WorldWideScience

Sample records for vhf radiotelephone transmitter

  1. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  2. 47 CFR 22.727 - Power limits for conventional rural radiotelephone transmitters.

    Science.gov (United States)

    2010-10-01

    ... radiotelephone transmitters. 22.727 Section 22.727 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... this section. (a) Maximum ERP. The effective radiated power (ERP) of central office and rural... circumstances. Frequency range (MHz) Maximum ERP (watts) 152-153 1400 157-159 150 454-455 3500 459-460 150 (b...

  3. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  4. 46 CFR 169.669 - Radiotelephone equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Radiotelephone equipment. 169.669 Section 169.669 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS... of Less Than 100 Gross Tons § 169.669 Radiotelephone equipment. A separate circuit from the...

  5. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  6. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  7. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  8. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  9. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  10. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  11. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  12. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  13. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  14. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  15. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  16. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  17. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  18. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  19. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  20. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  1. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  2. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  3. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  4. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  5. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  6. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  7. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  8. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  9. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  10. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  11. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  12. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  13. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  14. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  15. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  16. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  17. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  18. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  19. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  20. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  1. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  2. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  3. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  4. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  5. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  6. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  7. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  8. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  9. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  10. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  11. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  12. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  13. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  14. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  15. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  16. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  17. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  18. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  19. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  20. Effects of implanted radio transmitters with percutaneous antennas on the behavior of Canada Geese

    Science.gov (United States)

    Hupp, Jerry W.; Ruhl, G.A.; Pearce, John M.; Mulcahy, Daniel M.; Tomeo, M.A.

    2003-01-01

    We examined whether surgically-implanted radio transmitters with percutaneous antennas affected behavior of Lesser Canada Geese (Branta canadensis parvipes) in Anchorage, Alaska. We implanted either a 26-g VHF radio transmitter or a larger VHF radio that was the same mass (35 g) and shape as a satellite transmitter in the coelom of adult females captured during molt in 2000. A control group of females was marked with leg bands. We simultaneously observed behavior of radio-marked and control females from 4-62 d following capture. We observed no differences in the proportion of time birds in different treatments allocated among grazing, resting, comfort, walking, and alert behavior. Females in different treatments spent a similar proportion of time in the water. Implantation of radio transmitters did not affect the frequency of agonistic interactions. We conclude that coelomic radio transmitters with percutaneous antennas had minimal effects on the behavior of Canada Geese.

  1. 47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...

  2. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  3. 47 CFR 22.719 - Additional channel policy for rural radiotelephone stations.

    Science.gov (United States)

    2010-10-01

    ... applied for or been granted an authorization for other rural radiotelephone channel pairs in the same area... grade of service (blocking probability), and the applicant demonstrates that there will still be...

  4. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  5. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  6. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  7. 47 CFR 22.709 - Rural radiotelephone service application requirements.

    Science.gov (United States)

    2010-10-01

    ... call signs, if any, of any fixed points of communication. (c) No landline facilities. Each application... authority to operate a new interoffice station or to add transmitters or points of communications to an... center frequency of each channel requested, the maximum effective radiated power, the effective radiated...

  8. Spectral transmittance reference standards

    Energy Technology Data Exchange (ETDEWEB)

    Kruglyakova, M.A.; Belyaeva, O.N.; Nikitin, M.V.

    1995-06-01

    This paper presents spectral transmittance reference standards for UV and IR spectrophotometers, developed, studied, and certified by a precision spectrophotometry laboratory (the RSP Complex). 8 refs., 3 figs., 3 tabs.

  9. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  10. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  11. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  12. Distributed data transmitter

    Science.gov (United States)

    Brown, Kenneth Dewayne [Grain Valley, MO; Dunson, David [Kansas City, MO

    2008-06-03

    A distributed data transmitter (DTXR) which is an adaptive data communication microwave transmitter having a distributable architecture of modular components, and which incorporates both digital and microwave technology to provide substantial improvements in physical and operational flexibility. The DTXR has application in, for example, remote data acquisition involving the transmission of telemetry data across a wireless link, wherein the DTXR is integrated into and utilizes available space within a system (e.g., a flight vehicle). In a preferred embodiment, the DTXR broadly comprises a plurality of input interfaces; a data modulator; a power amplifier; and a power converter, all of which are modularly separate and distinct so as to be substantially independently physically distributable and positionable throughout the system wherever sufficient space is available.

