable challenges with some of the approaches, the article finally points out practically viable near-term strategies.

  4. Novel electrolyte mixtures based on dimethyl sulfone, ethylene carbonate and LiPF6 for lithium-ion batteries

    Science.gov (United States)

    Hofmann, Andreas; Hanemann, Thomas

    2015-12-01

    In this study, novel electrolyte mixtures for Li-ion cells are presented which are composed of ethylene carbonate/dimethyl sulfone (80:20 wt./wt.) as a solvent mixture and LiPF6, lithium bis(oxalato)borate and lithium difluoro(oxalato)borate as conducting salts. The main advantages of the solvent mixture are high flash points of >140 °C which enhance the intrinsic safety of Li-ion cells while maintaining good cell performance above 0-5 °C. The movability of the lithium ions in the electrolyte is investigated via programmed current derivative chronopotentiometry. It is found that pure electrolyte properties cannot necessarily predict the electrolyte behavior in real Li-ion cells but the complex interplay between electrolytes, electrode materials and separators has to be taken into account. Using the newly developed electrolytes, it is possible to achieve C-rates up to 1.5C with >80% of the initial specific discharge capacity (25 °C). Within 200 cycles during one month in cell tests (C||NMC) it is proven that the retention of the specific capacity is >98% of the third discharge cycle in dependence of the conducting salt.

  5. Charge Equalization Controller Algorithm for Series-Connected Lithium-Ion Battery Storage Systems: Modeling and Applications

    Directory of Open Access Journals (Sweden)

    Mahammad A. Hannan

    2017-09-01

    Full Text Available This study aims to develop an accurate model of a charge equalization controller (CEC that manages individual cell monitoring and equalizing by charging and discharging series-connected lithium-ion (Li-ion battery cells. In this concept, an intelligent control algorithm is developed to activate bidirectional cell switches and control direct current (DC–DC converter switches along with pulse width modulation (PWM generation. Individual models of an electric vehicle (EV-sustainable Li-ion battery, optimal power rating, a bidirectional flyback DC–DC converter, and charging and discharging controllers are integrated to develop a small-scale CEC model that can be implemented for 10 series-connected Li-ion battery cells. Results show that the charge equalization controller operates at 91% efficiency and performs well in equalizing both overdischarged and overcharged cells on time. Moreover, the outputs of the CEC model show that the desired balancing level occurs at 2% of state of charge difference and that all cells are operated within a normal range. The configuration, execution, control, power loss, cost, size, and efficiency of the developed CEC model are compared with those of existing controllers. The proposed model is proven suitable for high-tech storage systems toward the advancement of sustainable EV technologies and renewable source of applications.

  6. Solid lithium ion conducting electrolytes and methods of preparation

    Science.gov (United States)

    Narula, Chaitanya K; Daniel, Claus

    2013-05-28

    A composition comprised of nanoparticles of lithium ion conducting solid oxide material, wherein the solid oxide material is comprised of lithium ions, and at least one type of metal ion selected from pentavalent metal ions and trivalent lanthanide metal ions. Solution methods useful for synthesizing these solid oxide materials, as well as precursor solutions and components thereof, are also described. The solid oxide materials are incorporated as electrolytes into lithium ion batteries.

  7. High Performance Pillared Vanadium Oxide Cathode for Lithium Ion Batteries

    Science.gov (United States)

    2015-04-24

    Performance Pillared Vanadium Oxide Cathode for Lithium Ion Batteries Siu on Tung, Krista L. Hawthorne, Yi Ding, James Mainero, and Levi T. Thompson...Automotive Research Development and Engineering Center, Warren, MI 48387, USA Keywords: nanostructured materials, lithium ion batteries , cathode...2014 to 00-00-2015 4. TITLE AND SUBTITLE High Performance Pillared Vanadium Oxide Cathode for Lithium Ion Batteries 5a. CONTRACT NUMBER 5b. GRANT

  8. Invention of Lithium Ion Secondary Battery and Its Business Development

    OpenAIRE

    正本, 順三/米田,晴幸; 米田, 晴幸; MASAMOTO, Junzo; YONEDA, Haruyuki

    2010-01-01

    At present, mobile phones and laptop computers are essential items in our daily life. As a battery for such portable devices, the lithium ion secondary battery is used. The lithium ion secondary battery, which is used as a battery for such portable devices, was first invented by Dr. Yoshino at Asahi Kasei. In this paper, the authors describe how the lithium ion secondary battery was developed by the inventor. The authors also describe the battery separator, which is one of the key components ...

  9. Lithium Ion Electrolytes and Lithium Ion Cells With Good Low Temperature Performance

    Science.gov (United States)

    Smart, Marshall C. (Inventor); Bugga, Ratnakumar V. (Inventor)

    2014-01-01

    There is provided in one embodiment of the invention an electrolyte for use in a lithium ion electrochemical cell. The electrolyte comprises a mixture of an ethylene carbonate (EC), an ethyl methyl carbonate (EMC), an ester cosolvent, and a lithium salt. The ester cosolvent comprises methyl propionate (MP), ethyl propionate (EP), methyl butyrate (MB), ethyl butyrate (EB), propyl butyrate (PB), or butyl butyrate (BB). The electrochemical cell operates in a temperature range of from about -60 C to about 60 C. In another embodiment there is provided a lithium ion electrochemical cell using the electrolyte of the invention.

  10. Dicty_cDB: VHP817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP817 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHP...817Z 632 - - - - Show VHP817 Library VH (Link to library) Clone ID VHP817 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHP8-A/VHP817Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHP817 (VHP817Q) /CSM/VH/VHP8-A/VHP817Q.Seq.d/ XXXXXXXXXXTTTGATC...kt*cpk**sic*dskrniryi**ttyftkcrlyhpksn*tqte*slqk*sc*n*sflkn ekqnktnnqiiysknlffnkifffnkiff Frame C: ---DHQVVT

  11. Dicty_cDB: VHP342 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP342 (Link to dictyBase) - - - Contig-U13473-1 - (Link to Original site) VHP...342F 452 - - - - - - Show VHP342 Library VH (Link to library) Clone ID VHP342 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHP3-B/VHP342Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHP342 (VHP342Q) /CSM/VH/VHP3-B/VHP342Q.Seq.d/ AAAAGACCATCATAATA...klhqih*vlcnixsyln itlhqmlmhqhpktlvkiyq*kynsn*--- Frame B: kdhhniiqyffff*nteslshkn

  12. Fabrication of All-Solid-State Lithium-ion Cells using Three-Dimensionally Structured Solid Electrolyte Li7La3Zr2O12 Pellets

    Directory of Open Access Journals (Sweden)

    MAO SHOJI

    2016-08-01

    Full Text Available All-solid-state lithium-ion batteries using Li+-ion conducting ceramic electrolytes have been focused on as attractive future batteries for electric vehicles and renewable energy conversion systems because high safety can be realized due to non-flammability of ceramic electrolytes. In addition, a higher volumetric energy density than that of current lithium-ion batteries is expected since the all-solid-state lithium-ion batteries can be made in bipolar cell configurations. However, the special ideas and techniques based on ceramic processing are required to construct the electrochemical interface for all-solid-state lithium-ion batteries since the battery development has been done so far based on liquid electrolyte system over 100 years. As one of promising approaches to develop practical all-solid-state batteries, we have been focusing on three-dimensionally (3D structured cell configurations such as an interdigitated combination of 3D pillars of cathode and anode, which can be realized by using solid electrolyte membranes with hole-array structures. The application of such kinds of 3D structures effectively increases the interface between solid electrode and solid electrolyte per unit volume, lowering the internal resistance of all-solid-state lithium-ion batteries. In this study, Li6.25Al0.25La3Zr2O12 (LLZAl, which is a Al-doped Li7La3Zr2O12 (LLZ with Li+-ion conductivity of ~10–4 S cm–1 at room temperature and high stability against lithium-metal, was used as a solid electrolyte, and its pellets with 700 um depth holes in 700 x 700 um2 area were fabricated to construct 3D-structured all-solid-state batteries with LiCoO2 / LLZAl / lithium-metal configuration. It is expected that the LiCoO2-LLZAl interface is formed by point to point contact even when the LLZAl pellet with 3D hole-array structure is applied. Therefore, the application of mechanically soft Li3BO3 with a low melting point at around 700 °C was also performed as a supporting

  13. Simulation of the Impact of Si Shell Thickness on the Performance of Si-Coated Vertically Aligned Carbon Nanofiber as Li-Ion Battery Anode

    Directory of Open Access Journals (Sweden)

    Susobhan Das

    2015-12-01

    Full Text Available Micro- and nano-structured electrodes have the potential to improve the performance of Li-ion batteries by increasing the surface area of the electrode and reducing the diffusion distance required by the charged carriers. We report the numerical simulation of Lithium-ion batteries with the anode made of core-shell heterostructures of silicon-coated carbon nanofibers. We show that the energy capacity can be significantly improved by reducing the thickness of the silicon anode to the dimension comparable or less than the Li-ion diffusion length inside silicon. The results of simulation indicate that the contraction of the silicon electrode thickness during the battery discharge process commonly found in experiments also plays a major role in the increase of the energy capacity.

  14. Simulation of the Impact of Si Shell Thickness on the Performance of Si-Coated Vertically Aligned Carbon Nanofiber as Li-Ion Battery Anode

    Science.gov (United States)

    Das, Susobhan; Li, Jun; Hui, Rongqing

    2015-01-01

    Micro- and nano-structured electrodes have the potential to improve the performance of Li-ion batteries by increasing the surface area of the electrode and reducing the diffusion distance required by the charged carriers. We report the numerical simulation of Lithium-ion batteries with the anode made of core-shell heterostructures of silicon-coated carbon nanofibers. We show that the energy capacity can be significantly improved by reducing the thickness of the silicon anode to the dimension comparable or less than the Li-ion diffusion length inside silicon. The results of simulation indicate that the contraction of the silicon electrode thickness during the battery discharge process commonly found in experiments also plays a major role in the increase of the energy capacity. PMID:28347120

  15. Dicty_cDB: VHP646 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP646 (Link to dictyBase) - - - - VHP646P (Link to Original site) VHP646F 617 VHP...646Z 665 VHP646P 1262 - - Show VHP646 Library VH (Link to library) Clone ID VHP646 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...6-B/VHP646Q.Seq.d/ Representative seq. ID VHP646P (Link to... Original site) Representative DNA sequence >VHP646 (VHP646Q) /CSM/VH/VHP6-B/VHP646Q.Seq.d/ AACTCTCGAGTGCAAA

  16. Dicty_cDB: VHP339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP339 (Link to dictyBase) - - - - VHP339P (Link to Original site) VHP339F 530 VHP...339Z 682 VHP339P 1192 - - Show VHP339 Library VH (Link to library) Clone ID VHP339 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...3-B/VHP339Q.Seq.d/ Representative seq. ID VHP339P (Link to... Original site) Representative DNA sequence >VHP339 (VHP339Q) /CSM/VH/VHP3-B/VHP339Q.Seq.d/ AACTCTCGAGTGCAAA

  17. Dicty_cDB: VHP407 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP407 (Link to dictyBase) - - - - VHP407P (Link to Original site) VHP407F 646 VHP...407Z 771 VHP407P 1397 - - Show VHP407 Library VH (Link to library) Clone ID VHP407 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...4-A/VHP407Q.Seq.d/ Representative seq. ID VHP407P (Link to... Original site) Representative DNA sequence >VHP407 (VHP407Q) /CSM/VH/VHP4-A/VHP407Q.Seq.d/ AACTCTCGAGTGCAAA

  18. Dicty_cDB: VHP154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP154 (Link to dictyBase) - G23560 DDB0231372 Contig-U12088-1 | Contig-U13789-1 VHP...154P (Link to Original site) VHP154F 617 VHP154Z 715 VHP154P 1312 - - Show VHP154 Libr...ary VH (Link to library) Clone ID VHP154 (Link to dictyBase) Atlas ID - NBRP ID G23560 dictyBase ID DDB02313...ycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-C/VHP154Q.Seq.d/ Representative seq. ID VHP154P (Link to Original site) ...Representative DNA sequence >VHP154 (VHP154Q) /CSM/VH/VHP1-C/VHP154Q.Seq.d/ TACAACTGCAGCTAATTTATTCAAGAAAACCG

  19. Dicty_cDB: VHP524 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP524 (Link to dictyBase) - - - Contig-U11514-1 VHP524P (Link to Original site) VHP...524F 185 VHP524Z 287 VHP524P 452 - - Show VHP524 Library VH (Link to library) Clone ID VHP... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-A/VHP524Q.Seq.d/ Representative seq. ID VHP...524P (Link to Original site) Representative DNA sequence >VHP524 (VHP524Q) /CSM/VH/VHP5-A/VHP5...anctfr*pwllvqlnslkrkp sslv*hplknwllwisyvpiklvlsl*if*pxmn Homology vs CSM-cDNA Score E Sequences producing si

  20. Dicty_cDB: VHP227 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP227 (Link to dictyBase) - - - - VHP227P (Link to Original site) VHP227F 553 VHP...227Z 683 VHP227P 1216 - - Show VHP227 Library VH (Link to library) Clone ID VHP227 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...2-B/VHP227Q.Seq.d/ Representative seq. ID VHP227P (Link to... Original site) Representative DNA sequence >VHP227 (VHP227Q) /CSM/VH/VHP2-B/VHP227Q.Seq.d/ GAGAAAGCCTCCGTAA

  1. Dicty_cDB: VHP695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP695 (Link to dictyBase) - - - - VHP695P (Link to Original site) VHP695F 617 VHP...695Z 689 VHP695P 1286 - - Show VHP695 Library VH (Link to library) Clone ID VHP695 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...6-D/VHP695Q.Seq.d/ Representative seq. ID VHP695P (Link to... Original site) Representative DNA sequence >VHP695 (VHP695Q) /CSM/VH/VHP6-D/VHP695Q.Seq.d/ AAACTCTCGAGTGCAA

  2. Dicty_cDB: VHP874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP874 (Link to dictyBase) - - - - VHP874P (Link to Original site) VHP874F 617 VHP...874Z 690 VHP874P 1287 - - Show VHP874 Library VH (Link to library) Clone ID VHP874 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...8-D/VHP874Q.Seq.d/ Representative seq. ID VHP874P (Link to... Original site) Representative DNA sequence >VHP874 (VHP874Q) /CSM/VH/VHP8-D/VHP874Q.Seq.d/ AACTCTCGAGTGCAAA

  3. Dicty_cDB: VHP594 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP594 (Link to dictyBase) - - - - VHP594P (Link to Original site) VHP594F 616 VHP...594Z 745 VHP594P 1341 - - Show VHP594 Library VH (Link to library) Clone ID VHP594 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...5-D/VHP594Q.Seq.d/ Representative seq. ID VHP594P (Link to... Original site) Representative DNA sequence >VHP594 (VHP594Q) /CSM/VH/VHP5-D/VHP594Q.Seq.d/ AACTCTCGAGTGCAAA

  4. Dicty_cDB: VHP647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP647 (Link to dictyBase) - - - - VHP647P (Link to Original site) VHP647F 646 VHP...647Z 744 VHP647P 1370 - - Show VHP647 Library VH (Link to library) Clone ID VHP647 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...6-B/VHP647Q.Seq.d/ Representative seq. ID VHP647P (Link to... Original site) Representative DNA sequence >VHP647 (VHP647Q) /CSM/VH/VHP6-B/VHP647Q.Seq.d/ AACTCTCGAGTGCAAA

  5. Dicty_cDB: VHP134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP134 (Link to dictyBase) - - - Contig-U16260-1 VHP134P (Link to Original site) VHP...134F 617 VHP134Z 769 VHP134P 1366 - - Show VHP134 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-B/VHP134Q.Seq.d/ Representative seq. ID VHP...134P (Link to Original site) Representative DNA sequence >VHP134 (VHP134Q) /CSM/VH/VHP1-B/VHP...VNVIVGNTE--- ---liqr*skssc*lsr**prmg*k*chehlvfrsrr*rcqsprqchqrcsife*n*rff rwcfpmghqrrccl**kherypfqsl*chpph*chpqrwwsnhp

  6. Dicty_cDB: VHP177 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP177 (Link to dictyBase) - - - Contig-U16260-1 VHP177P (Link to Original site) VHP...177F 639 VHP177Z 631 VHP177P 1250 - - Show VHP177 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-D/VHP177Q.Seq.d/ Representative seq. ID VHP...177P (Link to Original site) Representative DNA sequence >VHP177 (VHP177Q) /CSM/VH/VHP1-D/VHP...y*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflirtpikh* rslslfp*sy*irqchcw*h*r*gir*ch--- ---e*n*rffrwcfpmghqrrccl**kherypfqsl*chpph*chp

  7. Dicty_cDB: VHP702 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP702 (Link to dictyBase) - - - Contig-U16260-1 VHP702P (Link to Original site) VHP...702F 615 VHP702Z 734 VHP702P 1329 - - Show VHP702 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP7-A/VHP702Q.Seq.d/ Representative seq. ID VHP...702P (Link to Original site) Representative DNA sequence >VHP702 (VHP702Q) /CSM/VH/VHP7-A/VHP...lslfp*sy*irqchcw*h*--- ---sr**prmg*k*chehlvfrsrr*rcqsprqchqrcsife*n*rffrwcfpmghqrrc cl**kherypfqsl*chpph*chpqrwwsnhp

  8. Dicty_cDB: VHP244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP244 (Link to dictyBase) - G03062 DDB0216322 Contig-U12556-1 VHP...244P (Link to Original site) VHP244F 616 VHP244Z 781 VHP244P 1377 - - Show VHP244 Library VH (Link to library) Clone ID VHP...Contig-U12556-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-B/VHP...244Q.Seq.d/ Representative seq. ID VHP244P (Link to Original site) Representative DNA sequence >VHP244 (VHP244Q) /CSM/VH/VHP...2-B/VHP244Q.Seq.d/ GTTCGTAATTATTTCAAAATTGGTGCGACACACTCGTATCCACAATGAAAAAATTAGTCC ATAAAGA

  9. Dicty_cDB: VHP793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP793 (Link to dictyBase) - - - Contig-U12022-1 | Contig-U13798-1 VHP...793P (Link to Original site) VHP793F 566 VHP793Z 785 VHP793P 1331 - - Show VHP793 Library VH (Link to library) Clone ID VHP...022-1 | Contig-U13798-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP7-D/VHP...793Q.Seq.d/ Representative seq. ID VHP793P (Link to Original site) Representative DNA sequence >VHP793 (VHP...793Q) /CSM/VH/VHP7-D/VHP793Q.Seq.d/ ATGAGCAGAACCAAAGGGTATTCGTATTGAAGTAGTCGATTCAAAGGATTTCAAATTCAC

  10. Dicty_cDB: VHP117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP117 (Link to dictyBase) - - - Contig-U12100-1 | Contig-U13787-1 VHP...117P (Link to Original site) VHP117F 210 VHP117Z 824 VHP117P 1014 - - Show VHP117 Library VH (Link to library) Clone ID VHP...100-1 | Contig-U13787-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-A/VHP...117Q.Seq.d/ Representative seq. ID VHP117P (Link to Original site) Representative DNA sequence >VHP117 (VHP...117Q) /CSM/VH/VHP1-A/VHP117Q.Seq.d/ ATTTTTTGTACATAAAACCGTGTTTATATTATCTTCATCTATATTCGTATTTAAAATATT

  11. Dicty_cDB: VHP204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP204 (Link to dictyBase) - - - - VHP204P (Link to Original site) VHP204F 644 VHP...204Z 767 VHP204P 1391 - - Show VHP204 Library VH (Link to library) Clone ID VHP204 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...2-A/VHP204Q.Seq.d/ Representative seq. ID VHP204P (Link to... Original site) Representative DNA sequence >VHP204 (VHP204Q) /CSM/VH/VHP2-A/VHP204Q.Seq.d/ AACTCTCGAGTGCAAA

  12. Dicty_cDB: VHP408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP408 (Link to dictyBase) - - - - VHP408P (Link to Original site) VHP408F 646 VHP...408Z 768 VHP408P 1394 - - Show VHP408 Library VH (Link to library) Clone ID VHP408 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...4-A/VHP408Q.Seq.d/ Representative seq. ID VHP408P (Link to... Original site) Representative DNA sequence >VHP408 (VHP408Q) /CSM/VH/VHP4-A/VHP408Q.Seq.d/ AACTCTCGAGTGCAAA

  13. Dicty_cDB: VHP533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VHP533 (Link to dictyBase) - - - Contig-U16251-1 - (Link to Original site) VHP533F 648 - - -...- - - - Show VHP533 Library VH (Link to library) Clone ID VHP533 (Link to dictyBase) Atlas ID - NBRP...http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP5-B/VHP533Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >VHP533 (VHP533Q) /CSM/VH/VHP5-B/VHP533Q.Seq.d/ TTTTGTTCAAAAGATTTTCAAAG...significant alignments: (bits) Value VHP533 (VHP533Q) /CSM/VH/VHP5-B/VHP533Q.Seq.d/ 1265 0.0 VHE329 (VHE329Q)

  14. The lithium-ion accumulators in Japan; Les accumulateurs lithium-ion au Japon

    Energy Technology Data Exchange (ETDEWEB)

    Lazzari, O

    2006-07-15

    This document takes stock on the different technologies of lithium based batteries developed in Japan as the materials used to produce their different elements. The today tendencies of the japanese researches are discussed. The applications of the lithium-ion are presented. A list of the main public and private laboratories in the domain and the research programs is provided. (A.L.B.)

  15. 78 FR 19024 - Lithium Ion Batteries in Transportation Public Forum

    Science.gov (United States)

    2013-03-28

    ... SAFETY BOARD Lithium Ion Batteries in Transportation Public Forum On Thursday and Friday, April 11-12, 2013, the National Transportation Safety Board (NTSB) will convene a forum titled, ``Lithium Ion Batteries in Transportation.'' The forum will begin at 9:00 a.m. on both days and is open to all. Attendance...

  16. Lithium-Ion Electrolytes with Fluoroester Co-Solvents

    Science.gov (United States)

    Smart, Marshall C. (Inventor); Bugga, Ratnakumar V. (Inventor); Prakash, G. K. Surya (Inventor); Smith, Kiah (Inventor); Bhalla, Pooja (Inventor)

    2014-01-01

    An embodiment lithium-ion battery comprising a lithium-ion electrolyte of ethylene carbonate; ethyl methyl carbonate; and at least one solvent selected from the group consisting of trifluoroethyl butyrate, ethyl trifluoroacetate, trifluoroethyl acetate, methyl pentafluoropropionate, and 2,2,2-trifluoroethyl propionate. Other embodiments are described and claimed.

  17. Investigation into key interfacial reactions within lithium-ion batteries

    Science.gov (United States)

    Vissers, Daniel Richard

    Given the concern of global climate change and the understanding that carbon dioxide emissions are driving this change, much effort has been invested into lowering carbon dioxide emissions. One approach to reduce carbon dioxide emissions is to curtail the carbon dioxide emissions from vehicles through the introduction of hybrid electric vehicles, plug-in hybrid electric vehicles, and electric vehicles. Today, lithium cobalt oxide materials are widely used in consumer electronic applications, yet these materials are cost prohibitive for larger scale vehicle applications. As a result, alternative materials with higher energy densities and lower costs are being investigated. One key alternative to cobalt that has received much attention is manganese. Manganese is of interest for its lower cost and favorable environmental friendliness. The use of manganese has led to numerous cathode materials such as Li 1-deltaMn2O4 (4V spinel), Li1-deltaMn 1.5Ni0.25O4 (5V spinel), Li1-(Mn 1-x-yNiyCox)O2 (layered), Li2MnO 3-Li1-delta(Mn1-x-yNiyCox)O 2 (layered-layered), and Li2MnO3-Li1-delta (Mn1-x-yNiyCox)1O2 -Li1-deltaMn2O4 (layered-layered-spinel). The work disclosed in the dissertation focuses on two topics associated with these manganese based cathodes. The first topic is the exceptional cyclic-ability of a high power, high energy density, 5V spinel cathode material (Li 1-deltaMn1.5Ni0.25O4) with a core-shell architecture, and the second is the severe capacity fade associated with manganese dissolution from cathodes at elevated operating temperatures. Both topics are of interest to the Li-ion battery industry. For instance, a 5V spinel cathode represents a viable path to increase both the power and energy density of Li-ion batteries. As its name implies, the 5V spinel operates at 5V that is higher than the conventional 4V lithium ion batteries. Since power and energy are directly proportional to the potential, moving from an operating potential of 4V to 5V represents an increase

  18. The Incorporation of Lithium Alloying Metals into Carbon Matrices for Lithium Ion Battery Anodes

    Science.gov (United States)

    Hays, Kevin A.

    arsenic particles that were synthesized on melt away carbon nanotubes by akalide reduction. The performance of these anodes proved sensitive to electrolyte composition, which was significantly improved by using fluorinated ethylene carbonate. Additionally, further gains in capacity retention can be made by limiting the loading voltage to 0.75 V vs lithium metal. The arsenic and melt away carbon nanotube composite was found to have excellent cycle life and capacity at high mass loading (80% arsenic) when the nanoparticles were directly synthesized on the melt away carbon nanotubes. Gallium arsenide is well known for its semiconducting properties, but its performance as in Li-ion battery anodes is first reported here. Gallium is a metal with a low melting point that has been touted as a possible self-healing material for lithium ion anodes. Alone, gallium proves to be unstable as a lithium ion battery anode, but when synthesized as gallium arsenide nanoparticles and mixed with melt away carbon nanotubes it can charge and discharge in a battery 100 times with approximately twice the capacity of graphite anodes. This first study of gallium arsenide shows dramatic cycle life improvements by using nanoscale rather that micron size gallium arsenide.

  19. Structural Integration of Silicon Solar Cells and Lithium-ion Batteries Using Printed Electronics

    Science.gov (United States)

    Kang, Jin Sung

    Inkjet printing of electrode using copper nanoparticle ink is presented. Electrode was printed on a flexible glass epoxy composite substrate using drop on demand piezoelectric dispenser and was sintered at 200°C in N 2 gas condition. The printed electrodes were made with various widths and thicknesses. Surface morphology of electrode was analyzed using scanning electron microscope (SEM) and atomic force microscope (AFM). Reliable dimensions for printed electronics were found from this study. Single-crystalline silicon solar cells were tested under four-point bending to find the feasibility of directly integrating them onto a carbon fiber/epoxy composite laminate. These solar cells were not able to withstand 0.2% strain. On the other hand, thin-film amorphous silicon solar cells were subjected to flexural fatigue loadings. The current density-voltage curves were analyzed at different cycles, and there was no noticeable degradation on its performance up to 100 cycles. A multifunctional composite laminate which can harvest and store solar energy was fabricated using printed electrodes. The integrated printed circuit board (PCB) was co-cured with a carbon/epoxy composite laminate by the vacuum bag molding process in an autoclave; an amorphous silicon solar cell and a thin-film solid state lithium-ion (Li-ion) battery were adhesively joined and electrically connected to a thin flexible PCB; and then the passive components such as resistors and diodes were electrically connected to the printed circuit board by silver pasting. Since a thin-film solid state Li-ion battery was not able to withstand tensile strain above 0.4%, thin Li-ion polymer batteries were tested under various mechanical loadings and environmental conditions to find the feasibility of using the polymer batteries for our multifunctional purpose. It was found that the Li-ion polymer batteries were stable under pressure and tensile loading without any noticeable degradation on its charge and discharge

  20. Carbon nanomaterials used as conductive additives in lithium ion batteries.

    Science.gov (United States)

    Zhang, Qingtang; Yu, Zuolong; Du, Ping; Su, Ce

    2010-06-01

    As the vital part of lithium ion batteries, conductive additives play important roles in the electrochemical performance of lithium ion batteries. They construct a conductive percolation network to increase and keep the electronic conductivity of electrode, enabling it charge and discharge faster. In addition, conductive additives absorb and retain electrolyte, allowing an intimate contact between the lithium ions and active materials. Carbon nanomaterials are carbon black, Super P, acetylene black, carbon nanofibers, and carbon nanotubes, which all have superior properties such as low weight, high chemical inertia and high specific surface area. They are the ideal conductive additives for lithium ion batteries. This review will discuss some registered patents and relevant papers about the carbon nanomaterials that are used as conductive additives in cathode or anode to improve the electrochemical performance of lithium ion batteries.

  1. Electrostatic spray deposition based lithium ion capacitor

    Science.gov (United States)

    Agrawal, Richa; Chen, Chunhui; Wang, Chunlei

    2016-05-01

    Conventional Electrochemical double-layer capacitors (EDLCs) are well suited as power devices that can provide large bursts of energy in short time periods. However, their relatively inferior energy densities as compared to their secondary battery counterparts limit their application in devices that require simultaneous supply of both high energy and high power. In the wake of addressing this shortcoming of EDLCs, the concept of hybridization of lithium-ion batteries (LIBs) and EDLCs has attracted significant scientific interest in recent years. Such a device, generally referred to as the "lithium-ion capacitor" typically utilizes a lithium intercalating electrode along with a fast charging capacitor electrode. Herein we have constructed a lithium hybrid electrochemical capacitor comprising a Li4Ti5O12-TiO2 (LTO-TiO2) anode and a reduced graphene oxide and carbon nanotube (rGO-CNT) composite cathode using electrostatic spray deposition (ESD). The electrodes were characterized using scanning electron microscopy and X-ray diffraction studies. Cyclic voltammetry and galvanostatic charge-discharge measurements were carried out to evaluate the electrochemical performance of the individual electrodes and the full hybrid cells.

  2. Fast formation cycling for lithium ion batteries

    Science.gov (United States)

    An, Seong Jin; Li, Jianlin; Du, Zhijia; Daniel, Claus; Wood, David L.

    2017-02-01

    The formation process for lithium ion batteries typically takes several days or more, and it is necessary for providing a stable solid electrolyte interphase on the anode (at low potentials vs. Li/Li+) for preventing irreversible consumption of electrolyte and lithium ions. An analogous layer known as the cathode electrolyte interphase layer forms at the cathode at high potentials vs. Li/Li+. However, several days, or even up to a week, of these processes result in either lower LIB production rates or a prohibitively large size of charging-discharging equipment and space (i.e. excessive capital cost). In this study, a fast and effective electrolyte interphase formation protocol is proposed and compared with an Oak Ridge National Laboratory baseline protocol. Graphite, NMC 532, and 1.2 M LiPF6 in ethylene carbonate: diethyl carbonate were used as anodes, cathodes, and electrolytes, respectively. Results from electrochemical impedance spectroscopy show the new protocol reduced surface film (electrolyte interphase) resistances, and 1300 aging cycles show an improvement in capacity retention.

  3. Chemical Shuttle Additives in Lithium Ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Patterson, Mary

    2013-03-31

    The goals of this program were to discover and implement a redox shuttle that is compatible with large format lithium ion cells utilizing LiNi{sub 1/3}Mn{sub 1/3}Co{sub 1/3}O{sub 2} (NMC) cathode material and to understand the mechanism of redox shuttle action. Many redox shuttles, both commercially available and experimental, were tested and much fundamental information regarding the mechanism of redox shuttle action was discovered. In particular, studies surrounding the mechanism of the reduction of the oxidized redox shuttle at the carbon anode surface were particularly revealing. The initial redox shuttle candidate, namely 2-(pentafluorophenyl)-tetrafluoro-1,3,2-benzodioxaborole (BDB) supplied by Argonne National Laboratory (ANL, Lemont, Illinois), did not effectively protect cells containing NMC cathodes from overcharge. The ANL-RS2 redox shuttle molecule, namely 1,4-bis(2-methoxyethoxy)-2,5-di-tert-butyl-benzene, which is a derivative of the commercially successful redox shuttle 2,5-di-tert-butyl-1,4-dimethoxybenzene (DDB, 3M, St. Paul, Minnesota), is an effective redox shuttle for cells employing LiFePO{sub 4} (LFP) cathode material. The main advantage of ANL-RS2 over DDB is its larger solubility in electrolyte; however, ANL-RS2 is not as stable as DDB. This shuttle also may be effectively used to rebalance cells in strings that utilize LFP cathodes. The shuttle is compatible with both LTO and graphite anode materials although the cell with graphite degrades faster than the cell with LTO, possibly because of a reaction with the SEI layer. The degradation products of redox shuttle ANL-RS2 were positively identified. Commercially available redox shuttles Li{sub 2}B{sub 12}F{sub 12} (Air Products, Allentown, Pennsylvania and Showa Denko, Japan) and DDB were evaluated and were found to be stable and effective redox shuttles at low C-rates. The Li{sub 2}B{sub 12}F{sub 12} is suitable for lithium ion cells utilizing a high voltage cathode (potential that is higher

  4. Visualization of O-O peroxo-like dimers in high-capacity layered oxides for Li-ion batteries.

    Science.gov (United States)

    McCalla, Eric; Abakumov, Artem M; Saubanère, Matthieu; Foix, Dominique; Berg, Erik J; Rousse, Gwenaelle; Doublet, Marie-Liesse; Gonbeau, Danielle; Novák, Petr; Van Tendeloo, Gustaaf; Dominko, Robert; Tarascon, Jean-Marie

    2015-12-18

    Lithium-ion (Li-ion) batteries that rely on cationic redox reactions are the primary energy source for portable electronics. One pathway toward greater energy density is through the use of Li-rich layered oxides. The capacity of this class of materials (>270 milliampere hours per gram) has been shown to be nested in anionic redox reactions, which are thought to form peroxo-like species. However, the oxygen-oxygen (O-O) bonding pattern has not been observed in previous studies, nor has there been a satisfactory explanation for the irreversible changes that occur during first delithiation. By using Li2IrO3 as a model compound, we visualize the O-O dimers via transmission electron microscopy and neutron diffraction. Our findings establish the fundamental relation between the anionic redox process and the evolution of the O-O bonding in layered oxides. Copyright © 2015, American Association for the Advancement of Science.

  5. Synthesis of rock-salt type lithium borohydride and its peculiar Li+ ion conduction properties

    Science.gov (United States)

    Miyazaki, R.; Maekawa, H.; Takamura, H.

    2014-05-01

    The high energy density and excellent cycle performance of lithium ion batteries makes them superior to all other secondary batteries and explains why they are widely used in portable devices. However, because organic liquid electrolytes have a higher operating voltage than aqueous solution, they are used in lithium ion batteries. This comes with the risk of fire due to their flammability. Solid electrolytes are being investigated to find an alternative to organic liquid. However, the nature of the solid-solid point contact at the interface between the electrolyte and electrode or between the electrolyte grains is such that high power density has proven difficult to attain. We develop a new method for the fabrication of a solid electrolyte using LiBH4, known for its super Li+ ion conduction without any grain boundary contribution. The modifications to the conduction pathway achieved by stabilizing the high pressure form of this material provided a new structure with some LiBH4, more suitable to the high rate condition. We synthesized the H.P. form of LiBH4 under ambient pressure by doping LiBH4 with the KI lattice by sintering. The formation of a KI - LiBH4 solid solution was confirmed both macroscopically and microscopically. The obtained sample was shown to be a pure Li+ conductor despite its small Li+ content. This conduction mechanism, where the light doping cation played a major role in ion conduction, was termed the "Parasitic Conduction Mechanism." This mechanism made it possible to synthesize a new ion conductor and is expected to have enormous potential in the search for new battery materials.

  6. Synthesis of rock-salt type lithium borohydride and its peculiar Li+ ion conduction properties

    Directory of Open Access Journals (Sweden)

    R. Miyazaki

    2014-05-01

    Full Text Available The high energy density and excellent cycle performance of lithium ion batteries makes them superior to all other secondary batteries and explains why they are widely used in portable devices. However, because organic liquid electrolytes have a higher operating voltage than aqueous solution, they are used in lithium ion batteries. This comes with the risk of fire due to their flammability. Solid electrolytes are being investigated to find an alternative to organic liquid. However, the nature of the solid-solid point contact at the interface between the electrolyte and electrode or between the electrolyte grains is such that high power density has proven difficult to attain. We develop a new method for the fabrication of a solid electrolyte using LiBH4, known for its super Li+ ion conduction without any grain boundary contribution. The modifications to the conduction pathway achieved by stabilizing the high pressure form of this material provided a new structure with some LiBH4, more suitable to the high rate condition. We synthesized the H.P. form of LiBH4 under ambient pressure by doping LiBH4 with the KI lattice by sintering. The formation of a KI - LiBH4 solid solution was confirmed both macroscopically and microscopically. The obtained sample was shown to be a pure Li+ conductor despite its small Li+ content. This conduction mechanism, where the light doping cation played a major role in ion conduction, was termed the “Parasitic Conduction Mechanism.” This mechanism made it possible to synthesize a new ion conductor and is expected to have enormous potential in the search for new battery materials.

  7. Electrochemical properties and lithium ion diffusion in Li4FeSbO6 studied by first principle

    Science.gov (United States)

    Jia, Mingzhen; Wang, Hongyan; Wang, Hui; Chen, Yuanzheng; Guo, Chunsheng; Gan, Liyong

    2017-10-01

    Due to the high capacity, Li-rich materials Li2MO3 (M = transition metal) have attracted considerable attention as the next generation of Li-ion batteries. Li4FeSbO6 is a new Li-rich layered oxide material with antiferromagnet honeycomb structure. In this work, the electrochemical behavior, charging process and oxygen stability of LixFeSbO6 (0 ≤ xoxygen atoms through analyzing the Bader charges of each element. In addition, oxygen evolution reactions will occur in LixFeSbO6 (x ≤ 1.5), which will decay the capacities during cycling process. Finally, we calculated that the lithium ion can diffuse in a three-dimensional pathway with the activation barriers from 0.36 eV to 0.67 eV.

  8. Embedded Si/Graphene Composite Fabricated by Magnesium-Thermal Reduction as Anode Material for Lithium-Ion Batteries

    Science.gov (United States)

    Zhu, Jiangliu; Ren, Yurong; Yang, Bo; Chen, Wenkai; Ding, Jianning

    2017-12-01

    Embedded Si/graphene composite was fabricated by a novel method, which was in situ generated SiO2 particles on graphene sheets followed by magnesium-thermal reduction. The tetraethyl orthosilicate (TEOS) and flake graphite was used as original materials. On the one hand, the unique structure of as-obtained composite accommodated the large volume change to some extent. Simultaneously, it enhanced electronic conductivity during Li-ion insertion/extraction. The MR-Si/G composite is used as the anode material for lithium ion batteries, which shows high reversible capacity and ascendant cycling stability reach to 950 mAh·g-1 at a current density of 50 mA·g-1 after 60 cycles. These may be conducive to the further advancement of Si-based composite anode design.

  9. All-Solid-State Lithium-Ion Batteries with Grafted Ceramic Nanoparticles Dispersed in Solid Polymer Electrolytes.

    Science.gov (United States)

    Lago, Nerea; Garcia-Calvo, Oihane; Lopez del Amo, Juan Miguel; Rojo, Teofilo; Armand, Michel

    2015-09-21

    Lithium-based rechargeable batteries offer superior specific energy and power, and have enabled exponential growth in industries focused on small electronic devices. However, further increases in energy density, for example for electric transportation, face the challenge of harnessing the lithium metal as negative electrode instead of limited-capacity graphite and its heavy copper current collector. All-solid-state batteries utilize solid polymer electrolytes (SPEs) to overcome the safety issues of liquid electrolytes. We demonstrate an all-solid-state lithium-ion battery by using plasticized poly(ethylene oxide)-based SPEs comprising anions grafted or co-grafted onto ceramic nanoparticles. This new approach using grafted ceramic nanoparticles enables the development of a new generation of nanohybrid polymer electrolytes with high ionic conductivity as well as high electrochemical and mechanical stability, enabling Li-ion batteries with long cycle life. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Hydrometallurgical recovery of metal values from sulfuric acid leaching liquor of spent lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiangping; Chen, Yongbin; Zhou, Tao, E-mail: zhoutao@csu.edu.cn; Liu, Depei; Hu, Hang; Fan, Shaoyun

    2015-04-15

    Highlights: • Selective precipitation and solvent extraction were adopted. • Nickel, cobalt and lithium were selectively precipitated. • Co-D2EHPA was employed as high-efficiency extraction reagent for manganese. • High recovery percentages could be achieved for all metal values. - Abstract: Environmentally hazardous substances contained in spent Li-ion batteries, such as heavy metals and nocuous organics, will pose a threat to the environment and human health. On the other hand, the sustainable recycling of spent lithium-ion batteries may bring about environmental and economic benefits. In this study, a hydrometallurgical process was adopted for the comprehensive recovery of nickel, manganese, cobalt and lithium from sulfuric acid leaching liquor from waste cathode materials of spent lithium-ion batteries. First, nickel ions were selectively precipitated and recovered using dimethylglyoxime reagent. Recycled dimethylglyoxime could be re-used as precipitant for nickel and revealed similar precipitation performance compared with fresh dimethylglyoxime. Then the separation of manganese and cobalt was conducted by solvent extraction method using cobalt loaded D2EHPA. And McCabe–Thiele isotherm was employed for the prediction of the degree of separation and the number of extraction stages needed at specific experimental conditions. Finally, cobalt and lithium were sequentially precipitated and recovered as CoC{sub 2}O{sub 4}⋅2H{sub 2}O and Li{sub 2}CO{sub 3} using ammonium oxalate solution and saturated sodium carbonate solution, respectively. Recovery efficiencies could be attained as follows: 98.7% for Ni; 97.1% for Mn, 98.2% for Co and 81.0% for Li under optimized experimental conditions. This hydrometallurgical process may promise a candidate for the effective separation and recovery of metal values from the sulfuric acid leaching liquor.