  13. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  14. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  15. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  16. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  17. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  18. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  19. Interconnects, Transmitters, and Receivers

    Science.gov (United States)

    Hoefflinger, Bernd

    Interconnects on-chip between transistors and between functions like processors and memories, between chips on carriers or in stacks, and the communication with the outside world have become a highly complex performance, reliability, cost, and energy challenge. Twelve layers of metal interconnects, produced by lithography, require, including the contact vias, 24 mask and process cycles on top of the process front-end. The resulting lines are associated with resistance, capacitance and inductance parasitics as well as with ageing due to high current densities. Large savings in wiring lengths are achieved with 3D integration: transistor stacking, chip stacking and TSV's, a direction, which has exploded since 2005 because of many other benefits and, at the same time, with sensitive reliability and cost issues. On top of this or as an alternative, non-contact interconnects are possible with capacitive or inductive coupling. Inductive in particular has proven to be attractive because its transmission range is large enough for communication in chip stacks and yet not too large to cause interference.Optical transmitters based on integrated III-V compound-semiconductor lasers and THz power amplifiers compete with ascending low-cost, parallel-wire transmitters based on BiCMOS technologies. Parallel mm-wave and THz transceiver arrays enable mm-wave radar for traffic safety and THz computed-tomography. In spite of all these technology advances, the power efficiency of data communication will only improve 100× in a decade. New compression and architectural techniques are in high demand.

  20. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  1. Development Of VHF (240-270 MHz) Antennas For SoOp (Signal Of Opportunity) Receiver For 6u Cubesat Platforms

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2016-01-01

    The main goal of this research is to design, fabricate, and test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a truly global direct surface soil moisture (SM) and RZSM measurement system (Figure 1) over a variety of land covers with limited density restrictions. In SoOp methodology, signals transmitted by already existing transmitters (known as transmitters of opportunity, in this case the Military Satellite Communication (MilSatCom) System's UHF Follow-On program) are utilized to measure properties of reflecting targets by recording reflected signals using a simple passive microwave receiver.

  2. 47 CFR 74.461 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Transmitter power. 74.461 Section 74.461....461 Transmitter power. (a) Transmitter power is the power at the transmitter output terminals and.... For the purpose of this Subpart, the transmitter power is the carrier power. (b) The authorized...

  3. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  4. Optical transmittance of multilayer graphene

    Science.gov (United States)

    Zhu, Shou-En; Yuan, Shengjun; Janssen, G. C. A. M.

    2014-10-01

    We study the optical transmittance of multilayer graphene films up to 65 layers thick. By combing large-scale tight-binding simulation and optical measurement on CVD multilayer graphene, the optical transmission through graphene films in the visible region is found to be solely determined by the number of graphene layers. We argue that the optical transmittance measurement is more reliable in the determination of the number of layers than the commonly used the Raman spectroscopy. Moreover, the optical transmittance measurement can be applied also to other 2D materials with weak van der Waals interlayer interaction.

  5. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  6. Transmittance measurement using scanning LED

    Science.gov (United States)

    Ping, Yao; Mohan, Rosmin Elsa; Lau, Gih-Keong; Asundi, Anand Krishna

    2017-06-01

    In order to measure the transmittance for a large field of view (FOV), a system based on scanning LED is developed. The system mainly consists of tunable LEDs, a glass diffuser and a camera. The LED panel would display different colors in the CIE color space. An algorithm of converting the light wavelength to the RGB values is adopted. The images are captured using a monochrome camera. Depending on the number of colors displayed, the transmittance map for the entire spread of visible colors can be determined. Results are compared with those measured through a spectrometer. The spectral transmittance for the two methods exhibit good similarity. The system provides a means of measuring transmittance with no moving parts and can be extended to other hyperspectral imaging applications.

  7. Optical transmittance of multilayer graphene

    OpenAIRE

    Zhu, Shou-En; Yuan, Shengjun; Janssen, G.C.A.M.

    2014-01-01

    We study the optical transmittance of multilayer graphene films up to 65 layers thick. By combing large-scale tight-binding simulation and optical measurement on CVD multilayer graphene, the optical transmission through graphene films in the visible region is found to be solely determined by the number of graphene layers. We argue that the optical transmittance measurement is more reliable in the determination of the number of layers than the commonly used Raman Spectroscopy. Moreover, optica...

  8. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  9. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  10. 47 CFR 22.657 - Transmitter locations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Transmitter locations. 22.657 Section 22.657 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES... effective radiated power (ERP) of the most powerful mobile transmitter(s) in the system: Mobile unit ERP...

  11. 47 CFR 101.513 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 101.513 Section 101.513... SERVICES 24 GHz Service and Digital Electronic Message Service § 101.513 Transmitter power. The transmitter power will be governed by § 101.113. Further, each application must contain an analysis demonstrating...

  12. 47 CFR 80.215 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 80.215 Section 80.215... MARITIME SERVICES General Technical Standards § 80.215 Transmitter power. (a) Transmitter power shown on the radio station authorization is the maximum power the licensee is authorized to use. Power is...

  13. 47 CFR 101.807 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 101.807 Section 101.807... SERVICES Local Television Transmission Service § 101.807 Transmitter power. Stations in this service will not be authorized to use transmitters having a rated power output in excess of the limits set forth in...

  14. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  15. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  16. Transmitter Signal Measurements, Task 5C Report

    Science.gov (United States)

    Horton, Kent; Eppic, Brian; Huffman, Mitch; White, Harrison

    2005-01-01

    Signal Measurements were obtained on four (4) different airport systems. Systems measured were Localizer (LOC), Very High Frequency Communication, (VHF), Glideslope, (G/S), and Global Positioning System (GPS). The task calls for path loss measurements to be taken at Hartsfield-Jackson International Airport (ATL) and one smaller airport which was Greenville/ Spartanburg Airport (GSP) to determine relative signal strengths on the airport properties.

  17. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  18. Autoregressive smoothing of GOMOS transmittances

    Science.gov (United States)

    Fussen, D.; Vanhellemont, F.; Bingen, C.; Kyrölä, B.; Tamminen, J.; Sofieva, V.; Hassinen, S.; Seppälä, A.; Verronen, P. T.; Bertaux, J. L.; Hauchecorne, A.; Dalaudier, F.; d'Andon, O. Fanton; Barrot, G.; Mangin, A.; Theodore, B.; Guirlet, M.; Renard, J. B.; Fraisse, R.; Snoeij, P.; Koopman, R.; Saavedra, L.

    GOMOS is a stellar occultation instrument onboard ENVISAT. It has already measured several hundreds of thousands occultations since March 2002. In some circumstances, the obliqueness of the star setting causes the remote sounding of possible horizontal turbulence that cannot be adequately corrected by using the fast photometer signals, leading to the presence of residual scintillation in the atmospheric transmittance. We investigate the mechanism that produces this spurious signal that may cause the retrieval of wavy constituent profiles. A special algorithm of vertical autoregressive smoothing (VAS) is proposed that takes into account the physical correlation between adjacent measurements at different tangent altitudes. A regularization parameter of the method may be optimized on basis of the minimal correlation between the residuals as prescribed by the Durbin-Watson statistics. The improvements obtained in the retrieval of both O 3 and NO 2 number density profiles is presented and discussed with respect to the results of the official data processing model.

  19. 47 CFR 15.212 - Modular transmitters.

    Science.gov (United States)

    2010-10-01

    ... radiofrequency transmitter device that is typically incorporated into another product, host or device. Split... transmitter control element (or specific hardware on which the software that controls the radio operation... powered, it must comply with the AC line conducted requirements found in § 15.207. AC or DC power lines...

  20. 77 FR 1779 - Emergency Locator Transmitters (ELTs)

    Science.gov (United States)

    2012-01-11

    ... Locator Transmitter (ELT) Equipment. SUMMARY: This notice announces the FAA's intent to cancel TSO-C91a, Emergency Locator Transmitter (ELT) Equipment. The effect of the cancelled TSO will result in no new TSO... the 14 Code of ] Federal Regulation (14 CFR) Sec. 91.207 ELT equipage requirement. DATES: Comments...