  11. Environmental impact assessment and end-of-life treatment policy analysis for Li-ion batteries and Ni-MH batteries.

    Science.gov (United States)

    Yu, Yajuan; Chen, Bo; Huang, Kai; Wang, Xiang; Wang, Dong

    2014-03-18

    Based on Life Cycle Assessment (LCA) and Eco-indicator 99 method, a LCA model was applied to conduct environmental impact and end-of-life treatment policy analysis for secondary batteries. This model evaluated the cycle, recycle and waste treatment stages of secondary batteries. Nickel-Metal Hydride (Ni-MH) batteries and Lithium ion (Li-ion) batteries were chosen as the typical secondary batteries in this study. Through this research, the following results were found: (1) A basic number of cycles should be defined. A minimum cycle number of 200 would result in an obvious decline of environmental loads for both battery types. Batteries with high energy density and long life expectancy have small environmental loads. Products and technology that help increase energy density and life expectancy should be encouraged. (2) Secondary batteries should be sorted out from municipal garbage. Meanwhile, different types of discarded batteries should be treated separately under policies and regulations. (3) The incineration rate has obvious impact on the Eco-indicator points of Nickel-Metal Hydride (Ni-MH) batteries. The influence of recycle rate on Lithium ion (Li-ion) batteries is more obvious. These findings indicate that recycling is the most promising direction for reducing secondary batteries' environmental loads. The model proposed here can be used to evaluate environmental loads of other secondary batteries and it can be useful for proposing policies and countermeasures to reduce the environmental impact of secondary batteries.

  12. Environmental Impact Assessment and End-of-Life Treatment Policy Analysis for Li-Ion Batteries and Ni-MH Batteries

    Directory of Open Access Journals (Sweden)

    Yajuan Yu

    2014-03-01

    Full Text Available Based on Life Cycle Assessment (LCA and Eco-indicator 99 method, a LCA model was applied to conduct environmental impact and end-of-life treatment policy analysis for secondary batteries. This model evaluated the cycle, recycle and waste treatment stages of secondary batteries. Nickel-Metal Hydride (Ni-MH batteries and Lithium ion (Li-ion batteries were chosen as the typical secondary batteries in this study. Through this research, the following results were found: (1 A basic number of cycles should be defined. A minimum cycle number of 200 would result in an obvious decline of environmental loads for both battery types. Batteries with high energy density and long life expectancy have small environmental loads. Products and technology that help increase energy density and life expectancy should be encouraged. (2 Secondary batteries should be sorted out from municipal garbage. Meanwhile, different types of discarded batteries should be treated separately under policies and regulations. (3 The incineration rate has obvious impact on the Eco-indicator points of Nickel-Metal Hydride (Ni-MH batteries. The influence of recycle rate on Lithium ion (Li-ion batteries is more obvious. These findings indicate that recycling is the most promising direction for reducing secondary batteries’ environmental loads. The model proposed here can be used to evaluate environmental loads of other secondary batteries and it can be useful for proposing policies and countermeasures to reduce the environmental impact of secondary batteries.

  13. Environmental Impact Assessment and End-of-Life Treatment Policy Analysis for Li-Ion Batteries and Ni-MH Batteries

    Science.gov (United States)

    Yu, Yajuan; Chen, Bo; Huang, Kai; Wang, Xiang; Wang, Dong

    2014-01-01

    Based on Life Cycle Assessment (LCA) and Eco-indicator 99 method, a LCA model was applied to conduct environmental impact and end-of-life treatment policy analysis for secondary batteries. This model evaluated the cycle, recycle and waste treatment stages of secondary batteries. Nickel-Metal Hydride (Ni-MH) batteries and Lithium ion (Li-ion) batteries were chosen as the typical secondary batteries in this study. Through this research, the following results were found: (1) A basic number of cycles should be defined. A minimum cycle number of 200 would result in an obvious decline of environmental loads for both battery types. Batteries with high energy density and long life expectancy have small environmental loads. Products and technology that help increase energy density and life expectancy should be encouraged. (2) Secondary batteries should be sorted out from municipal garbage. Meanwhile, different types of discarded batteries should be treated separately under policies and regulations. (3) The incineration rate has obvious impact on the Eco-indicator points of Nickel-Metal Hydride (Ni-MH) batteries. The influence of recycle rate on Lithium ion (Li-ion) batteries is more obvious. These findings indicate that recycling is the most promising direction for reducing secondary batteries’ environmental loads. The model proposed here can be used to evaluate environmental loads of other secondary batteries and it can be useful for proposing policies and countermeasures to reduce the environmental impact of secondary batteries. PMID:24646862

  14. Selective recovery of valuable metals from spent Li-ion batteries using solvent-impregnated resins.

    Science.gov (United States)

    Guo, Fuqiang; Nishihama, Syouhei; Yoshizuka, Kazuharu

    2013-01-01

    Selective recovery of valuable metals (Cu(2+), Co(2+) and Li(+)) from leachate of spent lithium-ion (Li-ion) batteries was investigated in acidic chloride media using solvent impregnated resins (SIRs). An SIR containing bis(2-ethylhexyl) phosphoric acid (D2EHPA) had high selectivity for Fe(3+) and Al(3+), with an order of selectivity Fe(3+) > Al(3+) > Cu(2+) > Co(2+). Fe(3+) and Al(3+) could be removed from synthetic leachate by precipitation, followed by column adsorption with the SIR containing D2EHPA. The synthetic leachate was then applied to chromatography for selective recovery of Cu(2+), Co(2+) and Li(+). The solution was first fed upward to a column packed with an SIR containing 2-ethylhexylphosphonic acid mono-2-ethylhexyl ester (PC-88A) for selective separation of Cu(2+), followed by upward feed to another column packed with an SIR comprising PC-88A and bis(2,4,4-trimethylpentyl) phosphinic acid (Cyanex 272) for selective recovery of Co(2+). Finally, a column packed with a synergistic SIR containing both 1-phenyl-1,3-tetradecanedione (C11phbetaDK) and tri-n-octylphosphine oxide (TOPO) was used for selective recovery of Li(+). A process flowsheet is proposed for selective recovery of Cu(2+), Co(2+) and Li(+) using several SIRs. This process was found to be simple and efficient for selective recovery of valuable metals from leachate of spent Li-ion batteries. Pure copper, cobalt and lithium products were obtained, with high elution yields.

  15. Progress in Application of CNTs in Lithium-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Li Li

    2014-01-01

    Full Text Available The lithium-ion battery is widely used in the fields of portable devices and electric cars with its superior performance and promising energy storage applications. The unique one-dimensional structure formed by the graphene layer makes carbon nanotubes possess excellent mechanical, electrical, and electrochemical properties and becomes a hot material in the research of lithium-ion battery. In this paper, the applicable research progress of carbon nanotubes in lithium-ion battery is described, and its future development is put forward from its two aspects of being not only the anodic conductive reinforcing material and the cathodic energy storage material but also the electrically conductive framework material.

  16. 4-Vinyl-1,3-Dioxolane-2-One as an Additive for Li-Ion Cells

    Science.gov (United States)

    Smart, Marshall; Bugga, Ratnakumar

    2006-01-01

    Electrolyte additive 4-vinyl-1,3-dioxolane-2-one has been found to be promising for rechargeable lithium-ion electrochemical cells. This and other additives, along with advanced electrolytes comprising solutions of LiPF6 in various mixtures of carbonate solvents, have been investigated in a continuing effort to improve the performances of rechargeable lithium-ion electrochemical cells, especially at low temperatures. In contrast to work by other researchers who have investigated the use of this additive to improve the high-temperature resilience of Li-ion cells, the current work involves the incorporation of 4-vinyl-1,3-dioxolane-2-one into quaternary carbonate electrolyte mixtures, previously optimized for low-temperature applications, resulting in improved low-temperature performance. The benefit afforded by 4-vinyl-1,3- dioxolane-2-one can be better understood in the light of relevant information from a number of prior NASA Tech Briefs articles about electrolytes and additives for such cells. To recapitulate: The loss of performance with decreasing temperature is attributable largely to a decrease of ionic conductivity and the increase in viscosity of the electrolyte. What is needed to extend the lower limit of operating temperature is a stable electrolyte solution with relatively small lowtemperature viscosity, a large electric permittivity, adequate coordination behavior, and appropriate ranges of solubilities of liquid and salt constituents. Whether the anode is made of graphitic or non-graphitic carbon, a film on the surface of the anode acts as a solid/electrolyte interface (SEI), the nature of which is critical to low-temperature performance. Desirably, the surface film should exert a chemically protective (passivating) effect on both the anode and the electrolyte, yet should remain conductive to lithium ions to facilitate intercalation and de-intercalation of the ions into and out of the carbon during discharging and charging, respectively. The additives

  17. Shutdown potential adjustment of modified carbene adducts as additives for lithium ion battery electrolytes

    Science.gov (United States)

    Janssen, Pia; Streipert, Benjamin; Krafft, Roman; Murmann, Patrick; Wagner, Ralf; Lewis-Alleyne, Lesley; Röschenthaler, Gerd-Volker; Winter, Martin; Cekic-Laskovic, Isidora

    2017-11-01

    To improve the intrinsic safety of lithium ion batteries (LIBs) by preventing cells from a thermal runaway, we studied two carbene adduct electrolyte additives. The recently synthesized compounds (1,3-dimethylimidazolidin-2-μm-trifluoroborate (NHC-BF3) and 1,3-dimethylimidazolidin-2-μm-tetrafluorotrifluoromethylphosphate (NHC-PF4CF3)) were investigated on LiNi1/3Co1/3Mn1/3O2 (NMC111) electrodes in Li metal and Li-ion cell setups as overcharge protection shutdown additives in 1M LiPF6 in EC:DEC (3:7, by wt.) electrolyte. By varying the NHC-ligand (-BF3, -PF5, -PF4CF3) in the molecule, the shutdown potential of the investigated carbene adduct electrolyte additives can be tailored for specific applications with different cut-off potentials. NHC-BF3 was identified as a promising candidate for the application with NMC111 electrodes up to 4.4 V vs. Li/Li+, whereas the carbene adduct NHC-PF4CF3 is ideal for the high-voltage application with the NMC-based electrode up to 4.6 V vs. Li/Li+. Next to electrochemical investigations in NMC111/Li and NMC111/graphite cells, Atomic Force Microscopy (AFM) and X-Ray Photoelectron Spectroscopy (XPS) were performed to verify the presence of a decomposition layer on the cathode, responsible for the shutdown effect. Furthermore, it has been proven that the investigated electrolyte additives have no influence on the cell performance under normal conditions in both, Li metal and Li-ion cell setups.

  18. Investigating the stability of cathode materials for rechargeable lithium ion batteries

    Science.gov (United States)

    Huang, Yiqing

    Lithium ion batteries are widely used in portable electronic devices and electric vehicles. However, safety is one of the most important issues for the Li-ion batteries' use. Some cathode materials, such as LiCoO 2, are thermally unstable in the charged state. Upon decomposition these cathode materials release O2, which could react with organic electrolyte, leading to a thermal runaway. Thus understanding the stability of the cathode materials is critical to the safety of lithium ion batteries. Olivine-type LiMnPO4 is a promising cathode material for lithium ion batteries because of its high energy density. We have revealed the critical role of carbon in the stability and thermal behaviour of olivine MnPO 4 obtained by chemical delithiation of LiMnPO4. (Li)MnPO 4 samples with various particle sizes and carbon contents were studied. Carbon-free LiMnPO4 obtained by solid state synthesis in O 2 becomes amorphous upon delithiation. Small amounts of carbon (0.3 wt.%) help to stabilize the olivine structure, so that completely delithiated crystalline olivine MnPO4 can be obtained. Larger amount of carbon (2 wt.%) prevents full delithiation. Heating in air, O2, or N 2 results in structural disorder (analysis. Safety of batteries not only depends on the stability of the active materials, but also the interactions between the active materials and electrolyte. Thus we study the stability between the cathode materials and the electrolyte. The thermal stability of electrochemically delithiated Li0.1N 0.8C0.15Al0.05O2 (NCA), FePO4 (FP), Mn0.8Fe0.2PO4 (MFP), hydrothermally synthesized VOPO4, LiVOPO4 and electrochemically lithiated Li2VOPO4 is investigated by differential scanning calorimetry (DSC) and thermogravimetric analysis, coupled with mass spectrometry (TGA-MS). The thermal stability is found in the order: NCAperformance of the aerogel. In addition to fully reversible V reduction and oxidation due to the intercalation reaction, we observe the formation of LiOH species

  19. Nanostructured Phosphorus Doped Silicon/Graphite Composite as Anode for High-Performance Lithium-Ion Batteries.

    Science.gov (United States)

    Huang, Shiqiang; Cheong, Ling-Zhi; Wang, Deyu; Shen, Cai

    2017-07-19

    Silicon as the potential anode material for lithium-ion batteries suffers from huge volume change (up to 400%) during charging/discharging processes. Poor electrical conductivity of silicon also hinders its long-term cycling performance. Herein, we report a two-step ball milling method to prepare nanostructured P-doped Si/graphite composite. Both P-doped Si and coated graphite improved the conductivity by providing significant transport channels for lithium ions and electrons. The graphite skin is able to depress the volume expansion of Si by forming a stable SEI film. The as-prepared composite anode having 50% P-doped Si and 50% graphite exhibits outstanding cyclability with a specific capacity of 883.4 mAh/g after 200 cycles at the current density of 200 mA/g. The cost-effective materials and scalable preparation method make it feasible for large-scale application of the P-doped Si/graphite composite as anode for Li-ion batteries.

  20. Estimation of State of Charge for Two Types of Lithium-Ion Batteries by Nonlinear Predictive Filter for Electric Vehicles

    Directory of Open Access Journals (Sweden)

    Yin Hua

    2015-04-01

    Full Text Available Estimation of state of charge (SOC is of great importance for lithium-ion (Li-ion batteries used in electric vehicles. This paper presents a state of charge estimation method using nonlinear predictive filter (NPF and evaluates the proposed method on the lithium-ion batteries with different chemistries. Contrary to most conventional filters which usually assume a zero mean white Gaussian process noise, the advantage of NPF is that the process noise in NPF is treated as an unknown model error and determined as a part of the solution without any prior assumption, and it can take any statistical distribution form, which improves the estimation accuracy. In consideration of the model accuracy and computational complexity, a first-order equivalent circuit model is applied to characterize the battery behavior. The experimental test is conducted on the LiCoO2 and LiFePO4 battery cells to validate the proposed method. The results show that the NPF method is able to accurately estimate the battery SOC and has good robust performance to the different initial states for both cells. Furthermore, the comparison study between NPF and well-established extended Kalman filter for battery SOC estimation indicates that the proposed NPF method has better estimation accuracy and converges faster.

  1. Nanostructured Materials for Li-Ion Batteries and Beyond

    Directory of Open Access Journals (Sweden)

    Xifei Li

    2016-04-01

    Full Text Available This Special Issue “Nanostructured Materials for Li-Ion Batteries and Beyond” of Nanomaterials is focused on advancements in the synthesis, optimization, and characterization of nanostructured materials, with an emphasis on the application of nanomaterials for building high performance Li-ion batteries (LIBs and future systems.[...

  2. Development of Contact-Wireless Type Railcar by Lithium Ion Battery

    OpenAIRE

    OGIHARA, Takashi

    2010-01-01

    Large lithium ion battery was developed for the running of railcar. Mn type lithium ion battery was used because of low cost and higher safety. LMP with high rechargeable performance were produced by large flame type spray pyrolysis. The laminate sheet type lithium ion cell was made using LMP. Various type large lithium ion battery modules consisted of submodule, in which laminate sheet type lithium ion cells were connected in series and parallel, were constructed. The running test of DC and ...

  3. Lithium Ion Testing at NSWC Crane in Support of NASA Goddard Space Flight Center

    Science.gov (United States)

    Brown, Harry; Jung, David; Lee, Leonine

    2010-01-01

    This viewgraph presentation reviews Lithium Ion Cell testing at the Naval Surface Warfare Center in Crane, India. The contents include: 1) Quallion 15 Ahr Lithium-Ion Cells, LEO Life Cycle Test; 2) Lithion 50 Ahr Lithium-Ion Cells, LEO Life Cycle Test; 3) ABSL 5 Ahr Lithium-Ion Battery, LRO-LLO Life Cycle Test, SDO-GEO Life Cycle Test; and 4) A123 40 Ahr Lithium-Ion Battery, GPM Life Cycle Test, MMS Life Cycle Test.

  4. Practical Methods in Li-ion Batteries

    DEFF Research Database (Denmark)

    Barreras, Jorge Varela

    to parameterize battery models based solely on manufacturer’s datasheets • Manuscript II presents a parameterization method for battery models based on the notion of direct current resistance • Manuscript III proposes a battery electric vehicle design that combines fixed and swappable packs • Manuscript IV......This thesis presents, as a collection of papers, practical methods in Li-ion batteries for simplified modeling (Manuscript I and II), battery electric vehicle design (III), battery management system testing (IV and V) and balancing system control (VI and VII). • Manuscript I tackles methodologies...... develops a battery system model for battery management system testing on a hardware-in-the-loop simulator • Manuscript V extends the previous work, introducing theoretical principles and presenting a practical method to develop ad hoc software and strategies for testing • Manuscript VI presents...

  5. Smart materials for energy storage in Li-ion batteries

    Directory of Open Access Journals (Sweden)

    Ashraf E Abdel-Ghany

    2016-01-01

    Full Text Available Advanced lithium-ion batteries contain smart materials having the function of insertion electrodes in the form of powders with specific and optimized electrochemical properties. Different classes can be considered: the surface modified active particles at either positive or negative electrodes, the nano-composite electrodes and the blended materials. In this paper, various systems are described, which illustrate the improvement of lithium-ion batteries in term of specific energy and power, thermal stability and life cycling.

  6. High Capacity Anodes for Advanced Lithium Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Lithium-ion batteries are slowly being introduced into satellite power systems, but their life still presents concerns for longer duration missions. Future NASA...

  7. Bipolar and Monopolar Lithium-Ion Battery Technology at Yardney

    Science.gov (United States)

    Russell, P.; Flynn, J.; Reddy, T.

    1996-01-01

    Lithium-ion battery systems offer several advantages: intrinsically safe; long cycle life; environmentally friendly; high energy density; wide operating temperature range; good discharge rate capability; low self-discharge; and no memory effect.

  8. Improved OCV Model of a Li-Ion NMC Battery for Online SOC Estimation Using the Extended Kalman Filter

    Directory of Open Access Journals (Sweden)

    Ines Baccouche

    2017-05-01

    Full Text Available Accurate modeling of the nonlinear relationship between the open circuit voltage (OCV and the state of charge (SOC is required for adaptive SOC estimation during the lithium-ion (Li-ion battery operation. Online SOC estimation should meet several constraints, such as the computational cost, the number of parameters, as well as the accuracy of the model. In this paper, these challenges are considered by proposing an improved simplified and accurate OCV model of a nickel manganese cobalt (NMC Li-ion battery, based on an empirical analytical characterization approach. In fact, composed of double exponential and simple quadratic functions containing only five parameters, the proposed model accurately follows the experimental curve with a minor fitting error of 1 mV. The model is also valid at a wide temperature range and takes into account the voltage hysteresis of the OCV. Using this model in SOC estimation by the extended Kalman filter (EKF contributes to minimizing the execution time and to reducing the SOC estimation error to only 3% compared to other existing models where the estimation error is about 5%. Experiments are also performed to prove that the proposed OCV model incorporated in the EKF estimator exhibits good reliability and precision under various loading profiles and temperatures.

  9. Hierarchical micro-lamella-structured 3D porous copper current collector coated with tin for advanced lithium-ion batteries

    Science.gov (United States)

    Park, Hyeji; Um, Ji Hyun; Choi, Hyelim; Yoon, Won-Sub; Sung, Yung-Eun; Choe, Heeman

    2017-03-01

    A Novel 3D porous Sn-Cu architecture is prepared as an anode material for use in an advanced lithium-ion battery. Micro-lamellar-structured 3D porous Cu foam, which is electroless-plated with Sn as an active material, is used as anode current collector. Compared to Sn-coated Cu foil, the 3D Sn-Cu foam exhibits superior Li-ion capacity and stable capacity retention, demonstrating the advantage of 3D porous architecture by preserving its structural integrity. In addition, the effect of heat-treatment after Sn plating is investigated. Sn/Sn6Cu5 and SnO2/Cu10Sn3 were formed on and in the 3D Sn-Cu foam under the heat-treatment at 150 °C and 500 °C, respectively. The development of Cu10Sn3 in the 3D Sn-Cu foam heat-treated at 500 °C can be a key factor for the enhanced cyclic stability because the Cu10Sn3 inactively reacts with Li-ion and alleviates the volume expansion of SnO2 as an inactive matrix.

  10. Ternary CNTs@TiO2/CoO Nanotube Composites: Improved Anode Materials for High Performance Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Mahmoud Madian

    2017-06-01

    Full Text Available TiO2 nanotubes (NTs synthesized by electrochemical anodization are discussed as very promising anodes for lithium ion batteries, owing to their high structural stability, high surface area, safety, and low production cost. However, their poor electronic conductivity and low Li+ ion diffusivity are the main drawbacks that prevent them from achieving high electrochemical performance. Herein, we report the fabrication of a novel ternary carbon nanotubes (CNTs@TiO2/CoO nanotubes composite by a two-step synthesis method. The preparation includes an initial anodic fabrication of well-ordered TiO2/CoO NTs from a Ti-Co alloy, followed by growing of CNTs horizontally on the top of the oxide films using a simple spray pyrolysis technique. The unique 1D structure of such a hybrid nanostructure with the inclusion of CNTs demonstrates significantly enhanced areal capacity and rate performances compared to pure TiO2 and TiO2/CoO NTs, without CNTs tested under identical conditions. The findings reveal that CNTs provide a highly conductive network that improves Li+ ion diffusivity, promoting a strongly favored lithium insertion into the TiO2/CoO NT framework, and hence resulting in high capacity and an extremely reproducible high rate capability.

  11. Preventing thermal runaway propagation in lithium ion battery packs using a phase change composite material: An experimental study

    Science.gov (United States)

    Wilke, Stephen; Schweitzer, Ben; Khateeb, Siddique; Al-Hallaj, Said

    2017-02-01

    The safety issues of lithium ion batteries pose ongoing challenges as the market for Li-ion technology continues to grow in personal electronics, electric mobility, and stationary energy storage. The severe risks posed by battery thermal runaway necessitate safeguards at every design level - from materials, to cell construction, to module and pack assembly. One promising approach to pack thermal management is the use of phase change composite materials (PCC™), which offer passive protection at low weight and cost while minimizing system complexity. We present experimental nail penetration studies on a Li-ion pack for small electric vehicles, designed with and without PCC, to investigate the effectiveness of PCC thermal management for preventing propagation when a single cell enters thermal runaway. The results show that when parallel cells short-circuit through the penetrated cell, the packs without PCC propagate fully while those equipped with PCC show no propagation. In cases where no external short circuits occur, packs without PCC sometimes propagate, but not consistently. In all test conditions, the use of PCC lowers the maximum temperature experienced by neighboring cells by 60 °C or more. We also elucidate the propagation sequence and aspects of pack failure based on cell temperature, voltage, and post-mortem data.

  12. Adaptive prognosis of lithium-ion batteries based on the combination of particle filters and radial basis function neural networks

    Science.gov (United States)

    Sbarufatti, Claudio; Corbetta, Matteo; Giglio, Marco; Cadini, Francesco

    2017-03-01

    Lithium-Ion rechargeable batteries are widespread power sources with applications to consumer electronics, electrical vehicles, unmanned aerial and spatial vehicles, etc. The failure to supply the required power levels may lead to severe safety and economical consequences. Thus, in view of the implementation of adequate maintenance strategies, the development of diagnostic and prognostic tools for monitoring the state of health of the batteries and predicting their remaining useful life is becoming a crucial task. Here, we propose a method for predicting the end of discharge of Li-Ion batteries, which stems from the combination of particle filters with radial basis function neural networks. The major innovation lies in the fact that the radial basis function model is adaptively trained on-line, i.e., its parameters are identified in real time by the particle filter as new observations of the battery terminal voltage become available. By doing so, the prognostic algorithm achieves the flexibility needed to provide sound end-of-discharge time predictions as the charge-discharge cycles progress, even in presence of anomalous behaviors due to failures or unforeseen operating conditions. The method is demonstrated with reference to actual Li-Ion battery discharge data contained in the prognostics data repository of the NASA Ames Research Center database.

  13. Molecular dynamics simulations of the first charge of a Li-ion-Si-anode nanobattery.

    Science.gov (United States)

    Galvez-Aranda, Diego E; Ponce, Victor; Seminario, Jorge M

    2017-04-01

    Rechargeable lithium-ion batteries are the most popular devices for energy storage but still a lot of research needs to be done to improve their cycling and storage capacity. Silicon has been proposed as an anode material because of its large theoretical capacity of ∼3600 mAh/g. Therefore, focus is needed on the lithiation process of silicon anodes where it is known that the anode increases its volume more than 300%, producing cracking and other damages. We performed molecular dynamics atomistic simulations to study the swelling, alloying, and amorphization of a silicon nanocrystal anode in a full nanobattery model during the first charging cycle. A dissolved salt of lithium hexafluorophosphate in ethylene carbonate was chosen as the electrolyte solution and lithium cobalt oxide as cathode. External electric fields are applied to emulate the charging, causing the migration of the Li-ions from the cathode to the anode, by drifting through the electrolyte solution, thus converting pristine Si gradually into Li 14 Si 5 when fully lithiated. When the electric field is applied to the nanobattery, the temperature never exceeds 360 K due to a temperature control imposed resembling a cooling mechanism. The volume of the anode increases with the amorphization of the silicon as the external field is applied by creating a layer of LiSi alloy between the electrolyte and the silicon nanocrystal and then, at the arrival of more Li-ions changing to an alloy, where the drift velocity of Li-ions is greater than the velocity in the initial nanocrystal structure. Charge neutrality is maintained by concerted complementary reduction-oxidation reactions at the anode and cathode, respectively. In addition, the nanobattery model developed here can be used to study charge mobility, current density, conductance and resistivity, among several other properties of several candidate materials for rechargeable batteries and constitutes the initial point for further studies on the formation of

  14. Flexible lithium-ion planer thin-film battery

    KAUST Repository

    Kutbee, Arwa T.

    2016-02-03

    Commercialization of wearable electronics requires miniaturized, flexible power sources. Lithium ion battery is a strong candidate as the next generation high performance flexible battery. The development of flexible materials for battery electrodes suffers from the limited material choices. In this work, we present a flexible inorganic lithium-ion battery with no restrictions on the materials used. The battery showed an enhanced normalized capacity of 146 ??Ah/cm2.

  15. Free-form Flexible Lithium-Ion Microbattery

    KAUST Repository

    Kutbee, Arwa T.

    2016-03-02

    Wearable electronics need miniaturized, safe and flexible power sources. Lithium ion battery is a strong candidate as high performance flexible battery. The development of flexible materials for battery electrodes suffers from the limited material choices. In this work, we present integration strategy to rationally design materials and processes to report flexible inorganic lithium-ion microbattery with no restrictions on the materials used. The battery shows an enhanced normalized capacity of 147 μAh/cm2 when bent.

  16. Internal and External Temperature Monitoring of a Li-Ion Battery with Fiber Bragg Grating Sensors

    Directory of Open Access Journals (Sweden)

    Susana Novais

    2016-08-01

    Full Text Available The integration of fiber Bragg grating (FBG sensors in lithium-ion cells for in-situ and in-operando temperature monitoring is presented herein. The measuring of internal and external temperature variations was performed through four FBG sensors during galvanostatic cycling at C-rates ranging from 1C to 8C. The FBG sensors were placed both outside and inside the cell, located in the center of the electrochemically active area and at the tab-electrode connection. The internal sensors recorded temperature variations of 4.0 ± 0.1 °C at 5C and 4.7 ± 0.1 °C at 8C at the center of the active area, and 3.9 ± 0.1 °C at 5C and 4.0 ± 0.1 °C at 8C at the tab-electrode connection, respectively. This study is intended to contribute to detection of a temperature gradient in real time inside a cell, which can determine possible damage in the battery performance when it operates under normal and abnormal operating conditions, as well as to demonstrate the technical feasibility of the integration of in-operando microsensors inside Li-ion cells.

  17. Failure Mechanisms of Ni-H2 and Li-Ion Batteries Under Hypervelocity Impacts

    Science.gov (United States)

    Miller, J. E.; Lyons, F.; Christiansen, E. L.; Lear, D. M.

    2017-01-01

    Lithium-Ion (Li-Ion) batteries have yielded significant performance advantages for many industries, including the aerospace industry, and have been selected to replace nickel hydrogen (Ni-H2) batteries for the International Space Station (ISS) program to meet the energy storage demands. As the ISS uses its vast solar arrays to generate its power, the solar ar-rays meet their sunlit power demands and supply excess power to battery packs for power de-livery on the sun obscured phase of the approximate 90 minute low Earth orbit. These large battery packs are located on the exterior of the ISS, and as such, the battery packs are ex-posed to external environment threats like naturally occurring meteoroids and artificial orbital debris (MMOD). While the risks from these solid particle environments has been known and addressed to an acceptable risk of failure through shield design, it is not possible to completely eliminate the risk of loss of these assets on orbit due to MMOD, and as such, failure consequences to the ISS have been considered.

  18. Electrochemically engineered single Li-ion conducting solid polymer electrolyte on titania nanotubes for microbatteries

    Science.gov (United States)

    Ferrari, I. V.; Braglia, M.; Djenizian, T.; Knauth, P.; Di Vona, M. L.

    2017-06-01

    Single Li-ion conducting p-sulfonated poly(allyl phenyl ether) (SPAPE) is electrochemically synthesized directly on TiO2 nanotubes in the range of -1.5 to -1.8 V vs. Ag/AgCl. The electrochemical deposition conditions are studied by cyclic voltammetry and chronoamperometry; the polymer formation can be followed by electrochemical impedance spectroscopy. The polymer structure is analyzed by NMR and FTIR spectroscopies, showing the formation of linear aliphatic chains with methyl-oxy-benzene sulfonate side groups. SEM observations of the polymer morphology show that a thin (∼300 nm) and continuous layer is obtained depending on the electrochemical synthesis conditions. The combination of a mobile aliphatic backbone, ether groups with reduced cation affinity and immobile anions grafted on the side chains allows obtaining a single lithium-ion conducting polymer. Half-cell battery tests against Li metal show an excellent cycling performance with high areal capacity (up to 110 μAh cm-2) and very good retention especially at large C-rates, studied up to 12 C.

  19. Morphology-dependent vanadium oxide nanostructures grown on Ti foil for Li-ion battery.

    Science.gov (United States)

    Wei, Lunzhen; Wang, Yuhang; Wang, Yanli; Xu, Ming; Zheng, Gengfeng

    2014-10-15

    Vanadium oxide is considered as a potential cathode material for lithium-ion batteries, while its performance is significantly restricted by its poor Li(+) ion diffusion rate and low electric conductivity. These ion and charge transport rates, however, are also well correlated with the 3-dimensional (3D) morphologies/structures of the electroactive materials. Herein, we synthesized three different nanostructured vanadium oxides on Ti foils. The comparison of electrochemical properties of these materials shows that the structures of electrodes have great influences on their performances. Among these structures, the nanoribbons are most beneficial for fast charge transfer and reduced contact resistance. In addition, the spaces between each nanoribbon provide efficient ion transport pathways and sufficient electrolyte penetration. The initial discharge and charge capacities of vanadium oxide nanoribbon reach to 322 and 310mAhg(-)(1), with a reversible discharge/charge capacity of 200mAhg(-)(1) at the current rate of 1C (1C=300mAg(-)(1)). Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Engineering 2D Nanofluidic Li-Ion Transport Channels for Superior Electrochemical Energy Storage.

    Science.gov (United States)

    Yan, Chunshuang; Lv, Chade; Zhu, Yue; Chen, Gang; Sun, Jingxue; Yu, Guihua

    2017-10-17

    Rational surface engineering of 2D nanoarchitectures-based electrode materials is crucial as it may enable fast ion transport, abundant-surface-controlled energy storage, long-term structural integrity, and high-rate cycling performance. Here we developed the stacked ultrathin Co3 O4 nanosheets with surface functionalization (SUCNs-SF) converted from layered hydroxides with inheritance of included anion groups (OH(-) , NO3(-) , CO3(2-) ). Such stacked structure establishes 2D nanofluidic channels offering extra lithium storage sites, accelerated Li-ion transport, and sufficient buffering space for volume change during electrochemical processes. Tested as an anode material, this unique nanoarchitecture delivers high specific capacity (1230 and 1011 mAh g(-1) at 0.2 and 1 A g(-1) , respectively), excellent rate performance, and long cycle capability (1500 cycles at 5 A g(-1) ). The demonstrated advantageous features by constructing 2D nanochannels in nonlayered materials may open up possibilities for designing high-power lithium ion batteries. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Influence of Electrode Density on the Performance of Li-Ion Batteries: Experimental and Simulation Results

    Directory of Open Access Journals (Sweden)

    Jelle Smekens

    2016-02-01

    Full Text Available Lithium-ion battery (LIB technology further enabled the information revolution by powering smartphones and tablets, allowing these devices an unprecedented performance against reasonable cost. Currently, this battery technology is on the verge of carrying the revolution in road transport and energy storage of renewable energy. However, to fully succeed in the latter, a number of hurdles still need to be taken. Battery performance and lifetime constitute a bottleneck for electric vehicles as well as stationary electric energy storage systems to penetrate the market. Electrochemical battery models are one of the engineering tools which could be used to enhance their performance. These models can help us optimize the cell design and the battery management system. In this study, we evaluate the ability of the Porous Electrode Theory (PET to predict the effect of changing positive electrode density in the overall performance of Li-ion battery cells. It can be concluded that Porous Electrode Theory (PET is capable of predicting the difference in cell performance due to a changing positive electrode density.

  2. Solid state NMR investigation of a novel Li ion ceramic electrolyte. Li doped BPO sub 4

    CERN Document Server

    Dodd, A J

    2002-01-01

    Over the last decade lithium ion conducting batteries have emerged as the leading technology in battery materials. Their performance, however, is limited to applications below around 50 deg C by the liquid nature of the electrolytes used. In the quest for a solid state electrolyte for use in high temperature applications the nano-crystalline ceramic lithium doped boron phosphate material was developed. Solid state nuclear magnetic resonance (NMR) has been employed to investigate some of the fundamental properties of this material including ionic mobility, defect structure, sample purity and ionic distribution. The findings of this work show that when synthesised at a reaction temperature above 600 deg C the loss of boron from the structure results in the incorporation of vacancy sites about which the Li ions gather in small clusters. Multiple-pulse multiple-quantum spin counting techniques are employed in an effort to count the number of quadrupolar sup 7 Li nuclei interacting in a cluster though it is ultima...

  3. Binder Free SnO2-CNT Composite as Anode Material for Li-Ion Battery

    Directory of Open Access Journals (Sweden)

    Dionne Hernandez

    2014-01-01

    Full Text Available Tin dioxide-carbon nanotube (SnO2-CNT composite films were synthesized on copper substrates by a one-step process using hot filament chemical vapor deposition (HFCVD with methane gas (CH4 as the carbon source. The composite structural properties enhance the surface-to-volume ratio of SnO2 demonstrating a desirable electrochemical performance for a lithium-ion battery anode. The SnO2 and CNT interactions were characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, transmission electron microscopy (TEM, Raman spectroscopy, X-ray photoelectron spectroscopy (XPS, and Fourier transform infrared-attenuated total reflectance (ATR-FTIR spectroscopy. Comprehensive analysis of the structural, chemical, and electrochemical properties reveals that the material consists of self-assembled and highly dispersed SnO2 nanoparticles in CNT matrix. The process employed to develop this SnO2-CNT composite film presents a cost effective and facile way to develop anode materials for Li-ion battery technology.

  4. Binder Free Hierarchical Mesoporous Carbon Foam for High Performance Lithium Ion Battery.

    Science.gov (United States)

    Zhou, Zhengping; Zhang, Hua; Zhou, Yan; Qiao, Hui; Gurung, Ashim; Naderi, Roya; Elbohy, Hytham; Smirnova, Alevtina L; Lu, Huitian; Chen, Shuiliang; Qiao, Qiquan

    2017-05-03

    A hierarchical mesoporous carbon foam (ECF) with an interconnected micro-/mesoporous architecture was prepared and used as a binder-free, low-cost, high-performance anode for lithium ion batteries. Due to its high specific surface area (980.6 m2/g), high porosity (99.6%), light weight (5 mg/cm3) and narrow pore size distribution (~2 to 5 nm), the ECF anode exhibited a high reversible specific capacity of 455 mAh/g. Experimental results also demonstrated that the anode thickness significantly influence the specific capacity of the battery. Meanwhile, the ECF anode retained a high rate performance and an excellent cycling performance approaching 100% of its initial capacity over 300 cycles at 0.1 A/g. In addition, no binders, carbon additives or current collectors are added to the ECF based cells that will increase the total weight of devices. The high electrochemical performance was mainly attributed to the combined favorable hierarchical structures which can facilitate the Li+ accessibility and also enable the fast diffusion of electron into the electrode during the charge and discharge process. The synthesis process used to make this elastic carbon foam is readily scalable to industrial applications in energy storage devices such as li-ion battery and supercapacitor.

  5. A study of novel anode material CoS 2 for lithium ion battery

    Science.gov (United States)

    Yan, J. M.; Huang, H. Z.; Zhang, J.; Liu, Z. J.; Yang, Y.

    This paper reports the study of cobalt disulfide as a promising anode material for lithium ion batteries. The crystal structure and surface morphology have been characterized by using X-ray diffraction (XRD), SEM and Brunauer-Emmett-Teller (BET) techniques. The results of XRD show that the sample is a cubic phase with a space group Pa3. The grain size of the sample was 30 μm with a special nano-structured characteristic as observed by means of SEM. Charge-discharge experiments show that the sample with 30 wt.% acetylene black at the current density of 50 mA g -1 has the best performance, it shows that the first discharge capacity is up to 1280 mAh g -1. Ex situ XRD experiments were also carried out to determine the structural changes of delithiated/lithiated anode materials and used to analyze the reaction mechanism. Calculated Gibbs free energy change (Δ rG) and electromotive force (emf, E) values for the reaction CoS 2 + 4Li + + 4e - → Co + 2Li 2S are -146 kJ mol and 1.898 V, respectively. Based on the results, a possible reaction mechanism of CoS 2 anode during intercalation of Li ions was proposed.

  6. Scalable Preparation of Ternary Hierarchical Silicon Oxide-Nickel-Graphite Composites for Lithium-Ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Wang , Jing [School of Materials Science and Engineering, Beijing Key Laboratory of Environmental Science and Engineering, Beijing Institute of Technology, Beijing 100081 China; National Development Center of High Technology Green Materials, Beijing 100081 China; Innovation Center of Electric Vehicles, Beijing 100081 China; Bao, Wurigumula [School of Materials Science and Engineering, Beijing Key Laboratory of Environmental Science and Engineering, Beijing Institute of Technology, Beijing 100081 China; Ma, Lu [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Avenue Lemont Illinois 60439 USA; Tan, Guoqiang [School of Materials Science and Engineering, Beijing Key Laboratory of Environmental Science and Engineering, Beijing Institute of Technology, Beijing 100081 China; Su , Yuefeng [School of Materials Science and Engineering, Beijing Key Laboratory of Environmental Science and Engineering, Beijing Institute of Technology, Beijing 100081 China; National Development Center of High Technology Green Materials, Beijing 100081 China; Innovation Center of Electric Vehicles, Beijing 100081 China; Chen , Shi [School of Materials Science and Engineering, Beijing Key Laboratory of Environmental Science and Engineering, Beijing Institute of Technology, Beijing 100081 China; National Development Center of High Technology Green Materials, Beijing 100081 China; Innovation Center of Electric Vehicles, Beijing 100081 China; Wu , Feng [School of Materials Science and Engineering, Beijing Key Laboratory of Environmental Science and Engineering, Beijing Institute of Technology, Beijing 100081 China; National Development Center of High Technology Green Materials, Beijing 100081 China; Innovation Center of Electric Vehicles, Beijing 100081 China; Lu, Jun [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Avenue Lemont Illinois 60439 USA; Amine, Khalil [Chemical Sciences and Engineering Division, Argonne National Laboratory, 9700 S. Cass Avenue Lemont Illinois 60439 USA

    2015-11-09

    Silicon monoxide is a promising anode candidate because of its high theoretical capacity and good cycle performance. To solve the problems associated with this material, including large volume changes during charge-discharge processes, we report a ternary hierarchical silicon oxide–nickel–graphite composite prepared by a facile two-step ball-milling method. The composite consists of nano-Si dispersed silicon oxides embedded in nano-Ni/graphite matrices (Si@SiOx/Ni/graphite). In the composite, crystalline nano-Si particles are generated by the mechanochemical reduction of SiO by ball milling with Ni. These nano-Si dispersed oxides have abundant electrochemical activity and can provide high Li-ion storage capacity. Furthermore, the milled nano-Ni/graphite matrices stick well to active materials and interconnect to form a crosslinked framework, which functions as an electrical highway and a mechanical backbone so that all silicon oxide particles become electrochemically active. Owing to these advanced structural and electrochemical characteristics, the composite enhances the utilization efficiency of SiO, accommodates its large volume expansion upon cycling, and has good ionic and electronic conductivity. The composite electrodes thus exhibit substantial improvements in electrochemical performance. This ternary hierarchical Si@SiOx/Ni/graphite composite is a promising candidate anode material for high-energy lithium-ion batteries. Additionally, the mechanochemical ball-milling method is low cost and easy to reproduce, indicating potential for the commercial production of the composite materials.

  7. Superconcentrated electrolytes for a high-voltage lithium-ion battery

    Science.gov (United States)

    Wang, Jianhui; Yamada, Yuki; Sodeyama, Keitaro; Chiang, Ching Hua; Tateyama, Yoshitaka; Yamada, Atsuo

    2016-01-01

    Finding a viable electrolyte for next-generation 5 V-class lithium-ion batteries is of primary importance. A long-standing obstacle has been metal-ion dissolution at high voltages. The LiPF6 salt in conventional electrolytes is chemically unstable, which accelerates transition metal dissolution of the electrode material, yet beneficially suppresses oxidative dissolution of the aluminium current collector; replacing LiPF6 with more stable lithium salts may diminish transition metal dissolution but unfortunately encounters severe aluminium oxidation. Here we report an electrolyte design that can solve this dilemma. By mixing a stable lithium salt LiN(SO2F)2 with dimethyl carbonate solvent at extremely high concentrations, we obtain an unusual liquid showing a three-dimensional network of anions and solvent molecules that coordinate strongly to Li+ ions. This simple formulation of superconcentrated LiN(SO2F)2/dimethyl carbonate electrolyte inhibits the dissolution of both aluminium and transition metal at around 5 V, and realizes a high-voltage LiNi0.5Mn1.5O4/graphite battery that exhibits excellent cycling durability, high rate capability and enhanced safety. PMID:27354162

  8. New Lithium-ion Polymer Battery for the Extravehicular Mobility Unit Suit

    Science.gov (United States)

    Jeevarajan, J. A.; Darcy, E. C.