  1. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  2. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  3. Modeling NDT piezoelectric ultrasonic transmitters.

    Science.gov (United States)

    San Emeterio, J L; Ramos, A; Sanz, P T; Ruíz, A; Azbaid, A

    2004-04-01

    Ultrasonic NDT applications are frequently based on the spike excitation of piezoelectric transducers by means of efficient pulsers which usually include a power switching device (e.g. SCR or MOS-FET) and some rectifier components. In this paper we present an approximate frequency domain electro-acoustic model for pulsed piezoelectric ultrasonic transmitters which, by integrating partial models of the different stages (driving electronics, tuning/matching networks and broadband piezoelectric transducer), allows the computation of the emission transfer function and output force temporal waveform. An approximate frequency domain model is used for the evaluation of the electrical driving pulse from the spike generator. Tuning circuits, interconnecting cable and mechanical impedance matching layers are modeled by means of transmission lines and the classical quadripole approach. The KLM model is used for the piezoelectric transducer. In addition, a PSPICE scheme is used for an alternative simulation of the broadband driving spike, including the accurate evaluation of non-linear driving effects. Several examples illustrate the capabilities of the specifically developed software.

  4. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  5. Radio Hazard Safety Assessment for Marine Ship Transmitters: Measurements Using a New Data Collection Method and Comparison with ICNIRP and ARPANSA Limits

    Directory of Open Access Journals (Sweden)

    Malka N. Halgamuge

    2015-05-01

    Full Text Available We investigated the levels of radio frequency electromagnetic fields (RF EMFs emitted from marine ship transmitters. In this study, we recorded the radio frequency (RF electric field (EF levels emitted from transmitters from a marine vessel focusing on the areas normally occupied by crew members and passengers. Previous studies considered radiation hazard safety assessment for marine vessels with a limited number of transmitters, such as very high-frequency (VHF transceivers, radar and communication transmitters. In our investigation, EF levels from seven radio transmitters were measured, including: VHF, medium frequency/high frequency (MF/HF, satellite communication (Sat-Com C, AISnavigation, radar X-band and radar S-band. Measurements were carried out in a 40 m-long, three-level ship (upper deck, bridge deck and bridge roof at 12 different locations. We developed a new data-collection protocol and performed it under 11 different scenarios to observe and measure the radiation emissions from all of the transmitters. In total, 528 EF field measurements were collected and averaged over all three levels of the marine ship with RF transmitters: the measured electric fields were the lowest on the upper deck (0.82–0.86 V/m, the highest on the bridge roof (2.15–3.70 V/m and in between on the bridge deck (0.47–1.15 V/m. The measured EF levels were then assessed for compliance with the occupational and general public reference levels of the International Commission on Non-Ionizing Radiation Protection (ICNIRP guidelines and the Australian Radiation Protection and Nuclear Safety Agency (ARPANSA standards. The ICNIRP and the ARPANSA limits for the general public were exceeded on the bridge roof; nevertheless, the occupational limits were respected everywhere. The measured EF levels, hence, complied with the ICNIRP guidelines and the ARPANSA standards. In this paper, we provide a new data collection model for future surveys, which could be conducted

  6. A VLF transmitter on the Space Shuttle

    Science.gov (United States)

    Inan, U. S.; Bell, T. F.; Helliwell, R. A.; Katsufrakis, K. P.

    The use of space-borne transmitters for the study of interactions of energetic radiation belt particles and coherent plasma waves in the earth's magnetosphere has been considered. The proposed Space Shuttle/Space Lab system would provide a useful VLF transmitter platform since it can lift the required large payloads into orbit, erect long antennas, supply the electrical power required, and provide real-time control. A study is conducted of the power budget of such a VLF transmitter in an attempt to assess the feasibility of the experiment. It is found that a 1-10 kW transmitter placed on the Space Shuttle/Space Lab system can inject from one watt to up to a few kilowatts of wave power into the whistler mode. Recent results of ground-based VLF wave-injection experiments show that such power levels would be more than enough for initiating nonlinear wave growth and amplification and emission triggering in the magnetosphere.