    2004-01-01

    The Extravehicular Mobility Unit (EMU) suit currently has a silver-zinc battery that is 20.5 V and 45 Ah capacity. The EMU's portable life support system (PLSS) will draw power from the battery during the entire period of an EVA. Due to the disadvantages of using the silver-zinc battery in terms of cost and performance, a new high energy density battery is being developed for future use, The new battery (Lithium-ion battery or LIB) will consist of Li-ion polymer cells that will provide power to the EMU suit. The battery design consists of five 8 Ah cells in parallel to form a single module of 40 Ah and five such modules will be placed in series to give a 20.5 V, 40 Ah battery. Charging will be accomplished on the Shuttle or Station using the new LIB charger or the existing ALPS (Air Lock Power Supply) charger. The LIB delivers a maximum of 3.8 A on the average, for seven continuous hours, at voltages ranging from 20.5 V to 16.0 V and it should be capable of supporting transient pulses during start up and once every hour to support PLSS fan and pump operation. Figure 1 shows the placement of the battery in the backpack area of the EMU suit. The battery and cells will undergo testing under different conditions to understand its performance and safety characteristics.

  9. High-loading Fe2O3/SWNT composite films for lithium-ion battery applications

    Science.gov (United States)

    Wang, Ying; Guo, Jiahui; Li, Li; Ge, Yali; Li, Baojun; Zhang, Yingjiu; Shang, Yuanyuan; Cao, Anyuan

    2017-08-01

    Single-walled carbon nanotube (SWNT) films are a potential candidate as porous conductive electrodes for energy conversion and storage; tailoring the loading and distribution of active materials grafted on SWNTs is critical for achieving maximum performance. Here, we show that as-synthesized SWNT samples containing residual Fe catalyst can be directly converted to Fe2O3/SWNT composite films by thermal annealing in air. The mass loading of Fe2O3 nanoparticles is tunable from 63 wt% up to 96 wt%, depending on the annealing temperature (from 450 °C to 600 °C), while maintaining the porous network structure. Interconnected SWNT networks containing high-loading active oxides lead to synergistic effect as an anode material for lithium ion batteries. The performance is improved consistently with increasing Fe2O3 loading. As a result, our Fe2O3/SWNT composite films exhibit a high reversible capacity (1007.1 mA h g-1 at a current density of 200 mA g-1), excellent rate capability (384.9 mA h g-1 at 5 A g-1) and stable cycling performance with the discharge capacity up to 567.1 mA h g-1 after 600 cycles at 2 A g-1. The high-loading Fe2O3/SWNT composite films have potential applications as nanostructured electrodes for various energy devices such as supercapacitors and Li-ion batteries.

  10. Synthesis of dual porous structured germanium anodes with exceptional lithium-ion storage performance

    Science.gov (United States)

    Kwon, Dohyoung; Ryu, Jaegeon; Shin, Myungsoo; Song, Gyujin; Hong, Dongki; Kim, Kwang S.; Park, Soojin

    2018-01-01

    Dual-porous Ge nanostructures are synthesized via two straightforward steps. Compared with conventional approaches related to porous Ge materials, different types of pores can be readily generated by adjusting the relative ratio of the precursor amounts for GeO2 and SiO2. Unlike using hard templates with different sizes for introducing secondary pores, this system makes a uniformly blended structure of porogen and active sites in the nanoscale range. When GeO2 is subjected to zincothermic reduction, it is selectively converted to pure Ge still connected to unreacted SiO2. During the reduction process, primary pores (larger than 50 nm) are formed by eliminating zinc oxide by-products, while inactive SiO2 with respect to zinc metal could contribute to retaining the overall structure. Finally, the HF treatment completely leaches remaining SiO2 and formed secondary pores (micro/mesopores) to complete the dual-porous Ge structure. The resulting Ge structure is tested as an anode material for lithium-ion batteries. The Ge electrode exhibits an outstanding reversibility and an exceptional cycling stability corresponding to a capacity retention of 100% after 100 cycles at C/5 and of 94.4% after 300 cycles at C/2. Furthermore, multi-scale pores facilitate a facile Li-ion accessibility, resulting in an excellent rate capability delivering ∼740 mAh g-1 at 5C.

  11. Electrospun montmorillonite modified poly(vinylidene fluoride) nanocomposite separators for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Changjiang; Yang, Shuli; Zhao, Xinfei [College of Materials and Textile, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Du, Pingfan, E-mail: dupf@zstu.edu.cn [College of Materials and Textile, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Key Laboratory of Advanced Textile Materials and Manufacturing Technology (Ministry of Education), Zhejiang Sci-Tech University, Hangzhou 310018 (China); Xiong, Jie, E-mail: jxiong@zstu.edu.cn [College of Materials and Textile, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Key Laboratory of Advanced Textile Materials and Manufacturing Technology (Ministry of Education), Zhejiang Sci-Tech University, Hangzhou 310018 (China)

    2016-07-15

    Highlights: • Composite separators of PVDF and MMT for lithium-ion batteries were electrospun. • Thermal dimensional stability and tensile property of composite separators get improved. • Presence of montmorillonite promotes electrical properties of PVDF fibrous separators. • Batteries consisting of PVDF/MMT-5% separator achieve the best performance. - Abstract: Composite separators of poly(vinylidene fluoride) (PVDF) with different contents of montmorillonite (MMT) for Li-ion batteries have been fabricated by electrospinning. The morphology, function group, crystallinity, and mechanical properties of membranes were investigated by scanning electron microscope (SEM), Fourier Transform infrared spectra (FT-IR), differential scanning calorimetry (DSC), and tensile test, respectively. Interlayer spacing of MMT in polymer was characterized by X-ray diffraction (XRD). In addition, the results of electrochemical measurements suggest that PVDF/MMT-5% composite membrane has maximum ionic conductivity of 4.2 mS cm{sup −1}, minimum interfacial resistance of 97 Ω, and excellent electrochemical stability. The cell comprising PVDF/MMT-5% composite membrane shows higher capacity and more stable cycle performance than the one using commercial Celgard PP membrane.

  12. Fuzzy logic modeling of EIS measurements on lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Pritpal [ECE Department, Villanova University, Villanova, PA 19085 (United States)]. E-mail: singh@ece.vill.edu; Vinjamuri, Ramana [ECE Department, Villanova University, Villanova, PA 19085 (United States); Wang, Xiquan [US Nanocorp, Inc., 74 Batterson Park Rd., Farmington, CT 06032 (United States); Reisner, David [US Nanocorp , Inc., 74 Batterson Park Rd., Farmington, CT 06032 (United States)

    2006-01-20

    A fuzzy logic-based state of health (SOH) meter is being developed for lithium-ion (Li-ion) batteries for potential use in portable defibrillators. Electrochemical impedance spectroscopy (EIS) measurements have been made from which input parameters for a fuzzy logic model to estimate the state of charge (SOC) and SOH are derived. The batteries are discharged continuously at a 1.4 A load current to simulate the constant current draw during the monitoring and recording of a patient's EKG, and periodically interrupted by 10 A pulses to simulate the battery discharge to charge up the capacitor that is in turn discharged to supply high voltage to the electrodes for the defibrillation of the patient. The test procedures included both voltage recovery and EIS measurements, and were made as the batteries were being discharged and over 30 charge/discharge cycles. Accurate models have been developed to estimate the number of pulses that the battery pack can deliver at various stages of its cycle life (SOC measure) and the number of charge/discharge cycles (SOH measure) that it had undergone.

  13. Nanomaterials for lithium-ion rechargeable batteries.

    Science.gov (United States)

    Liu, Hua Kun; Wang, Guo Xiu; Guo, Zaiping; Wang, Jiazhao; Konstantinov, Kosta

    2006-01-01

    In lithium-ion batteries, nanocrystalline intermetallic alloys, nanosized composite materials, carbon nanotubes, and nanosized transition-metal oxides are all promising new anode materials, while nanosized LiCoO2, LiFePO4, LiMn2O4, and LiMn2O4 show higher capacity and better cycle life as cathode materials than their usual larger-particle equivalents. The addition of nanosized metal-oxide powders to polymer electrolyte improves the performance of the polymer electrolyte for all solid-state lithium rechargeable batteries. To meet the challenge of global warming, a new generation of lithium rechargeable batteries with excellent safety, reliability, and cycling life is needed, i.e., not only for applications in consumer electronics, but especially for clean energy storage and for use in hybrid electric vehicles and aerospace. Nanomaterials and nanotechnologies can lead to a new generation of lithium secondary batteries. The aim of this paper is to review the recent developments on nanomaterials and nanotechniques used for anode, cathode, and electrolyte materials, the impact of nanomaterials on the performance of lithium batteries, and the modes of action of the nanomaterials in lithium rechargeable batteries.

  14. Overview And In-Orbit Behavior Of The First Lithium-Ion Batteries Used Onboard Eutelsat W3A Geo Telecommunications Satellite

    Science.gov (United States)

    Mattesco, Patrick; Peiro, Philippe; Thakur, Vijay; Borthomieu, Yannick

    2011-10-01

    The Lithium-ion (Li-ion) battery has been perceived several years ago by Astrium as a very promising technology in terms of technical, industrial and cost aspects for its Eurostar E3000 platform dedicated to telecommunications satellite for payload power from 5 up to 18 kW. One of the main advantages of such energy storage technology is the capacity to deliver very high power and energy density with quite low dissipation when compared to the other qualified technologies. On March 16, 2004, a Proton Launcher placed successfully into orbit the W3A spacecraft for Eutelsat (first Eurostar E3000 satellite equipped with Li-ion batteries). This was the achievement of the work, initiated with the support of ESA and CNES in 1996 with Stentor program. In 2011, 25 Li-ion batteries are in orbit on 15 Eurostar E3000 satellites. This paper is an update of the one presented at the Seventh European Space Power Conference in 2005 [1]. First part is a recall of the battery development, battery design, and battery management during system tests and pre-launch phases. In the second part, the seven years behaviour in orbit for the two W3A lithium batteries is provided (less than one year in orbit data was available at the time of [1]).

  15. Coexistence of conversion and intercalation mechanisms in lithium ion batteries. Consequences for microstructure and interaction between the active material and electrolyte

    Energy Technology Data Exchange (ETDEWEB)

    Adam, Robert [TU Bergakademie, Freiberg (Germany). Inst. of Materials Science; Lepple, Maren [Karlsruhe Institute of Technology (KIT), Eggenstein-Leopoldshafen (Germany). Inst. for Applied Materials - Applied Materials Physics (IAM-AWP); Technische Univ. Darmstadt (Germany). Eduard-Zintl-Inst. fuer Anorganische und Physikalische Chemie; Mayer, Nicolas A. [Karlsruhe Institute of Technology (KIT), Eggenstein-Leopoldshafen (Germany). Inst. for Applied Materials - Applied Materials Physics (IAM-AWP); and others

    2017-11-15

    Conversion-type lithium ion batteries experience severe and partly irreversible phase transitions during operation. Such phase transitions reduce the crystallite size and therefore enhance the exchange of the Li ions. Concurrently, the irreversible nature of the phase transitions may deteriorate the cycling stability and the long-term capacity of conversion-type batteries. In this contribution, the observed correlations between the crystal structures of compounds which are employed as anodes in conversion-type Li ion cells, the capacity and the long-term stability of these cells are discussed. The central characteristics affecting the performance of conversion-type Li ion cells seem to be the similarity of crystal structures of intermediately forming phases during the charge/discharge process, which facilitates strong local preferred orientation of nanocrystallites of neighboring phases and for the formation of local strain fields at partially coherent phase boundaries. The effect of the above-mentioned phenomena on capacity and cycle stability is argued from the point of view of a possibly impeded ion exchange. Equilibrium open circuit potentials are calculated using the CALPHAD method. However, it is shown that in order to better reproduce the experimentally determined plateau voltages, thermodynamic descriptions of the non-equilibrium intermediate phases have to be included. In addition, the stabilization of the conversion reaction by the electrolyte is pointed out.

  16. Nb-based MXenes for Li-ion battery applications

    KAUST Repository

    Zhu, Jiajie

    2015-11-16

    Li-ion batteries depend critically on the stability and capacity of the electrodes. In this respect the recently synthesized two-dimensional MXenes are promising materials, as they combine an excellent Li-ion capacity with very high charging rates. We employ density functional theory to investigate the impact of Li adsorption on the structural and electronic properties of monolayer Nb2C and Nb2CX2. The Li ions are predicted to migrate easily on the pristine MXene due to a diffusion barrier of only 36 meV, whereas larger diffusion barriers are obtained for the functionalized MXenes.

  17. Dicty_cDB: VHP548 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP548 (Link to dictyBase) - - - Contig-U15722-1 VHP548P (Link... to Original site) VHP548F 634 VHP548Z 937 VHP548P 1551 - - Show VHP548 Library VH (Link to library) Clone ID VHP548 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...XTMPIMNILGNGCEFTRCPLDCSTPNGTCDNNTGNCTCHNEH FGNSCEFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSG ICTC... ---LFDPPMVLGNNNTGNXTMPIMNILGNGCEFTRCPLDCSTPNGTCDNNTGNCTCHNEH FGNSCEFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSG ICT

  18. Lithium-ion Energy Storage at Very Low Temperatures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Li-ion batteries with specific energy >180 Wh/kg, calendar life (>15years), and a wide operating temperature range (-60oC to 60oC) are crucial for the...

  19. Thermal Stability of Li-Ion Cells

    Energy Technology Data Exchange (ETDEWEB)

    ROTH,EMANUEL P.

    1999-09-17

    The thermal stability of Li-ion cells with intercalating carbon anodes and metal oxide cathodes was measured as a function of state of charge and temperature for two advanced cell chemistries. Cells of the 18650 design with Li{sub x}CoO{sub 2} cathodes (commercial SONY cells) and Li{sub x}Ni{sub 0.8}Co{sub 0.2}O{sub 2} cathodes were measured for thermal reactivity in the open circuit cell condition. Accelerating rate calorimetry (ARC) was used to measure cell thermal runaway as a function of state of charge (SOC). Microcalorimetry was used to measure the time dependence of heat generating side reactions also as a function of SOC. Components of cells were measured using differential scanning calorimetry (DSC) to study the thermal reactivity of the individual electrodes to determine the temperature regimes and conditions of the major thermal reactions. Thermal decomposition of the SEI layer at the anodes was identified as the initiating source for thermal runaway. The cells with Li{sub x}CoO{sub 2} cathodes showed greater sensitivity to SOC and higher accelerating heating rates than seen for the cells with Li{sub x}Ni{sub 0.8}Co{sub 0.2}O{sub 2}cathodes. Lower temperature reactions starting as low as 40 C were also observed that were SOC dependent but not accelerating. These reactions were also measured in the microcalorimeter and observed to decay over time with a power-law dependence and are believed to result in irreversible capacity loss in the cells.

  20. High Capacity Nano-Composite Cathodes for Human-Rated Lithium-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Non-incremental improvements are necessary in lithium-ion batteries order to meet future space applications demands such as NASA's call for lithium-ion battery...

  1. Applications of Carbon Nanotubes for Lithium Ion Battery Anodes

    Directory of Open Access Journals (Sweden)

    Hyoung-Joon Jin

    2013-03-01

    Full Text Available Carbon nanotubes (CNTs have displayed great potential as anode materials for lithium ion batteries (LIBs due to their unique structural, mechanical, and electrical properties. The measured reversible lithium ion capacities of CNT-based anodes are considerably improved compared to the conventional graphite-based anodes. Additionally, the opened structure and enriched chirality of CNTs can help to improve the capacity and electrical transport in CNT-based LIBs. Therefore, the modification of CNTs and design of CNT structure provide strategies for improving the performance of CNT-based anodes. CNTs could also be assembled into free-standing electrodes without any binder or current collector, which will lead to increased specific energy density for the overall battery design. In this review, we discuss the mechanism of lithium ion intercalation and diffusion in CNTs, and the influence of different structures and morphologies on their performance as anode materials for LIBs.

  2. Factor affecting the capacity retention of lithium-ion cells

    Science.gov (United States)

    Ohzuku, Tsutomu; Ueda, Atsushi; Yamamoto, Norihiro; Iwakoshi, Yasunobu

    Capacity failure due to the imbalance of coulombic efficiencies between positive and negative electrodes in a lithium-ion (shuttlecock) cell was examined by fabricating two types of cells, i.e., Li[Li 1/3Ti 5/3]O 4/LiNiO 2 and carbon/LiNiO 2. Rechargeable capacity of a lithium-ion cell consisting of Li[Li 1/3Ti 5/3]O 4 and LiNiO 2 faded more rapidly than that of a cell based on natural graphite and LiNiO 2 in spite of superior coulombic efficiency of Li[Li 1/3Ti 5/3]O 4 (very close to 100%) compared with that of natural graphite (about 98%). The important role of the electrolyte upon the capacity retention of lithium-ion cells is described and specific problems to extend cycle life are discussed.

  3. Applications of Carbon Nanotubes for Lithium Ion Battery Anodes

    Science.gov (United States)

    Xiong, Zhili; Yun, Young Soo; Jin, Hyoung-Joon

    2013-01-01

    Carbon nanotubes (CNTs) have displayed great potential as anode materials for lithium ion batteries (LIBs) due to their unique structural, mechanical, and electrical properties. The measured reversible lithium ion capacities of CNT-based anodes are considerably improved compared to the conventional graphite-based anodes. Additionally, the opened structure and enriched chirality of CNTs can help to improve the capacity and electrical transport in CNT-based LIBs. Therefore, the modification of CNTs and design of CNT structure provide strategies for improving the performance of CNT-based anodes. CNTs could also be assembled into free-standing electrodes without any binder or current collector, which will lead to increased specific energy density for the overall battery design. In this review, we discuss the mechanism of lithium ion intercalation and diffusion in CNTs, and the influence of different structures and morphologies on their performance as anode materials for LIBs. PMID:28809361

  4. Saft Electrochemical Lithium-Ion Model (SLIM)

    Science.gov (United States)

    Borthomieu, Y.; Prevot, D.; Masgrangeas, D.

    2008-09-01

    In the last 5 years, Saft has developed a life prediction model for VES and MPS cells. The Saft Li-Ion Model (SLIM) is a macroscopic electrochemical model based on energy (global at cell level). The main purpose is to predict the cell performances during the life for GEO, MEO and LEO missions. This model is based on electrochemical characteristics such as Energy, Capacity, EMF, Internal resistance, end of charge voltage. It uses fading and calendar law effects on energy and internal impedance vs. time, temperature, End of Charge voltage. The degradation mechanisms at electrode levels have been set up based on the Destructive Physical Analyses that were focused on the electrochemical changes. Heavy analysis methods have been used to characterize shrewdly the particles modification.The model is also able to provide the battery performances using mission figures and profiles: power, duration, DOD, end of charge voltages, temperatures during eclipses and solstices, cell failures. The main outputs are the cell and battery voltage profiles, energy evolution through the life time (nominal and failed cases) see figure 1. This model has been correlated with existing life and calendar tests performed on VES140, VES180 and MPS cells. The accuracy of the model from voltage point of view is less than 10 mV at End Of Life. In addition, the comparison with in-orbit data has been also successfully achieved.So, the paper will present the definition of the key electrochemical laws implemented within the SLIM model. In addition, the validation of the modeled ageing mechanism through life tests, Destructive Physical Analyses and in-orbit results will be described. Finally it will be presented the accuracy of the model versus the cycling results.

  5. Electrolyte Suitable for Use in a Lithium Ion Cell or Battery

    Science.gov (United States)

    McDonald, Robert C. (Inventor)

    2014-01-01

    Electrolyte suitable for use in a lithium ion cell or battery. According to one embodiment, the electrolyte includes a fluorinated lithium ion salt and a solvent system that solvates lithium ions and that yields a high dielectric constant, a low viscosity and a high flashpoint. In one embodiment, the solvent system includes a mixture of an aprotic lithium ion solvating solvent and an aprotic fluorinated solvent.

  6. Non-aqueous electrolytes for lithium ion batteries

    Science.gov (United States)

    Chen, Zonghai; Amine, Khalil

    2015-11-12

    The present invention is generally related to electrolytes containing anion receptor additives to enhance the power capability of lithium-ion batteries. The anion receptor of the present invention is a Lewis acid that can help to dissolve LiF in the passivation films of lithium-ion batteries. Accordingly, one aspect the invention provides electrolytes comprising a lithium salt; a polar aprotic solvent; and an anion receptor additive; and wherein the electrolyte solution is substantially non-aqueous. Further there are provided electrochemical devices employing the electrolyte and methods of making the electrolyte.

  7. Nanomaterials for lithium-ion batteries fundamentals and applications

    CERN Document Server

    Yazami, Rachid

    2013-01-01

    ""The book has good technical depth, yet is still very readable. It contains many photos, illustrations, tables, and graphs of data that provide the reader with the insight needed to understand the phenomena being described and the processes occurring in lithium battery chemistry. Researchers as well as students studying lithium-ion batteries will find this book well worth reading. It provides insight into many different avenues for potentially improving lithium-ion battery performance. The reader will learn about these new ideas and gain a better understanding of what currently limits batt

  8. Optimized Li-Ion Electrolytes Containing Fluorinated Ester Co-Solvents

    Science.gov (United States)

    Prakash, G. K. Surya; Smart, Marshall; Smith, Kiah; Bugga, Ratnakumar

    2010-01-01

    A number of experimental lithium-ion cells, consisting of MCMB (meso-carbon microbeads) carbon anodes and LiNi(0.8)Co(0.2)O2 cathodes, have been fabricated with increased safety and expanded capability. These cells serve to verify and demonstrate the reversibility, low-temperature performance, and electrochemical aspects of each electrode as determined from a number of electrochemical characterization techniques. A number of Li-ion electrolytes possessing fluorinated ester co-solvents, namely trifluoroethyl butyrate (TFEB) and trifluoroethyl propionate (TFEP), were demonstrated to deliver good performance over a wide temperature range in experimental lithium-ion cells. The general approach taken in the development of these electrolyte formulations is to optimize the type and composition of the co-solvents in ternary and quaternary solutions, focusing upon adequate stability [i.e., EC (ethylene carbonate) content needed for anode passivation, and EMC (ethyl methyl carbonate) content needed for lowering the viscosity and widening the temperature range, while still providing good stability], enhancing the inherent safety characteristics (incorporation of fluorinated esters), and widening the temperature range of operation (the use of both fluorinated and non-fluorinated esters). Further - more, the use of electrolyte additives, such as VC (vinylene carbonate) [solid electrolyte interface (SEI) promoter] and DMAc (thermal stabilizing additive), provide enhanced high-temperature life characteristics. Multi-component electrolyte formulations enhance performance over a temperature range of -60 to +60 C. With the need for more safety with the use of these batteries, flammability was a consideration. One of the solvents investigated, TFEB, had the best performance with improved low-temperature capability and high-temperature resilience. This work optimized the use of TFEB as a co-solvent by developing the multi-component electrolytes, which also contain non

  9. New lithium-ion conducting perovskite oxides related to (Li, La)TiO3

    Indian Academy of Sciences (India)

    Unknown

    work on lithium-ion conducting perovskite oxides containing d0 cations. Keywords. Lithium ion conductors; lithium–lanthanum perovskites; lithium– lanthanum titanates. 1. Introduction. There is a continuous search for new materials exhibiting high lithium ion conductivity in view of their potential technological application as ...

  10. Recent advances in first principles computational research of cathode materials for lithium-ion batteries.

    Science.gov (United States)

    Meng, Ying Shirley; Arroyo-de Dompablo, M Elena

    2013-05-21

    To meet the increasing demands of energy storage, particularly for transportation applications such as plug-in hybrid electric vehicles, researchers will need to develop improved lithium-ion battery electrode materials that exhibit high energy density, high power, better safety, and longer cycle life. The acceleration of materials discovery, synthesis, and optimization will benefit from the combination of both experimental and computational methods. First principles (ab Initio) computational methods have been widely used in materials science and can play an important role in accelerating the development and optimization of new energy storage materials. These methods can prescreen previously unknown compounds and can explain complex phenomena observed with these compounds. Intercalation compounds, where Li(+) ions insert into the host structure without causing significant rearrangement of the original structure, have served as the workhorse for lithium ion rechargeable battery electrodes. Intercalation compounds will also facilitate the development of new battery chemistries such as sodium-ion batteries. During the electrochemical discharge reaction process, the intercalating species travel from the negative to the positive electrode, driving the transition metal ion in the positive electrode to a lower oxidation state, which delivers useful current. Many materials properties change as a function of the intercalating species concentrations (at different state of charge). Therefore, researchers will need to understand and control these dynamic changes to optimize the electrochemical performance of the cell. In this Account, we focus on first-principles computational investigations toward understanding, controlling, and improving the intrinsic properties of five well known high energy density Li intercalation electrode materials: layered oxides (LiMO2), spinel oxides (LiM2O4), olivine phosphates (LiMPO4), silicates-Li2MSiO4, and the tavorite-LiM(XO4)F (M = 3d

  11. Li ion conductivities in boro-tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Lithium ion conductivity has been investigated in a boro-tellurite glass system, LiCl⋅LiBO2⋅TeO2. In the absence of LiCl, the conductivity increases with increasing non-bridging oxygen (NBO) concentration. LiCl addition has little influence on total conductivity although the observed barriers are low. Formation of.

  12. Synthesis, Structure, and Li-Ion Conductivity of LiLa(BH4)3X, X = Cl, Br, I

    DEFF Research Database (Denmark)

    GharibDoust, Seyed Hosein Payandeh; Brighi, Matteo; Sadikin, Yolanda

    2017-01-01

    )3Br, 7.74 × 10-5 S/cm at room temperature (RT) and 1.8 × 10-3 S/cm at 140°C with an activation energy of 0.272 eV. Topological analysis suggests a new lithium ion conduction pathway with two new different types of bottleneck windows. The sizes of these windows reveal an opposite size change......In this work, a new type of addition reaction between La(BH4)3 and LiX, X = Cl, Br, I, is used to synthesize LiLa(BH4)3Cl and two new compounds LiLa(BH4)3X, X = Br, I. This method increases the amounts of LiLa(BH4)3X and the sample purity. The highest Li-ion conductivity is observed for LiLa(BH4...

  13. Mesocarbon Microbead Carbon-Supported Magnesium Hydroxide Nanoparticles: Turning Spent Li-ion Battery Anode into a Highly Efficient Phosphate Adsorbent for Wastewater Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yan; Guo, Xingming; Wu, Feng; Yao, Ying; Yuan, Yifei; Bi, Xuanxuan; Luo, Xiangyi; Shahbazian-Yassar, Reza; Zhang, Cunzhong; Amine, Khalil

    2016-08-24

    Phosphorus in water eutrophication has become a serious problem threatening the environment. However, the development of efficient adsorbents for phosphate removal from water is lagging. In this work, we recovered the waste material, graphitized carbon, from spent lithium ion batteries and modified it with nanostructured Mg(OH)2 on the surface to treat excess phosphate. This phosphate adsorbent shows one of the highest phosphate adsorption capacities to date, 588.4 mg/g (1 order of magnitude higher than previously reported carbon-based adsorbents), and exhibits decent stability. A heterogeneous multilayer adsorption mechanism was proposed on the basis of multiple adsorption results. This highly efficient adsorbent from spent Li-ion batteries displays great potential to be utilized in industry, and the mechanism study paved a way for further design of the adsorbent for phosphate adsorption.

  14. Mesocarbon Microbead Carbon-Supported Magnesium Hydroxide Nanoparticles: Turning Spent Li-ion Battery Anode into a Highly Efficient Phosphate Adsorbent for Wastewater Treatment.

    Science.gov (United States)

    Zhang, Yan; Guo, Xingming; Wu, Feng; Yao, Ying; Yuan, Yifei; Bi, Xuanxuan; Luo, Xiangyi; Shahbazian-Yassar, Reza; Zhang, Cunzhong; Amine, Khalil

    2016-08-24

    Phosphorus in water eutrophication has become a serious problem threatening the environment. However, the development of efficient adsorbents for phosphate removal from water is lagging. In this work, we recovered the waste material, graphitized carbon, from spent lithium ion batteries and modified it with nanostructured Mg(OH)2 on the surface to treat excess phosphate. This phosphate adsorbent shows one of the highest phosphate adsorption capacities to date, 588.4 mg/g (1 order of magnitude higher than previously reported carbon-based adsorbents), and exhibits decent stability. A heterogeneous multilayer adsorption mechanism was proposed on the basis of multiple adsorption results. This highly efficient adsorbent from spent Li-ion batteries displays great potential to be utilized in industry, and the mechanism study paved a way for further design of the adsorbent for phosphate adsorption.

  15. Fabrication of hierarchically branched SnO2 nanowires by two-step deposition method and their applications to electrocatalyst support and Li ion electrode

    Science.gov (United States)

    Lee, Sang Ho; Jo, Yong-Ryun; Noh, Yuseong; Kim, Bong-Joong; Kim, Won Bae

    2017-11-01

    This paper reports hierarchically branched structures of tin dioxide nanowires for use in electrochemical energy conversion and storage electrode systems. The shallow tin dioxide branches are epitaxially grown on the tin dioxide nanowire backbones that are directly formed on current collectors. The branched tin dioxide nanowires are applied as anode electrodes for lithium-ion batteries, while palladium-incorporated branched nanowires are utilized as electrocatalysts for ethanol electrooxidation reactions. The structural benefits of these hierarchical platforms, such as enlarged electrochemical active surface area, void space formed between the branched structures, and conformal contact of the electroactive materials with current collectors, play important roles in improving the electrochemical Li-ion storage as well as electrocatalytic activity.

  16. Freestanding rGO-SWNT-STN Composite Film as an Anode for Li Ion Batteries with High Energy and Power Densities

    Directory of Open Access Journals (Sweden)

    Taeseup Song

    2015-12-01

    Full Text Available Freestanding Si-Ti-Ni alloy particles/reduced graphene oxide/single wall carbon nanotube composites have been prepared as an anode for lithium ion batteries via a simple filtration method. This composite electrode showed a 9% increase in reversible capacity, a two-fold higher cycle retention at 50 cycles and a two-fold higher rate capability at 2 C compared to pristine Si-Ti-Ni (STN alloy electrodes. These improvements were attributed to the suppression of the pulverization of the STN active material by the excellent mechanical properties of the reduced graphene oxide-single wall carbon nanotube networks and the enhanced kinetics associated with both electron and Li ion transport.

  17. An efficient route to Cu{sub 2}O nanorod array film for high-performance Li-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yumei; Wang, Kun; Yang, Zeheng, E-mail: zehengyang@hfut.edu.cn; Zhang, Yingmeng; Gu, Heyun; Zhang, Weixin; Li, Errui; Zhou, Chen

    2016-06-01

    Fabrication of well-organized one-dimensional nanostructured arrays on conducting substrates as binder free electrodes allows us to synergize and integrate multi-functionalities into lithium ion batteries. In this contribution, we report a metal-induced thermal reduction (MITR) method to prepare free-standing Cu{sub 2}O nanorod array film with average diameters of 400 ± 100 nm and lengths of several microns on copper substrates by direct thermal reduction of Cu(OH){sub 2} nanorod arrays on copper foils in nitrogen atmosphere at 500 °C. The presence of Cu substrates reduces the Cu(OH){sub 2} to Cu{sub 2}O and decreases the reduction temperature significantly through changing the reaction Gibbs energy. Compared with some previously-reported methods about thermal reduction, the MITR method is facile, controllable, efficient and low energy consumption. The free-standing Cu{sub 2}O nanorod array film on Cu substrates as anode can achieve high rate capability (315 mAh g{sup −1} at 10 C) and good cyclability (358 mAh g{sup −1} after 200 cycles at 1 C), demonstrating their excellent electrochemical performance in lithium ion batteries, which results from relatively faster electron and ion transport, easier electrolyte diffusion and better accommodation of strains from the repeated conversion reactions based on their one-dimensional nanostructured arrays. - Highlights: • A metal-induced thermal reduction method was used to prepare Cu{sub 2}O nanorod array film. • Copper substrate takes an important part in the conversion of Cu(OH){sub 2} to Cu{sub 2}O. • The Cu{sub 2}O films show excellent electrochemical properties as anode for Li-ion battery.

  18. Computational Studies of Thermodynamics and Kinetics of Metal Oxides in Li-Ion Batteries and Earth's Lower Mantle Materials

    Science.gov (United States)

    Xu, Shenzhen

    Metal oxide materials are ubiquitous in nature and in our daily lives. For example, the Earth's mantle layer that makes up about 80% of our Earth's volume is composed of metal oxide materials, the cathode materials in the lithium-ion batteries that provide power for most of our mobile electronic devices are composed of metal oxides, the chemical components of the passivation layers on many kinds of metal materials that protect the metal from further corrosion are metal oxides. This thesis is composed of two major topics about the metal oxide materials in nature. The first topic is about our computational study of the iron chemistry in the Earth's lower mantle metal oxide materials, i.e. the bridgmanite (Fe-bearing MgSiO3 where iron is the substitution impurity element) and the ferropericlase (Fe-bearing MgO where iron is the substitution impurity element). The second topic is about our multiscale modeling works for understanding the nanoscale kinetic and thermodynamic properties of the metal oxide cathode interfaces in Li-ion batteries, including the intrinsic cathode interfaces (intergrowth of multiple types of cathode materials, compositional gradient cathode materials, etc.), the cathode/coating interface systems and the cathode/electrolyte interface systems. This thesis uses models based on density functional theory quantum mechanical calculations to explore the underlying physics behind several types of metal oxide materials existing in the interior of the Earth or used in the applications of lithium-ion batteries. The exploration of this physics can help us better understand the geochemical and seismic properties of our Earth and inspire us to engineer the next generation of electrochemical technologies.

  19. LiSICON-Ionic Liquid Electrolyte for Lithium Ion Battery

    Science.gov (United States)

    2011-08-15

    SBR) and carboxymethyl cellulose ( CMC ). The reversible capacity of the electrode is 330mAh g -1 . Half-cells were constructed to be used in charge...UNCLASSIFIED UNCLASSIFIED Conclusion A lithium ion anode battery design incorporating a ceramic membrane was investigated. In order for the

  20. Organometallic-inorganic hybrid electrodes for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Qian; Lemmon, John P.; Choi, Daiwon; Cosimbescu, Lelia

    2016-09-13

    Disclosed are embodiments of active materials for organometallic and organometallic-inorganic hybrid electrodes and particularly active materials for organometallic and organometallic-inorganic hybrid cathodes for lithium-ion batteries. In certain embodiments the organometallic material comprises a ferrocene polymer.

  1. Electrolytes for Wide Operating Temperature Lithium-Ion Cells

    Science.gov (United States)

    Smart, Marshall C. (Inventor); Bugga, Ratnakumar V. (Inventor)

    2016-01-01

    Provided herein are electrolytes for lithium-ion electrochemical cells, electrochemical cells employing the electrolytes, methods of making the electrochemical cells and methods of using the electrochemical cells over a wide temperature range. Included are electrolyte compositions comprising a lithium salt, a cyclic carbonate, a non-cyclic carbonate, and a linear ester and optionally comprising one or more additives.

  2. Lithium ion conducting solid polymer blend electrolyte based on bio ...

    Indian Academy of Sciences (India)

    Lithium ion conducting polymer blend electrolyte films based on poly(vinyl alcohol) (PVA) and poly(vinyl pyrrolidone) (PVP) with different Mwt% of lithium nitrate (LiNO3) salt, using a solution cast technique, have been prepared. The polymer blend electrolyte has been characterized by XRD, FTIR, DSC and impedance ...

  3. Role of Disorder in Enhancing Lithium-Ion Battery Performance

    DEFF Research Database (Denmark)

    Yue, Yuanzheng; He, W.

    and type of disorder, material performances can be significantly enhanced. Disorder can be tuned by doping, calcination, redox reaction, composition tuning, and so on. Recently we have fabricated a cathode material for lithium ion battery by introducing heterostructure and disorder into the material...

  4. Non-aqueous electrolyte for lithium-ion battery

    Science.gov (United States)

    Zhang, Lu; Zhang, Zhengcheng; Amine, Khalil

    2014-04-15

    The present technology relates to stabilizing additives and electrolytes containing the same for use in electrochemical devices such as lithium ion batteries and capacitors. The stabilizing additives include triazinane triones and bicyclic compounds comprising succinic anhydride, such as compounds of Formulas I and II described herein.

  5. Lithium-ion battery materials and engineering current topics and problems from the manufacturing perspective

    CERN Document Server

    Gulbinska, Malgorzata K

    2014-01-01

    Gaining public attention due, in part,  to their potential application as energy storage devices in cars, Lithium-ion batteries have encountered widespread demand, however, the understanding of lithium-ion technology has often lagged behind production. This book defines the most commonly encountered challenges from the perspective of a high-end lithium-ion manufacturer with two decades of experience with lithium-ion batteries and over six decades of experience with batteries of other chemistries. Authors with years of experience in the applied science and engineering of lithium-ion batterie

  6. Spinel-structured surface layers for facile Li ion transport and improved chemical stability of lithium manganese oxide spinel

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hae Ri [Center for Energy Convergence Research, Korea Institute of Science Technology, Hwarang-ro 14-gil 5, Seongbuk-gu, Seoul 136-791 (Korea, Republic of); Department of Chemical and Biological Engineering, Korea University, 145, Anam-ro, Seongbuk-gu, Seoul 136-701 (Korea, Republic of); Seo, Hyo Ree; Lee, Boeun; Cho, Byung Won [Center for Energy Convergence Research, Korea Institute of Science Technology, Hwarang-ro 14-gil 5, Seongbuk-gu, Seoul 136-791 (Korea, Republic of); Lee, Kwan-Young [Department of Chemical and Biological Engineering, Korea University, 145, Anam-ro, Seongbuk-gu, Seoul 136-701 (Korea, Republic of); Oh, Si Hyoung, E-mail: sho74@kist.re.kr [Center for Energy Convergence Research, Korea Institute of Science Technology, Hwarang-ro 14-gil 5, Seongbuk-gu, Seoul 136-791 (Korea, Republic of)

    2017-01-15

    Graphical abstract: Strategically-designed spinel-structured nano-scale surface layer, LiM{sub x}Mn{sup IV}{sub 1−x}O{sub 4}, featuring a high Li{sup +} ion conductivity and a good chemical stability was applied on Al-doped LiMn{sub 2}O{sub 4} spinel for the drastic improvement of the electrochemical performance at the elevated temperature as a promising cathode material for lithium rechargeable batteries. - Highlights: • Spinel-structured surface layer with a high Li-ion conductivity and a good chemical stability was prepared. • Simple wet process was developed to apply nano-scale surface layer on aluminum doped lithium manganese oxide spinel. • The properties of nano-scale surface layer were characterized by analytical tools including GITT, HR-TEM and XAS. • Materials with surface coating layer exhibit an excellent electrochemical performance at the elevated temperature. - Abstract: Li-ion conducting spinel-structured oxide layer with a manganese oxidation state close to being tetravalent was prepared on aluminum-doped lithium manganese oxide spinel for improving the electrochemical performances at the elevated temperatures. This nanoscale surface layer provides a good ionic conduction path for lithium ion transport to the core and also serves as an excellent chemical barrier for protecting the high-capacity core material from manganese dissolution into the electrolyte. In this work, a simple wet process was employed to prepare thin LiAlMnO{sub 4} and LiMg{sub 0.5}Mn{sub 1.5}O{sub 4} layers on the surface of LiAl{sub 0.1}Mn{sub 1.9}O{sub 4}. X-ray absorption studies revealed an oxidation state close to tetravalent manganese on the surface layer of coated materials. Materials with these surface coating layers exhibited excellent capacity retentions superior to the bare material, without undermining the lithium ion transport characteristics and the high rate performances.

  7. Carbon supported tin-based nanocomposites as anodes for Li-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Xiangyang; Zou, Youlan [School of Metallurgical Science and Engineering, Central South University, Yuelu mountain 932, Changsha 410083 (China); Yang, Juan, E-mail: zylan0935@csu.edu.cn [School of Metallurgical Science and Engineering, Central South University, Yuelu mountain 932, Changsha 410083 (China)

    2013-02-15

    SnO{sub 2} (Sn)/C composites as anodes for Li-ion batteries were fabricated by a simple chemical process of hydrothermal synthesis and subsequent heat treatment. The as-prepared materials were characterized by various analytic techniques. Results show that heat treatment temperature has a strong influence on physical and electrochemical performance of these composites. In these composites, irregular SnO{sub 2} lamellas arranged like chrysanthemum were dispersed among the elastic carbon matrix for rapid access of lithium ions to the material bulk. SnO{sub 2}/C anode heat-treated at a temperature of 600 Degree-Sign C exhibits a reversible capacity of 533.4 mAh/g after 50 cycles at the current density of 100 mA/g. - Graphical abstract: Chrysanthemum-like microstructures SnO{sub 2} grains expand along two-dimensional direction during cycling. The intervals among adjacent SnO{sub 2} lamellas provide the sites for lithium insertion and the space for volume expansion. After long cycling, SnO{sub 2} lamellas adhere together to form compact layers, which preserved the integrity of the structure. Highlights: Black-Right-Pointing-Pointer Carbon supported SnO{sub 2} (Sn)/C composites have been synthesized. Black-Right-Pointing-Pointer Temperature control affects the physical and electrochemical performance. Black-Right-Pointing-Pointer Clusters of chrysanthemum-like microstructures were observed. Black-Right-Pointing-Pointer Intervals exist between SnO{sub 2} layers. Black-Right-Pointing-Pointer Integrity structure of SnO{sub 2}/C composites was preserved.