  7. World War II Weather Record Transmittances

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — World War II Weather Record Transmittances are a record of the weather and meteorological data observed during World War II and transferred to the archive. It...

  8. Quantum Communications Transmitter at 775 nm Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose a novel new architecture for a quantum communications laser transmitter that is designed for free-space polarization encoded quantum key distribution...

  9. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  10. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  11. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  12. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  13. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  14. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  15. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  16. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  17. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  18. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  19. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  20. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  1. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  2. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  3. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  4. Mortality, Transmitter Retention, Growth, and Wound Healing in Juvenile Salmon Injected with Micro Acoustic Transmitters

    Energy Technology Data Exchange (ETDEWEB)

    Liss, Stephanie A.; Brown, Richard S.; Deters, Katherine A.; Walker, Ricardo W.; Deng, Z. Daniel; Eppard, M. Brad; Townsend, Richard L.; Seaburg, Adam G.

    2016-07-28

    A cylindrical acoustic transmitter (AT; 0.2 g) has been developed for injection into the peritoneum of fish. Laboratory studies can provide tagging guidelines to minimize the effect of implantation techniques and transmitter burden (relative weight of the transmitter to the weight of the fish) in fish before a transmitter is used in field studies. The goal of this study was to examine response variables (mortality, transmitter expulsion, growth, wound area) of juvenile Chinook Salmon (Oncorhynchus tschawytscha; 65–104 mm fork length [FL]) injected with an AT along a wide range of sizes that could lead to a guideline for minimizing tagging effects. The overarching goal was to determine a minimum size threshold for fish that can be injected, while minimizing adverse transmitter effects. Juveniles (n = 700) were separated into four treatments: (1) acoustic transmitter injection (AT), (2) AT and a passive integrated transponder tag injection (AT+PIT), (3) visual implant elastomer injection (Marked control), and (4) unmarked (Unmarked control). Fish were evaluated weekly for four weeks, and again at the end of the study (60 d post-tagging). Fish injected with an AT or an AT+PIT experienced greater mortality than Marked controls. By 60 d post-tagging, transmitter expulsion was 44% for AT fish and 20% for AT+PIT fish. Fish injected with an AT or an AT+PIT grew (FL and weight gain) significantly less than Marked controls, and no minimum size thresholds were detected. Finally, initial size (FL) significantly affected wound area in AT and AT+PIT fish. A size threshold was only identified on Day 7 (85.1 mm) for AT+PIT fish, indicating that wound areas in fish < 85.1 mm were larger than wound areas of fish > 85.1 mm. This research suggests that injecting juveniles with an AT or an AT+PIT had a greater effect on smaller fish than larger fish.

  5. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  6. Agricultural applications of NIR reflectance and transmittance

    DEFF Research Database (Denmark)

    Gislum, René

    2009-01-01

    There has been a considerable increase in the use of near infrared (NIR) reflectance and transmittance spectroscopy technologies for rapid determination of quality parameters in agriculture, including applications within crop product quality, feed and food quality, manure quality, soil analyses etc....... As a result it was decided to arrange a seminar within the Nordic Association of Agricultural Scientists. This is a report of the meeting....

  7. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  8. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  9. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  10. Surgical implantation of transmitters into fish

    Science.gov (United States)

    Mulcahy, Daniel M.

    2003-01-01

    Although the Animal Welfare Act does not cover poikilotherms, individual institutions and policies and legal requirements other than the Animal Welfare Act (e.g., the US Public Health Service and the Interagency Research Animal Committee's Principles for the Utilization and Care of Vertebrate Animals Used in Testing, Research, and Training) require the review of projects involving fish by institutional animal care and use committees (IACUCs). IACUCs may, however, lack the knowledge and experience to evaluate fish projects judiciously, especially when the projects are in field settings. Surgeries involving implantation of transmitters and other instruments into the coelom, which now comprise a very common research tool in the study of free-ranging fishes, are examples of surgeries that use a broad spectrum of surgical and anesthetic techniques, some of which would not be considered acceptable for similar work on mammals. IACUCs should apply the standards they would expect to be used for surgeries on homeotherms to surgeries on fish. Surgeons should be carefully trained and experienced. Surgical instruments and transmitters should be sterile. Regulations and laws on the use of drugs in animals should be followed, particularly those concerned with anesthetics and antibiotics used on free-ranging fish. Exceptions to surgical procedures should be made only when circumstances are extreme enough to warrant the use of less than optimal procedures.

  11. Behavior of sandhill cranes harnessed with different satellite transmitters

    Science.gov (United States)

    Olsen, Glenn H.; Ellis, D.H.; Landfried, S.E.; Miller, L.H.; Klugman, S.S.; Fuller, M.R.; Vermillion, C.H.

    1992-01-01

    The effectiveness of various attachment methods and designs of platform transmitting terminals (PTT's) was tested on captive sandhill cranes (Grus canadensis) at the Patuxent Wildlife Research Center, Laurel, Maryland, during 1989-91. Combinations of attachment and transmitter designs included neoprene cord harness with batteries separate from the transmitter (2 harness designs), Teflon ribbon harness with batteries incorporated into the transmitter package (4 transmitter models), and a package attached directly to the bird with epoxy glue only. Physical effects seen on cranes wearing PTT's ranged from skin lacerations (caused by rubbing of harness material) to no observed effects (other than feather wear). The most successful harness material and design utilized a Teflon ribbon harness with the 4 ribbon ends from the transmitter forming a neck loop and a body loop joined at the sternum. Time spent by sandhill cranes performing most activities did not change after transmitter attachment using this harness method.

  12. Automobile windscreen rake, spectacle lenses, and effective transmittance.

    Science.gov (United States)

    Walsh, Glyn

    2009-12-01

    To investigate the effect of windscreen rake angle on effective transmittance and the contribution of spectacle lenses to the total transmittance of the system. Theoretical analysis has been carried out using the Fresnel reflectance equations. Windscreen rake can reduce effective transmittance significantly at angles present on modern aerodynamic vehicles. Spectacle lenses reduce the total transmittance still further, often to below the minimum level permissible in current international standards for windscreens. Drivers should always be supplied antireflection-coated lenses where there is a chance of their spectacles being used for night-time driving, if current International standards for windscreen transmittance are to be met by the spectacle-windscreen combination. Windscreen rake angle should be accounted for both in the International Organization for Standardization transmittance standards and in roadside testing devices.

  13. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  14. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  15. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  16. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  17. An Energy Harvesting Underwater Acoustic Transmitter for Aquatic Animals

    OpenAIRE

    Huidong Li; Chuan Tian; Jun Lu; Myjak, Mitchell J.; Martinez, Jayson J.; Brown, Richard S.; Zhiqun Daniel Deng

    2016-01-01

    Acoustic telemetry is the primary method to actively track aquatic animals for behavioral studies. However, the small storage capacities of the batteries used in the transmitters limit the time that the implanted animals can be studied. In this research, we developed and implemented a battery-free acoustic transmitter that uses a flexible piezoelectric beam to harvest energy from fish swimming as the power source. The transmitter sends out a unique identification code with a sufficiently stro...

  18. Optical Transmitter Terminal for Selective RF High Frequency Bans Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective of the proposal work is to investigate the highly innovative conceptual design of an optical communication selective frequency transmitter terminal...

  19. Opportunistic transmitter selection for selfless overlay cognitive radios

    KAUST Repository

    Shaqfeh, Mohammad

    2013-11-01

    We propose an opportunistic strategy to grant channel access to the primary and secondary transmitters in causal selfless overlay cognitive radios over block-fading channels. The secondary transmitter helps the primary transmitter by relaying the primary messages opportunistically, aided by a buffer to store the primary messages temporarily. The optimal channel-aware transmitter- selection strategy is the solution of the maximization of the average secondary rate under the average primary rate requirement and the buffer stability constraints. Numerical results demonstrate the gains of the proposed opportunistic selection strategy. © 2013 IEEE.