  8. Porous one-dimensional carbon/iron oxide composite for rechargeable lithium-ion batteries with high and stable capacity

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Jiadeng, E-mail: jzhu14@ncsu.edu; Lu, Yao, E-mail: ylu14@ncsu.edu; Chen, Chen, E-mail: cchen20@ncsu.edu; Ge, Yeqian, E-mail: yge3@ncsu.edu; Jasper, Samuel, E-mail: smjasper@ncsu.edu; Leary, Jennifer D., E-mail: jdleary@ncsu.edu; Li, Dawei, E-mail: ldw19900323@163.com; Jiang, Mengjin, E-mail: mjiang5@ncsu.edu; Zhang, Xiangwu, E-mail: xiangwu_zhang@ncsu.edu

    2016-07-05

    Hematite iron oxide (α-Fe{sub 2}O{sub 3}) is considered to be a prospective anode material for lithium-ion batteries (LIBs) because of its high theoretical capacity (1007 mAh g{sup −1}), nontoxicity, and low cost. However, the low electrical conductivity and large volume change during Li insertion/extraction of α-Fe{sub 2}O{sub 3} hinder its use in practical batteries. In this study, carbon-coated α-Fe{sub 2}O{sub 3} nanofibers, prepared via an electrospinning method followed by a thermal treatment process, are employed as the anode material for LIBs. The as-prepared porous nanofibers with a carbon content of 12.5 wt% show improved cycling performance and rate capability. They can still deliver a high and stable capacity of 715 mAh g{sup −1} even at superior high current density of 1000 mA g{sup −1} after 200 cycles with a large Coulombic efficiency of 99.2%. Such improved electrochemical performance can be assigned to their unique porous fabric structure as well as the conductive carbon coating which shorten the distance for Li ion transport, enhancing Li ion reversibility and kinetic properties. It is, therefore, demonstrated that carbon-coated α-Fe{sub 2}O{sub 3} nanofiber prepared under optimized conditions is a promising anode material candidate for LIBs. - Graphical abstract: Carbon-coated α-Fe{sub 2}O{sub 3} nanofibers are employed as anode material to achieve high and stable electrochemical performance for lithium-ion batteries, enhancing their commercial viability. - Highlights: • α-Fe{sub 2}O{sub 3}/C nanofibers were fabricated by electrospinning and thermal treatment. • α-Fe{sub 2}O{sub 3}/C nanofibers exhibit stable cyclability and good rate capability. • α-Fe{sub 2}O{sub 3}–C nanofibers maintain high capacity at 1000 mA g{sup −1} for 200 cycles. • A capacity retention of 99.2% is achieved by α-Fe{sub 2}O{sub 3}–C nanofibers after 200 cycles.

  9. Analyzing the Performance of Lithium-Ion Batteries for Plug-In Hybrid Electric Vehicles and Second-Life Applications

    Science.gov (United States)

    Vaidya, Rutvik Milind

    The automotive industry is committed to moving towards sustainable modes of transportation through electrified vehicles to improve the fuel economy with a reduced carbon footprint. In this context, battery-operated hybrid, plug-in hybrid and all-electric vehicles (EVs) are becoming commercially viable throughout the world. Lithium-ion (Li-ion) batteries with various active materials, electrolytes, and separators are currently being used for electric vehicle applications. Specifically, lithium-ion batteries with Lithium Iron Phosphate (LiFePO4 - LFP) and Lithium Nickel Manganese Cobalt Oxide (Li(NiMnCo)O 2 - NMC) cathodes are being studied mainly due to higher cycle life and higher energy density values, respectively. In the present work, 26650 Li-ion batteries with LFP and NMC cathodes were evaluated for Plug-in Hybrid Electric Vehicle (PHEV) applications, using the Federal Urban Driving Schedule (FUDS) to discharge the batteries with 20 A current in simulated Arizona, USA weather conditions (50 °C & electric vehicles, second-use of these retired batteries is gaining importance, and the possibility of second-life use of these tested batteries was also examined under constant current charge/discharge cycling at 50 °C. The capacity degradation rate under the PHEV test protocol for batteries with NMC-based cathode (16% over 800 cycles) was twice the degradation compared to batteries with LFP-based cathode (8% over 800 cycles), reiterating the fact that batteries with LFP cathodes have a higher cycle life compared to other lithium battery chemistries. Also, the high frequency resistance measured by electrochemical impedance spectroscopy (EIS) was found to increase significantly with cycling, leading to power fading for both the NMC- as well as LFP-based batteries. The active materials analyzed using X-ray diffraction (XRD) showed no significant phase change in the materials after 800 PHEV cycles. For second-life tests, these batteries were subjected to a constant

  10. Scalable Preparation of Ternary Hierarchical Silicon Oxide-Nickel-Graphite Composites for Lithium-Ion Batteries.

    Science.gov (United States)

    Wang, Jing; Bao, Wurigumula; Ma, Lu; Tan, Guoqiang; Su, Yuefeng; Chen, Shi; Wu, Feng; Lu, Jun; Amine, Khalil

    2015-12-07

    Silicon monoxide is a promising anode candidate because of its high theoretical capacity and good cycle performance. To solve the problems associated with this material, including large volume changes during charge-discharge processes, we report a ternary hierarchical silicon oxide-nickel-graphite composite prepared by a facile two-step ball-milling method. The composite consists of nano-Si dispersed silicon oxides embedded in nano-Ni/graphite matrices (Si@SiOx /Ni/graphite). In the composite, crystalline nano-Si particles are generated by the mechanochemical reduction of SiO by ball milling with Ni. These nano-Si dispersed oxides have abundant electrochemical activity and can provide high Li-ion storage capacity. Furthermore, the milled nano-Ni/graphite matrices stick well to active materials and interconnect to form a crosslinked framework, which functions as an electrical highway and a mechanical backbone so that all silicon oxide particles become electrochemically active. Owing to these advanced structural and electrochemical characteristics, the composite enhances the utilization efficiency of SiO, accommodates its large volume expansion upon cycling, and has good ionic and electronic conductivity. The composite electrodes thus exhibit substantial improvements in electrochemical performance. This ternary hierarchical Si@SiOx /Ni/graphite composite is a promising candidate anode material for high-energy lithium-ion batteries. Additionally, the mechanochemical ball-milling method is low cost and easy to reproduce, indicating potential for the commercial production of the composite materials. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Facile Hydrothermal Synthesis of VS2/Graphene Nanocomposites with Superior High-Rate Capability as Lithium-Ion Battery Cathodes.

    Science.gov (United States)

    Fang, Wenying; Zhao, Hongbin; Xie, Yanping; Fang, Jianhui; Xu, Jiaqiang; Chen, Zhongwei

    2015-06-17

    In this study, a facile one-pot process for the synthesis of hierarchical VS2/graphene nanosheets (VS2/GNS) composites based on the coincident interaction of VS2 and reduced graphene oxide (rGO) sheets in the presence of cetyltrimethylammonium bromide is developed for the first time. The nanocomposites possess a hierarchical structure of 50 nm VS2 sheets in thickness homogeneously anchored on graphene. The VS2/GNS nanocomposites exhibit an impressive high-rate capability and good cyclic stability as a cathode material for Li-ion batteries, which retain 89.3% of the initial capacity 180.1 mAh g(-1) after 200 cycles at 0.2 C. Even at 20 C, the composites still deliver a high capacity of 114.2 mAh g(-1) corresponding to 62% of the low-rate capacity. Expanded studies show that VS2/GNS, as an anode material, also has a good reversible performance with 528 mAh g(-1) capacity after 100 cycles at 200 mA g(-1). The excellent electrochemical performance of the composites for reversible Li+ storage should be attributed to the exceptional interaction between VS2 and GNS that enabled fast electron transport between graphene and VS2, facile Li-ion diffusion within the electrode. Moreover, GNS provides a topological and structural template for the nucleation and growth of two-dimensional VS2 nanosheets and acted as buffer matrix to relieve the volume expansion/contraction of VS2 during the electrochemical charge/discharge, facilitating improved cycling stability. The VS2/GNS composites may be promising electrode materials for the next generation of rechargeable lithium ion batteries.

  12. Hydrothermal synthesis of morphology-controlled LiFePO4 cathode material for lithium-ion batteries

    Science.gov (United States)

    Pei, Bo; Yao, Hongxu; Zhang, Weixin; Yang, Zeheng

    2012-12-01

    A simple sodium dodecyl benzene sulfonate (SDBS) mediated hydrothermal method has been described in this paper to prepare morphology-controlled LiFePO4, cathode material such as nanoparticles, nanorods and nanoplates with controllable b-axis thickness. When used in lithium-ion batteries, the LiFePO4/C nanoparticles (200 nm in size) and nanorods (90 nm in diameter along b-axis and 200 nm-1 μm in length) display initial discharge capacities of 145.3 and 149.0 mAh g-1 at 0.1 C rate, 33.9 and 61.3 mAh g-1 at 10 C rate, respectively. The LiFePO4/C nanoplates (20 nm thickness along b-axis and 50 nm width) deliver a discharge capacity of 162.9 mAh g-1 at 0.1 C rate and 107.9 mAh g-1 at 10 C rate. The Li-ion diffusion coefficients of the LiFePO4/C nanoparticles, nanorods and nanoplates are calculated to be 1.66 × 10-12, 2.99 × 10-12 and 1.64 × 10-11 cm2 s-1, respectively. In general, the discharge capacity and rate performance have been found to increase with the decreasing thickness of the b-axis. The experimental results demonstrate that decreasing the crystallite size in the b-axis and increasing the surface area of (010) plane can shorten Li-ion diffusion path and increase the electrode reaction, which significantly improve electrochemical performance of the LiFePO4/C nanocomposites.

  13. Strain-tolerant High Capacity Silicon Anodes via Directed Lithium Ion Transport for High Energy Density Lithium-ion Batteries

    Science.gov (United States)

    Goldman, Jason

    2012-02-01

    Energy storage is an essential component of modern technology, with applications including public infrastructure, transportation systems, and consumer electronics. Lithium-ion batteries are the preeminent form of energy storage when high energy / moderate power densities are required. Improvements to lithium-ion battery energy / power density through the adoption of silicon anodes—with approximately an order of magnitude greater gravimetric capacity than traditional carbon-based anodes--have been limited by ˜300% strains during electrochemical lithium insertion which result in short operational lifetimes. In two different systems we demonstrated improvements to silicon-based anode performance via directed lithium ion transport. The first system demonstrated a crystallographic-dependent anisotropic electrochemical lithium insertion in single-crystalline silicon anode microstructures. Exploiting this anisotropy, we highlight model silicon anode architectures that limit the maximum strain during electrochemical lithium insertion. This self-strain-limiting is a result of selecting a specific microstructure design such that during lithiation the anisotropic evolution of strain, above a given threshold, blocks further lithium intercalation. Exemplary design rules have achieved self-strain-limited charging capacities ranging from 677 mAhg-1 to 2833 mAhg-1. A second system with variably encapsulated silicon-based anodes demonstrated greater than 98% of their initial capacity after 130+ cycles. This anode also can operate stably at high energy/power densities. A lithium-ion battery with this anode was able to continuously (dis)charge in 10 minutes, corresponding to a power / energy density of ˜1460 W/kg and ˜243 Wh/kg--up to 780% greater power density and 220% higher energy density than conventional lithium-ion batteries. Anodes were also demonstrated with areal capacities of 12.7 mAh/cm^2, two orders of magnitude greater than traditional thin-film silicon anodes.[4pt

  14. Catalytically graphitized glass-like carbon examined as anode for lithium-ion cell performing at high charge/discharge rates

    Energy Technology Data Exchange (ETDEWEB)

    Skowronski, Jan M.; Knofczynski, Krzysztof [Poznan University of Technology, Institute of Chemistry and Technical Electrochemistry, ul. Piotrowo 3, 60-965 Poznan (Poland)

    2009-10-20

    The influence of a long-time heat treatment of hard carbon in the presence of iron catalyst on its structural properties and electrochemical performance is concerned in terms of potential application as anode material for lithium-ion cell. Glass-like carbon spheres obtained by carbonization of phenol resin were catalytically graphitized by heat treatment at temperature 1000 C in argon atmosphere for 20 h and 100 h. After this process iron was completely removed from the product of reaction. The original carbon was entirely useless as anode for Li-ion cell because of its extremely poor reversible capacity (54 mAh g{sup -1}). Due to heat treatment composite materials consisting of microcrystalline graphite admixed with turbostratic carbon were produced. Modified carbons were tested as anode materials using gradually increasing current density. Based on electrochemical measurements a mixed intercalation/insertion mechanism for storage of lithium ions was concluded. Discharge capacity of carbon heat treated for 100 h attained value of 276 mAh g{sup -1} and its reversible capacity appeared to be better than that of flaky graphite upon discharging at current density in the range 50-250 mA g{sup -1}. (author)

  15. Tunable Synthesis of Yolk-Shell Porous Silicon@Carbon for Optimizing Si/C-Based Anode of Lithium-Ion Batteries.

    Science.gov (United States)

    Guo, Sichang; Hu, Xiang; Hou, Yang; Wen, Zhenhai

    2017-12-06

    Significant "breathing effect" calls for exploring efficient strategies to address the intrinsic issues of silicon anode of lithium-ion batteries (LIBs). We here report a controllable synthetic route to fabricate the silicon-carbon hybrids, in which porous silicon nanoparticles (p-SiNPs) are loaded in void carbon spheres by forming the yolk-shell p-SiNPs@hollow carbon (HC) nanohybrids tunable. A set of controlled experiments accompanying with systematic characterizations demonstrate that the void space and mass loading of Si can be adjusted in an effective way so that the nanostructure can be optimized with achieving improved electrochemical performance as anode of lithium-ion batteries (LIBs). The optimized p-SiNPs@HC nanohybrids show excellent performance as anode for Li-ion battery, delivering a capacity of more than 1400 mA h g -1 after 100 cycles at 0.2 A g -1 and 720 mA h g -1 at a high current density of 4 A g -1 . The present work may provide us with an attractive and promising strategy for advancing Si-based anode materials due to advantages of tunable structure of silicon-carbon nanohybrids for optimizing electrochemical performance.

  16. Efficient Reformulation of Solid Phase Diffusion in Electrochemical-Mechanical Coupled Models for Lithium-Ion Batteries: Effect of Intercalation Induced Stresses

    Energy Technology Data Exchange (ETDEWEB)

    De, S; Suthar, B; Rife, D; Sikha, G; Subramanian, VR

    2013-07-23

    Lithium-ion batteries are typically modeled using porous electrode theory coupled with various transport and reaction mechanisms with an appropriate discretization or approximation for the solid phase diffusion within the electrode particle. One of the major difficulties in simulating Li-ion battery models is the need for simulating solid-phase diffusion in the second radial dimension r within the particle. It increases the complexity of the model as well as the computation time/cost to a great extent. This is Particularly true for the inclusion of pressure induced diffusion inside particles experiencing volume change. A computationally efficient representation for solid-phase diffusion is discussed in this paper. The operating condition has a significant effect on the validity, accuracy, and efficiency of various approximations for the solid-phase transport governed by pressure induced diffusion. This paper introduces efficient methods for solid phase reformulation - (1) parabolic profile approach and (2) a mixed order finite difference method for approximating/representing solid-phase concentration variations within the active materials of porous electrodes for macroscopic models for lithium-ion batteries. (C) 2013 The Electrochemical Society. All rights reserved.

  17. Enhanced representations of lithium-ion batteries in power systems models and their effect on the valuation of energy arbitrage applications

    Science.gov (United States)

    Sakti, Apurba; Gallagher, Kevin G.; Sepulveda, Nestor; Uckun, Canan; Vergara, Claudio; de Sisternes, Fernando J.; Dees, Dennis W.; Botterud, Audun

    2017-02-01

    We develop three novel enhanced mixed integer-linear representations of the power limit of the battery and its efficiency as a function of the charge and discharge power and the state of charge of the battery, which can be directly implemented in large-scale power systems models and solved with commercial optimization solvers. Using these battery representations, we conduct a techno-economic analysis of the performance of a 10 MWh lithium-ion battery system testing the effect of a 5-min vs. a 60-min price signal on profits using real time prices from a selected node in the MISO electricity market. Results show that models of lithium-ion batteries where the power limits and efficiency are held constant overestimate profits by 10% compared to those obtained from an enhanced representation that more closely matches the real behavior of the battery. When the battery system is exposed to a 5-min price signal, the energy arbitrage profitability improves by 60% compared to that from hourly price exposure. These results indicate that a more accurate representation of li-ion batteries as well as the market rules that govern the frequency of electricity prices can play a major role on the estimation of the value of battery technologies for power grid applications.

  18. Three-dimensional Fe2 N@C microspheres grown on reduced graphite oxide for lithium-ion batteries and the Li storage mechanism.

    Science.gov (United States)

    Yu, Peng; Wang, Lei; Sun, Fanfei; Zhao, Dongdong; Tian, Chungui; Zhao, Lu; Liu, Xu; Wang, Jianqiang; Fu, Honggang

    2015-02-16

    Nanostructured iron compounds as lithium-ion-battery anode material have attracted considerable attention with respect to improved electrochemical energy storage and excellent specific capacity, so lots of iron-based composites have been developed. Herein, a novel composite composed of three-dimensional Fe2 N@C microspheres grown on reduced graphite oxide (denoted as Fe2 N@C-RGO) has been synthesized through a simple and effective technique assisted by a hydrothermal and subsequent heating treatment process. As the anode material for lithium-ion batteries, the synthetic Fe2 N@C-RGO displayed excellent Li(+) -ion storage performance with a considerable initial capacity of 847 mAh g(-1) , a superior cycle stability (a specific discharge capacity of 760 mAh g(-1) remained after the 100th cycle), and an improved rate-capability performance compared with those of the pure Fe2 N and Fe2 N-RGO nanostructures. The good performance should be attributed to the existence of RGO layers that can facilitate to enhance the conductivity and shorten the lithium-ion diffusion path; in addition, the carbon layer on the surface of Fe2 N can avert the structure decay caused by the volume change during the lithiation/delithiation process. Moreover, in situ X-ray absorption fine-structure analysis demonstrated that the excellent performance can be attributed to the lack of any obvious change in the coordination geometry of Fe2 N@C-RGO during the charge/discharge processes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Preparation of PPy-Coated MnO2 Hybrid Micromaterials and Their Improved Cyclic Performance as Anode for Lithium-Ion Batteries

    Science.gov (United States)

    Feng, Lili; Zhang, Yinyin; Wang, Rui; Zhang, Yanli; Bai, Wei; Ji, Siping; Xuan, Zhewen; Yang, Jianhua; Zheng, Ziguang; Guan, Hongjin

    2017-09-01

    MnO2@PPy core-shell micromaterials are prepared by chemical polymerization of pyrrole on the MnO2 surface. The polypyrrole (PPy) is formed as a homogeneous organic shell on the MnO2 surface. The thickness of PPy shell can be adjusted by the usage of pyrrole. The analysis of SEM, FT-IR, X-ray photoelectron spectroscopy (XPS), thermo-gravimetric analysis (TGA), and XRD are used to confirm the formation of PPy shell. Galvanostatic cell cycling and electrochemical impedance spectroscopy (EIS) are used to evaluate the electrochemical performance as anode for lithium-ion batteries. The results show that after formation of MnO2@PPy core-shell micromaterials, the cyclic performance as anode for lithium-ion batteries is improved. Fifty microliters of PPy-coated caddice-clew-like MnO2 has the best cyclic performances as has 620 mAh g-1 discharge specific capacities after 300 cycles. As a comparison, the discharge specific capacity of bare MnO2 materials falls to below 200 mAh g-1 after 10 cycles. The improved lithium-storage cyclic stability of the MnO2@PPy samples attributes to the core-shell hybrid structure which can buffer the structural expansion and contraction of MnO2 caused by the repeated embedding and disengagement of Li ions and can prevent the pulverization of MnO2. This experiment provides an effective way to mitigate the problem of capacity fading of the transition metal oxide materials as anode materials for (lithium-ion batteries) LIBs.

  20. Lithium-Ion Electrolytes Containing Phosphorous-Based, Flame-Retardant Additives

    Science.gov (United States)

    Smart, Marshall C.; Smith, Kiah A.; Bugga, Ratnakumar V.; Prakash, G. K. Surya

    2010-01-01

    Future NASA missions aimed at exploring Mars, the Moon, and the outer planets require rechargeable batteries that can operate over a wide temperature range (-60 to +60 C) to satisfy the requirements of various applications. In addition, many of these applications will require improved safety, due to their use by humans. Currently, the state-of-the-art lithium-ion (Li-ion) system has been demonstrated to operate over a wide range of temperatures (-40 to +40 C); however, abuse conditions can often lead to cell rupture and fire. The nature of the electrolyte can greatly affect the propensity of the cell/battery to catch fire, given the flammability of the organic solvents used within. Li-ion electrolytes have been developed that contain a flame-retardant additive in conjunction with fluorinated co-solvents to provide a safe system with a wide operating temperature range. Previous work incorporated fluorinated esters into multi-component electrolyte formulations, which were demonstrated to cover a temperature range from 60 to +60 C. This work was described in Fluoroester Co-Solvents for Low-Temperature Li+ Cells (NPO-44626), NASA Tech Briefs, Vol. 33, No. 9 (September 2009), p. 37; and Optimized Li-Ion Electrolytes Con tain ing Fluorinated Ester Co-Solvents (NPO-45824), NASA Tech Briefs, Vol. 34, No. 3 (March 2010), p. 48. Other previous work improved the safety characteristics of the electrolytes by adding flame-retardant additives such as triphenyl phosphate (TPhPh), tri-butyl phosphate (TBuPh), triethyl phosphate (TEtPh), and bis(2,2,2-trifluoroethyl) methyl phosphonate (TFMPo). The current work involves further investigation of other types of flame-retardant additives, including tris(2,2,2-trifluoroethyl) phosphate, tris(2,2,2-trifluoroethyl) phosphite, triphenylphosphite, diethyl ethylphosphonate, and diethyl phenylphosphonate added to an electrolyte composition intended for wide operating temperatures. In general, many of the formulations investigated in this

  1. Fragmentation of positronium in collision with Li ion including ...

    Indian Academy of Sciences (India)

    Abstract. Fragmentation of ground state ortho-positronium (Ps) in collision with Li ion (Li+) is studied in the framework of post-collisional Coulomb distorted eikonal ap- proximation (CDEA), giving special emphasis on the dynamics of the electron loss to the continuum (ELC) that occurs when the electron (e) and the positron ...

  2. Atomic layer deposition for nanostructured Li-ion batteries

    NARCIS (Netherlands)

    Knoops, H. C. M.; Donders, M. E.; M. C. M. van de Sanden,; Notten, P. H. L.; Kessels, W. M. M.

    2012-01-01

    Nanostructuring is targeted as a solution to achieve the improvements required for implementing Li-ion batteries in a wide range of applications. These applications range in size from electrical vehicles down to microsystems. Atomic layer deposition (ALD) could be an enabling technology for

  3. Dicty_cDB: VHP417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP417 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) VHP417F 553 - - - - - - Show VHP417 Library VH (Link to library) Clone ID VHP417 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...GYLAASQSFNEGTDVIVLATHQI RKDFLSSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLR --- Translated Amino Ac... VAVQKLTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQI RKDFLSSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHI

  4. Performance and Lifetime Limiting Effects in Li-ion Batteries

    DEFF Research Database (Denmark)

    Scipioni, Roberto

    Lithium-ion batteries (LIBs) find widespread use for electricity storage, from portable devices such as smart phones to electric vehicles (EV), because of their high energy density and design flexibility. However, limited lifetime is still a challenge for several LIB materials. Specifically......, the detailed coupling between degradation mechanisms and battery usage is not fully understood, which impede lifetime improvements. To understand the degradation mechanisms and increase the performance of these materials, the development of improved characterization methods is crucial. This PhD thesis focuses...... on the thorough analysis of degradation mechanism in LIBs, trying to relate morphological and structural changes in Lithium-ion battery electrodes to performance degradation observed during electrode cycling. Degradation mechanisms in laboratory scale LFP cathodes were correlated with the degradation mechanisms...

  5. Ion-exchange synthesis and improved Li insertion property of lithiated H2Ti12O25 as a negative electrode material for lithium-ion batteries

    Directory of Open Access Journals (Sweden)

    Kunimitsu Kataoka

    2016-03-01

    Full Text Available We successfully prepared the lithiated H2Ti12O25 sample by the H+/Li+ ion exchange synthetic technique in the molten LiNO3 at 270 °C using H2Ti12O25 as a starting compound. Chemical composition of the obtained lithiated H2Ti12O25 sample was determined to be H1.05Li0.35Ti12O25-δ having δ = 0.3 by ICP-AES and DTA-TG analyses. The H+/Li+ ion exchange was also confirmed by powder XRD, 1H-MAS NMR, and 7Li-MAS NMR measurements. Electrochemical Li insertion and extraction measurements revealed that the initial coulombic efficiency was improved from 88% in H2Ti12O25 to 93% in the lithiated H2Ti12O25 sample. In addition, superior capacity retention properties for the charge and discharge cycling performance and good charge rate capability of the present lithiated H2Ti12O25 were confirmed in the electrochemical measurements. Accordingly, the lithiated H2Ti12O25 is suggested to be one of the promising high-voltage and high-capacity oxide negative electrodes in advanced lithium-ion batteries.

  6. Enhanced Wettability and Thermal Stability of a Novel Polyethylene Terephthalate-Based Poly(Vinylidene Fluoride) Nanofiber Hybrid Membrane for the Separator of Lithium-Ion Batteries.

    Science.gov (United States)

    Zhu, Chunhong; Nagaishi, Tomoki; Shi, Jian; Lee, Hoik; Wong, Pok Yin; Sui, Jianhua; Hyodo, Kenji; Kim, Ick Soo

    2017-08-09

    In this study, a novel membrane for the separator in a lithium-ion (Li-ion) battery was proposed via a mechanically pressed process with a poly(vinylidene fluoride) (PVDF) nanofiber subject and polyethylene terephthalate (PET) microfiber support. Important physical properties, such as surface morphology, wettability, and heat stability were considered for the PET-reinforced PVDF nanofiber (PRPN) hybrid separator. Images of scanning electron microscopy (SEM) showed that the PRPN hybrid separator had a homogeneous pore size and high porosity. It can wet out in battery electrolytes completely and quickly, satisfying wettability requirements. Moreover, the electrolyte uptake was higher than that of dry-laid and wet-laid nonwovens. For heat stability, no shrink occurred even when the heating temperature reached 135 °C, demonstrating thermal and dimensional stability. Moreover, differential scanning calorimetry (DSC) showed that the PRPN hybrid separator possessed a shutdown temperature of 131 °C, which is the same as conventional separators. Also, the meltdown temperature reached 252 °C, which is higher than the shutdown temperature, and thus can protect against internal cell shorts. The proposed PRPN hybrid separator is a strong candidate material for utilization in Li-ion batteries.

  7. Novel flame synthesis of nanostructured α-Fe2O3 electrode as high-performance anode for lithium ion batteries

    Science.gov (United States)

    Wang, Yang; Roller, Justin; Maric, Radenka

    2018-02-01

    Nanostructured electrodes have significant potential for enhancing the kinetics of lithium storage in secondary batteries. A simple and economical manufacturing approach of these electrodes is crucial to the development and application of the next generation lithium ion (Li-ion) batteries. In this study, nanostructured α-Fe2O3 electrode is fabricated by a novel one-step flame combustion synthesis method, namely Reactive Spray Deposition Technology (RSDT). This process possesses the merits of simplicity and low cost. The structure and morphology of the electrode are investigated with X-ray diffraction, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Electrochemical performance of the nanostructured α-Fe2O3 electrodes as the anodes for Li-ion batteries is evaluated by cyclic voltammetry, galvanostatic charge/discharge and electrochemical impedance spectroscopy in coin-type half-cells. The as-prepared electrodes demonstrate superior cyclic performance at high current rate, which delivers a high reversible capacity of 1239.2 mAh g-1 at 1 C after 500 cycles. In addition, a discharge capacity of 513.3 mAh g-1 can be achieved at 10 C.

  8. High rate capability and cyclic stability of hierarchically porous Tin oxide (IV)-carbon nanofibers as anode in lithium ion batteries

    Science.gov (United States)

    Gupta, Ashish; Dhakate, Sanjay R.; Gurunathan, P.; Ramesha, K.

    2017-10-01

    Tin oxide-carbon composite porous nanofibres exhibiting superior electrochemical performance as lithium ion battery (LIB) anode have been prepared using electrospinning technique. Surface morphology and structural characterizations of the composite material is carried out by techniques such as XRD, FESEM, HR-TEM, XPS, TGA and Raman spectroscopy. FESEM and TEM studies reveal that nanofibers have a uniform diameter of 150-180 nm and contain highly porous outer wall. The carbon content is limited to 10% in the nanofibers as shown by the TGA and EDAX which does not fade the high capacity of SnO2. These nanofibers delivered a higher discharge capacity of 722 mAh/g even after 100 cycles at high rate of 1C. The excellent electrochemical performance can be ascribed to the synergy effect of small amount of carbon in the composite and the hierarchically porous structure which accommodate large volume changes associated with Li-ion insertion-desertion. The porous nano-architecture would also provide a short diffusion path for Li+ ions in addition to facilitating high flux of electrolyte percolation through micropores. The electrochemical performance of composite material has also been tested at 60 °C at a higher rate of 2C and 5C. Post cycling FESEM analysis shows no volumetric and morphology changes in porous nanofibers after completing rate capability at high rate of 10C.

  9. Si- and Sn-containing SiOCN-based nanocomposites as anode materials for lithium ion batteries. Synthesis, thermodynamic characterization and modeling

    Energy Technology Data Exchange (ETDEWEB)

    Rohrer, Jochen; Albe, Karsten [Technische Univ. Darmstadt (Germany). Materialmodellierung; Vrankovic, Dragoljub; Riedel, Ralf; Graczyk-Zajac, Magdalena [Technische Univ. Darmstadt (Germany). Disperse Feststoffe; Cupid, Damian; Seifert, Hans J. [Karlsruher Institut fuer Technologie, Eggenstein-Leopoldshafen (Germany). IAM - Angewandte Werkstoffphysik

    2017-11-15

    Novel nanocomposites consisting of silicon/tin nanoparticles (n-Si/n-Sn) embedded in silicon carbonitride (SiCN) or silicon oxycarbide (SiOC) ceramic matrices are investigated as possible anode materials for Li-ion batteries. The goal of our study is to exploit the large mass specific capacity of Si/Sn (3 579 mAh g{sup -1}/994 mAh g{sup -1}), while avoiding rapid capacity fading due to the large volume changes of Si/Sn during Li insertion. We show that a large amount (∝30-40 wt.%) of disordered carbon phase is dispersed within the SiOC/SiCN matrix and stabilizes the Si/Sn nanoparticles with respect to extended reversible lithium ion storage. Silicon nanocomposites are prepared by mixing of a polymeric precursor with commercial and ''home-synthesized'' crystalline and amorphous silicon. Tin nanocomposites, in contrast, are prepared using a single precursor approach, which allows the in-situ generation of Sn nanoparticles homogeneously dispersed within the SiOC host. The best electrochemical stability along with capacities of 600 - 700 mAh g{sup -1} is obtained when amorphous/porous silicon is used. Mechanisms contributing to the increase of storage capacity and the cycle stability are clarified by analyzing elemental composition, local solid-state structures, intercalation hosts and Li-ion mobility. Our work is supplemented by first-principles based atomistic modeling and thermochemical measurements.

  10. Synthesis, characterization and lithium-ion migration dynamics simulation of LiFe1- x T x PO4 (T = Mn, Co, La and Ce) doping cathode material for lithium-ion batteries

    Science.gov (United States)

    Xiao, Yi; Zhang, Fu Chun; Han, Jeong In

    2016-11-01

    LiFePO4 was doped by metallic cation in Fe sites via ball milling by a solid-state reaction method synthesis, and with very low-level doping of these samples, such as Li0.95T0.05FePO4 (where T = Mn2+, Co2+, La3+, Ce4+). The effects of doping were studied by X-ray diffraction pattern, Raman shift, scanning electronic microscopy and energy-dispersive X-ray spectroscopy as sample characterizations. The results indicate that these dopants have no significant effect on the structure of the material, but considerably improve its electrochemical behavior. First-principles calculations were used to obtain the migration pathway of Li ions along the one-dimensional (010) direction in LiFePO4, and molecular dynamics simulation was used to investigate the lithium-ion diffusion coefficients ( D Li) inside LiFePO4, which were derived from the slope of the mean square displacement versus time plots. The evolution of the structure during the simulation was analyzed by the radial distribution function to obtain the data, and radial distribution functions and mean square displacements were used to confirm the formation of crystalline units and the evolution of structure.

  11. Lithium-Ion Textile Batteries with Large Areal Mass Loading

    KAUST Repository

    Hu, Liangbing

    2011-10-06

    We integrate Li-ion battery electrode materials into a 3D porous textile conductor by using a simple process. When compared to flat metal current collectors, our 3D porous textile conductor not only greatly facilitates the ability for a high active material mass loading on the battery electrode but also leads to better device performance.

  12. Silicon clathrates for lithium ion batteries: A perspective

    Science.gov (United States)

    Warrier, Pramod; Koh, Carolyn A.

    2016-12-01

    Development of novel energy storage techniques is essential for the development of sustainable energy resources. Li-ion batteries have the highest rated energy density among rechargeable batteries and have attracted a lot of attention for energy storage in the last 15-20 years. However, significant advancements are required in anode materials before Li-ion batteries become viable for a wide variety of applications, including in renewable energy storage, grid storage, and electric vehicles. While graphite is the current standard anode material in commercial Li-ion batteries, it is Si that exhibits the highest specific energy density among all materials considered for this purpose. Si, however, suffers from significant volume expansion/contraction and the formation of a thick solid-electrolyte interface layer. To resolve these issues, Si clathrates are being considered for anode materials. Clathrates are inclusion compounds and contain cages in which Li could be captured. While Si clathrates offer promising advantages due to their caged structure which enables negligible volume change upon Li insertion, there remains scientific challenges and knowledge gaps to be overcome before these materials can be utilized for Li-ion battery applications, i.e., understanding lithiation/de-lithiation mechanisms, optimizing guest concentrations, as well as safe and economic synthesis routes.

  13. Silicon clathrates for lithium ion batteries: A perspective

    Energy Technology Data Exchange (ETDEWEB)

    Warrier, Pramod, E-mail: pramod.warrier@gmail.com; Koh, Carolyn A. [Center for Hydrate Research, Chemical & Biological Engineering Department, Colorado School of Mines, Golden, Colorado 80401 (United States)

    2016-12-15

    Development of novel energy storage techniques is essential for the development of sustainable energy resources. Li-ion batteries have the highest rated energy density among rechargeable batteries and have attracted a lot of attention for energy storage in the last 15–20 years. However, significant advancements are required in anode materials before Li-ion batteries become viable for a wide variety of applications, including in renewable energy storage, grid storage, and electric vehicles. While graphite is the current standard anode material in commercial Li-ion batteries, it is Si that exhibits the highest specific energy density among all materials considered for this purpose. Si, however, suffers from significant volume expansion/contraction and the formation of a thick solid-electrolyte interface layer. To resolve these issues, Si clathrates are being considered for anode materials. Clathrates are inclusion compounds and contain cages in which Li could be captured. While Si clathrates offer promising advantages due to their caged structure which enables negligible volume change upon Li insertion, there remains scientific challenges and knowledge gaps to be overcome before these materials can be utilized for Li-ion battery applications, i.e., understanding lithiation/de-lithiation mechanisms, optimizing guest concentrations, as well as safe and economic synthesis routes.

  14. Reactive sintering of ceramic lithium ion electrolyte membranes

    Energy Technology Data Exchange (ETDEWEB)

    Badding, Michael Edward; Dutta, Indrajit; Iyer, Sriram Rangarajan; Kent, Brian Alan; Lonnroth, Nadja Teresia

    2017-06-06

    Disclosed herein are methods for making a solid lithium ion electrolyte membrane, the methods comprising combining a first reactant chosen from amorphous, glassy, or low melting temperature solid reactants with a second reactant chosen from refractory oxides to form a mixture; heating the mixture to a first temperature to form a homogenized composite, wherein the first temperature is between a glass transition temperature of the first reactant and a crystallization onset temperature of the mixture; milling the homogenized composite to form homogenized particles; casting the homogenized particles to form a green body; and sintering the green body at a second temperature to form a solid membrane. Solid lithium ion electrolyte membranes manufactured according to these methods are also disclosed herein.

  15. A Self-Healing Aqueous Lithium-Ion Battery.

    Science.gov (United States)

    Zhao, Yang; Zhang, Ye; Sun, Hao; Dong, Xiaoli; Cao, Jingyu; Wang, Lie; Xu, Yifan; Ren, Jing; Hwang, Yunil; Son, In Hyuk; Huang, Xianliang; Wang, Yonggang; Peng, Huisheng

    2016-11-07

    Flexible lithium-ion batteries are critical for the next-generation electronics. However, during the practical application, they may break under deformations such as twisting and cutting, causing their failure to work or even serious safety problems. A new family of all-solid-state and flexible aqueous lithium ion batteries that can self-heal after breaking has been created by designing aligned carbon nanotube sheets loaded with LiMn2 O4 and LiTi2 (PO4 )3 nanoparticles on a self-healing polymer substrate as electrodes, and a new kind of lithium sulfate/sodium carboxymethylcellulose serves as both gel electrolyte and separator. The specific capacity, rate capability, and cycling performance can be well maintained after repeated cutting and self-healing. These self-healing batteries are demonstrated to be promising for wearable devices. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Recovery Of Electrodic Powder From Spent Lithium Ion Batteries (LIBs

    Directory of Open Access Journals (Sweden)

    Shin S.M.

    2015-06-01

    Full Text Available This study was focused on recycling process newly proposed to recover electrodic powder enriched in cobalt (Co and lithium (Li from spent lithium ion battery. In addition, this new process was designed to prevent explosion of batteries during thermal treatment under inert atmosphere. Spent lithium ion batteries (LIBs were heated over the range of 300°C to 600°C for 2 hours and each component was completely separated inside reactor after experiment. Electrodic powder was successfully recovered from bulk components containing several pieces of metals through sieving operation. The electrodic powder obtained was examined by X-ray diffraction (XRD, energy dispersive X-ray spectroscopy (EDS, and atomic absorption spectroscopy (AA and furthermore image of the powder was taken by scanning electron microscopy (SEM. It was finally found that cobalt and lithium were mainly recovered to about 49 wt.% and 4 wt.% in electrodic powder, respectively.

  17. Interphase Evolution of a Lithium-Ion/Oxygen Battery.

    Science.gov (United States)

    Elia, Giuseppe Antonio; Bresser, Dominic; Reiter, Jakub; Oberhumer, Philipp; Sun, Yang-Kook; Scrosati, Bruno; Passerini, Stefano; Hassoun, Jusef

    2015-10-14

    A novel lithium-ion/oxygen battery employing Pyr14TFSI-LiTFSI as the electrolyte and nanostructured LixSn-C as the anode is reported. The remarkable energy content of the oxygen cathode, the replacement of the lithium metal anode by a nanostructured stable lithium-alloying composite, and the concomitant use of nonflammable ionic liquid-based electrolyte result in a new and intrinsically safer energy storage system. The lithium-ion/oxygen battery delivers a stable capacity of 500 mAh g(-1) at a working voltage of 2.4 V with a low charge-discharge polarization. However, further characterization of this new system by electrochemical impedance spectroscopy, scanning electron microscopy, and energy-dispersive X-ray spectroscopy reveals the progressive decrease of the battery working voltage, because of the crossover of oxygen through the electrolyte and its direct reaction with the LixSn-C anode.

  18. Lithium ion batteries with titania/graphene anodes

    Science.gov (United States)

    Liu, Jun; Choi, Daiwon; Yang, Zhenguo; Wang, Donghai; Graff, Gordon L; Nie, Zimin; Viswanathan, Vilayanur V; Zhang, Jason; Xu, Wu; Kim, Jin Yong

    2013-05-28

    Lithium ion batteries having an anode comprising at least one graphene layer in electrical communication with titania to form a nanocomposite material, a cathode comprising a lithium olivine structure, and an electrolyte. The graphene layer has a carbon to oxygen ratio of between 15 to 1 and 500 to 1 and a surface area of between 400 and 2630 m.sup.2/g. The nanocomposite material has a specific capacity at least twice that of a titania material without graphene material at a charge/discharge rate greater than about 10 C. The olivine structure of the cathode of the lithium ion battery of the present invention is LiMPO.sub.4 where M is selected from the group consisting of Fe, Mn, Co, Ni and combinations thereof.

  19. Solution synthesis of lead seeded germanium nanowires and branched nanowire networks and their application as Li-ion battery anodes

    Science.gov (United States)

    Flynn, Grace; Palaniappan, Kumaranand; Sheehan, Martin; Kennedy, Tadhg; Ryan, Kevin M.

    2017-06-01

    Herein, we report the high density growth of lead seeded germanium nanowires (NWs) and their development into branched nanowire networks suitable for application as lithium ion battery anodes. The synthesis of the NWs from lead seeds occurs simultaneously in both the liquid zone (solution-liquid-solid (SLS) growth) and solvent rich vapor zone (vapor-liquid-solid (VLS) growth) of a high boiling point solvent growth system. The reaction is sufficiently versatile to allow for the growth of NWs directly from either an evaporated catalyst layer or from pre-defined nanoparticle seeds and can be extended to allowing extensive branched nanowire formation in a secondary reaction where these seeds are coated onto existing wires. The NWs are characterized using TEM, SEM, XRD and DF-STEM. Electrochemical analysis was carried out on both the single crystal Pb-Ge NWs and the branched Pb-Ge NWs to assess their suitability for use as anodes in a Li-ion battery. Differential capacity plots show both the germanium wires and the lead seeds cycle lithium and contribute to the specific capacity that is approximately 900 mAh g-1 for the single crystal wires, rising to approximately 1100 mAh g-1 for the branched nanowire networks.

  20. Facile Preparation of Graphene/SnO₂ Xerogel Hybrids as the Anode Material in Li-Ion Batteries.

    Science.gov (United States)

    Li, Zhe-Fei; Liu, Qi; Liu, Yadong; Yang, Fan; Xin, Le; Zhou, Yun; Zhang, Hangyu; Stanciu, Lia; Xie, Jian

    2015-12-16

    SnO2 has been considered as one of the most promising anode materials for Li-ion batteries due to its theoretical ability to store up to 8.4 Li(+). However, it suffers from poor rate performance and short cycle life due to the low intrinsic electrical conductivity and particle pulverization caused by the large volume change upon lithiation/delithiation. Here, we report a facile synthesis of graphene/SnO2 xerogel hybrids as anode materials using epoxide-initiated gelation method. The synthesized hybrid materials (19% graphene/SnO2 xerogel) exhibit excellent electrochemical performance: high specific capacity, stable cyclability, and good rate capability. Even cycled at a high current density of 1 A/g for 300 cycles, the hybrid electrode can still deliver a specific capacity of about 380 mAh/g, corresponding to more than 60% capacity retention. The incorporation of graphene sheets provides fast electron transfer between the interfaces of the graphene nanosheets and the SnO2 and a short lithium ion diffusion path. The porous structure of graphene/xerogel and the strong interaction between SnO2 and graphene can effectively accommodate the volume change and tightly confine the formed Li2O and Sn nanoparticles, thus preventing the irreversible capacity degradation.

  1. Cost and Price Metrics for Automotive Lithium-Ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    None

    2017-02-01

    Values of current energy technology costs and prices, available from a variety of sources, can sometimes vary. While some of this variation can be due to differences in the specific materials or configurations assumed, it can also reflect differences in the definition and context of the terms "cost" and "price." This fact sheet illustrates and explains this latter source of variation in a case study of automotive lithium-ion batteries.

  2. Effect of Calendering on Electrode Wettability in Lithium Ion Batteries

    OpenAIRE

    Yangping eSheng; Christopher R. Fell; Yong Kyu Son; Metz, Bernhard M.; Junwei eJiang; Benjamin C. Church

    2014-01-01

    Controlling the wettability between the porous electrode and the electrolyte in lithium-ion batteries can improve both the manufacturing process and the electrochemical performance of the cell. The wetting rate, which is the electrolyte transport rate in the porous electrode, can be quantified using the wetting balance. The effect of the calendering process on the wettability of anode electrodes was investigated. A graphite anode film with an as-coated thickness of 59 μm was used as baseline ...

  3. Kirigami-based stretchable lithium-ion batteries

    OpenAIRE

    Song, Zeming; Wang, Xu; Lv, Cheng; An, Yonghao; Liang, Mengbing; Ma, Teng; He, David; Zheng, Ying-Jie; Huang, Shi-Qing; Yu, Hongyu; Jiang, Hanqing

    2015-01-01

    We have produced stretchable lithium-ion batteries (LIBs) using the concept of kirigami, i.e., a combination of folding and cutting. The designated kirigami patterns have been discovered and implemented to achieve great stretchability (over 150%) to LIBs that are produced by standardized battery manufacturing. It is shown that fracture due to cutting and folding is suppressed by plastic rolling, which provides kirigami LIBs excellent electrochemical and mechanical characteristics. The kirigam...

  4. Lithium metal doped electrodes for lithium-ion rechargeable chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Gao; Battaglia, Vince; Wang, Lei

    2016-09-13

    An embodiment of the invention combines the superior performance of a polyvinylidene difluoride (PVDF) or polyethyleneoxide (POE) binder, the strong binding force of a styrene-butadiene (SBR) binder, and a source of lithium ions in the form of solid lithium metal powder (SLMP) to form an electrode system that has improved performance as compared to PVDF/SBR binder based electrodes. This invention will provide a new way to achieve improved results at a much reduced cost.

  5. In-situ synthesis of interconnected SWCNT/OMC framework on silicon nanoparticles for high performance lithium-ion batteries

    Directory of Open Access Journals (Sweden)

    Weiwei Li

    2016-04-01

    Full Text Available In spite of silicon has a superior theoretical capacity, the large volume expansion of Si anodes during Li+ insertion/extraction is the bottle neck that results in fast capacity fading and poor cycling performance. In this paper, we report a silicon, single-walled carbon nanotube, and ordered mesoporous carbon nanocomposite synthesized by an evaporation-induced self-assembly process, in which silicon nanoparticles and single-walled carbon nanotubes were added into the phenolic resol with F-127 for co-condensation. The ordered mesoporous carbon matrix and single-walled carbon nanotubes network could effectively accommodate the volume change of silicon nanoparticles, and the ordered mesoporous structure could also provide efficient channels for the fast transport of Li-ions. As a consequence, this hybrid material exhibits a reversible capacity of 861 mAh g−1 after 150 cycles at a current density of 400 mA g−1. It achieves significant improvement in the electrochemical performance when compared with the raw materials and Si nanoparticle anodes. Keywords: Silicon, Single-walled carbon nanotube, Ordered mesoporous carbon, Lithium ion battery

  6. A novel method for identification of lithium-ion battery equivalent circuit model parameters considering electrochemical properties

    Science.gov (United States)

    Zhang, Xi; Lu, Jinling; Yuan, Shifei; Yang, Jun; Zhou, Xuan

    2017-03-01

    This paper proposes a novel parameter identification method for the lithium-ion (Li-ion) battery equivalent circuit model (ECM) considering the electrochemical properties. An improved pseudo two-dimension (P2D) model is established on basis of partial differential equations (PDEs), since the electrolyte potential is simplified from the nonlinear to linear expression while terminal voltage can be divided into the electrolyte potential, open circuit voltage (OCV), overpotential of electrodes, internal resistance drop, and so on. The model order reduction process is implemented by the simplification of the PDEs using the Laplace transform, inverse Laplace transform, Pade approximation, etc. A unified second order transfer function between cell voltage and current is obtained for the comparability with that of ECM. The final objective is to obtain the relationship between the ECM resistances/capacitances and electrochemical parameters such that in various conditions, ECM precision could be improved regarding integration of battery interior properties for further applications, e.g., SOC estimation. Finally simulation and experimental results prove the correctness and validity of the proposed methodology.

  7. Enhanced lithium ion battery cycling of silicon nanowire anodes by template growth to eliminate silicon underlayer islands.

    Science.gov (United States)

    Cho, Jeong-Hyun; Picraux, S Tom

    2013-01-01

    It is well-known that one-dimensional nanostructures reduce pulverization of silicon (Si)-based anode materials during Li ion cycling because they allow lateral relaxation. However, even with improved designs, Si nanowire-based structures still exhibit limited cycling stability for extended numbers of cycles, with the specific capacity retention with cycling not showing significant improvements over commercial carbon-based anode materials. We have found that one important reason for the lack of long cycling stability can be the presence of milli- and microscale Si islands which typically form under nanowire arrays during their growth. Stress buildup in these Si island underlayers with cycling results in cracking, and the loss of specific capacity for Si nanowire anodes, due to progressive loss of contact with current collectors. We show that the formation of these parasitic Si islands for Si nanowires grown directly on metal current collectors can be avoided by growth through anodized aluminum oxide templates containing a high density of sub-100 nm nanopores. Using this template approach we demonstrate significantly enhanced cycling stability for Si nanowire-based lithium-ion battery anodes, with retentions of more than ~1000 mA·h/g discharge capacity over 1100 cycles.

  8. Interlayer-Expanded Metal Sulfides on Graphene Triggered by a Molecularly Self-Promoting Process for Enhanced Lithium Ion Storage.

    Science.gov (United States)

    Wang, Qingqing; Rui, Kun; Zhang, Chao; Ma, Zhongyuan; Xu, Jingsan; Sun, Wenping; Zhang, Weina; Zhu, Jixin; Huang, Wei

    2017-11-09

    A general synthetic approach has been demonstrated to fabricate three-dimensional (3D) structured metal sulfides@graphene, employing few-layered sulfide nanostructures with expanded interlayer spacing of the (002) plane (e.g., 0.98 nm for MoS2 nanoclusters and 0.65 nm for VS4 nanoribbons) and electrically conductive graphene as ideal building blocks. Here, small molecules (thioacetamide) acting as both the sulfur source and, more importantly, the structure-directing agent adjusting the interlayer spacing are wisely selected, further contributing to a sufficient space for ultrafast Li(+) ion intercalation. The appealing features of a mechanically robust backbone, ultrathin thickness, abundant exposure of interlayer edges, and good electrical conductivity in such 3D architectures are favorable for providing easy access for the electrolyte to the structures and offering a shortened diffusion length of Li(+) when utilized for energy storage. As a proof of concept, the electrochemical behavior of the resulting 3D structured metal sulfides@graphene as an anode material of lithium ion batteries (LIBs) is systematically investigated. As a consequence, high specific capacities, long lifespans, and superior rate capabilities have been realized in such well-designed architectures, e.g. maintaining a specific capacity as high as 965 mAh g(-1) for 120 cycles for VS4@graphene and 1100 mAh g(-1) for 150 cycles for MoS2@graphene.

  9. Tailored Recovery of Carbons from Waste Tires for Enhanced Performance as Anodes in Lithium-ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Naskar, Amit K [ORNL; Bi, [ORNL; Saha, Dipendu [ORNL; Chi, Miaofang [ORNL; Bridges, Craig A [ORNL; Paranthaman, Mariappan Parans [ORNL

    2014-01-01

    Morphologically tailored pyrolysis-recovered carbon black is utilized in lithium-ion batteries as a potential solution for adding value to waste tire-rubber-derived materials. Micronized tire rubber was digested in a hot oleum bath to yield a sulfonated rubber slurry that was then filtered, washed, and compressed into a solid cake. Carbon was recovered from the modified rubber cake by pyrolysis in a nitrogen atmosphere. The chemical pretreatment of rubber produced a carbon monolith with higher yield than that from the control (a fluffy tire-rubber-derived carbon black). The carbon monolith showed a very small volume fraction of pores of widths 3 4 nm, reduced specific surface area, and an ordered assembly of graphitic domains. Electrochemical studies on the recovered-carbon-based anode revealed an improved Li-ion battery performance with higher reversible capacity than that of commercial carbon materials. Anodes made with a sulfonated tire-rubber-derived carbon and a control tire-rubber-derived carbon, respectively, exhibited an initial coulombic efficiency of 80% and 45%, respectively. The reversible capacity of the cell with the sulfonated carbon as anode was 400 mAh/g after 100 cycles, with nearly 100% coulombic efficiency. Our success in producing higher performance carbon material from waste tire rubber for potential use in energy storage applications adds a new avenue to tire rubber recycling.

  10. Vanadium Nitride Nanowire Supported SnS2 Nanosheets with High Reversible Capacity as Anode Material for Lithium Ion Batteries.

    Science.gov (United States)

    Balogun, Muhammad-Sadeeq; Qiu, Weitao; Jian, Junhua; Huang, Yongchao; Luo, Yang; Yang, Hao; Liang, Chaolun; Lu, Xihong; Tong, Yexiang

    2015-10-21

    The vulnerable restacking problem of tin disulfide (SnS2) usually leads to poor initial reversible capacity and poor cyclic stability, which hinders its practical application as lithium ion battery anode (LIB). In this work, we demonstrated an effective strategy to improve the first reversible capacity and lithium storage properties of SnS2 by growing SnS2 nanosheets on porous flexible vanadium nitride (VN) substrates. When evaluating lithium-storage properties, the three-dimensional (3D) porous VN coated SnS2 nanosheets (denoted as CC-VN@SnS2) yield a high reversible capacity of 75% with high specific capacity of about 819 mAh g(-1) at a current density of 0.65 A g(-1). Remarkable cyclic stability capacity of 791 mAh g(-1) after 100 cycles with excellent capacity retention of 97% was also achieved. Furthermore, discharge capacity as high as 349 mAh g(-1) is still retained after 70 cycles even at a elevated current density of 13 A g(-1). The excellent performance was due to the conductive flexible VN substrate support, which provides short Li-ion and electron pathways, accommodates large volume variation, contributes to the capacity, and provides mechanical stability, which allows the electrode to maintain its structural stability.

  11. A coupled thermal and electrochemical study of lithium-ion battery cooled by paraffin/porous-graphite-matrix composite

    Science.gov (United States)

    Greco, Angelo; Jiang, Xi

    2016-05-01

    Lithium-ion (Li-ion) battery cooling using a phase change material (PCM)/compressed expanded natural graphite (CENG) composite is investigated, for a cylindrical battery cell and for a battery module scale. An electrochemistry model (average model) is coupled to the thermal model, with the addition of a one-dimensional model for the solution and solid diffusion using the nodal network method. The analysis of the temperature distribution of the battery module scale has shown that a two-dimensional model is sufficient to describe the transient temperature rise. In consequence, a two-dimensional cell-centred finite volume code for unstructured meshes is developed with additions of the electrochemistry and phase change. This two-dimensional thermal model is used to investigate a new and usual battery module configurations cooled by PCM/CENG at different discharge rates. The comparison of both configurations with a constant source term and heat generation based on the electrochemistry model showed the superiority of the new design. In this study, comparisons between the predictions from different analytical and computational tools as well as open-source packages were carried out, and close agreements have been observed.

  12. One Step Synthesis of Uniform SnO2 Electrode by UV Curing Technology toward Enhanced Lithium-Ion Storage.

    Science.gov (United States)

    Wei, Hang; Xia, Zhonghong; Xia, Dingguo

    2017-03-01

    A uniform anode material composed of ultrasmall tin oxide (SnO2) nanoparticles with an excellent lithium-ion (Li-ion) storage performance is obtained for the first time through one step UV curing technology. The diameter of ∼3 nm-sized SnO2 particles is uniformly dispersed in the styrylpyridinium (SbQ) polymer because of its photo-cross-linking property. The in situ cross-linking of SbQ polymer not only assist synthesis of uniform ultrasmall SnO2, but act as a strong adhesion binder on SnO2 nanoparticles, thereby effectively accommodating the volume expansion of SnO2 anodes during cycling process. The uniform electrode exhibits substantially higher specific capacity and longer cycling stability compared with the SnO2 nanoparticles electrodes treated by traditional PVDF-mixing method. A stable specific capacity of 572.5 mA h g(-1) of the SnO2 electrode derived from UV curing technology is obtained at a current density of 0.2 C (156.2 mA g(-1)) after 150 cycles. Even at high rate of 5 C (3905 mA g(-1)), the electrode still demonstrates specific capacity of 440.2 mA h g(-1). Therefore, the scalable and low-cost synthetic approach described herein can readily be extended to other nanomaterials electrodes to improve their lithium-storage properties.

  13. Polypropylene/hydrophobic-silica-aerogel-composite separator induced enhanced safety and low polarization for lithium-ion batteries

    Science.gov (United States)

    Feng, Guanhua; Li, Zihe; Mi, Liwei; Zheng, Jinyun; Feng, Xiangming; Chen, Weihua

    2018-02-01

    Separator as an important part of lithium-ion batteries, allowing the ion to transfer and preventing the direct contact of anode with cathode, determines the safety of the batteries. In this work, a kind of polypropylene/hydrophobic silica-aerogel-composite (SAC) separator is fabricated through combining hydrophobic silica aerogel and polypropylene (PP) separator. The rationally designed SAC effectively increases the thermal stability of the separator with slightly growing weight (the area retention rate is 30% higher than that of the PP separator after being heated for 30 min at 160 °C). In addition, the hydrophobic silica aerogel layer in SAC significantly improves the wettability of PP separator to electrolyte owning to the introduced hydrophobic functional groups of -Si(CH3)3 and porous structure, and the contact angles of SAC separator to several common organic electrolytes (EC/DMC, DMC/DOL, Diglyme) are close to 0°. Electrochemical tests show that the prepared SAC separator can decrease the polarization of Li-ion batteries and leads to improved power performance and cycle stability. And the SAC separator is firm with neglectable abscission after folding 200 times. This work provides a new way to improve the safety and simultaneously reduce the polarization of the batteries, implying promising application potential in power batteries.

  14. Materials issues in lithium ion rechargeable battery technology

    Energy Technology Data Exchange (ETDEWEB)

    Doughty, D.H.

    1995-07-01

    Lithium ion rechargeable batteries are predicted to replace Ni/Cd as the workhorse consumer battery. The pace of development of this battery system is determined in large part by the availability of materials and the understanding of interfacial reactions between materials. Lithium ion technology is based on the use of two lithium intercalating electrodes. Carbon is the most commonly used anode material, while the cathode materials of choice have been layered lithium metal chalcogenides (LiMX{sub 2}) and lithium spinel-type compounds. Electrolytes may be either organic liquids or polymers. Although the first practical use of graphite intercalation compounds as battery anodes was reported in 1981 for molten salt cells and in 1983 for ambient temperature systems, it was not until Sony Energytech announced a new lithium ion intercalating carbon anode in 1990, that interest peaked. The reason for this heightened interest is that these electrochemical cells have the high energy density, high voltage and light weight of metallic lithium, but without the disadvantages of dendrite formation on charge, improving their safety and cycle life.

  15. Nanostructured silicon anodes for lithium ion rechargeable batteries.

    Science.gov (United States)

    Teki, Ranganath; Datta, Moni K; Krishnan, Rahul; Parker, Thomas C; Lu, Toh-Ming; Kumta, Prashant N; Koratkar, Nikhil

    2009-10-01

    Rechargeable lithium ion batteries are integral to today's information-rich, mobile society. Currently they are one of the most popular types of battery used in portable electronics because of their high energy density and flexible design. Despite their increasing use at the present time, there is great continued commercial interest in developing new and improved electrode materials for lithium ion batteries that would lead to dramatically higher energy capacity and longer cycle life. Silicon is one of the most promising anode materials because it has the highest known theoretical charge capacity and is the second most abundant element on earth. However, silicon anodes have limited applications because of the huge volume change associated with the insertion and extraction of lithium. This causes cracking and pulverization of the anode, which leads to a loss of electrical contact and eventual fading of capacity. Nanostructured silicon anodes, as compared to the previously tested silicon film anodes, can help overcome the above issues. As arrays of silicon nanowires or nanorods, which help accommodate the volume changes, or as nanoscale compliant layers, which increase the stress resilience of silicon films, nanoengineered silicon anodes show potential to enable a new generation of lithium ion batteries with significantly higher reversible charge capacity and longer cycle life.

  16. Metal-organic frameworks for lithium ion batteries and supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Ke, Fu-Sheng; Wu, Yu-Shan; Deng, Hexiang, E-mail: hdeng@whu.edu.cn

    2015-03-15

    Porous materials have been widely used in batteries and supercapacitors attribute to their large internal surface area (usually 100–1000 m{sup 2} g{sup −1}) and porosity that can favor the electrochemical reaction, interfacial charge transport, and provide short diffusion paths for ions. As a new type of porous crystalline materials, metal-organic frameworks (MOFs) have received huge attention in the past decade due to their unique properties, i.e. huge surface area (up to 7000 m{sup 2} g{sup −1}), high porosity, low density, controllable structure and tunable pore size. A wide range of applications including gas separation, storage, catalysis, and drug delivery benefit from the recent fast development of MOFs. However, their potential in electrochemical energy storage has not been fully revealed. Herein, the present mini review appraises recent and significant development of MOFs and MOF-derived materials for rechargeable lithium ion batteries and supercapacitors, to give a glimpse into these potential applications of MOFs. - Graphical abstract: MOFs with large surface area and high porosity can offer more reaction sites and charge carriers diffusion path. Thus MOFs are used as cathode, anode, electrolyte, matrix and precursor materials for lithium ion battery, and also as electrode and precursor materials for supercapacitors. - Highlights: • MOFs have potential in electrochemical area due to their high porosity and diversity. • We summarized and compared works on MOFs for lithium ion battery and supercapacitor. • We pointed out critical challenges and provided possible solutions for future study.

  17. Operando Grazing Incidence Small-Angle X-ray Scattering/X-ray Diffraction of Model Ordered Mesoporous Lithium-Ion Battery Anodes.

    Science.gov (United States)

    Bhaway, Sarang M; Qiang, Zhe; Xia, Yanfeng; Xia, Xuhui; Lee, Byeongdu; Yager, Kevin G; Zhang, Lihua; Kisslinger, Kim; Chen, Yu-Ming; Liu, Kewei; Zhu, Yu; Vogt, Bryan D

    2017-02-28

    Emergent lithium-ion (Li+) batteries commonly rely on nanostructuring of the active electrode materials to decrease the Li+ ion diffusion path length and to accommodate the strains associated with the insertion and de-insertion of Li+, but in many cases these nanostructures evolve during electrochemical charging-discharging. This change in the nanostructure can adversely impact performance, and challenges remain regarding how to control these changes from the perspective of morphological design. In order to address these questions, operando grazing-incidence small-angle X-ray scattering and X-ray diffraction (GISAXS/GIXD) were used to assess the structural evolution of a family of model ordered mesoporous NiCo2O4 anode films during battery operation. The pore dimensions were systematically varied and appear to impact the stability of the ordered nanostructure during the cycling. For the anodes with small mesopores (≈9 nm), the ordered nanostructure collapses during the first two charge-discharge cycles, as determined from GISAXS. This collapse is accompanied by irreversible Li-ion insertion within the oxide framework, determined from GIXD and irreversible capacity loss. Conversely, anodes with larger ordered mesopores (17-28 nm) mostly maintained their nanostructure through the first two cycles with reversible Li-ion insertion. During the second cycle, there was a small additional deformation of the mesostructure. This preservation of the ordered structure lead to significant improvement in capacity retention during these first two cycles; however, a gradual loss in the ordered nanostructure from continuing deformation of the ordered structure during additional charge-discharge cycles leads to capacity decay in battery performance. These multiscale operando measurements provide insight into how changes at the atomic scale (lithium insertion and de-insertion) are translated to the nanostructure during battery operation. Moreover, small changes in the nanostructure

  18. Ti2Nb10O29-x mesoporous microspheres as promising anode materials for high-performance lithium-ion batteries

    Science.gov (United States)

    Deng, Shengjue; Luo, Zhibin; Liu, Yating; Lou, Xiaoming; Lin, Chunfu; Yang, Chao; Zhao, Hua; Zheng, Peng; Sun, Zhongliang; Li, Jianbao; Wang, Ning; Wu, Hui

    2017-09-01

    Ti2Nb10O29 has recently been reported as a promising anode material for lithium-ion batteries. However, its poor electronic conductivity and insufficient Li+-ion diffusion coefficient significantly limit its rate capability. To tackle this issue, a strategy combining nanosizing and crystal-structure modification is employed. Ti2Nb10O29-x mesoporous microspheres with a sphere-size range of 0.5-4 μm are prepared by a one-step solvothermal method followed by thermal treatment in N2. These Ti2Nb10O29-x mesoporous microspheres exhibit primary nanoparticles, a large specific surface area (22.9 m2 g-1) and suitable pore sizes, leading to easy electron/Li+-ion transport and good interfacial reactivity. Ti2Nb10O29-x shows a defective shear ReO3 crystal structure with O2- vacancies and an increased unit cell volume, resulting in its increased Li+-ion diffusion coefficient. Besides Ti4+ and Nb5+ ions, Ti2Nb10O29-x comprises Nb4+ ions with unpaired 4d electrons, which significantly increase its electronic conductivity. As a result of these improvements, the Ti2Nb10O29-x mesoporous microspheres reveal superior electrochemical performances in term of large reversible specific capacity (309 mAh g-1 at 0.1 C), outstanding rate capability (235 mAh g-1 at 40 C) and durable cyclic stability (capacity retention of 92.1% over 100 cycles at 10 C).

  19. Prediction study on the degeneration of lithium-ion battery based on fuzzy inference system

    Science.gov (United States)

    Shi, Jian Ping

    2017-07-01

    The degradation degree prediction of lithium-ion battery has been studied through experimental data. Characterization parameters on the degradation degree of lithium-ion battery were deduced under consideration of the internal and external factors. The analysis of discrete degree was proposed to depict the degradation degree for lithium-ion battery. Furthermore, based on fuzzy inference system (FIS), the predicted model of the degradation degree for lithium-ion battery was built and its output was defined as the degenerate coefficient β, β ∈ [0, 1]. Finally, by learning, training and simulating, the FIS model has been validated to be reliable and applicable in prediction on the degradation degree of lithium-ion battery. The simulation results show that the degradation degree of lithium-ion battery is more serious when β is closer to 1, and the degradation degree is lighter when β is closer to 0.

  20. Hectorite-based nanocomposite electrolytes for lithium-ion batteries

    Science.gov (United States)

    Riley, Michael William

    Hectorite clay is presented in this work as a promising component for electrolytes for lithium-ion batteries. This negatively-charged, plate-shaped (250 nm diameter by 1 nm thickness) clay has exchangeable cations for which lithium may be substituted. When properly dispersed in high-dielectric solvents such as the carbonates (ethylene carbonate and propylene carbonate) typically used in lithium-ion cells, a shear-thinning physical gel is created possessing a good conductivity (as high as 2 x 10-4 S/cm at room temperature has been measured) with near unity lithium-ion transference numbers. As a result, hectorite-based electrolytes could drastically reduce concentration polarization and present an inherently safer electrolyte as toxic salts such as LiPF6 that are typically used could be eliminated. Hectorite clay dispersions in aqueous and non-aqueous (1:1 (v:v) ethylene carbonate: poly(ethylene)glycol dimethyl ether 250 MW) solvents have been studied using rheology (dynamic and steady) and conductivity. The aqueous dispersions show a highly-exfoliated microstructure (fractal dimension, Df ≈ 1.6) created primarily through electrostatic repulsive forces which recovers after shear deformation by reorientation of the clay platelets. The non-aqueous dispersions form gel structures with a much higher degree of aggregation (Df ≈ 2.5), and recovery after shear deformation appears to be an aggregation controlled process as well. TEM imaging of non-aqueous clay dispersions shows the clay to be uniformly distributed, with the platelets existing in aggregates of 3 to 5 layers. Use of the hectorite-based electrolytes in lithium-ion cells requires electrodes that contain a single-ion conductor in the typically porous structures. Cathodes based on LiCoO2 that contain various lithium-conducting species (lithium hectorite, lithium LaponiteRTM, and lithium-exchanged NAFIONRTM) have been studied. AC impedance spectroscopy was used to probe the cells and equivalent circuits were

  1. Multi-layered, chemically bonded lithium-ion and lithium/air batteries

    Science.gov (United States)

    Narula, Chaitanya Kumar; Nanda, Jagjit; Bischoff, Brian L; Bhave, Ramesh R

    2014-05-13

    Disclosed are multilayer, porous, thin-layered lithium-ion batteries that include an inorganic separator as a thin layer that is chemically bonded to surfaces of positive and negative electrode layers. Thus, in such disclosed lithium-ion batteries, the electrodes and separator are made to form non-discrete (i.e., integral) thin layers. Also disclosed are methods of fabricating integrally connected, thin, multilayer lithium batteries including lithium-ion and lithium/air batteries.

  2. Graphene-Based Composites as Cathode Materials for Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Libao Chen

    2013-01-01

    Full Text Available Owing to the superior mechanical, thermal, and electrical properties, graphene was a perfect candidate to improve the performance of lithium ion batteries. Herein, we review the recent advances in graphene-based composites and their application as cathode materials for lithium ion batteries. We focus on the synthesis methods of graphene-based composites and the superior electrochemical performance of graphene-based composites as cathode materials for lithium ion batteries.

  3. Interpretation of the Particularities of Lithium-Ion Capacitors and Development of a Simple Circuit Model

    OpenAIRE

    El Ghossein, Nagham; SARI, Ali; VENET, Pascal

    2016-01-01

    International audience; The expeditious development of electric vehicles and hybrid electric vehicles relies on using appropriate energy storage systems such as supercapacitors and lithium-ion batteries. The new technology that combines both conventional energy storage systems is the lithium-ion capacitor. The aim of this component is to fill the gaps between supercapacitor's low energy density and lithium-ion battery's low power density. This paper presents the main electrical characteristic...

  4. Innovation and its Management as Observed in the Lithium Ion Secondary Battery Business

    OpenAIRE

    正本, 順三

    2008-01-01

    At present, mobile phones and laptop computers are essential items in our daily life. As a battery for such portable devices, the lithium ion secondary battery is used. The lithium ion secondary battery, which is used as a battery for such portable devices, was first invented by Dr. Yoshino at Asahi Kasei, where the present author formerly worked. In this paper, the author describes how the lithium ion secondary battery was developed by the inventor, how the technology originated in Japan and...

  5. Graphene-Based Composites as Cathode Materials for Lithium Ion Batteries

    OpenAIRE

    Libao Chen; Ming Zhang; Weifeng Wei

    2013-01-01

    Owing to the superior mechanical, thermal, and electrical properties, graphene was a perfect candidate to improve the performance of lithium ion batteries. Herein, we review the recent advances in graphene-based composites and their application as cathode materials for lithium ion batteries. We focus on the synthesis methods of graphene-based composites and the superior electrochemical performance of graphene-based composites as cathode materials for lithium ion batteries.

  6. High Cycle Life, Low Temperature Lithium Ion Battery for Earth Orbiting and Planetary Missions Project

    Data.gov (United States)

    National Aeronautics and Space Administration — NASA requires development of advanced rechargeable electrochemical battery systems for lithium ion batteries to support orbiting spacecraft and planetary missions....

  7. Robust, High Capacity, High Power Lithium Ion Batteries for Space Systems Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Lithium ion battery technology provides the highest energy density of all rechargeable battery technologies available today. However, the majority of the research...

  8. Novel Nanocomposite Materials for Advanced Li-Ion Rechargeable Batteries

    Directory of Open Access Journals (Sweden)

    Chuan Cai

    2009-09-01

    Full Text Available Nanostructured materials lie at the heart of fundamental advances in efficient energy storage and/or conversion, in which surface processes and transport kinetics play determining roles. Nanocomposite materials will have a further enhancement in properties compared to their constituent phases. This Review describes some recent developments of nanocomposite materials for high-performance Li-ion rechargeable batteries, including carbon-oxide nanocomposites, polymer-oxide nanocomposites, metal-oxide nanocomposites, and silicon-based nanocomposites, etc. The major goal of this Review is to highlight some new progress in using these nanocomposite materials as electrodes to develop Li-ion rechargeable batteries with high energy density, high rate capability, and excellent cycling stability.

  9. Advanced Electrodes for High Power Li-ion Batteries

    Directory of Open Access Journals (Sweden)

    Christian M. Julien

    2013-03-01

    Full Text Available While little success has been obtained over the past few years in attempts to increase the capacity of Li-ion batteries, significant improvement in the power density has been achieved, opening the route to new applications, from hybrid electric vehicles to high-power electronics and regulation of the intermittency problem of electric energy supply on smart grids. This success has been achieved not only by decreasing the size of the active particles of the electrodes to few tens of nanometers, but also by surface modification and the synthesis of new multi-composite particles. It is the aim of this work to review the different approaches that have been successful to obtain Li-ion batteries with improved high-rate performance and to discuss how these results prefigure further improvement in the near future.

  10. Electrolytes and Interphasial Chemistry in Li Ion Devices

    Directory of Open Access Journals (Sweden)

    Kang Xu

    2010-01-01

    Full Text Available Since its appearance in 1991, the Li ion battery has been the major power source driving the rapid digitalization of our daily life; however, much of the processes and mechanisms underpinning this newest battery chemistry remains poorly understood. As in any electrochemical device, the major challenge comes from the electrolyte/electrode interfaces, where the discontinuity in charge distribution and extreme disequality in electric forces induce diversified processes that eventually determine the kinetics of Li+ intercalation chemistry. This article will summarize the most recent efforts on the fundamental understanding of the interphases in Li ion devices. Emphasis will be placed on the formation chemistry of the so-called “SEI” on graphitic anode, the effect of solvation sheath structure of Li+ on the intercalation energy barrier, and the feasibility of tailoring a desired interphase. Biologically inspired approaches to an ideal interphase will also be briefly discussed.

  11. Predictive Models of Li-ion Battery Lifetime

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Kandler; Wood, Eric; Santhanagopalan, Shriram; Kim, Gi-heon; Shi, Ying; Pesaran, Ahmad

    2015-06-15

    It remains an open question how best to predict real-world battery lifetime based on accelerated calendar and cycle aging data from the laboratory. Multiple degradation mechanisms due to (electro)chemical, thermal, and mechanical coupled phenomena influence Li-ion battery lifetime, each with different dependence on time, cycling and thermal environment. The standardization of life predictive models would benefit the industry by reducing test time and streamlining development of system controls.

  12. Innovation Meets Performance Demands of Advanced Lithium-ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    2016-06-01

    Advancements in high capacity and low density battery technologies have led to a growing need for battery materials with greater charge capacity and therefore stability. NREL's developments in ALD and molecular layer MLD allow for thin film coatings to battery composite electrodes, which can improve battery lifespan, high charge capacity, and stability. Silicon, one of the best high-energy anode materials for Li-ion batteries, can experience capacity fade from volumetric expansion. Using MLD to examine how surface modification could stabilize silicon anode material in Li-ion batteries, researchers discovered a new reaction precursor that leads to a flexible surface coating that accommodates volumetric expansion of silicon electrodes.

  13. Thin, Flexible Secondary Li-Ion Paper Batteries

    KAUST Repository

    Hu, Liangbing

    2010-10-26

    There is a strong interest in thin, flexible energy storage devices to meet modern society needs for applications such as interactive packaging, radio frequency sensing, and consumer products. In this article, we report a new structure of thin, flexible Li-ion batteries using paper as separators and free-standing carbon nanotube thin films as both current collectors. The current collectors and Li-ion battery materials are integrated onto a single sheet of paper through a lamination process. The paper functions as both a mechanical substrate and separator membrane with lower impedance than commercial separators. The CNT film functions as a current collector for both the anode and the cathode with a low sheet resistance (∼5 Ohm/sq), lightweight (∼0.2 mg/cm2), and excellent flexibility. After packaging, the rechargeable Li-ion paper battery, despite being thin (∼300 μm), exhibits robust mechanical flexibility (capable of bending down to <6 mm) and a high energy density (108 mWh/g). © 2010 American Chemical Society.

  14. Calculations of the dynamic dipole polarizabilities for the Li+ ion

    Science.gov (United States)

    Zhang, Yong-Hui; Tang, Li-Yan; Zhang, Xian-Zhou; Shi, Ting-Yun

    2016-10-01

    The B-spline configuration-interaction method is applied to the investigations of dynamic dipole polarizabilities for the four lowest triplet states (2 3S, 33S, 23P, and 33P) of the Li+ ion. The accurate energies for the triplet states of n 3S, n 3P, and n 3D, the dipole oscillator strengths for 23S(33S) → n 3P, 23P(33P) → n 3S, and 23P(33P) → n 3D transitions, with the main quantum number n up to 10 are tabulated for references. The dynamic dipole polarizabilities for the four triplet states under a wide range of photon energy are also listed, which provide input data for analyzing the Stark shift of the Li+ ion. Furthermore, the tune-out wavelengths in the range from 100 nm to 1.2 μm for the four triplet states, and the magic wavelengths in the range from 100 nm to 600 nm for the 23S → 33S, 23S → 23P, and 23S → 33P transitions are determined accurately for the experimental design of the Li+ ion. Project supported by the National Basic Research Program of China (Grant No. 2012CB821305) and the National Natural Science Foundation of China (Grant Nos. 11474319, 11274348, and 91536102).

  15. Predictive Models of Li-ion Battery Lifetime (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Smith, K.; Wood, E.; Santhanagopalan, S.; Kim, G.; Shi, Y.; Pesaran, A.

    2014-09-01

    Predictive models of Li-ion battery reliability must consider a multiplicity of electrochemical, thermal and mechanical degradation modes experienced by batteries in application environments. Complicating matters, Li-ion batteries can experience several path dependent degradation trajectories dependent on storage and cycling history of the application environment. Rates of degradation are controlled by factors such as temperature history, electrochemical operating window, and charge/discharge rate. Lacking accurate models and tests, lifetime uncertainty must be absorbed by overdesign and warranty costs. Degradation models are needed that predict lifetime more accurately and with less test data. Models should also provide engineering feedback for next generation battery designs. This presentation reviews both multi-dimensional physical models and simpler, lumped surrogate models of battery electrochemical and mechanical degradation. Models are compared with cell- and pack-level aging data from commercial Li-ion chemistries. The analysis elucidates the relative importance of electrochemical and mechanical stress-induced degradation mechanisms in real-world operating environments. Opportunities for extending the lifetime of commercial battery systems are explored.

  16. Modified carbon black materials for lithium-ion batteries

    Science.gov (United States)

    Kostecki, Robert; Richardson, Thomas; Boesenberg, Ulrike; Pollak, Elad; Lux, Simon

    2016-06-14

    A lithium (Li) ion battery comprising a cathode, a separator, an organic electrolyte, an anode, and a carbon black conductive additive, wherein the carbon black has been heated treated in a CO.sub.2 gas environment at a temperature range of between 875-925 degrees Celsius for a time range of between 50 to 70 minutes to oxidize the carbon black and reduce an electrochemical reactivity of the carbon black towards the organic electrolyte.

  17. Lithium-ion textile batteries with large areal mass loading

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Liangbing; La Mantia, Fabio; Wu, Hui; Xie, Xing; McDonough, James; Pasta, Mauro; Cui, Yi [Department of Materials Science and Engineering, Stanford University, Stanford, CA (United States)

    2011-11-15

    We integrate Li-ion battery electrode materials into a 3D porous textile conductor by using a simple process. When compared to flat metal current collectors, our 3D porous textile conductor not only greatly facilitates the ability for a high active material mass loading on the battery electrode but also leads to better device performance. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Sustainability Impact of Nanomaterial Enhanced Lithium Ion Batteries

    Science.gov (United States)

    Ganter, Matthew

    Energy storage devices are becoming an integral part of sustainable energy technology adoption, particularly, in alternative transportation (electric vehicles) and renewable energy technologies (solar and wind which are intermittent). The most prevalent technology exhibiting near-term impact are lithium ion batteries, especially in portable consumer electronics and initial electric vehicle models like the Chevy Volt and Nissan Leaf. However, new technologies need to consider the full life-cycle impacts from material production and use phase performance to the end-of-life management (EOL). This dissertation investigates the impacts of nanomaterials in lithium ion batteries throughout the life cycle and develops strategies to improve each step in the process. The embodied energy of laser vaporization synthesis and purification of carbon nanotubes (CNTs) was calculated to determine the environmental impact of the novel nanomaterial at beginning of life. CNTs were integrated into lithium ion battery electrodes as conductive additives, current collectors, and active material supports to increase power, energy, and thermal stability in the use phase. A method was developed to uniformly distribute CNT conductive additives in composites. Cathode composites with CNT additives had significant rate improvements (3x the capacity at a 10C rate) and higher thermal stability (40% reduction in exothermic energy released upon overcharge). Similar trends were also measured with CNTs in anode composites. Advanced free-standing anodes incorporating CNTs with high capacity silicon and germanium were measured to have high capacities where surface area reduction improved coulombic efficiencies and thermal stability. A thermal stability plot was developed that compares the safety of traditional composites with free-standing electrodes, relating the results to thermal conductivity and surface area effects. The EOL management of nanomaterials in lithium ion batteries was studied and a novel

  19. Optimization and Domestic Sourcing of Lithium Ion Battery Anode Materials

    Energy Technology Data Exchange (ETDEWEB)

    Wood, III, D. L.; Yoon, S. [A123 Systems, Inc.

    2012-10-25

    The purpose of this Cooperative Research and Development Agreement (CRADA) between ORNL and A123Systems, Inc. was to develop a low-temperature heat treatment process for natural graphite based anode materials for high-capacity and long-cycle-life lithium ion batteries. Three major problems currently plague state-of-the-art lithium ion battery anode materials. The first is the cost of the artificial graphite, which is heat-treated well in excess of 2000°C. Because of this high-temperature heat treatment, the anode active material significantly contributes to the cost of a lithium ion battery. The second problem is the limited specific capacity of state-of-the-art anodes based on artificial graphites, which is only about 200-350 mAh/g. This value needs to be increased to achieve high energy density when used with the low cell-voltage nanoparticle LiFePO4 cathode. Thirdly, the rate capability under cycling conditions of natural graphite based materials must be improved to match that of the nanoparticle LiFePO4. Natural graphite materials contain inherent crystallinity and lithium intercalation activity. They hold particular appeal, as they offer huge potential for industrial energy savings with the energy costs essentially subsidized by geological processes. Natural graphites have been heat-treated to a substantially lower temperature (as low as 1000-1500°C) and used as anode active materials to address the problems described above. Finally, corresponding graphitization and post-treatment processes were developed that are amenable to scaling to automotive quantities.

  20. Novel lithium iron phosphate materials for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Jelena

    2011-06-15

    Conventional energy sources are diminishing and non-renewable, take million years to form and cause environmental degradation. In the 21st century, we have to aim at achieving sustainable, environmentally friendly and cheap energy supply by employing renewable energy technologies associated with portable energy storage devices. Lithium-ion batteries can repeatedly generate clean energy from stored materials and convert reversely electric into chemical energy. The performance of lithium-ion batteries depends intimately on the properties of their materials. Presently used battery electrodes are expensive to be produced; they offer limited energy storage possibility and are unsafe to be used in larger dimensions restraining the diversity of application, especially in hybrid electric vehicles (HEVs) and electric vehicles (EVs). This thesis presents a major progress in the development of LiFePO4 as a cathode material for lithium-ion batteries. Using simple procedure, a completely novel morphology has been synthesized (mesocrystals of LiFePO4) and excellent electrochemical behavior was recorded (nanostructured LiFePO4). The newly developed reactions for synthesis of LiFePO4 are single-step processes and are taking place in an autoclave at significantly lower temperature (200 deg. C) compared to the conventional solid-state method (multi-step and up to 800 deg. C). The use of inexpensive environmentally benign precursors offers a green manufacturing approach for a large scale production. These newly developed experimental procedures can also be extended to other phospho-olivine materials, such as LiCoPO4 and LiMnPO4. The material with the best electrochemical behavior (nanostructured LiFePO4 with carbon coating) was able to deliver a stable 94% of the theoretically known capacity.

  1. Composite anodes for lithium-ion batteries: status and trends

    Directory of Open Access Journals (Sweden)

    Christian M. Julien

    2016-07-01

    Full Text Available Presently, the negative electrodes of lithium-ion batteries (LIBs is constituted by carbon-based materials that exhibit a limited specific capacity 372 mAh g−1 associated with the cycle between C and LiC6. Therefore, many efforts are currently made towards the technological development nanostructured materials in which the electrochemical processes occurs as intercalation, alloying or conversion reactions with a good accommodation of dilatation/contraction during cycling. In this review, attention is focused on advanced anode composite materials based on carbon, silicon, germanium, tin, titanium and conversion anode composite based on transition-metal oxides.