  20. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  2. An Energy Harvesting Underwater Acoustic Transmitter for Aquatic Animals

    Energy Technology Data Exchange (ETDEWEB)

    Li, Huidong; Tian, Chuan; Lu, Jun; Myjak, Mitchell J.; Martinez, Jayson J.; Brown, Richard S.; Deng, Zhiqun

    2016-09-20

    This paper presents a self-powered underwater acoustic transmitter using a piezoelectric beam to harvest the mechanical energy from fish swimming. This transmitter does not require a battery and is demonstrated in live fish. It transmits an acoustic waveform as the implanted fish swims. It enables long-term monitoring of aquatic animals.

  3. Evaluation of vaginal implant transmitters in elk (Cervus elaphus nelsoni).

    Science.gov (United States)

    Bruce K. Johnson; Terrance McCoy; Christopher O. Kochanny; Rachel C. Cook

    2006-01-01

    The effects of vaginal implant transmitters for tissue damage after 11 wk in 13 captive adult elk (Cervus elaphus nelsoni) and subsequent reproductive performance in 38 free-ranging elk were evaluated. Vaginal implant transmitters are designed to be shed at parturition and are used to locate birth sites of wild ungulates; however, potential adverse...

  4. 47 CFR 22.165 - Additional transmitters for existing systems.

    Science.gov (United States)

    2010-10-01

    .... (b) Antenna structure registration. Certain antenna structures must be registered with the Commission... contours of the additional transmitter(s) must be totally encompassed by the composite interfering contour... composite service area contour and predicted interfering contour, respectively, of the existing station on...

  5. Juvenile Salmon Acoustic Telemetry System Transmitter Downsize Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Carlson, Thomas J.; Myjak, Mitchell J.

    2010-04-30

    At the request of the U.S. Army Corps of Engineers, Portland District, researchers from Pacific Northwest National Laboratory investigated the use of an application-specific integrated circuit (ASIC) to reduce the weight and volume of Juvenile Salmon Acoustic Telemetry System (JSATS) transmitters while retaining current functionality. Review of the design of current JSATS transmitters identified components that could be replaced by an ASIC while retaining the function of the current transmitter and offering opportunities to extend function if desired. ASIC design alternatives were identified that could meet transmitter weight and volume targets of 200 mg and 100 mm3. If alternatives to the cylindrical batteries used in current JSATS transmitters can be identified, it could be possible to implant ASIC-based JSATS transmitters by injection rather than surgery. Using criteria for the size of fish suitable for surgical implantation of current JSATS transmitters, it was concluded that fish as small as 70 mm in length could be implanted with an ASIC-based transmitter, particularly if implantation by injection became feasible.

  6. 47 CFR 95.639 - Maximum transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Maximum transmitter power. 95.639 Section 95.639 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES... (ERP). (e) The maximum transmitter output power authorized for LPRS stations is 100 mW. (f) In the Med...

  7. luminous transmittance and phase transition temperature of vo2:ce ...

    African Journals Online (AJOL)

    nb

    A two-step increase in transmittance observed in the cooling loop in pure VO2 was found to be suppressed by cerium inclusion. Keywords: vanadium dioxide, luminous transmittance, phase transition temperature. INTRODUCTION. Discovery of novel behavior of vanadium dioxide to undergo a metal-to-insulator phase.

  8. 47 CFR 25.281 - Automatic Transmitter Identification System (ATIS).

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Automatic Transmitter Identification System... Identification System (ATIS). All satellite uplink transmissions carrying broadband video information shall be identified through the use of an automatic transmitter identification system as specified below. (a...

  9. 47 CFR 90.473 - Operation of internal transmitter control systems through licensed fixed control points.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Operation of internal transmitter control... Transmitter Control Internal Transmitter Control Systems § 90.473 Operation of internal transmitter control systems through licensed fixed control points. An internal transmitter control system may be operated...