  2. High capacity anode materials for lithium ion batteries

    Science.gov (United States)

    Lopez, Herman A.; Anguchamy, Yogesh Kumar; Deng, Haixia; Han, Yongbon; Masarapu, Charan; Venkatachalam, Subramanian; Kumar, Suject

    2015-11-19

    High capacity silicon based anode active materials are described for lithium ion batteries. These materials are shown to be effective in combination with high capacity lithium rich cathode active materials. Supplemental lithium is shown to improve the cycling performance and reduce irreversible capacity loss for at least certain silicon based active materials. In particular silicon based active materials can be formed in composites with electrically conductive coatings, such as pyrolytic carbon coatings or metal coatings, and composites can also be formed with other electrically conductive carbon components, such as carbon nanofibers and carbon nanoparticles. Additional alloys with silicon are explored.

  3. Kirigami-based stretchable lithium-ion batteries

    Science.gov (United States)

    Song, Zeming; Wang, Xu; Lv, Cheng; An, Yonghao; Liang, Mengbing; Ma, Teng; He, David; Zheng, Ying-Jie; Huang, Shi-Qing; Yu, Hongyu; Jiang, Hanqing

    2015-01-01

    We have produced stretchable lithium-ion batteries (LIBs) using the concept of kirigami, i.e., a combination of folding and cutting. The designated kirigami patterns have been discovered and implemented to achieve great stretchability (over 150%) to LIBs that are produced by standardized battery manufacturing. It is shown that fracture due to cutting and folding is suppressed by plastic rolling, which provides kirigami LIBs excellent electrochemical and mechanical characteristics. The kirigami LIBs have demonstrated the capability to be integrated and power a smart watch, which may disruptively impact the field of wearable electronics by offering extra physical and functionality design spaces. PMID:26066809

  4. High throughput materials research and development for lithium ion batteries

    Directory of Open Access Journals (Sweden)

    Parker Liu

    2017-09-01

    Full Text Available Development of next generation batteries requires a breakthrough in materials. Traditional one-by-one method, which is suitable for synthesizing large number of sing-composition material, is time-consuming and costly. High throughput and combinatorial experimentation, is an effective method to synthesize and characterize huge amount of materials over a broader compositional region in a short time, which enables to greatly speed up the discovery and optimization of materials with lower cost. In this work, high throughput and combinatorial materials synthesis technologies for lithium ion battery research are discussed, and our efforts on developing such instrumentations are introduced.

  5. Kirigami-based stretchable lithium-ion batteries.

    Science.gov (United States)

    Song, Zeming; Wang, Xu; Lv, Cheng; An, Yonghao; Liang, Mengbing; Ma, Teng; He, David; Zheng, Ying-Jie; Huang, Shi-Qing; Yu, Hongyu; Jiang, Hanqing

    2015-06-11

    We have produced stretchable lithium-ion batteries (LIBs) using the concept of kirigami, i.e., a combination of folding and cutting. The designated kirigami patterns have been discovered and implemented to achieve great stretchability (over 150%) to LIBs that are produced by standardized battery manufacturing. It is shown that fracture due to cutting and folding is suppressed by plastic rolling, which provides kirigami LIBs excellent electrochemical and mechanical characteristics. The kirigami LIBs have demonstrated the capability to be integrated and power a smart watch, which may disruptively impact the field of wearable electronics by offering extra physical and functionality design spaces.

  6. Electronically conductive polymer binder for lithium-ion battery electrode

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Gao; Xun, Shidi; Battaglia, Vincent S.; Zheng, Honghe

    2017-05-16

    A family of carboxylic acid group containing fluorene/fluorenon copolymers is disclosed as binders of silicon particles in the fabrication of negative electrodes for use with lithium ion batteries. These binders enable the use of silicon as an electrode material as they significantly improve the cycle-ability of silicon by preventing electrode degradation over time. In particular, these polymers, which become conductive on first charge, bind to the silicon particles of the electrode, are flexible so as to better accommodate the expansion and contraction of the electrode during charge/discharge, and being conductive promote the flow battery current.

  7. Recycling of spent lithium-ion battery cathode materials by ammoniacal leaching

    Energy Technology Data Exchange (ETDEWEB)

    Ku, Heesuk; Jung, Yeojin; Jo, Minsang; Park, Sanghyuk [Department of Energy & Mineral Resources Engineering, Sejong University, Seoul 05006 (Korea, Republic of); Kim, Sookyung [Urban Mine Department, Korea Institute of Geoscience and Mineral Resources, 124 Gwahang-no, Yuseong-gu, Daejeon (Korea, Republic of); Yang, Donghyo, E-mail: ydh@kigam.re.kr [Urban Mine Department, Korea Institute of Geoscience and Mineral Resources, 124 Gwahang-no, Yuseong-gu, Daejeon (Korea, Republic of); Rhee, Kangin; An, Eung-Mo; Sohn, Jeongsoo [Urban Mine Department, Korea Institute of Geoscience and Mineral Resources, 124 Gwahang-no, Yuseong-gu, Daejeon (Korea, Republic of); Kwon, Kyungjung, E-mail: kfromberk@gmail.com [Department of Energy & Mineral Resources Engineering, Sejong University, Seoul 05006 (Korea, Republic of)

    2016-08-05

    Highlights: • Ammoniacal leaching is used to recover spent Li-ion battery cathode materials. • Leaching agents consist of ammonia, ammonium sulfite and ammonium carbonate. • Ammonium sulfite is a reductant and ammonium carbonate acts as pH buffer. • Co and Cu can be fully leached while Mn and Al are not leached. • Co recovery via ammoniacal leaching is economical compared to acid leaching. - Abstract: As the production and consumption of lithium ion batteries (LIBs) increase, the recycling of spent LIBs appears inevitable from an environmental, economic and health viewpoint. The leaching behavior of Ni, Mn, Co, Al and Cu from treated cathode active materials, which are separated from a commercial LIB pack in hybrid electric vehicles, is investigated with ammoniacal leaching agents based on ammonia, ammonium carbonate and ammonium sulfite. Ammonium sulfite as a reductant is necessary to enhance leaching kinetics particularly in the ammoniacal leaching of Ni and Co. Ammonium carbonate can act as a pH buffer so that the pH of leaching solution changes little during leaching. Co and Cu can be fully leached out whereas Mn and Al are hardly leached and Ni shows a moderate leaching efficiency. It is confirmed that the cathode active materials are a composite of LiMn{sub 2}O{sub 4}, LiCo{sub x}Mn{sub y}Ni{sub z}O{sub 2,} Al{sub 2}O{sub 3} and C while the leach residue is composed of LiNi{sub x}Mn{sub y}Co{sub z}O{sub 2}, LiMn{sub 2}O{sub 4}, Al{sub 2}O{sub 3}, MnCO{sub 3} and Mn oxides. Co recovery via the ammoniacal leaching is believed to gain a competitive edge on convenitonal acid leaching both by reducing the sodium hydroxide expense for increasing the pH of leaching solution and by removing the separation steps of Mn and Al.

  8. Diagnosis of Lithium-Ion Batteries State-of-Health based on Electrochemical Impedance Spectroscopy Technique

    DEFF Research Database (Denmark)

    Stroe, Daniel Ioan; Swierczynski, Maciej Jozef; Stan, Ana-Irina

    2014-01-01

    Lithium-ion batteries have developed into a popular energy storage choice for a wide range of applications because of their superior characteristics in comparison to other energy storage technologies. Besides modelling the performance behavior of Lithium-ion batteries, it has become of huge inter...

  9. An electrostatic CMOS/BiCMOS Lithium ion vibration-based harvester-charger IC

    Science.gov (United States)

    Torres, Erick Omar

    Self-powered microsystems, such as wireless transceiver microsensors, appeal to an expanding application space in monitoring, control, and diagnosis for commercial, industrial, military, space, and biomedical products. As these devices continue to shrink, their microscale dimensions allow them to be unobtrusive and economical, with the potential to operate from typically unreachable environments and, in wireless network applications, deploy numerous distributed sensing nodes simultaneously. Extended operational life, however, is difficult to achieve since their limited volume space constrains the stored energy available, even with state-of-the-art technologies, such as thin-film lithium-ion batteries (Li Ion) and micro-fuel cells. Harvesting ambient energy overcomes this deficit by continually replenishing the energy reservoir and, as a result, indefinitely extending system lifetime. In this work, an electrostatic harvester that harnesses ambient kinetic energy from vibrations to charge an energy-storage device (e.g., a battery) is investigated, developed, and evaluated. The proposed harvester charges and holds the voltage across a vibration-sensitive variable capacitor so that vibrations can induce it to generate current into the battery when capacitance decreases (as its plates separate). The challenge is that energy is harnessed at relatively slow rates, producing low output power, and the electronics required to transfer it to charge a battery can easily demand more than the power produced. To this end, the system reduces losses by time-managing and biasing its circuits to operate only when needed and with just enough energy while charging the capacitor through an efficient quasi-lossless inductor-based precharger. As result, the proposed energy harvester stores a net energy gain in the battery during every vibration cycle. Two energy-harvesting integrated circuits (IC) were analyzed, designed, developed, and validated using a 0.7-im BiCMOS process and a 30-Hz

  10. Optimized Carbonate and Ester-Based Li-Ion Electrolytes

    Science.gov (United States)

    Smart, Marshall; Bugga, Ratnakumar

    2008-01-01

    To maintain high conductivity in low temperatures, electrolyte co-solvents have been designed to have a high dielectric constant, low viscosity, adequate coordination behavior, and appropriate liquid ranges and salt solubilities. Electrolytes that contain ester-based co-solvents in large proportion (greater than 50 percent) and ethylene carbonate (EC) in small proportion (less than 20 percent) improve low-temperature performance in MCMB carbon-LiNiCoO2 lithium-ion cells. These co-solvents have been demonstrated to enhance performance, especially at temperatures down to 70 C. Low-viscosity, ester-based co-solvents were incorporated into multi-component electrolytes of the following composition: 1.0 M LiPF6 in ethylene carbonate (EC) + ethyl methyl carbonate (EMC) + X (1:1:8 volume percent) [where X = methyl butyrate (MB), ethyl butyrate EB, methyl propionate (MP), or ethyl valerate (EV)]. These electrolyte formulations result in improved low-temperature performance of lithium-ion cells, with dramatic results at temperatures below 40 C.

  11. 76 FR 57627 - Special Conditions: Cessna Aircraft Company Model M680 Airplane; Rechargeable Lithium-Ion Battery...

    Science.gov (United States)

    2011-09-16

    ... Airplane; Rechargeable Lithium-Ion Battery Installations AGENCY: Federal Aviation Administration (FAA), DOT... lithium-ion batteries. The applicable airworthiness regulations do not contain adequate or appropriate... lithium-ion batteries in the Model 680. Type Certification Basis Under the provisions of Title 14, Code of...

  12. Costs of lithium-ion batteries for vehicles

    Energy Technology Data Exchange (ETDEWEB)

    Gaines, L.; Cuenca, R.

    2000-08-21

    One of the most promising battery types under development for use in both pure electric and hybrid electric vehicles is the lithium-ion battery. These batteries are well on their way to meeting the challenging technical goals that have been set for vehicle batteries. However, they are still far from achieving the current cost goals. The Center for Transportation Research at Argonne National Laboratory undertook a project for the US Department of Energy to estimate the costs of lithium-ion batteries and to project how these costs might change over time, with the aid of research and development. Cost reductions could be expected as the result of material substitution, economies of scale in production, design improvements, and/or development of new material supplies. The most significant contributions to costs are found to be associated with battery materials. For the pure electric vehicle, the battery cost exceeds the cost goal of the US Advanced Battery Consortium by about $3,500, which is certainly enough to significantly affect the marketability of the vehicle. For the hybrid, however, the total cost of the battery is much smaller, exceeding the cost goal of the Partnership for a New Generation of Vehicles by only about $800, perhaps not enough to deter a potential buyer from purchasing the power-assist hybrid.

  13. Graphene composites as anode materials in lithium-ion batteries

    Science.gov (United States)

    Mazar Atabaki, M.; Kovacevic, R.

    2013-03-01

    Since the world of mobile phones and laptops has significantly altered by a big designer named Steve Jobs, the electronic industries have strived to prepare smaller, thinner and lower weight products. The giant electronic companies, therefore, compete in developing more efficient hardware such as batteries used inside the small metallic or polymeric frame. One of the most important materials in the production lines is the lithium-based batteries which is so famous for its ability in recharging as many times as a user needs. However, this is not an indication of being long lasted, as many of the electronic devices are frequently being used for a long time. The performance, chemistry, safety and above all cost of the lithium ion batteries should be considered when the design of the compounds are at the top concern of the engineers. To increase the efficiency of the batteries a combination of graphene and nanoparticles is recently introduced and it has shown to have enormous technological effect in enhancing the durability of the batteries. However, due to very high electronic conductivity, these materials can be thought of as preparing the anode electrode in the lithiumion battery. In this paper, the various approaches to characterize different types of graphene/nanoparticles and the process of preparing the anode for the lithium-ion batteries as well as their electrical properties are discussed.

  14. Functionalized graphene for high performance lithium ion capacitors.

    Science.gov (United States)

    Lee, Ji Hoon; Shin, Weon Ho; Ryou, Myung-Hyun; Jin, Jae Kyu; Kim, Junhyung; Choi, Jang Wook

    2012-12-01

    Lithium ion capacitors (LICs) have recently drawn considerable attention because they utilize the advantages of supercapacitors (high power) and lithium ion batteries (high energy). However, the energy densities of conventional LICs, which consist of a pair of graphite and activated carbon electrodes, are limited by the small capacities of the activated carbon cathodes. To overcome this limitation, we have engaged urea-reduced graphene oxide. The amide functional groups generated during the urea reduction facilitate the enolization processes for reversible Li binding, which improves the specific capacity by 37 % compared to those of conventional systems such as activated carbon and hydrazine-reduced graphene oxide. Utilizing the increased Li binding capability, when evaluated based on the mass of the active materials on both sides, the LICs based on urea-reduced graphene oxide deliver a specific energy density of approximately 106 Wh kg(total) (-1) and a specific power density of approximately 4200 W kg(total) (-1) with perfect capacity retention up to 1000 cycles. These values are far superior to those of previously reported LICs and supercapacitors, which suggests that appropriately treated graphene can be a promising electrode material for LICs. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Electrochemical model based charge optimization for lithium-ion batteries

    Science.gov (United States)

    Pramanik, Sourav; Anwar, Sohel

    2016-05-01

    In this paper, we propose the design of a novel optimal strategy for charging the lithium-ion battery based on electrochemical battery model that is aimed at improved performance. A performance index that aims at minimizing the charging effort along with a minimum deviation from the rated maximum thresholds for cell temperature and charging current has been defined. The method proposed in this paper aims at achieving a faster charging rate while maintaining safe limits for various battery parameters. Safe operation of the battery is achieved by including the battery bulk temperature as a control component in the performance index which is of critical importance for electric vehicles. Another important aspect of the performance objective proposed here is the efficiency of the algorithm that would allow higher charging rates without compromising the internal electrochemical kinetics of the battery which would prevent abusive conditions, thereby improving the long term durability. A more realistic model, based on battery electro-chemistry has been used for the design of the optimal algorithm as opposed to the conventional equivalent circuit models. To solve the optimization problem, Pontryagins principle has been used which is very effective for constrained optimization problems with both state and input constraints. Simulation results show that the proposed optimal charging algorithm is capable of shortening the charging time of a lithium ion cell while maintaining the temperature constraint when compared with the standard constant current charging. The designed method also maintains the internal states within limits that can avoid abusive operating conditions.

  16. New Aqueous Binders for Lithium-ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Jansen, Andrew N. [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Krumdick, Gregory K. [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Trask, Stephen E. [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Polzin, Bryant J. [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Lu, Wenquan [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Kahvecioglu Feridun, Ozge [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Hellring, Stuart D. [PPG Industries, Inc., Allison Park, PA (United States); Stewart, Matthew [PPG Industries, Inc., Allison Park, PA (United States); Kornish, Brian [PPG Industries, Inc., Allison Park, PA (United States)

    2016-12-22

    This final report summarizes the research effort of the CRADA between PPG Industries and Argonne National Laboratory (CRADA # C1400501 and Amendment 1 - ACK 85C11, Rev. 1), and completes the requirements of Task #5 in the CRADA. The results from Argonne represent a combined effort between the MERF and CAMP Facility (Materials Engineering Research Facility and the Cell Analysis, Modeling and Prototyping Facility). The key points of this report can be briefly summarized as: The multicomponent aqueous binder for NCM cathodes developed by PPG shows promising results when used on the CAMP Facility’s pilot-scale coater; NCM523 cathode electrodes exposed to water exhibit a voltage anomaly in the first two formation cycles that appears to have little effect on the material capacity, but needs to be explored further; the experimental LFP electrode produced by PPG does cycle electrochemically, but with reduced capacity and an uncharacteristic voltage profile; there is no obvious correlation between the pH and zeta-potential of materials that are commonly used in the lithium-ion battery; lithium ions are more readily dissolved out of NCM523 by water than the transition metals (by two orders of magnitude), and suggests that the plating bath may need to be spiked with a lithium salt; the approach of creating sub-micron size NCM523 particles via ball milling results in a cathode material with poor electrochemical performance.

  17. Electrochemical and thermal studies of lithium ion batteries

    Science.gov (United States)

    Lu, Wenquan

    The structural, electrochemical, and thermal characteristics of carbonaceous anodes and LiNi0.8Co0.2O2 cathode in Li-ion cells were investigated using various electrochemical and calorimetric techniques. The electrode-electrolyte interface was investigated for various carbonaceous materials such as graphite with different shapes, surface modified graphite with copper, and novel carbon material derived from sepiolite template. The structural and morphological properties were determined using XRD, TGA, SEM, BET techniques. The electrochemical characteristics were studied using conventional electrochemical techniques such as galvanostatic charge/discharge cycling, cyclic voltammetry, and impedance (AC and DC) methods. It was observed that the electrochemical active surface area instead of the BET area plays a critical role in the irreversible capacity loss associated with the carbonaceous anodes. It was also found that the exfoliation of carbon anodes especially in PC based electrolyte could be significantly reduced by protective copper coating of the natural graphite. LiNi0.8Co0.2O2 cathode material was found to possess high energy density and excellent cycling characteristics. The structural and electrochemical properties of LiNi0.8Co 0.2O2 synthesized by sol-gel and solid-state methods were studied. Results of the AC impedance spectroscopy carried out on LiNi 0.8Co0.2O2 cathodes revealed that the charge transfer resistance is a function of the state of charge. The solid state Li + diffusion was calculated to be around 10-13 cm2/s in the oxide particle by Warburg impedance method. In addition, the cell fabricated with LiNi0.8Co0.2O 2 cathode showed excellent energy and power performance under static and dynamic load conditions that prevail in Electric and Hybrid Vehicles. Thermal properties of the LiNi0.8Co0.2O2 cathode, carbonaceous anodes, and Li-ion cells fabricated with these electrodes were also investigated using isothermal microcalorimetry (IMC), differential

  18. A Review of Approaches for the Design of Li-Ion BMS Estimation Functions Revue de différentes approches pour l’estimation de l’état de charge de batteries Li-ion

    Directory of Open Access Journals (Sweden)

    Di Domenico D.

    2013-02-01

    Full Text Available This paper aims at comparing different approaches for the estimation of the state of charge of lithium-ion batteries. The main advantages as well as the critical points of the considered techniques are analyzed, highlighting the impact of the cell model precision and complexity on the estimator performance. Among others, the electrical equivalent circuit based technique is selected for further development. The results of a complete procedure from the cell characterization to the online estimation are illustrated. The experimental tests based on the data collected on batteries testing facilities of IFP Energies nouvelles show that the proposed strategy allows a satisfying state of charge real time estimation. Cet article vise à comparer différentes approches pour l’estimation de l’état de charge pour les batteries Li-ion. Les principaux avantages ainsi que les points critiques des différentes techniques sont analysés, en soulignant l’impact de la complexité et de la précision du modèle sur les performances de l’estimateur. La procédure complète, allant de la caractérisation de la cellule jusqu’à l’estimation en ligne de l’état de charge, est présentée pour la modélisation par circuit électrique équivalent. Les tests expérimentaux sur la base des données acquises au laboratoire batteries d’IFP Energies nouvelles montrent que cette stratégie permet d’obtenir un estimateur en temps réel de l’état de charge présentant de bonnes performances.

  19. Advanced Nanofiber-Based Lithium-Ion Battery Cathodes

    Science.gov (United States)

    Toprakci, Ozan

    Among various energy storage technologies, rechargeable lithium-ion batteries have been considered as effective solution to the increasing need for high-energy density electrochemical power sources. Rechargeable lithium-ion batteries offer energy densities 2 - 3 times and power densities 5 - 6 times higher than conventional Ni-Cd and Ni-MH batteries, and as a result, they weigh less and take less space for a given energy delivery. However, the use of lithium-ion batteries in many large applications such as electric vehicles and storage devices for future power grids is hindered by the poor thermal stability, relatively high toxicity, and high cost of lithium cobalt oxide (LiCoO2) powders, which are currently used as the cathode material in commercial lithium-ion batteries. Recently, lithium iron phosphate (LiFePO 4) powders have become a favorable cathode material for lithium-ion batteries because of their low cost, high discharge potential (around 3.4 V versus Li/Li+), large specific capacity (170 mAh g -1), good thermal stability, and high abundance with the environmentally benign and safe nature. As a result, there is a huge demand for the production of high-performance LiFePO4. However, LiFePO4 also has its own limitation such as low conductivity (˜10-9 S cm -1), which results in poor rate capability. To address this problem, various approaches can be used such as decreasing particle size of LiFePO 4, doping LiFePO4 with metal ions or coating LiFePO 4 surface with carboneous materials. Formation of conductive layer on LiFePO4 and decreasing particle size are promising approaches due to their superior contribution to electrical conductivity and electrochemical performance of LiFePO4. Although different approaches can be used for surface coating and particle size decrement, electrospinning can be potentially considered as an efficient, simple and inexpensive way. In this study, LiFePO 4/carbon and carbon nanotube- and graphene-loaded electrospun LiFePO 4/carbon

  20. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  1. Well-dispersed LiFePO4 nanoparticles anchored on a three-dimensional graphene aerogel as high-performance positive electrode materials for lithium-ion batteries

    Science.gov (United States)

    Tian, Xiaohui; Zhou, Yingke; Tu, Xiaofeng; Zhang, Zhongtang; Du, Guodong

    2017-02-01

    A three-dimensional graphene aerogel supporting LiFePO4 nanoparticles (LFP/GA) has been synthesized by a hydrothermal process. The morphology and microstructure of LFP/GA were investigated by X-ray diffraction, scanning electron microscopy, transmission electron microscopy and thermal gravimetric analysis. The electrochemical properties were evaluated by constant-current charge/discharge tests, cyclic voltammetry and electrochemical impedance spectroscopy. Well-distributed LFP nanoparticles are anchored on both sides of graphene and then assemble into a highly porous three-dimensional aerogel architecture. Conductive graphene networks provide abundant paths to facilitate the transfer of electrons, while the aerogel structures offer plenty of interconnected open pores for the storage of electrolyte to enable the fast supply of Li ions. The LFP and graphene aerogel composites present superior specific capacity, rate capability and cycling performance in comparison to the pristine LFP or LFP supported on graphene sheets and are thus promising for lithium-ion battery applications.

  2. Mesoporous Tin-Based Oxide Nanospheres/Reduced Graphene Composites as Advanced Anodes for Lithium-Ion Half/Full Cells and Sodium-Ion Batteries.

    Science.gov (United States)

    He, Yanyan; Li, Aihua; Dong, Caifu; Li, Chuanchuan; Xu, Liqiang

    2017-10-04

    The large volume variations of tin-based oxides hinder their extensive application in the field of lithium-ion batteries (LIBs). In this study, structure design, hybrid fabrication, and carbon-coating approaches have been simultaneously adopted to address these shortcomings. To this end, uniform mesoporous NiO/SnO2 @rGO, Ni-Sn oxide@rGO, and SnO2 @rGO nanosphere composites have been selectively fabricated. Among them, the obtained NiO/SnO2 @rGO composite exhibited a high capacity of 800 mAh g(-1) at 1000 mA g(-1) after 400 cycles. The electrochemical mechanism of NiO/SnO2 as an anode for LIBs has been preliminarily investigated by ex situ XRD pattern analysis. Furthermore, an NiO/SnO2 @rGO-LiCoO2 lithium-ion full cell showed a high capacity of 467.8 mAh g(-1) at 500 mA g(-1) after 100 cycles. Notably, the NiO/SnO2 @rGO composite also showed good performance when investigated as an anode for sodium-ion batteries (SIBs). It is believed that the unique mesoporous nanospherical framework, synergistic effects between the various components, and uniform rGO wrapping of NiO/SnO2 shorten the Li(+) ion diffusion pathways, maintain sufficient contact between the active material and the electrolyte, mitigate volume changes, and finally improve the electrical conductivity of the electrode. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Cu0.02Ti0.94Nb2.04O7: An advanced anode material for lithium-ion batteries of electric vehicles

    Science.gov (United States)

    Yang, Chao; Lin, Chunfu; Lin, Shiwei; Chen, Yongjun; Li, Jianbao

    2016-10-01

    To explore advanced anode materials for lithium-ion batteries of electric vehicles, Cu2+/Nb5+ co-doped TiNb2O7 is studied. Cu0.02Ti0.94Nb2.04O7 is successfully fabricated using a facile solid-state reaction. X-ray diffraction analyses combined with Rietveld refinements demonstrate that the trace Cu2+/Nb5+ co-doping does not destroy the shear ReO3 crystal structure of TiNb2O7 but increases the lattice parameters and unit cell volume. Specific surface area tests and scanning electron microscopy images reveal a smaller average particle size in Cu0.02Ti0.94Nb2.04O7. Due to the increased unit cell volume and free 3d electrons in Cu2+ ions, the Li+-ion diffusion coefficient and electronic conductivity of Cu0.02Ti0.94Nb2.04O7 are respectively enhanced by 14.8 times and at least 220 times. Consequently, Cu0.02Ti0.94Nb2.04O7 exhibits advanced electrochemical properties in terms of specific capacity, rate capability and cyclic stability. At 0.1 C, it delivers a large first-cycle discharge/charge capacity of 346/315 mAh g-1. At 10 C, it still provides a large capacity of 182 mAh g-1 with tiny loss of only 1.2% over 1000 cycles. In sharp contrast, TiNb2O7 shows a small capacity of only 90 mAh g-1 and large loss of 59.8%. Therefore, Cu0.02Ti0.94Nb2.04O7 possesses great potential for the application in lithium-ion batteries for electric vehicles.

  4. Lithium Ion Cell Development for Photovoltaic Energy Storage Applications

    Energy Technology Data Exchange (ETDEWEB)

    Babinec, Susan [A123 Systems, Inc., Waltham, MA (United States)

    2012-02-08

    The overall project goal is to reduce the cost of home and neighborhood photovoltaic storage systems by reducing the single largest cost component the energy storage cells. Solar power is accepted as an environmentally advantaged renewable power source. Its deployment in small communities and integrated into the grid, requires a safe, reliable and low cost energy storage system. The incumbent technology of lead acid cells is large, toxic to produce and dispose of, and offer limited life even with significant maintenance. The ideal PV storage battery would have the safety and low cost of lead acid but the performance of lithium ion chemistry. Present lithium ion batteries have the desired performance but cost and safety remain the two key implementation barriers. The purpose of this project is to develop new lithium ion cells that can meet PVES cost and safety requirements using A123Systems phosphate-based cathode chemistries in commercial PHEV cell formats. The cost target is a cell design for a home or neighborhood scale at <$25/kWh. This DOE program is the continuation and expansion of an initial MPSC (Michigan Public Service Commission) program towards this goal. This program further pushes the initial limits of some aspects of the original program even lower cost anode and cathode actives implemented at even higher electrode loadings, and as well explores new avenues of cost reduction via new materials specifically our higher voltage cathode. The challenge in our materials development is to achieve parity in the performance metrics of cycle life and high temperature storage, and to produce quality materials at the production scale. Our new cathode material, M1X, has a higher voltage and so requires electrolyte reformulation to meet the high temperature storage requirements. The challenge of thick electrode systems is to maintain adequate adhesion and cycle life. The composite separator has been proven in systems having standard loading electrodes; the challenge

  5. Electrospun porous carbon nanofiber@MoS2 core/sheath fiber membranes as highly flexible and binder-free anodes for lithium-ion batteries

    Science.gov (United States)

    Miao, Yue-E.; Huang, Yunpeng; Zhang, Longsheng; Fan, Wei; Lai, Feili; Liu, Tianxi

    2015-06-01

    Self-standing membranes of porous carbon nanofiber (PCNF)@MoS2 core/sheath fibers have been facilely obtained through a combination of electrospinning, high-temperature carbonization and the solvothermal reaction. PCNF fibers with porous channels are used as building blocks for the construction of hierarchical PCNF@MoS2 composites where thin MoS2 nanosheets are uniformly distributed on the PCNF surface. Thus, a three-dimensional open structure is formed, which provides a highly conductive pathway for rapid charge-transfer reactions, as well as greatly improving the surface active sites of MoS2 for fast lithiation/delithiation of Li+ ions. The highly flexible PCNF@MoS2 composite membrane electrode exhibits synergistically improved electrochemical performance with a high specific capacity of 954 mA h g-1 upon the initial discharge, a high rate capability of 475 mA h g-1 even at a high current density of 1 A g-1, and good cycling stability with almost 100% retention after 50 cycles, indicating its potential application as a binder-free anode for high-performance lithium-ion batteries.Self-standing membranes of porous carbon nanofiber (PCNF)@MoS2 core/sheath fibers have been facilely obtained through a combination of electrospinning, high-temperature carbonization and the solvothermal reaction. PCNF fibers with porous channels are used as building blocks for the construction of hierarchical PCNF@MoS2 composites where thin MoS2 nanosheets are uniformly distributed on the PCNF surface. Thus, a three-dimensional open structure is formed, which provides a highly conductive pathway for rapid charge-transfer reactions, as well as greatly improving the surface active sites of MoS2 for fast lithiation/delithiation of Li+ ions. The highly flexible PCNF@MoS2 composite membrane electrode exhibits synergistically improved electrochemical performance with a high specific capacity of 954 mA h g-1 upon the initial discharge, a high rate capability of 475 mA h g-1 even at a high

  6. Li(+)-conductive polymer-embedded nano-Si particles as anode material for advanced Li-ion batteries.

    Science.gov (United States)

    Chen, Yao; Zeng, Shi; Qian, Jianfeng; Wang, Yadong; Cao, Yuliang; Yang, Hanxi; Ai, Xinping

    2014-03-12

    Si has been considered as a promising alternative anode for next-generation lithium ion batteries (LIBs), but the commercial application of Si anodes is still limited due to their poor cyclability. In this paper, we propose a new strategy to enhance the long-term cyclability of Si anode by embedding nano-Si particles into a Li(+)-conductive polymer to form a Si/polymer composite with core-shell structure, in which nano-Si cores act as active Li-storage phase and the polymeric matrix serves not only as a strong buffer to accommodate the volume change, but also as a protection barrier to prevent the direct contact of Si surface with electrolyte, so as to maintain the mechanical integrity of Si anode and suppress the repeated destruction and construction of solid electrolyte interphase (SEI) on the Si surface. To realize this strategy, we synthesize a Si/PPP (polyparaphenylene) composite simply by ball-milling the Si nanoparticles with PPP polymer that has n-doping activity. Our experimental results demonstrate that the thus-prepared Si/PPP composite exhibits a high capacity of 3184 mA h g(-1) with an initial coulombic efficiency of 78%, an excellent rate capability with a considerably high capacity of 1670 mA h g(-1) even at a very high rate of 16 A g(-1), and a long-term cyclability with 60% capacity retention over 400 cycles, showing a great prospect for battery application. In addition, this structural design could be adopted to other Li-storable metals or alloys for developing cycle-stable anode materials for Li-ion batteries.

  7. Thigh burns from exploding e-cigarette lithium ion batteries: First case series.

    Science.gov (United States)

    Nicoll, K J; Rose, A M; Khan, M A A; Quaba, O; Lowrie, A G

    2016-06-01

    E-cigarette (EC) use has risen meteorically over the last decade. The majority of these devices are powered by re-chargeable lithium ion batteries, which can represent a fire hazard if damaged, over-heated, over-charged or stored inappropriately. There are currently no reports in the medical literature of lithium ion battery burns related to EC use and no guidance on the appropriate management of lithium ion battery associated injuries. We report two individual cases of burn resulting from explosion of EC re-chargeable lithium ion batteries. Both patients required in-patient surgical management. We provide evidence that lithium ion battery explosions can be associated with mixed thermal and alkali chemical burns, resulting from the significant discharge of thermal energy and the dispersal of corrosive lithium ion compounds. We would recommend, as with other elemental metal exposures, caution in exposing lithium ion battery burns to water irrigation. Early and thorough cleaning and debridement of such burns, to remove residual lithium contamination, may limit the risk of burn wound extension and potentially improve outcomes. Copyright © 2016 Elsevier Ltd and ISBI. All rights reserved.

  8. Mesoporous Silicon Hollow Nanocubes Derived from Metal-Organic Framework Template for Advanced Lithium-Ion Battery Anode.

    Science.gov (United States)

    Yoon, Taeseung; Bok, Taesoo; Kim, Chulhyun; Na, Younghoon; Park, Soojin; Kim, Kwang S

    2017-05-23

    Controlling the morphology of nanostructured silicon is critical to improving the structural stability and electrochemical performance in lithium-ion batteries. The use of removable or sacrificial templates is an effective and easy route to synthesize hollow materials. Herein, we demonstrate the synthesis of mesoporous silicon hollow nanocubes (m-Si HCs) derived from a metal-organic framework (MOF) as an anode material with outstanding electrochemical properties. The m-Si HC architecture with the mesoporous external shell (∼15 nm) and internal void (∼60 nm) can effectively accommodate volume variations and relieve diffusion-induced stress/strain during repeated cycling. In addition, this cube architecture provides a high electrolyte contact area because of the exposed active site, which can promote the transportation of Li ions. The well-designed m-Si HC with carbon coating delivers a high reversible capacity of 1728 mAhg -1 with an initial Coulombic efficiency of 80.1% after the first cycle and an excellent rate capability of >1050 mAhg -1 even at a 15 C-rate. In particular, the m-Si HC anode effectively suppresses electrode swelling to ∼47% after 100 cycles and exhibits outstanding cycle stability of 850 mAhg -1 after 800 cycles at a 1 C-rate. Moreover, a full cell (2.9 mAhcm -2 ) comprising a m-Si HC-graphite anode and LiCoO 2 cathode exhibits remarkable cycle retention of 72% after 100 cycles at a 0.2 C-rate.

  9. Nb{sub 2}O{sub 5} hollow nanospheres as anode material for enhanced performance in lithium ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Sasidharan, Manickam [Department of Chemistry, Faculty of Science and Engineering, Saga University, 1 Honjo-machi, Saga 840-8502 (Japan); Gunawardhana, Nanda [Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki, E-mail: yoshio@cc.saga-u.ac.jp [Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Nakashima, Kenichi, E-mail: nakashik@cc.saga-u.ac.jp [Department of Chemistry, Faculty of Science and Engineering, Saga University, 1 Honjo-machi, Saga 840-8502 (Japan)

    2012-09-15

    Graphical abstract: Nb{sub 2}O{sub 5} hollow nanosphere constructed electrode delivers high capacity of 172 mAh g{sup −1} after 250 cycles and maintains structural integrity and excellent cycling stability. Highlights: ► Nb{sub 2}O{sub 5} hollow nanospheres synthesis was synthesized by soft-template. ► Nb{sub 2}O{sub 5} hollow nanospheres were investigated as anode material in Li-ion battery. ► Nanostructured electrode delivers high capacity of 172 mAh g{sup −1} after 250 cycles. ► The electrode maintains the structural integrity and excellent cycling stability. ► Nanosized shell domain facilitates fast lithium intercalation/deintercalation. -- Abstract: Nb{sub 2}O{sub 5} hollow nanospheres of average diameter ca. ∼29 nm and hollow cavity size ca. 17 nm were synthesized using polymeric micelles with core–shell–corona architecture under mild conditions. The hollow particles were thoroughly characterized by transmission electron microscope (TEM), X-ray diffraction (XRD), infrared spectroscopy (FTIR), thermal (TG/DTA) and nitrogen adsorption analyses. Thus obtained Nb{sub 2}O{sub 5} hollow nanospheres were investigated as anode materials for lithium ion rechargeable batteries for the first time. The nanostructured electrode delivers high capacity of 172 mAh g{sup −1} after 250 cycles of charge/discharge at a rate of 0.5 C. More importantly, the hollow particles based electrodes maintains the structural integrity and excellent cycling stability even after exposing to high current density 6.25 A g{sup −1}. The enhanced electrochemical behavior is ascribed to hollow cavity coupled with nanosized Nb{sub 2}O{sub 5} shell domain that facilitates fast lithium intercalation/deintercalation kinetics.

  10. Hierarchical structured graphene/metal oxide/porous carbon composites as anode materials for lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Rong [Beijing Key Laboratory of Energy Conversion and Storage Materials, College of Chemistry, Beijing Normal University, Beijing 100875 (China); Yue, Wenbo, E-mail: wbyue@bnu.edu.cn [Beijing Key Laboratory of Energy Conversion and Storage Materials, College of Chemistry, Beijing Normal University, Beijing 100875 (China); Ren, Yu [National Institute of Clean-and-Low-Carbon Energy, Beijing 102209 (China); Zhou, Wuzong [School of Chemistry, University of St. Andrews, St. Andrews, Fite KY16 9ST (United Kingdom)

    2016-01-15

    Highlights: • CeO{sub 2} and Co{sub 3}O{sub 4} nanoparticles display different behavior within CMK-3. • CMK-3-CeO{sub 2} and Co{sub 3}O{sub 4} show various electrochemical properties • CMK-3-CeO{sub 2} and Co{sub 3}O{sub 4} are further wrapped by graphene nanosheets. • Graphene-encapsulated composites show better electrochemical performances. - Abstract: As a novel anode material for lithium-ion batteries, CeO{sub 2} displays imperceptible volumetric and morphological changes during the lithium insertion and extraction processes, and thereby exhibits good cycling stability. However, the low theoretical capacity and poor electronic conductivity of CeO{sub 2} hinder its practical application. In contrast, Co{sub 3}O{sub 4} possesses high theoretical capacity, but undergoes huge volume change during cycling. To overcome these issues, CeO{sub 2} and Co{sub 3}O{sub 4} nanoparticles are formed inside the pores of CMK-3 and display various electrochemical behaviors due to the different morphological structures of CeO{sub 2} and Co{sub 3}O{sub 4} within CMK-3. Moreover, the graphene/metal oxide/CMK-3 composites with a hierarchical structure are then prepared and exhibit better electrochemical performances than metal oxides with or without CMK-3. This novel synthesis strategy is hopefully employed in the electrode materials design for Li-ion batteries or other energy conversion and storage devices.

  11. Defective Ti2Nb10O27.1: an advanced anode material for lithium-ion batteries

    Science.gov (United States)

    Lin, Chunfu; Yu, Shu; Zhao, Hua; Wu, Shunqing; Wang, Guizhen; Yu, Lei; Li, Yanfang; Zhu, Zi-Zhong; Li, Jianbao; Lin, Shiwei

    2015-12-01

    To explore anode materials with large capacities and high rate performances for the lithium-ion batteries of electric vehicles, defective Ti2Nb10O27.1 has been prepared through a facile solid-state reaction in argon. X-ray diffractions combined with Rietveld refinements indicate that Ti2Nb10O27.1 has the same crystal structure with stoichiometric Ti2Nb10O29 (Wadsley-Roth shear structure with A2/m space group) but larger lattice parameters and 6.6% O2- vacancies (vs. all O2- ions). The electronic conductivity and Li+ion diffusion coefficient of Ti2Nb10O27.1 are at least six orders of magnitude and ~2.5 times larger than those of Ti2Nb10O29, respectively. First-principles calculations reveal that the significantly enhanced electronic conductivity is attributed to the formation of impurity bands in Ti2Nb10O29-x and its conductor characteristic. As a result of the improvements in the electronic and ionic conductivities, Ti2Nb10O27.1 exhibits not only a large initial discharge capacity of 329 mAh g-1 and charge capacity of 286 mAh g-1 at 0.1 C but also an outstanding rate performance and cyclability. At 5 C, its charge capacity remains 180 mAh g-1 with large capacity retention of 91.0% after 100 cycles, whereas those of Ti2Nb10O29 are only 90 mAh g-1 and 74.7%.

  12. Lithium-ion batteries with intrinsic pulse overcharge protection

    Science.gov (United States)

    Chen, Zonghai; Amine, Khalil

    2013-02-05

    The present invention relates in general to the field of lithium rechargeable batteries, and more particularly relates to the positive electrode design of lithium-ion batteries with improved high-rate pulse overcharge protection. Thus the present invention provides electrochemical devices containing a cathode comprising at least one primary positive material and at least one secondary positive material; an anode; and a non-aqueous electrolyte comprising a redox shuttle additive; wherein the redox potential of the redox shuttle additive is greater than the redox potential of the primary positive material; the redox potential of the redox shuttle additive is lower than the redox potential of the secondary positive material; and the redox shuttle additive is stable at least up to the redox potential of the secondary positive material.

  13. Carbon Cryogel Silicon Composite Anode Materials for Lithium Ion Batteries

    Science.gov (United States)

    Woodworth James; Baldwin, Richard; Bennett, William

    2010-01-01

    A variety of materials are under investigation for use as anode materials in lithium-ion batteries, of which, the most promising are those containing silicon. 10 One such material is a composite formed via the dispersion of silicon in a resorcinol-formaldehyde (RF) gel followed by pyrolysis. Two silicon-carbon composite materials, carbon microspheres and nanofoams produced from nano-phase silicon impregnated RF gel precursors have been synthesized and investigated. Carbon microspheres are produced by forming the silicon-containing RF gel into microspheres whereas carbon nano-foams are produced by impregnating carbon fiber paper with the silicon containing RF gel to create a free standing electrode. 1-4,9 Both materials have demonstrated their ability to function as anodes and utilize the silicon present in the material. Stable reversible capacities above 400 mAh/g for the bulk material and above 1000 mAh/g of Si have been observed.

  14. Reliable reference electrodes for lithium-ion batteries

    KAUST Repository

    La Mantia, F.

    2013-06-01

    Despite the high attention drawn to the lithium-ion batteries by the scientific and industrial community, most of the electrochemical characterization is carried out using poor reference electrodes or even no reference electrode. In this case, the performances of the active material are inaccurate, especially at high current densities. In this work we show the error committed in neglecting the polarizability of lithium counter electrodes, and we propose two reference electrodes to use in organic electrolytes based on lithium salts, namely Li4Ti5O12 and LiFePO 4. In particular, it was observed that, the polarizability of the metallic lithium counter electrode has a relevant stochastic component, which renders measurements at high current densities (above 1 mA·cm - 2) in two electrode cells non reproducible.

  15. Results of screening over 200 pristine lithium-ion cells

    DEFF Research Database (Denmark)

    Varela Barreras, Jorge; Raj, Trishna; Howey, David

    2017-01-01

    This paper presents and analyses results from simplified screening tests conducted on more than 200 large format Kokam NMC lithium-ion pouch cells at their beginning of life. Such data are not common in the literature. The cells were sandwiched between two large heat sinks for testing, which...... resistance. In this paper, statistical results show that the cells under test present small cell-to-cell differences in capacities and internal resistances at their beginning-of-life. For example, the relative standard deviation is below 0.4 % for the capacities and 2.5 % for the pure ohmic plus polarization...... resistances. However, these differences may be enhanced by system level issues, and exacerbated over time by complex degradation mechanisms....

  16. Lithium-Ion Battery Cycling for Magnetism Control.

    Science.gov (United States)

    Zhang, Qingyun; Luo, Xi; Wang, Luning; Zhang, Lifang; Khalid, Bilal; Gong, Jianghong; Wu, Hui

    2016-01-13

    Magnetization and electric-field coupling is fundamentally interesting and important. Specifically, current- or voltage-driven magnetization switching at room temperature is highly desirable from scientific and technological viewpoints. Herein, we demonstrate that magnetization can be controlled via the discharge-charge cycling of a lithium-ion battery (LIB) with rationally designed electrode nanomaterials. Reversible manipulation of magnetism over 3 orders of magnitude was achieved by controlling the lithiation/delithiation of a nanoscale α-Fe2O3-based electrode. The process was completed rapidly under room-temperature conditions. Our results indicate that in addition to energy storage LIBs, which have been under continuous development for several decades, provide exciting opportunities for the multireversible magnetization of magnetic fields.

  17. Robust recursive impedance estimation for automotive lithium-ion batteries

    Science.gov (United States)

    Fridholm, Björn; Wik, Torsten; Nilsson, Magnus

    2016-02-01

    Recursive algorithms, such as recursive least squares (RLS) or Kalman filters, are commonly used in battery management systems to estimate the electrical impedance of the battery cell. However, these algorithms can in some cases run into problems with bias and even divergence of the estimates. This article illuminates problems that can arise in the online estimation using recursive methods, and lists modifications to handle these issues. An algorithm is also proposed that estimates the impedance by separating the problem in two parts; one estimating the ohmic resistance with an RLS approach, and another one where the dynamic effects are estimated using an adaptive Kalman filter (AKF) that is novel in the battery field. The algorithm produces robust estimates of ohmic resistance and time constant of the battery cell in closed loop with SoC estimation, as demonstrated by both in simulations and with experimental data from a lithium-ion battery cell.

  18. Electronically conductive polymer binder for lithium-ion battery electrode

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Gao; Xun, Shidi; Battaglia, Vincent S.; Zheng, Honghe; Wu, Mingyan

    2017-08-01

    A family of carboxylic acid groups containing fluorene/fluorenon copolymers is disclosed as binders of silicon particles in the fabrication of negative electrodes for use with lithium ion batteries. Triethyleneoxide side chains provide improved adhesion to materials such as, graphite, silicon, silicon alloy, tin, tin alloy. These binders enable the use of silicon as an electrode material as they significantly improve the cycle-ability of silicon by preventing electrode degradation over time. In particular, these polymers, which become conductive on first charge, bind to the silicon particles of the electrode, are flexible so as to better accommodate the expansion and contraction of the electrode during charge/discharge, and being conductive promote the flow battery current.

  19. Secondary-Phase Stochastics in Lithium-Ion Battery Electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Kandler A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Mistry, Aashutosh N. [Purdue University; Mukherjee, Partha P. [Purdue University

    2018-01-12

    Lithium-ion battery electrodes exhibit complex interplay among multiple electrochemically coupled transport processes, which rely on the underlying functionality and relative arrangement of different constituent phases. The electrochemically inactive solid phases (e.g., conductive additive and binder, referred to as the secondary phase), while beneficial for improved electronic conductivity and mechanical integrity, may partially block the electrochemically active sites and introduce additional transport resistances in the pore (electrolyte) phase. In this work, the role of mesoscale interactions and inherent stochasticity in porous electrodes is elucidated in the context of short-range (interface) and long-range (transport) characteristics. The electrode microstructure significantly affects kinetically and transport-limiting scenarios and thereby the cell performance. The secondary-phase morphology is also found to strongly influence the microstructure-transport-kinetics interactions. Apropos, strategies have been proposed for performance improvement via electrode microstructural modifications.

  20. Interfacial Fracture of Nanowire Electrodes of Lithium-Ion Batteries

    Science.gov (United States)

    Hardin, G. R.; Zhang, Y.; Fincher, C. D.; Pharr, M.

    2017-09-01

    Nanowires (NW) have emerged as a promising design for high power-density lithium-ion battery (LIB) electrodes. However, volume changes during cycling can lead to fracture of the NWs. In this paper, we investigate a particularly detrimental form of fracture: interfacial detachment of the NW from the current collector (CC). We perform finite element simulations to calculate the energy release rates of NWs during lithiation as a function of geometric parameters and mechanical properties. The simulations show that the energy release rate of a surface crack decreases as it propagates along the NW/CC interface toward the center of the NW. Moreover, this paper demonstrates that plastic deformation in the NWs drastically reduces stresses and thus crack-driving forces, thereby mitigating interfacial fracture. Overall, the results in this paper provide design guidelines for averting NW/CC interfacial fractures during operation of LIBs.

  1. Metal-organic frameworks for lithium ion batteries and supercapacitors

    Science.gov (United States)

    Ke, Fu-Sheng; Wu, Yu-Shan; Deng, Hexiang

    2015-03-01

    Porous materials have been widely used in batteries and supercapacitors attribute to their large internal surface area (usually 100-1000 m2 g-1) and porosity that can favor the electrochemical reaction, interfacial charge transport, and provide short diffusion paths for ions. As a new type of porous crystalline materials, metal-organic frameworks (MOFs) have received huge attention in the past decade due to their unique properties, i.e. huge surface area (up to 7000 m2 g-1), high porosity, low density, controllable structure and tunable pore size. A wide range of applications including gas separation, storage, catalysis, and drug delivery benefit from the recent fast development of MOFs. However, their potential in electrochemical energy storage has not been fully revealed. Herein, the present mini review appraises recent and significant development of MOFs and MOF-derived materials for rechargeable lithium ion batteries and supercapacitors, to give a glimpse into these potential applications of MOFs.

  2. Lithium Ion Storage Characteristics of Mechanically Fractured Titanate Nanotubes

    Directory of Open Access Journals (Sweden)

    Jeongeun Kim

    2012-01-01

    Full Text Available The effect of mechanical milling on the formation of short titanate nanotube and structural change induced is investigated. Mechanical milling produces the short nanotubes with the length of 30–160 nm. The lithium ion intercalation characteristics of the obtained short titanate nanotube were studied to verify the effect of the newly formed cross-sections of nanotubes. It was found that the protonated titanate nanotubes maintained long shapes until 30 min of mechanical milling and were transformed into agglomerated nanosheets and finally anatase granules depending on the treatment duration. Through galvanostatic investigation, the nanotubes with milling of 15 min exhibited the highest discharge capacity of 336 mAh·g−1 in first cycle, 12.4% larger than pristine.

  3. Electronically conductive polymer binder for lithium-ion battery electrode

    Science.gov (United States)

    Liu, Gao; Xun, Shidi; Battaglia, Vincent S.; Zheng, Honghe; Wu, Mingyan

    2015-07-07

    A family of carboxylic acid groups containing fluorene/fluorenon copolymers is disclosed as binders of silicon particles in the fabrication of negative electrodes for use with lithium ion batteries. Triethyleneoxide side chains provide improved adhesion to materials such as, graphite, silicon, silicon alloy, tin, tin alloy. These binders enable the use of silicon as an electrode material as they significantly improve the cycle-ability of silicon by preventing electrode degradation over time. In particular, these polymers, which become conductive on first charge, bind to the silicon particles of the electrode, are flexible so as to better accommodate the expansion and contraction of the electrode during charge/discharge, and being conductive promote the flow battery current.

  4. Oral Exposure of a Child to a Lithium Ion Battery.

    Science.gov (United States)

    Townsend, Janice A; Curran, Ronald

    2016-01-01

    Battery exposure has the potential for severe morbidity and possible mortality. Accidental exposure is rising with the increased use of button batteries, and young children and older adults are at highest risk for accidental exposure. The purpose of this paper is to report a case of mouth exposure to a lithium ion battery in a boy. A review of the current literature on incidence, diagnosis, and outcomes of battery exposure is presented. When symptoms such as diarrhea, vomiting, and abdominal distress of non-specific origin are present, battery ingestion should be included in the differential diagnosis. Dentists may be the first health professionals to encounter battery exposure, especially in the case of mouth exposures. Knowledge of signs and symptoms are necessary to properly diagnose and refer for medical management.

  5. Synthesis of Lithium Fluoride from Spent Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Daniela S. Suarez

    2017-05-01

    Full Text Available Lithium (Li is considered a strategic element whose use has significantly expanded. Its current high demand is due to its use in lithium ion batteries for portable electronic devices, whose manufacture and market are extensively growing every day. These days there is a great concern about the final disposal of these batteries. Therefore, the possibility of developing new methodologies to recycle their components is of great importance, both commercially and environmentally. This paper presents results regarding important operational variables for the dissolution of the lithium and cobalt mixed-oxide (LiCoO2 cathodes from spent lithium ion batteries (LIBs with hydrofluoric acid. The recovery and synthesis of Co and Li compounds were also investigated. The dissolution parameters studied were: temperature, reaction time, solid-liquid ratio, stirring speed, and concentration of HF. The investigated recovery parameters included: pH, temperature, and time with and without stirring. The final precipitation of lithium fluoride was also examined. The results indicate that an increase in the HF concentration, temperature, and reaction time favors the leaching reaction of the LiCoO2. Dissolutions were close to 60%, at 75 °C and 120 min with a HF concentration of 25% (v/v. The recovery of Co and Li were 98% and 80%, respectively, with purities higher than 94%. Co and Li compounds, such as Co3O4 and LiF, were synthesized. Furthermore, it was possible to almost completely eliminate the F− ions as CaF2.

  6. Fully Coupled Simulation of Lithium Ion Battery Cell Performance

    Energy Technology Data Exchange (ETDEWEB)

    Trembacki, Bradley L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Murthy, Jayathi Y. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Roberts, Scott Alan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-09-01

    Lithium-ion battery particle-scale (non-porous electrode) simulations applied to resolved electrode geometries predict localized phenomena and can lead to better informed decisions on electrode design and manufacturing. This work develops and implements a fully-coupled finite volume methodology for the simulation of the electrochemical equations in a lithium-ion battery cell. The model implementation is used to investigate 3D battery electrode architectures that offer potential energy density and power density improvements over traditional layer-by-layer particle bed battery geometries. Advancement of micro-scale additive manufacturing techniques has made it possible to fabricate these 3D electrode microarchitectures. A variety of 3D battery electrode geometries are simulated and compared across various battery discharge rates and length scales in order to quantify performance trends and investigate geometrical factors that improve battery performance. The energy density and power density of the 3D battery microstructures are compared in several ways, including a uniform surface area to volume ratio comparison as well as a comparison requiring a minimum manufacturable feature size. Significant performance improvements over traditional particle bed electrode designs are observed, and electrode microarchitectures derived from minimal surfaces are shown to be superior. A reduced-order volume-averaged porous electrode theory formulation for these unique 3D batteries is also developed, allowing simulations on the full-battery scale. Electrode concentration gradients are modeled using the diffusion length method, and results for plate and cylinder electrode geometries are compared to particle-scale simulation results. Additionally, effective diffusion lengths that minimize error with respect to particle-scale results for gyroid and Schwarz P electrode microstructures are determined.

  7. Technology roadmap for lithium ion batteries 2030; Technologie-Roadmap Lithium-Ionen-Batterien 2030

    Energy Technology Data Exchange (ETDEWEB)

    Thielmann, Axel; Isenmann, Ralf; Wietschel, Martin [Fraunhofer-Institut fuer Systemtechnik und Innovationsforschung (ISI), Karlsruhe (Germany)

    2010-07-01

    The technology roadmap for lithium ion batteries 2030 presents a graphical representation of the cell components, cell types and cell characteristics of lithium ion batteries and their connection with the surrounding technology field from today through 2030. This is a farsighted orientation on the way into the future and an implementation of the ''Roadmap: Batterieforschung Deutschland'' of the BMBF (Federal Ministry of Education and Science). The developments in lithium ion batteries are identified through 2030 form today's expert view in battery development and neighbouring areas. (orig.)

  8. Evaluation of different methods for measuring the impedance of Lithium-ion batteries during ageing

    DEFF Research Database (Denmark)

    Stroe, Daniel Loan; Swierczynski, Maciej Jozef; Stroe, Ana-Irina

    2015-01-01

    The impedance represents one of the most important performance parameters of the Lithium-ion batteries since it used for power capability calculations, battery pack and system design, cooling system design and also for state-of-health estimation. In the literature, different approaches...... are presented for measuring the impedance of Lithium-ion batteries and electrochemical impedance spectroscopy and dc current pulses are the most used ones; each of these approaches has its own advantages and drawbacks. The goal of this paper is to investigate which of the most encountered impedance measurement...... approaches is the most suitable for measuring the impedance of Lithium-ion batteries during ageing....

  9. Stable high-order molecular sandwiches: Hydrocarbon polyanion pairs with multiple lithium ions inside and out

    Energy Technology Data Exchange (ETDEWEB)

    Ayalon, A.; Rabinovitz, M. (Hebrew Univ. of Jerusalem (Israel)); Sygula, A.; Rabideau, P.W. (Louisiana State Univ., Baton Rouge, LA (United States)); Cheng, P.C.; Scott, L.T. (Boston College, Chestnut Hill, MA (United States))

    1994-08-19

    Stable ten-component sandwich compounds have been characterized in which four lithium ions reside between two tetraanions derived from corannulene or its alkyl-substituted derivatives and four additional lithium ions decorate the exterior. In tetrahydrofuran solution, the four lithium ions inside the sandwich can exchange environments with the four external lithium atoms, but the two tetraanion decks of the sandwich never separate from one another on the time scale of nuclear magnetic resonance. Theoretical calculations point to a [open quotes]stacked bowl[close quotes] conformation and a low energy barrier for synchronous double inversion of the tetraanion bowls in the solvated sandwich compounds.

  10. Two-dimensional Thermal Modeling of Lithium-ion Battery Cell Based on Electrothermal Impedance Spectroscopy

    DEFF Research Database (Denmark)

    Swierczynski, Maciej Jozef; Stroe, Daniel Loan; Knap, Vaclav

    2016-01-01

    Thermal modeling of lithium-ion batteries is gaining its importance together with increasing power density and compact design of the modern battery systems in order to assure battery safety and long lifetime. Thermal models of lithium-ion batteries are usually either expensive to develop...... and accurate or equivalent thermal circuit based with moderate accuracy and without spatial temperature distribution. This work presents initial results that can be used as a fundament for the cost-efficient development of the two-dimensional thermal model of lithium-ion battery based on multipoint...

  11. Surface-Modified Membrane as A Separator for Lithium-Ion Polymer Battery

    Directory of Open Access Journals (Sweden)

    Jun Young Kim

    2010-04-01

    Full Text Available This paper describes the fabrication of novel modified polyethylene (PE membranes using plasma technology to create high-performance and cost-effective separator membranes for practical applications in lithium-ion polymer batteries. The modified PE membrane via plasma modification process plays a critical role in improving wettability and electrolyte retention, interfacial adhesion between separators and electrodes, and cycle performance of lithium-ion polymer batteries. This paper suggests that the performance of lithium-ion polymer batteries can be greatly enhanced by the plasma modification of commercial separators with proper functional materials for targeted application.

  12. Measurements of electrode potentials in practical lithium ion cells; Jitsuyogata lithium ion denchi no tankyoku den`i hyoka shuho no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Miyashiro, H.; Kobayashi, Y.; Takei, K.; Kumai, K. [Central Research Institute of Electric Power Industry, Tokyo (Japan)

    1996-06-01

    A new technique has been developed, which allows simultaneous measurements of individual potentials of the cathode and anode, and temperature of center of the practical lithium ion cells. The developed technique was applied to commercialized lithium ion cells as received and degraded by high rate charge/discharge cycles, to confirm efficiency of the technique. For the developed technique, metal lithium was attached on the surface of stainless steel sheathed thermocouple with a diameter of 1 mm, and this was inserted in the center of the cell through a hole at the bottom of cathode can to measure the temperature of center of the cell as well as to use itself as a reference electrode. The modified cells could provide stable charge/discharge cycles for more than two months during the test. Thus, the developed technique was applied to commercialized lithium ion cells as received and degraded by cycles. It was found that increasing of lithium ion insertion/desertion resistance on the cathode and/or increasing of electric resistance of the cathode were the main reason of the degradation of lithium ion cells investigated. Effectiveness of this technique for diagnosis of degradation of cells was confirmed. 5 refs., 16 figs., 1 tab.

  13. High Capacity, Superior Cyclic Performances in All-Solid-State Lithium-Ion Batteries Based on 78Li2S-22P2S5 Glass-Ceramic Electrolytes Prepared via Simple Heat Treatment.

    Science.gov (United States)

    Zhang, Yibo; Chen, Rujun; Liu, Ting; Shen, Yang; Lin, Yuanhua; Nan, Ce-Wen

    2017-08-30

    Highly Li-ion conductive 78Li2S-22P2S5 glass-ceramic electrolytes were prepared by simple heat treatment of the glass phase obtained via mechanical ball milling. A high ionic conductivity of ∼1.78 × 10(-3) S cm(-1) is achieved at room temperature and is attributed to the formation of a crystalline phase of high lithium-ion conduction. All-solid-state lithium-ion batteries based on these glass-ceramic electrolytes are assembled by using Li2S nanoparticles or low-cost commercially available FeS2 as active cathode materials and Li-In alloys as anode. A high discharge capacity of 535 mAh g(-1) is achieved after at least 50 cycles for the all-solid-state cells with Li2S as cathode materials, suggesting a rather high capacity retention of 97.4%. Even for the cells using low-cost FeS2 as cathode materials, same high discharge capacity of 560 mAh g(-1) is also achieved after at least 50 cycles. Moreover, the Coulombic efficiency remain at ∼99% for these all-solid-state cells during the charge-discharge cycles.

  14. Recent progress in theoretical and computational investigations of Li-ion battery materials and electrolytes.

    Science.gov (United States)

    Bhatt, Mahesh Datt; O'Dwyer, Colm

    2015-02-21

    There is an increasing worldwide demand for high energy density batteries. In recent years, rechargeable Li-ion batteries have become important power sources, and their performance gains are driving the adoption of electrical vehicles (EV) as viable alternatives to combustion engines. The exploration of new Li-ion battery materials is an important focus of materials scientists and computational physicists and chemists throughout the world. The practical applications of Li-ion batteries and emerging alternatives may not be limited to portable electronic devices and circumventing hurdles that include range anxiety and safety among others, to their widespread adoption in EV applications in the future requires new electrode materials and a fuller understanding of how the materials and the electrolyte chemistries behave. Since this field is advancing rapidly and attracting an increasing number of researchers, it is crucial to summarise the current progress and the key scientific challenges related to Li-ion batteries from theoretical point of view. Computational prediction of ideal compounds is the focus of several large consortia, and a leading methodology in designing materials and electrolytes optimized for function, including those for Li-ion batteries. In this Perspective, we review the key aspects of Li-ion batteries from theoretical perspectives: the working principles of Li-ion batteries, the cathodes, anodes, and electrolyte solutions that are the current state of the art, and future research directions for advanced Li-ion batteries based on computational materials and electrolyte design.

  15. OPTIMIZATION BALANCING DEVICES LI-ION BATTERIES FOR HYBRID AND ELECTRIC VEHICLES

    Directory of Open Access Journals (Sweden)

    R. P. Sharkovich

    2016-01-01

    Full Text Available The article discusses and proves the feasibility of using the proposed system balancing Li-ion battery consisting of a plurality of series-connected cells, applied to hybrid and electric transportation. The main objective of the system is to increase the performance and operating time of Li-ion batteries.

  16. The recycling of lithium-ion batteries is industrializing; Le recyclage des batteries lithium-ion s'industrialise

    Energy Technology Data Exchange (ETDEWEB)

    Lepetit, V.

    2004-12-01

    The 2003 production of lithium-ion batteries represent 7600 t of cobalt consumed. The Belgium metal working company Umicore has developed a recycling technology for these batteries, named Val'Eas. In this process, the batteries are directly introduced in the melting furnace where a pyro-metallurgic process separates the different materials in a single step. Plastic parts are burnt, some others are oxidized to make a light slags phase (alumina, silica, lime) and the metals to be valorized are melted together to make a heavy iron, nickel, lithium and cobalt alloy which is separated from the slag phase by decantation. The combustion gases are treated with a plasma torch and about 80% of the heat used in this process comes from the process itself (combustion of plastics and aluminium oxidation) and is recovered through a heat exchanger. An industrial development of this process is under study by Umicore. Short paper. (J.S.)

  17. Three-dimensional core-shell Fe{sub 2}O{sub 3} @ carbon/carbon cloth as binder-free anode for the high-performance lithium-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiaohua; Zhang, Miao [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300350 (China); Liu, Enzuo, E-mail: ezliu@tju.edu.cn [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300350 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300350 (China); He, Fang; Shi, Chunsheng [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300350 (China); He, Chunnian [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300350 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300350 (China); Li, Jiajun [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300350 (China); Zhao, Naiqin, E-mail: nqzhao@tju.edu.cn [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300350 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300350 (China)

    2016-12-30

    Highlights: • The 3D core-shell Fe{sub 2}O{sub 3}@C/CC structure is fabricated by simple hydrothermal route. • The composite connected 3D carbon networks consist of carbon cloth, Fe{sub 2}O{sub 3} nanorods and outer carbon layer. • The Fe{sub 2}O{sub 3}@C/CC used as binder-free anode in LIBs, demonstrates excellent performances. - Abstract: A facile and scalable strategy is developed to fabricate three dimensional core-shell Fe{sub 2}O{sub 3} @ carbon/carbon cloth structure by simple hydrothermal route as binder-free lithium-ion battery anode. In the unique structure, carbon coated Fe{sub 2}O{sub 3} nanorods uniformly disperse on carbon cloth which forms the conductive carbon network. The hierarchical porous Fe{sub 2}O{sub 3} nanorods in situ grown on the carbon cloth can effectively shorten the transfer paths of lithium ions and reduce the contact resistance. The carbon coating significantly inhibits pulverization of active materials during the repeated Li-ion insertion/extraction, as well as the direct exposure of Fe{sub 2}O{sub 3} to the electrolyte. Benefiting from the structural integrity and flexibility, the nanocomposites used as binder-free anode for lithium-ion batteries, demonstrate high reversible capacity and excellent cyclability. Moreover, this kind of material represents an alternative promising candidate for flexible, cost-effective, and binder-free energy storage devices.

  18. Multifunctional Electrolytes for Abuse-Tolerant 5V Li-ion Space Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR Phase I project will develop a multifunctional electrolyte for high energy density abuse-tolerant lithium ion batteries with 5 V cathodes such as LiCoPO4....

  19. Expanded Operational Temperature Range for Space Rated Li-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Quallion's response to this solicitation calls for expanding the nominal operation range of its space rated lithium ion cells, while maintaining their long life...

  20. The cost of lithium is unlikely to upend the price of Li-ion storage systems

    Science.gov (United States)

    Ciez, Rebecca E.; Whitacre, J. F.

    2016-07-01

    As lithium ion batteries become more common in electric vehicles and other storage applications, concerns about the cost of their namesake material, and its impact on the cost of these batteries, will continue. However, examining the constituent materials of these devices shows that lithium is a relatively small contributor to both the battery mass and manufacturing cost. The use of more expensive lithium precursor materials results in less than 1% increases in the cost of lithium ion cells considered. Similarly, larger fluctuations in the global lithium price (from 0 to 25/kg from a baseline of 7.50 per kg of Li2CO3) do not change the cost of lithium ion cells by more than 10%. While this small cost increase will not have a substantial impact on consumers, it could affect the manufacturers of these lithium ion cells, who already operate with small profit margins.

  1. Expanded Operational Temperature Range for Space Rated Li-Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Quallion's Phase II proposal calls for expanding the nominal operation range of its space rated lithium ion cells, while maintaining their long life capabilities. To...

  2. Novel Parametric Circuit Modeling for Li-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Ximing Cheng

    2016-07-01

    Full Text Available Because of their simplicity and dynamic response, current pulse series are often used to extract parameters for equivalent electrical circuit modeling of Li-ion batteries. These models are then applied for performance simulation, state estimation, and thermal analysis in electric vehicles. However, these methods have two problems: The assumption of linear dependence of the matrix columns and negative parameters estimated from discrete-time equations and least-squares methods. In this paper, continuous-time equations are exploited to construct a linearly independent data matrix and parameterize the circuit model by the combination of non-negative least squares and genetic algorithm, which constrains the model parameters to be positive. Trigonometric functions are then developed to fit the parameter curves. The developed model parameterization methodology was applied and assessed by a standard driving cycle.

  3. Low-cost carbon-silicon nanocomposite anodes for lithium ion batteries

    National Research Council Canada - National Science Library

    Badi, Nacer; Erra, Abhinay Reddy; Hernandez, Francisco C Robles; Okonkwo, Anderson O; Hobosyan, Mkhitar; Martirosyan, Karen S

    2014-01-01

    ...) materials have limited lithium ion storage capacities. Carbon nanotubes, graphene, and carbon nanofibers are the most sought alternatives to replace AC materials but their synthesis cost makes them highly prohibitive...

  4. Control of Internal and External Short Circuits in Lithium Ion and Lithium Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — NASA has identified needs for compact high-energy-density primary and secondary batteries. Lithium and Lithium Ion cells, respectively, are meeting these needs for...

  5. Surface reconstruction and chemical evolution of stoichiometric layered cathode materials for lithium-ion batteries

    National Research Council Canada - National Science Library

    Lin, Feng; Markus, Isaac M; Nordlund, Dennis; Weng, Tsu-Chien; Asta, Mark D; Xin, Huolin L; Doeff, Marca M

    2014-01-01

    ...)O2 cathode materials for lithium-ion batteries. Using correlated ensemble-averaged high-throughput X-ray absorption spectroscopy and spatially resolved electron microscopy and spectroscopy, here we report structural reconstruction...

  6. Advances in repurposing and recycling of post-vehicle-application lithium-ion batteries.

    Science.gov (United States)

    2016-05-01

    Increased electrification of vehicles has increased the use of lithium-ion batteries for energy storage, and raised the issue of : what to do with post-vehicle-application batteries. Three possibilities have been identified: 1) remanufacturing for in...

  7. Microfibrillated Cellulose Based Ink for Eco-Sustainable Screen Printed Flexible Electrodes in Lithium Ion Batteries

    National Research Council Canada - National Science Library

    El Baradai, Oussama; Beneventi, Davide; Alloin, Fannie; Bongiovanni, Roberta; Bruas-Reverdy, Nadege; Bultel, Yann; Chaussy, Didier

    2016-01-01

    ... and eco- sustainable electrodes for lithium ion batteries. Content ratio of components and dispersion protocol were tailored in order to have theological properties suitable for a large and cheap manufacturing process as well as screen printing...

  8. Ionic liquid-modulated preparation of hexagonal tungsten trioxide mesocrystals for lithium-ion batteries

    Science.gov (United States)

    Duan, Xiaochuan; Xiao, Songhua; Wang, Lingling; Huang, Hui; Liu, Yuan; Li, Qiuhong; Wang, Taihong

    2015-01-01

    Hexagonal (h-WO3) mesocrystals with biconical morphology were prepared by a straightforward ionic liquid-assisted hydrothermal route and investigated as anodic materials for lithium-ion batteries. Compared to the alternatives, the biconical tungsten trioxide mesocrystal exhibited excellent lithium insertion with good cyclability and rate capability, making it a promising candidate as the anode material for high-performance lithium-ion batteries.Hexagonal (h-WO3) mesocrystals with biconical morphology were prepared by a straightforward ionic liquid-assisted hydrothermal route and investigated as anodic materials for lithium-ion batteries. Compared to the alternatives, the biconical tungsten trioxide mesocrystal exhibited excellent lithium insertion with good cyclability and rate capability, making it a promising candidate as the anode material for high-performance lithium-ion batteries. Electronic supplementary information (ESI) available. See DOI: 10.1039/c4nr05717a

  9. Coupled Mechanical-Electrochemical-Thermal Analysis of Failure Propagation in Lithium-ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Chao; Santhanagopalan, Shriram; Pesaran, Ahmad

    2016-07-28

    This is a presentation given at the 12th World Congress for Computational Mechanics on coupled mechanical-electrochemical-thermal analysis of failure propagation in lithium-ion batteries for electric vehicles.

  10. In Situ Monitoring of Temperature inside Lithium-Ion Batteries by Flexible Micro Temperature Sensors

    Directory of Open Access Journals (Sweden)

    Pei-Chi Chen

    2011-10-01

    Full Text Available Lithium-ion secondary batteries are commonly used in electric vehicles, smart phones, personal digital assistants (PDA, notebooks and electric cars. These lithium-ion secondary batteries must charge and discharge rapidly, causing the interior temperature to rise quickly, raising a safety issue. Over-charging results in an unstable voltage and current, causing potential safety problems, such as thermal runaways and explosions. Thus, a micro flexible temperature sensor for the in in-situ monitoring of temperature inside a lithium-ion secondary battery must be developed. In this work, flexible micro temperature sensors were integrated into a lithium-ion secondary battery using the micro-electro-mechanical systems (MEMS process for monitoring temperature in situ.

  11. Degradation Behaviour of Lithium-Ion Batteries based on Field Measured Frequency Regulation Mission Profile

    DEFF Research Database (Denmark)

    Stroe, Daniel Ioan; Swierczynski, Maciej Jozef; Stroe, Ana-Irina

    2015-01-01

    Energy storage systems based on Lithium-ion batteries have been proposed as an environmental friendly alternative to traditional conventional generating units for providing grid frequency regulation. One major challenge regarding the use of Lithium-ion batteries in such applications is their cost...... competitiveness in comparison to other storage technologies or with the traditional frequency regulation methods. In order to surpass this challenge and to allow for optimal sizing and proper use of the battery, accurate knowledge about the lifetime of the Lithium-ion battery and its degradation behaviour...... is required. This paper aims to investigate, based on a laboratory developed lifetime model, the degradation behaviour of the performance parameters (i.e., capacity and power capability) of a Lithium-ion battery cell when it is subjected to a field measured mission profile, which is characteristic...

  12. Flexible graphene-based lithium ion batteries with ultrafast charge and discharge rates

    National Research Council Canada - National Science Library

    Na Li; Zongping Chen; Wencai Ren; Feng Li; Hui-Ming Cheng

    2012-01-01

    .... Here we report a thin, lightweight, and flexible lithium ion battery made from graphene foam, a three-dimensional, flexible, and conductive interconnected network, as a current collector, loaded with Li₄Ti₅O₁₂ and LiFePO₄...

  13. Selectively accelerated lithium ion transport to silicon anodes via an organogel binder

    Science.gov (United States)

    Hwang, Chihyun; Cho, Yoon-Gyo; Kang, Na-Ri; Ko, Younghoon; Lee, Ungju; Ahn, Dongjoon; Kim, Ju-Young; Kim, Young-Jin; Song, Hyun-Kon

    2015-12-01

    Silicon, a promising high-capacity anode material of lithium ion batteries, suffers from its volume expansion leading to pulverization and low conductivities, showing capacity decay during cycling and low capacities at fast charging and discharging. In addition to popular active-material-modifying strategies, building lithium-ion-rich environments around silicon surface is helpful in enhancing unsatisfactory performances of silicon anodes. In this work, we accelerated lithium ion transport to silicon surface by using an organogel binder to utilize the electroactivity of silicon in a more efficient way. The cyanoethyl polymer (PVA-CN), characterized by high lithium ion transference number as well as appropriate elastic modulus with strong adhesion, enhanced cycle stability of silicon anodes with high coulombic efficiency even at high temperature (60 °C) as well as at fast charging/discharging rates.

  14. Lithium-Ion Electrolytes with Improved Safety Tolerance to High Voltage Systems

    Science.gov (United States)

    Smart, Marshall C. (Inventor); Bugga, Ratnakumar V. (Inventor); Prakash, Surya G. (Inventor); Krause, Frederick C. (Inventor)

    2015-01-01

    The invention discloses various embodiments of electrolytes for use in lithium-ion batteries, the electrolytes having improved safety and the ability to operate with high capacity anodes and high voltage cathodes. In one embodiment there is provided an electrolyte for use in a lithium-ion battery comprising an anode and a high voltage cathode. The electrolyte has a mixture of a cyclic carbonate of ethylene carbonate (EC) or mono-fluoroethylene carbonate (FEC) co-solvent, ethyl methyl carbonate (EMC), a flame retardant additive, a lithium salt, and an electrolyte additive that improves compatibility and performance of the lithium-ion battery with a high voltage cathode. The lithium-ion battery is charged to a voltage in a range of from about 2.0 V (Volts) to about 5.0 V (Volts).

  15. Novel Anodes for Rapid Recharge High Energy Density Lithium-ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — TIAX proposes to develop as a novel negative electrode active material for rechargeable lithium-ion batteries. This material will fill the gap between the...

  16. Suggested Operation Grid-Connected Lithium-Ion Battery Energy Storage System for Primary Frequency Regulation

    DEFF Research Database (Denmark)

    Stroe, Daniel Ioan; Knap, Vaclav; Swierczynski, Maciej Jozef

    2015-01-01

    Because of their characteristics, which have been continuously improved during the last years, Lithium ion batteries were proposed as an alternative viable solution to present fast-reacting conventional generating units to deliver the primary frequency regulation service. However, even though...... there are worldwide demonstration projects where energy storage systems based on Lithium-ion batteries are evaluated for such applications, the field experience is still very limited. In consequence, at present there are no very clear requirements on how the Lithium-ion battery energy storage systems should...... be operated while providing frequency regulation service and how the system has to re-establish its SOC once the frequency event has passed. Therefore, this paper aims to investigate the effect on the lifetime of the Lithium-ion batteries energy storage system of various strategies for re...

  17. Remanufacturing, repurposing, and recycling of post-vehicle-application lithium-ion batteries.

    Science.gov (United States)

    2014-06-01

    As lithium-ion batteries are an efficient energy storage mechanism, their use in vehicles is increasing to support electrification : to meet increasing average mileage and decreasing greenhouse gas emission standards. Principles of environmentalism :...

  18. Operation of Grid -Connected Lithium-Ion Battery Energy Storage System for Primary Frequency Regulation

    DEFF Research Database (Denmark)

    Stroe, Daniel Loan; Knap, Vaclav; Swierczynski, Maciej Jozef

    2017-01-01

    Because of their characteristics, which have been continuously improved during the last years, Lithium ion batteries were proposed as an alternative viable solution to present fast-reacting conventional generating units to deliver the primary frequency regulation service. However, even though...... there are worldwide demonstration projects where energy storage systems based on Lithium-ion batteries are evaluated for such applications, the field experience is still very limited. In consequence, at present there are no very clear requirements on how the Lithium-ion battery energy storage systems should...... be operated while providing frequency regulation service and how the system has to re-establish its SOC once the frequency event has passed. Therefore, this paper aims to investigate the effect on the lifetime of the Lithium-ion batteries energy storage system of various strategies for re...

  19. Non-Flammable, High Voltage Electrolytes for Lithium Ion Batteries Project

    Data.gov (United States)

    National Aeronautics and Space Administration — An electrolyte will be demonstrated for lithium ion batteries with increased range of charge and discharge voltages and with improved fire safety. Experimental...

  20. Liquid Cooling of Tractive Lithium Ion Batteries Pack with Nanofluids Coolant.

    Science.gov (United States)

    Li, Yang; Xie, Huaqing; Yu, Wei; Li, Jing

    2015-04-01

    The heat generated from tractive lithium ion batteries during discharge-charge process has great impacts on the performances of tractive lithium ion batteries pack. How to solve the thermal abuse in tractive lithium ion batteries pack becomes more and more urgent and important for future development of electrical vehicles. In this work, TiO2, ZnO and diamond nanofluids are prepared and utilized as coolants in indirect liquid cooling of tractive lithium ion batteries pack. The results show that nanofluids present superior cooling performance to that of pure fluids and the diamond nanofluid presents relatively excellent cooling abilities than that of TiO2 and ZnO nanofluids. During discharge process, the temperature distribution of batteries in batteries pack is uniform and stable, due to steady heat dissipation by indirect liquid cooling. It is expected that nanofluids could be considered as a potential alternative for indirect liquid cooling in electrical vehicles.

  1. Effects of additives on thermal stability of Li ion cells

    Science.gov (United States)

    Doughty, Daniel H.; Roth, E. Peter; Crafts, Chris C.; Nagasubramanian, G.; Henriksen, Gary; Amine, Khalil

    Li ion cells are being developed for high-power applications in hybrid electric vehicles, because these cells offer superior combination of power and energy density over current cell chemistries. Cells using this chemistry are proposed for battery systems in both internal combustion engine and fuel cell-powered hybrid electric vehicles. However, the safety of these cells needs to be understood and improved for eventual widespread commercial applications. The thermal-abuse response of Li ion cells has been improved by the incorporation of more stable anode carbons and electrolyte additives. Electrolyte solutions containing vinyl ethylene carbonate (VEC), triphenyl phosphate (TPP), tris(trifluoroethyl)phosphate (TFP) as well as some proprietary flame-retardant additives were evaluated. Test cells in the 18,650 configuration were built at Sandia National Laboratories using new stable electrode materials and electrolyte additives. A special test fixture was designed to allow determination of self-generated cell heating during a thermal ramp profile. The flammability of vented gas and expelled electrolyte was studied using a novel arrangement of a spark generator placed near the cell to ignite vent gas if a flammable gas mixture was present. Flammability of vent gas was somewhat reduced by the presence of certain additives. Accelerating rate calorimetry (ARC) was also used to characterize 18,650-size test cell heat and gas generation. Gas composition was analyzed by gas chromatography (GC) and was found to consist of CO 2, H 2, CO, methane, ethane, ethylene and small amounts of C1-C4 organic molecules.

  2. Dicty_cDB: VHP349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP349 (Link to dictyBase) - - - Contig-U16430-1 - (Link to Original site) - - VHP349Z...VHP349Z 219 - - - - Show VHP349 Library VH (Link to library) Clone ID VHP349 (Link to dictyBase) Atlas...AL110635 |AL110635.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 1e-14...AL114542 |AL114542.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 1e-14...AL112228 |AL112228.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 1e-14

  3. Developing New Electrolytes for Advanced Li-ion Batteries

    Science.gov (United States)

    McOwen, Dennis Wayne

    The use of renewable energy sources is on the rise, as new energy generating technologies continue to become more efficient and economical. Furthermore, the advantages of an energy infrastructure which relies more on sustainable and renewable energy sources are becoming increasingly apparent. The most readily available of these renewable energy sources, wind and solar energy in particular, are naturally intermittent. Thus, to enable the continued expansion and widespread adoption of renewable energy generating technology, a cost-effective energy storage system is essential. Additionally, the market for electric/hybrid electric vehicles, which both require efficient energy storage, continues to grow as more consumers seek to reduce their consumption of gasoline. These vehicles, however, remain quite expensive, due primarily to costs associated with storing the electrical energy. High-voltage and thermally stable Li-ion battery technology is a promising solution for both grid-level and electric vehicle energy storage. Current limitations in materials, however, limit the energy density and safe operating temperature window of the battery. Specifically, the state-of-the-art electrolyte used in Li-ion batteries is not compatible with recently developed high-voltage positive electrodes, which are one of the most effectual ways of increasing the energy density. The electrolyte is also thermally unstable above 50 °C, and prone to thermal runaway reaction if exposed to prolonged heating. The lithium salt used in such electrolytes, LiPF6, is a primary contributor to both of these issues. Unfortunately, an improved lithium salt which meets the myriad property requirements for Li-ion battery electrolytes has eluded researchers for decades. In this study, a renewed effort to find such a lithium salt was begun, using a recently developed methodology to rapidly screen for desirable properties. Four new lithium salts and one relatively new but uncharacterized lithium salt were

  4. Mesoporous TiO2-B Microspheres with Superior Rate Performance for Lithium Ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Hansan [ORNL; Bi, Zhonghe [ORNL; Sun, Xiao-Guang [ORNL; Unocic, Raymond R [ORNL; Paranthaman, Mariappan Parans [ORNL; Dai, Sheng [ORNL; Brown, Gilbert M [ORNL

    2011-01-01

    Mesoporous TiO2-B microsperes with a favorable material architecture are designed and synthesized for high power lithium ion batteries. This material, combining the advantages of fast lithium transport with a pseudocapacitive mechanism, adequate electrode-electrolyte contact and compact particle packing in electrode layer, shows superior high-rate charge-discharge capability and long-time cyclability for lithium ion batteries.

  5. Mesoporous TiO{sub 2}-B microspheres with superior rate performance for lithium ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Hansan; Bi, Zhonghe; Sun, Xiao-Guang; Paranthaman, M.Parans; Dai, Sheng; Brown, Gilbert M. [Chemical Sciences Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Unocic, Raymond R. [Material Sciences and Technology Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States)

    2011-08-09

    Mesoporous TiO{sub 2}-B microspheres with a favorable material architecture are designed and synthesized for highpower lithium ion batteries. This material, which combines the advantages of fast lithium transport with a pseudocapacitive mechanism, adequate electrode-electrolyte contact, and compact particle packing in the electrode layer, shows superior high-rate charge-discharge capability and long-time cyclability for lithium ion batteries. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. In Situ Monitoring of Temperature inside Lithium-Ion Batteries by Flexible Micro Temperature Sensors

    OpenAIRE

    Lee, Chi-Yuan; Lee, Shuo-Jen; Tang, Ming-Shao; Chen, Pei-Chi

    2011-01-01

    Lithium-ion secondary batteries are commonly used in electric vehicles, smart phones, personal digital assistants (PDA), notebooks and electric cars. These lithium-ion secondary batteries must charge and discharge rapidly, causing the interior temperature to rise quickly, raising a safety issue. Over-charging results in an unstable voltage and current, causing potential safety problems, such as thermal runaways and explosions. Thus, a micro flexible temperature sensor for the in in-situ monit...

  7. Surface-Modified Membrane as A Separator for Lithium-Ion Polymer Battery

    OpenAIRE

    Jun Young Kim; Dae Young Lim

    2010-01-01

    This paper describes the fabrication of novel modified polyethylene (PE) membranes using plasma technology to create high-performance and cost-effective separator membranes for practical applications in lithium-ion polymer batteries. The modified PE membrane via plasma modification process plays a critical role in improving wettability and electrolyte retention, interfacial adhesion between separators and electrodes, and cycle performance of lithium-ion polymer batteries. This paper suggests ...

  8. Plasma-Modified Polyethylene Separator Membrane for Lithium-ion Polymer Battery

    OpenAIRE

    Kim, Jun Young; Lim, Dae Young

    2010-01-01

    The separator is a critical component in the lithium-ion polymer batteries, and its primary function is to facilitate ionic transport between the electrodes as well as to prevent the electric contact of the electrodes. This chapter describes the fabrication of a novel modified polyethylene membrane via plasma-induced coating process to create high performance and cost-effective separator membranes for practical applications in rechargeable lithium-ion polymer battery. The enhanced interfacial...

  9. Interpretation of Simultaneous Mechanical-Electrical-Thermal Failure in a Lithium-Ion Battery Module: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Chao; Santhanagopalan, Shriram; Stock, Mark J.; Brunhart-Lupo, Nicholas; Gruchalla, Kenny

    2016-12-01

    Lithium-ion batteries are currently the state-of- the-art power sources for electric vehicles, and their safety behavior when subjected to abuse, such as a mechanical impact, is of critical concern. A coupled mechanical-electrical-thermal model for simulating the behavior of a lithium-ion battery under a mechanical crush has been developed. We present a series of production-quality visualizations to illustrate the complex mechanical and electrical interactions in this model.

  10. Technical feasibility for commercialization of lithium ion battery as a substitute dry battery for motorcycle

    Science.gov (United States)

    Kurniyati, Indah; Sutopo, Wahyudi; Zakaria, Roni; Kadir, Evizal Abdul

    2017-11-01

    Dry battery on a motorcycle has a rapid rate of voltage drop, life time is not too long, and a long charging time. These are problems for users of dry battery for motorcycle. When the rate in the voltage decreases, the energy storage in the battery is reduced, then at the age of one to two years of battery will be dead and cannot be used, it makes the user should replace the battery. New technology development of a motorcycle battery is lithium ion battery. Lithium ion battery has a specification that has been tested and possible to replace dry battery. Characteristics of lithium ion battery can answer the question on the dry battery service life, the rate of decrease in voltage and charging time. This paper discusses about the technical feasibility for commercialization of lithium ion battery for motorcycle battery. Our proposed methodology of technical feasibility by using a goldsmith commercialization model of the technical feasibility and reconfirm the technical standard using the national standard of motorcycle battery. The battery has been through all the stages of the technical feasibility of the goldsmith model. Based on the results of the study, lithium ion batteries have the minimum technical requirements to be commercialized and has been confirmed in accordance with the standard motorcycle battery. This paper results that the lithium ion battery is visible to commercialized by the technical aspect.

  11. Efficiently photo-charging lithium-ion battery by perovskite solar cell.

    Science.gov (United States)

    Xu, Jiantie; Chen, Yonghua; Dai, Liming

    2015-08-27

    Electric vehicles using lithium-ion battery pack(s) for propulsion have recently attracted a great deal of interest. The large-scale practical application of battery electric vehicles may not be realized unless lithium-ion batteries with self-charging suppliers will be developed. Solar cells offer an attractive option for directly photo-charging lithium-ion batteries. Here we demonstrate the use of perovskite solar cell packs with four single CH3NH3PbI3 based solar cells connected in series for directly photo-charging lithium-ion batteries assembled with a LiFePO4 cathode and a Li4Ti5O12 anode. Our device shows a high overall photo-electric conversion and storage efficiency of 7.80% and excellent cycling stability, which outperforms other reported lithium-ion batteries, lithium-air batteries, flow batteries and super-capacitors integrated with a photo-charging component. The newly developed self-chargeable units based on integrated perovskite solar cells and lithium-ion batteries hold promise for various potential applications.

  12. Efficiently photo-charging lithium-ion battery by perovskite solar cell

    Science.gov (United States)

    Xu, Jiantie; Chen, Yonghua; Dai, Liming

    2015-08-01

    Electric vehicles using lithium-ion battery pack(s) for propulsion have recently attracted a great deal of interest. The large-scale practical application of battery electric vehicles may not be realized unless lithium-ion batteries with self-charging suppliers will be developed. Solar cells offer an attractive option for directly photo-charging lithium-ion batteries. Here we demonstrate the use of perovskite solar cell packs with four single CH3NH3PbI3 based solar cells connected in series for directly photo-charging lithium-ion batteries assembled with a LiFePO4 cathode and a Li4Ti5O12 anode. Our device shows a high overall photo-electric conversion and storage efficiency of 7.80% and excellent cycling stability, which outperforms other reported lithium-ion batteries, lithium-air batteries, flow batteries and super-capacitors integrated with a photo-charging component. The newly developed self-chargeable units based on integrated perovskite solar cells and lithium-ion batteries hold promise for various potential applications.

  13. Ultrafast fluxional exchange dynamics in electrolyte solvation sheath of lithium ion battery.

    Science.gov (United States)

    Lee, Kyung-Koo; Park, Kwanghee; Lee, Hochan; Noh, Yohan; Kossowska, Dorota; Kwak, Kyungwon; Cho, Minhaeng

    2017-03-08

    Lithium cation is the charge carrier in lithium-ion battery. Electrolyte solution in lithium-ion battery is usually based on mixed solvents consisting of polar carbonates with different aliphatic chains. Despite various experimental evidences indicating that lithium ion forms a rigid and stable solvation sheath through electrostatic interactions with polar carbonates, both the lithium solvation structure and more importantly fluctuation dynamics and functional role of carbonate solvent molecules have not been fully elucidated yet with femtosecond vibrational spectroscopic methods. Here we investigate the ultrafast carbonate solvent exchange dynamics around lithium ions in electrolyte solutions with coherent two-dimensional infrared spectroscopy and find that the time constants of the formation and dissociation of lithium-ion···carbonate complex in solvation sheaths are on a picosecond timescale. We anticipate that such ultrafast microscopic fluxional processes in lithium-solvent complexes could provide an important clue to understanding macroscopic mobility of lithium cation in lithium-ion battery on a molecular level.

  14. Graphite as negative electrode in Li-ion batteries; Le graphite comme electrode negative dans les accumulateurs Li-ion

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, F.; Monnier, A. [Timcal SA (France)

    1996-12-31

    The last developments in lithium batteries design have demonstrated the advantages of graphite: competitive cost, flat output curve, high capacity thanks to the obtention of a final compound close to LiC{sub 6}, good behaviour during cycling and a high mass energy. However, these advantages are slightly tarnished by parasite secondary reactions during the evolution of the element. Two different cases are encountered: the formation of a passivation layer (loss of Li ions and formation of irreversible bounds) and the formation of a passivation layer with a reaction between graphite and the solvent (partial destruction of the graphite crystal lattice). In the first case, the theoretical graphite insertion capacity remains at 372 mAh/g while in the second case the insertion capacity is greatly reduced. Abstract only. (J.S.)

  15. One-step synthesis of 3D sulfur/nitrogen dual-doped graphene supported nano silicon as anode for Li-ion batteries

    Science.gov (United States)

    Li, Ruihong; Li, Junli; Qi, Kaiyu; Ge, Xin; Zhang, Qiwei; Zhang, Bangwen

    2018-03-01

    Silicon is one of the most promising candidates for next-generation anode of Lithium-ion batteries. However, poor electrical conductivity and large volume change during alloying/dealloying hinder its practical use. Here we reported a three-dimensional (3D) nitrogen and sulfur codoped graphene supported silicon nanoparticles composite (SN-G/Si) through one-step hydrothermal self-assembly. The obtained SN-G/Si was investigated in term of instrumental characterizations and electrochemical properties. The results show that SN-G/Si as a freestanding anode in LIBs delivers a reversible capacity of 2020 mAh g-1 after 100 cycles with coulombic efficiency of nearly 97%. The excellent electrochemical performance is associated with the unique structure and the synergistic effect of SN-G/Si, in which SN-G provides volume buffer for nano Si as the flexible loader, short paths/fast channels for electron/Li ion transport as porous skeleton, and low charge-transfer resistance.

  16. Achieving rapid Li-ion insertion kinetics in TiO2 mesoporous nanotube arrays for bifunctional high-rate energy storage smart windows.

    Science.gov (United States)

    Tong, Zhongqiu; Liu, Shikun; Li, Xingang; Mai, Liqiang; Zhao, Jiupeng; Li, Yao

    2018-01-31

    Smart electrochromic windows integrated with electrochemical energy storage capacity are receiving increasing interest for green buildings. However, the fabrication of bifunctional devices that demonstrate high-rate capability with stable and desirable optical modulation still remains a great challenge. Herein, a facile sacrificial template-accelerated hydrolysis approach is presented to prepare a designed lithium-ion insertion-type material layer on a fluorine-doped tin oxide substrate, with TiO2 mesoporous nanotube array (MNTA) film as an example, with rapid Li-ion insertion kinetics and without sacrificing window transparency, to meet requirements. A bifunctional device is assembled to exhibit the optical-electrochemical superiority of MNTA nanostructures. The as-assembled bifunctional smart window exhibits strong electrochromic contrast and high-rate capability in the fast galvanostatic charge/discharge process. For instance, at 1 A g-1, it completes the charge or discharge process within only 232 s and delivers a high, reversible and stable specific capacity of 60 mA h g-1, accompanying obvious transmittance modulation in the visible spectrum, with a typical value of ca. 30.4% at 700 nm, and strong color changes between deep blue and transparency.

  17. Thermal management optimization of an air-cooled Li-ion battery module using pin-fin heat sinks for hybrid electric vehicles

    Science.gov (United States)

    Mohammadian, Shahabeddin K.; Zhang, Yuwen

    2015-01-01

    Three dimensional transient thermal analysis of an air-cooled module that contains prismatic Li-ion cells next to a special kind of aluminum pin fin heat sink whose heights of pin fins increase linearly through the width of the channel in air flow direction was studied for thermal management of Lithium-ion battery pack. The effects of pin fins arrangements, discharge rates, inlet air flow velocities, and inlet air temperatures on the battery were investigated. The results showed that despite of heat sinks with uniform pin fin heights that increase the standard deviation of the temperature field, using this kind of pin fin heat sink compare to the heat sink without pin fins not only decreases the bulk temperature inside the battery, but also decreases the standard deviation of the temperature field inside the battery as well. Increasing the inlet air temperature leads to decreasing the standard deviation of the temperature field while increases the maximum temperature of the battery. Furthermore, increasing the inlet air velocity first increases the standard deviation of the temperature field till reaches to the maximum point, and after that decreases. Also, increasing the inlet air velocity leads to decrease in the maximum temperature of the battery.

  18. Combinatorial Study of the Li-Ni-Mn-Co Oxide Pseudoquaternary System for Use in Li-Ion Battery Materials Research.

    Science.gov (United States)

    Brown, Colby R; McCalla, Eric; Watson, Cody; Dahn, J R

    2015-06-08

    Combinatorial synthesis has proven extremely effective in screening for new battery materials for Li-ion battery electrodes. Here, a study in the Li-Ni-Mn-Co-O system is presented, wherein samples with nearly 800 distinct compositions were prepared using a combinatorial and high-throughput method to screen for single-phase materials of high interest as next generation positive electrode materials. X-ray diffraction is used to determine the crystal structure of each sample. The Gibbs' pyramid representing the pseudoquaternary system was studied by making samples within three distinct pseudoternary planes defined at fractional cobalt metal contents of 10%, 20%, and 30% within the Li-Ni-Mn-Co-O system. Two large single-phase regions were observed in the system: the layered region (ordered rocksalt) and cubic spinel region; both of which are of interest for next-generation positive electrodes in lithium-ion batteries. These regions were each found to stretch over a wide range of compositions within the Li-Ni-Mn-Co-O pseudoquaternary system and had complex coexistence regions existing between them. The sample cooling rate was found to have a significant effect on the position of the phase boundaries of the single-phase regions. The results of this work are intended to guide further research by narrowing the composition ranges worthy of study and to illustrate the broad range of applications where solution-based combinatorial synthesis can have significant impact.

  19. In Situ Studies of Fe4+ Stability in β-Li3Fe2(PO4)3 Cathodes for Li Ion Batteries

    DEFF Research Database (Denmark)

    Christiansen, Ane Sælland; Johnsen, Rune E.; Norby, Poul

    2015-01-01

    In commercial Fe-based batteries the Fe2+/Fe3+ oxidation states are used, however by also utilizing the Fe4+ oxidation state, intercalation of up to two Li ions per Fe ion could be possible. In this study, we investigate whether Fe4+ can be formed and stabilized in β-Li3Fe2(PO4)3. The work includes...... of Fe4+ formation. Oxidation of the organic electrolyte is inevitable at 4.5 V but this alone cannot explain the volume change. Instead, a reversible oxygen redox process (O2− → O−) could possibly explain and charge compensate for the reversible extraction of lithium ions from β-Li3Fe2(PO4)3....... in situ synchrotron X-ray powder diffraction studies (XRPD) during charging of β-Li3Fe2(PO4)3 up to 5.0 V vs. Li/Li+. A novel capillary-based micro battery cell for in situ XRPD has been designed for this. During charge, a plateau at 4.5 V was found and a small contraction in volume was observed...

  20. The mechanistic exploration of porous activated graphene sheets-anchored SnO2 nanocrystals for application in high-performance Li-ion battery anodes.

    Science.gov (United States)

    Yang, Yingchang; Ji, Xiaobo; Lu, Fang; Chen, Qiyuan; Banks, Craig E

    2013-09-28

    Porous activated graphene sheets have been for the first time exploited herein as encapsulating substrates for lithium ion battery (LIB) anodes. The as-fabricated SnO2 nanocrystals-porous activated graphene sheet (AGS) composite electrode exhibits improved electrochemical performance as an anode material for LIBs, such as better cycle performance and higher rate capability in comparison with graphene sheets, activated graphene sheets, bare SnO2 and SnO2-graphene sheet composites. The superior electrochemical performances of the designed anode can be ascribed to the porous AGS substrate, which improves the electrical conductivity of the electrode, inhibits agglomeration between particles and effectively buffers the strain from the volume variation during Li(+)-intercalation-de-intercalation and provides more cross-plane diffusion channels for Li(+) ions. As a result, the designed anode exhibits an outstanding capacity of up to 610 mA h g(-1) at a current density of 100 mA g(-1) after 50 cycles and a good rate performance of 889, 747, 607, 482 and 372 mA h g(-1) at a current density of 100, 200, 500, 1000, and 2000 mA g(-1), respectively. This work is of importance for energy storage as it provides a new substrate for the design and implementation of next-generation LIBs exhibiting exceptional electrochemical performances.

  1. Construction and testing of coin cells of lithium ion batteries.

    Science.gov (United States)

    Kayyar, Archana; Huang, Jiajia; Samiee, Mojtaba; Luo, Jian

    2012-08-02

    Rechargeable lithium ion batteries have wide applications in electronics, where customers always demand more capacity and longer lifetime. Lithium ion batteries have also been considered to be used in electric and hybrid vehicles or even electrical grid stabilization systems. All these applications simulate a dramatic increase in the research and development of battery materials, including new materials, doping, nanostructuring, coatings or surface modifications and novel binders. Consequently, an increasing number of physicists, chemists and materials scientists have recently ventured into this area. Coin cells are widely used in research laboratories to test new battery materials; even for the research and development that target large-scale and high-power applications, small coin cells are often used to test the capacities and rate capabilities of new materials in the initial stage. In 2010, we started a National Science Foundation (NSF) sponsored research project to investigate the surface adsorption and disordering in battery materials (grant no. DMR-1006515). In the initial stage of this project, we have struggled to learn the techniques of assembling and testing coin cells, which cannot be achieved without numerous help of other researchers in other universities (through frequent calls, email exchanges and two site visits). Thus, we feel that it is beneficial to document, by both text and video, a protocol of assembling and testing a coin cell, which will help other new researchers in this field. This effort represents the "Broader Impact" activities of our NSF project, and it will also help to educate and inspire students. In this video article, we document a protocol to assemble a CR2032 coin cell with a LiCoO2 working electrode, a Li counter electrode, and (the mostly commonly used) polyvinylidene fluoride (PVDF) binder. To ensure new learners to readily repeat the protocol, we keep the protocol as specific and explicit as we can. However, it is important

  2. Fluorine-doped SnO2 nanoparticles anchored on reduced graphene oxide as a high-performance lithium ion battery anode

    Science.gov (United States)

    Cui, Dongming; Zheng, Zhong; Peng, Xue; Li, Teng; Sun, Tingting; Yuan, Liangjie

    2017-09-01

    The composite of fluorine-doped SnO2 anchored on reduced graphene oxide (F-SnO2/rGO) has been synthesized through a hydrothermal method. F-SnO2 particles with average size of 8 nm were uniformly anchored on the surfaces of rGO sheets and the resulting composite had a high loading of F-SnO2 (ca. 90%). Benefiting from the remarkably improved electrical conductivity and Li-ion diffusion in the electrode by F doping and rGO incorporation, the composite material exhibited high reversible capacity, excellent long-term cycling stability and superior rate capability. The electrode delivered a large reversible capacity of 1037 mAh g-1 after 150 cycles at 100 mA g-1 and high rate capacities of 860 and 770 mAh g-1 at 1 and 2 A g-1, respectively. Moreover, the electrode could maintain a high reversible capacities of 733 mAh g-1 even after 250 cycles at 500 mA g-1. The outstanding electrochemical performance of the as-synthesized composite make it a promising anode material for high-energy lithium ion batteries.

  3. Silicon Nanoparticle/Nanowire and Graphite Composite Anode with Increased Binder for Lithium-Ion Coin Cells Aimed at High Energy Density Battery Applications

    Science.gov (United States)

    Qureshi, Muhammad Ali

    Silicon and graphite composite anode materials were prepared for a lithium ion half-cell with lithium metal as the reference electrode. All silicon/graphite composite anodes were prepared in the lab with mixing of slurry using ball milling technique. Battery grade copper foil was used as the current collector for the anode. The anode was coated using the doctor blade technique with thickness of 100μm and further calendared to provide higher energy densities for active material per cubic volume. The ratio of binder used was significantly higher than previously tested to show silicon material takes longer to detach from current collector with increased cycle life. Galvanostatic cycling show lithiation and de-lithiation of silicon anode with respect to lithium metal. Impedance measurements were taken for coin cells prior to cycle life tests. Silicon anode half-cell was charged/discharged for many cycles showing improved cycle life with great capacity retention. Charts show silicon expansion of material after cycle life however due to increased amount of binder material less silicon separates from the copper current collector initially. The coin cells made provide reproducible results which can be used for practical applications and have the ability for large volume production of high energy Li-ion batteries.

  4. Hierarchical flower-like carbon nanosheet assembly with embedded hollow NiCo{sub 2}O{sub 4} nanoparticles for high- performance lithium ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Ling; Qiu, Huajun; Luo, Pan; Li, Wenxiang; Zhang, Huijuan; Wang, Yu, E-mail: wangy@cqu.edu.cn

    2017-05-01

    Highlights: • Flower-like NiCo{sub 2}O{sub 4}@carbon nanosphere is firstly synthesized for Li-ion batteries. • The nanostructure exhibits the unique feature of hollow NiCo{sub 2}O{sub 4} nanoparticles embedded inside and graphitized carbon layers coating outside. • The sample reveals stable structure, large specific surface area and good electrical conductivity. • The composite exhibits superior rate capability, cycling capacity and excellent Coulombic efficiency. - Abstract: The fabrication of closely bounded metal oxides/carbon hybrid nano-structures is significant for its use in energy-related areas especially lithium ion batteries (LIBs). In this research, a flower-like carbon sphere with hollow NiCo{sub 2}O{sub 4} nanoparticles encapsulated inside the carbon thin nanopetal is fabricated by using a mixed basic carbonate nickel and cobalt sphere as the precursor and templates followed by the outer carbon membrane covering and two-step calcination process. When tested as anode material for LIBs, this flower-like carbon-based hybrid sphere demonstrates a significantly enhanced reversible capacity and cycling stability at various current densities.

  5. Photocatalytic properties of Co{sub 3}O{sub 4}/LiCoO{sub 2} recycled from spent lithium-ion batteries using citric acid as leaching agent

    Energy Technology Data Exchange (ETDEWEB)

    Santana, I.L.; Moreira, T.F.M.; Lelis, M.F.F.; Freitas, M.B.J.G., E-mail: marcosbjg@gmail.com

    2017-04-01

    In this work, cobalt and lithium from the cathodes of spent lithium-ion batteries were recycled to synthesize a mixture of Co{sub 3}O{sub 4} and LiCoO{sub 2}. The positive electrode was leached with citric acid in the green recycling. After being heated to 85 °C, the leaching solution formed a pink sol, and after being dried at 120 °C for 24 h, it formed a gel, which is a precursor material for Co{sub 3}O{sub 4} and LiCoO{sub 2} synthesis. A mixture of Co{sub 3}O{sub 4} and LT-LiCoO{sub 2} was obtained after the calcination of the precursor material at 450 °C for 3 h. The photocatalytic properties of the Co{sub 3}O{sub 4} and LiCoO{sub 2} were tested in the discoloration of methylene blue dye. The discoloration efficiency of methylene blue dye in the presence of Co{sub 3}O{sub 4} and LiCoO{sub 2} was 90% after 10 h and 100% after 24 h of heterogeneous catalysis. The contribution of this work is that it presents a means to produce valuable materials with photocatalytic properties from recycled batteries through a spent Li-ion battery recycling process without polluting the environment. - Highlights: • Synthesis a mixture of Co{sub 3}O{sub 4}/LiCoO{sub 2} from spent Li-ion batteries. • Citric acid for leaching of the cathodes of the spent Li-ion batteries. • Co{sub 3}O{sub 4}/LiCoO{sub 2} as catalysts in the photodegradation of the methylene blue dye.

  6. On fabrication procedures of Li-ion conducting garnets

    Energy Technology Data Exchange (ETDEWEB)

    Hanc, Emil [The Mineral and Energy Economy Research Institute, Polish Academy of Sciences, ul. Wybickiego 7, 31-261 Kraków (Poland); Zając, Wojciech, E-mail: wojciech.zajac@agh.edu.pl [AGH University of Science and Technology, Faculty of Energy and Fuels, al. Mickiewicza 30, 30-059 Kraków (Poland); Lu, Li; Yan, Binggong; Kotobuki, Masashi [Materials Science Group, Department of Mechanical Engineering, National University of Singapore (Singapore); Ziąbka, Magdalena [AGH University of Science and Technology, Faculty of Materials Science and Ceramics, al. Mickiewicza 30, 30-059 Kraków (Poland); Molenda, Janina [AGH University of Science and Technology, Faculty of Energy and Fuels, al. Mickiewicza 30, 30-059 Kraków (Poland)

    2017-04-15

    Ceramic oxides exhibiting high lithium-ion mobility at room temperature receive broad attention as candidate electrolytes for lithium batteries. Lithium-stuffed garnets from the Li{sub 7}La{sub 3}Zr{sub 2}O{sub 12} group seem to be especially promising because of their high ionic conductivity at room temperature and their electrochemical stability. In this work, we discuss factors that affect formation of the garnet in its bulk form or in the form of thick and thin films. We demonstrate that zinc oxide can be applied as a sintering aid that facilitate the formation of the highly conducting cubic Li{sub 7}La{sub 3}Zr{sub 2}O{sub 12} garnet phase in a single-step sintering procedure. Based on our experience with the single-step sintering experiments, we successfully fabricated a thick-film membrane consisting of a garnet solid electrolyte using the tape casting technique. In order to reduce the thickness of the electrolyte even further we investigated the fabrication of a thin-film Li{sub 7}La{sub 3}Zr{sub 2}O{sub 12} electrolyte by means of the pulsed laser deposition technique.

  7. Cathode materials produced by spray flame synthesis for lithium ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Hamid, NoorAshrina Binti A.

    2013-07-03

    Lithium ion batteries are one of the most enthralling rechargeable energy storage systems for portable application due to their high energy density. Nevertheless, with respect to electromobility innovation towards better electrochemical properties such as higher energy and power density is required. Altering the cathode material used in Li-ion batteries is favorable since the mass- and volume performance is closely related to the cathode electrode mass. Instead of using LiCoO{sub 2} as cathode electrode, LiFePO{sub 4} has gained serious attention as this material owns a high theoretical capacity of 170 mAh g{sup -1}. It is non-toxic, cheap and consists of abundant materials but suffers from low electronic and ionic conductivity. Utilization of nanotechnology methods in combination with composite formation is known to cure this problem effectively. In this work, a new combination of techniques using highly scalable gas-phase synthesis namely spray-flame synthesis and subsequent solid-state reaction has been used to synthesize nanocomposite LiFePO{sub 4}/C. At first this work deals with the formation and characterization of nanosize FePO{sub 4} from a solution of iron(III)acetylacetonate and tributyl phosphate in toluene using spray-flame synthesis. It was shown that a subsequent solid state reaction with Li{sub 2}CO{sub 3} and glucose yielded a LiFePO{sub 4}/C nanocomposite with very promising electrochemical properties. Based on these initial findings the influence of two synthesis parameter - carbon content and annealing temperature - was investigated towards the physicochemical properties of LiFePO{sub 4}/C. It was shown that an annealing temperature of 700 C leads to high purity composite materials consisting of crystalline LiFePO{sub 4} with crystallite sizes well below 100 nm and amorphous carbon consisting of disordered and graphite-like carbon. Variation of glucose amount between 10 and 30 wt% resulted in carbon contents between 2.1 and 7.3 wt%. In parallel

  8. Prelithiated silicon nanowires as an anode for lithium ion batteries.

    Science.gov (United States)

    Liu, Nian; Hu, Liangbing; McDowell, Matthew T; Jackson, Ariel; Cui, Yi

    2011-08-23

    Silicon is one of the most promising anode materials for the next-generation high-energy lithium ion battery (LIB), while sulfur and some other lithium-free materials have recently shown high promise as cathode materials. To make a full battery out of them, either the cathode or the anode needs to be prelithiated. Here, we present a method for prelithiating a silicon nanowire (SiNW) anode by a facile self-discharge mechanism. Through a time dependence study, we found that 20 min of prelithiation loads ∼50% of the full capacity into the SiNWs. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) studies show that the nanostructure of SiNWs is maintained after prelithiation. We constructed a full battery using our prelithiated SiNW anode with a sulfur cathode. Our work provides a protocol for pairing lithium-free electrodes to make the next-generation high-energy LIB. © 2011 American Chemical Society

  9. Effect of Calendering on Electrode Wettability in Lithium Ion Batteries

    Directory of Open Access Journals (Sweden)

    Yangping eSheng

    2014-12-01

    Full Text Available Controlling the wettability between the porous electrode and the electrolyte in lithium ion batteries can improve both the manufacturing process and the electrochemical performance of the cell. The wetting rate, which is the electrolyte transport rate in the porous electrode, can be quantified using the wetting balance. The effect of the calendering process on the wettability of anode electrodes was investigated. A graphite anode film with an as-coated thickness of 59 μm was used as baseline electrode film and was calendered to produce films with thickness ranging from 55 to 41 µm. Results show that wettability is improved by light calendering from an initial thickness of 59 μm to a calendered thickness of 53 μm where the wetting rate increased from 0.375 to 0.589 mm/s0.5. Further calendering below 53 µm resulted in a decrease in wetting rates to a minimum observed value of 0.206 mm/s0.5 at a calendered thickness of 41 μm. Under the same electrolyte, wettability of the electrode is controlled to a great extent by the pore structure in the electrode film which includes parameters such as porosity, pore size distribution, pore geometry and topology. Relations between the wetting behavior and the pore structure as characterized by mercury intrusion and electron microscopy exist and can be used to manipulate the wetting behavior of electrodes.

  10. Prelithiated Silicon Nanowires as an Anode for Lithium Ion Batteries

    KAUST Repository

    Liu, Nian

    2011-08-23

    Silicon is one of the most promising anode materials for the next-generation high-energy lithium ion battery (LIB), while sulfur and some other lithium-free materials have recently shown high promise as cathode materials. To make a full battery out of them, either the cathode or the anode needs to be prelithiated. Here, we present a method for prelithiating a silicon nanowire (SiNW) anode by a facile self-discharge mechanism. Through a time dependence study, we found that 20 min of prelithiation loads ∼50% of the full capacity into the SiNWs. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) studies show that the nanostructure of SiNWs is maintained after prelithiation. We constructed a full battery using our prelithiated SiNW anode with a sulfur cathode. Our work provides a protocol for pairing lithium-free electrodes to make the next-generation high-energy LIB. © 2011 American Chemical Society.

  11. Nanostructured mesoporous materials for lithium-ion battery applications

    Science.gov (United States)

    Balaya, P.; Saravanan, K.; Hariharan, S.; Ramar, V.; Lee, H. S.; Kuezma, M.; Devaraj, S.; Nagaraju, D. H.; Ananthanarayanan, K.; Mason, C. W.

    2011-06-01

    The Energy crisis happens to be one of the greatest challenges we are facing today. In this view, much effort has been made in developing new, cost effective, environmentally friendly energy conversion and storage devices. The performance of such devices is fundamentally related to material properties. Hence, innovative materials engineering is important in solving the energy crisis problem. One such innovation in materials engineering is porous materials for energy storage. Porous electrode materials for lithium-ion batteries (LIBs) offer a high degree of electrolyte-electrode wettability, thus enhancing the electrochemical activity within the material. Among the porous materials, mesoporous materials draw special attention, owing to shorter diffusion lengths for Li+ and electronic movement. Nanostructured mesoporous materials also offer better packing density compared to their nanostructured counterparts such as nanopowders, nanowires, nanotubes etc., thus opening a window for developing electrode materials with high volumetric energy densities. This would directly translate into a scenario of building batteries which are much lighter than today's commercial LIBs. In this article, the authors present a simple, soft template approach for preparing both cathode and anode materials with high packing density for LIBs. The impact of porosity on the electrochemical storage performance is highlighted.

  12. Quantification of Lithium-ion Cell Thermal Runaway Energetics

    Energy Technology Data Exchange (ETDEWEB)

    Orendorff, Christopher; Lamb, Joshua; Steele, Leigh Anna Marie; Spangler, Scott Wilmer; Langendorf, Jill Louise

    2016-01-01

    Much of what is known about lithium-ion cell thermal runaway energetics has been measured and extrapolated from data acquired on relatively small cells (< 3 Ah). This work is aimed at understanding the effects of cell size on thermal runaway energetics on cells from 3 to 50 Ah of both LiFePO4 (LFP) and LiNi0.80Co0.15Al0.05O2 (NCA) chemistries. Results show that for both LFP and NCA cells, the normalized heating rate (W/Ah) increases roughly linearly for cells from 3-38 Ah while the normalized total heat released (kJ/Ah) is relatively constant over that cell size range. The magnitude of the normalized heating rate is on the order of 2x greater for NCA relative to LFP chemistries for 2-3 Ah cells, while that difference is on the order of 10x for 30-40 Ah cells. The total normalized heat release is ~ 15-20% greater for NCA relative to LFP cells across the entire size range studied 3-38 Ah.

  13. Separator-Integrated, Reversely Connectable Symmetric Lithium-Ion Battery.

    Science.gov (United States)

    Wang, Yuhang; Zeng, Jiren; Cui, Xiaoqi; Zhang, Lijuan; Zheng, Gengfeng

    2016-02-24

    A separator-integrated, reversely connectable, symmetric lithium-ion battery is developed based on carbon-coated Li3V2(PO4)3 nanoparticles and polyvinylidene fluoride-treated separators. The Li3V2(PO4)3 nanoparticles are synthesized via a facile solution route followed by calcination in Ar/H2 atmosphere. Sucrose solution is used as the carbon source for uniform carbon coating on the Li3V2(PO4)3 nanoparticles. Both the carbon and the polyvinylidene fluoride treatments substantially improve the cycling life of the symmetric battery by preventing the dissolution and shuttle of the electroactive Li3V2(PO4)3. The obtained symmetric full cell exhibits a reversible capacity of ≈ 87 mA h g(-1), good cycling stability, and capacity retention of ≈ 70% after 70 cycles. In addition, this type of symmetric full cell can be operated in both forward and reverse connection modes, without any influence on the cycling of the battery. Furthermore, a new separator integration approach is demonstrated, which enables the direct deposition of electroactive materials for the battery assembly and does not affect the electrochemical performance. A 10-tandem-cell battery assembled without differentiating the electrode polarity exhibits a low thickness of ≈ 4.8 mm and a high output voltage of 20.8 V. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Optimization of Layered Cathode Materials for Lithium-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Christian Julien

    2016-07-01

    Full Text Available This review presents a survey of the literature on recent progress in lithium-ion batteries, with the active sub-micron-sized particles of the positive electrode chosen in the family of lamellar compounds LiMO2, where M stands for a mixture of Ni, Mn, Co elements, and in the family of yLi2MnO3•(1 − yLiNi½Mn½O2 layered-layered integrated materials. The structural, physical, and chemical properties of these cathode elements are reported and discussed as a function of all the synthesis parameters, which include the choice of the precursors and of the chelating agent, and as a function of the relative concentrations of the M cations and composition y. Their electrochemical properties are also reported and discussed to determine the optimum compositions in order to obtain the best electrochemical performance while maintaining the structural integrity of the electrode lattice during cycling.

  15. Prototype Lithium-Ion Battery Developed for Mars 2001 Lander

    Science.gov (United States)

    Manzo, Michelle A.

    2000-01-01

    In fiscal year 1997, NASA, the Jet Propulsion Laboratory, and the U.S. Air Force established a joint program to competitively develop high-power, rechargeable lithium-ion battery technology for aerospace applications. The goal was to address Department of Defense and NASA requirements not met by commercial battery developments. Under this program, contracts have been awarded to Yardney Technical Products, Eagle- Picher Technologies, LLC, BlueStar Advanced Technology Corporation, and SAFT America, Inc., to develop cylindrical and prismatic cell and battery systems for a variety of NASA and U.S. Air Force applications. The battery systems being developed range from low-capacity (7 to 20 A-hr) and low-voltage (14 to 28 V) systems for planetary landers and rovers to systems for aircraft that require up to 270 V and for Unmanned Aerial Vehicles that require capacities up to 200 A-hr. Low-Earth-orbit and geosynchronousorbit spacecraft pose additional challenges to system operation with long cycle life (>30,000 cycles) and long calendar life (>10 years), respectively.

  16. Characterizing aging effects of lithium ion batteries by impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Troeltzsch, Uwe [University of the Bundeswehr Munich Institute for Measurement and Automation, 85579 Neubiberg (Germany)]. E-mail: uwe.troeltzsch@unibw-muenchen.de; Kanoun, Olfa [University of the Bundeswehr Munich Institute for Measurement and Automation, 85579 Neubiberg (Germany); Traenkler, Hans-Rolf [University of the Bundeswehr Munich Institute for Measurement and Automation, 85579 Neubiberg (Germany)

    2006-01-20

    Impedance spectroscopy is one of the most promising methods for characterizing aging effects of portable secondary batteries online because it provides information about different aging mechanisms. However, application of impedance spectroscopy 'in the field' has some higher requirements than for laboratory experiments. It requires a fast impedance measurement process, an accurate model applicable with several batteries and a robust method for model parameter estimation. In this paper, we present a method measuring impedance at different frequencies simultaneously. We propose to use a composite electrode model, capable to describe porous composite electrode materials. A hybrid method for parameter estimation based on a combination of evolution strategy and Levenberg-Marquardt method allowed a robust and fast parameter calculation. Based on this approach, an experimental investigation of aging effects of a lithium ion battery was carried out. After 230 discharge/charge cycles, the battery showed a 14% decreased capacity. Modeling results show that series resistance, charge transfer resistance and Warburg coefficient changed thereby their values by approximately 60%. A single frequency impedance measurement, usually carried out at 1 kHz, delivers only information about series resistance. Impedance spectroscopy allows additionally the estimation of charge transfer resistance and Warburg coefficient. This fact and the high sensitivity of model parameters to capacity change prove that impedance spectroscopy together with an accurate modeling deliver information that significantly improve characterization of aging effects.

  17. Graphite Recycling from Spent Lithium-Ion Batteries.

    Science.gov (United States)

    Rothermel, Sergej; Evertz, Marco; Kasnatscheew, Johannes; Qi, Xin; Grützke, Martin; Winter, Martin; Nowak, Sascha

    2016-12-20

    The present work reports on challenges in utilization of spent lithium-ion batteries (LIBs)-an increasingly important aspect associated with a significantly rising demand for electric vehicles (EVs). In this context, the feasibility of anode recycling in combination with three different electrolyte extraction concepts is investigated. The first method is based on a thermal treatment of graphite without electrolyte recovery. The second method additionally utilizes a subcritical carbon-dioxide (subcritical CO2 )-assisted electrolyte extraction prior to thermal treatment. And the final investigated approach uses supercritical carbon dioxide (scCO2 ) as extractant, subsequently followed by the thermal treatment. It is demonstrated that the best performance of recycled graphite anodes can be achieved when electrolyte extraction is performed using subcritical CO2 . Comparative studies reveal that, in the best case, the electrochemical performance of recycled graphite exceeds the benchmark consisting of a newly synthesized graphite anode. As essential efforts towards electrolyte extraction and cathode recycling have been made in the past, the electrochemical behavior of recycled graphite, demonstrating the best performance, is investigated in combination with a recycled LiNi1/3 Co1/3 Mn1/3 O2 cathode. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Lithium Ion Batteries—Development of Advanced Electrical Equivalent Circuit Models for Nickel Manganese Cobalt Lithium-Ion

    Directory of Open Access Journals (Sweden)

    Alexandros Nikolian

    2016-05-01

    Full Text Available In this paper, advanced equivalent circuit models (ECMs were developed to model large format and high energy nickel manganese cobalt (NMC lithium-ion 20 Ah battery cells. Different temperatures conditions, cell characterization test (Normal and Advanced Tests, ECM topologies (1st and 2nd Order Thévenin model, state of charge (SoC estimation techniques (Coulomb counting and extended Kalman filtering and validation profiles (dynamic discharge pulse test (DDPT and world harmonized light vehicle profiles have been incorporated in the analysis. A concise state-of-the-art of different lithium-ion battery models existing in the academia and industry is presented providing information about model classification and information about electrical models. Moreover, an overview of the different steps and information needed to be able to create an ECM model is provided. A comparison between begin of life (BoL and aged (95%, 90% state of health ECM parameters (internal resistance (Ro, polarization resistance (Rp, activation resistance (Rp2 and time constants (τ is presented. By comparing the BoL to the aged parameters an overview of the behavior of the parameters is introduced and provides the appropriate platform for future research in electrical modeling of battery cells covering the ageing aspect. Based on the BoL parameters 1st and 2nd order models were developed for a range of temperatures (15 °C, 25 °C, 35 °C, 45 °C. The highest impact to the accuracy of the model (validation results is the temperature condition that the model was developed. The 1st and 2nd order Thévenin models and the change from normal to advanced characterization datasets, while they affect the accuracy of the model they mostly help in dealing with high and low SoC linearity problems. The 2nd order Thévenin model with advanced characterization parameters and extended Kalman filtering SoC estimation technique is the most efficient and dynamically correct ECM model developed.

  19. High voltage and high specific capacity dual intercalating electrode Li-ion batteries

    Science.gov (United States)

    West, William C. (Inventor); Blanco, Mario (Inventor)

    2010-01-01

    The present invention provides high capacity and high voltage Li-ion batteries that have a carbonaceous cathode and a nonaqueous electrolyte solution comprising LiF salt and an anion receptor that binds the fluoride ion. The batteries can comprise dual intercalating electrode Li ion batteries. Methods of the present invention use a cathode and electrode pair, wherein each of the electrodes reversibly intercalate ions provided by a LiF salt to make a high voltage and high specific capacity dual intercalating electrode Li-ion battery. The present methods and systems provide high-capacity batteries particularly useful in powering devices where minimizing battery mass is important.

  20. Electrode assembly for a lithium ion battery, process for the production of such electrode assembly, and lithium ion battery comprising such electrode assemblies

    NARCIS (Netherlands)

    Mulder, F.M.; Wagemaker, M.

    2013-01-01

    The invention provides an electrode assembly for a lithium ion battery, the electrode assembly comprising a lithium storage electrode layer on a current collector, wherein the lithium storage electrode layer is a porous layer having a porosity in the range of -35 %, with pores having pore widths in