  10. Light transmittance and polymerization kinetics of amorphous calcium phosphate composites.

    Science.gov (United States)

    Par, Matej; Marovic, Danijela; Skenderovic, Hrvoje; Gamulin, Ozren; Klaric, Eva; Tarle, Zrinka

    2017-05-01

    This study investigated light transmittance and polymerization kinetics of experimental remineralizing composite materials based on amorphous calcium phosphate (ACP), reinforced with inert fillers. Light-curable composites were composed of Bis-EMA-TEGDMA-HEMA resin and ACP, barium glass, and silica fillers. Additionally, a commercial composite Tetric EvoCeram was used as a reference. Light transmittance was recorded in real-time during curing, and transmittance curves were used to assess polymerization kinetics. To obtain additional information on polymerization kinetics, temperature rise was monitored in real-time during curing and degree of conversion was measured immediately and 24 h post-cure. Light transmittance values of 2-mm thick samples of uncured ACP composites (2.3-2.9 %) were significantly lower than those of the commercial composite (3.8 %). The ACP composites presented a considerable transmittance rise during curing, resulting in post-cure transmittance values similar to or higher than those of the commercial composite (5.5-7.9 vs. 5.4 %). The initial part of light transmittance curves of experimental composites showed a linear rise that lasted for 7-20 s. Linear fitting was performed to obtain a function whose slope was assessed as a measure of polymerization rate. Comparison of transmittance and temperature curves showed that the linear transmittance rise lasted throughout the most part of the pre-vitrification period. The linear rise of light transmittance during curing has not been reported in previous studies and may indicate a unique kinetic behavior, characterized by a long period of nearly constant polymerization rate. The observed kinetic behavior may result in slower development of polymerization shrinkage stress but also inferior mechanical properties.

  11. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  12. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  13. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  14. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  15. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  16. Emergency Locator Transmitter Survivability and Reliability Study

    Science.gov (United States)

    Stimson, Chad M.; Littell, Justin D.; Mazzuca, Lisa M.; Foster, Anthony W.; Theodorakos, George J.

    2017-01-01

    A comprehensive study of Emergency Locator Transmitter (ELT) performance was conducted over a three year period concluding in 2016 in support of the Search and Rescue (SAR) Mission Office at National Aeronautics and Space Administration (NASA) Goddard Space Flight Center (GSFC). The study began with a review of reported performance cited in a collection of works published as early as 1980 as well as analysis of a focused set of contemporary aviation crash reports. Based on initial research findings, a series of subscale and fullscale system tests were performed at NASA Langley Research Center (LaRC) with the goals of investigating ELT system failure modes and developing recommended improvements to the Radio Technical Commission for Aeronautics (RTCA) Minimum Operational Performance Specification (MOPS) that will result in improved system performance. Enhanced performance of ELT systems in aviation accidents will reduce unnecessary loss of human life and make SAR operations safer and less costly by reducing the amount of time required to locate accident sites.

  17. High energy microlaser and compact MOPA transmitter

    Science.gov (United States)

    Brickeen, Brian K.; Bernot, Dave; Geathers, Eliot; Mosovsky, Joseph

    2011-06-01

    A compact micro-oscillator incorporating a dual-bounce, grazing incidence gain module with a folded resonator cavity is presented. The gain module, previously developed for Nd:YVO4, is embodied in highly doped ceramic Nd:YAG to generate improved Q-switch performance while maintaining localized pump absorption. The cavity design utilizes a doubly folded optics path around the gain crystal to increase the intra-cavity mode for a more optimum overlap with the pump light volume produced by standard lensed laser diode bars. A modified CS-package diode mount is developed to facilitate the reduced size of the oscillator without sacrificing the ability to use a high-energy, side-pumping arrangement. The oscillator is combined with a high gain, high energy extraction VHGM amplifier to generate a transmitter source on the order of 50 mJ. Cooling for both the oscillator and amplifier modules is provided via a conductive path through the base of the package. Both devices are mounted on opposite sides of a phase-change cooling reservoir to enable self-contained, burst-mode operation. Beam shaping of the oscillator output, in preparation for injection into the amplifier, is contained in a small cut-away path on the reservoir side.

  18. MST radar transmitter control and monitor system

    Science.gov (United States)

    Brosnahan, J. W.

    1983-01-01

    A generalized transmitter control and monitor card was developed using the Intel 8031 (8051 family) microprocessor. The design was generalized so that this card can be utilized for virtually any control application with only firmware changes. The block diagram appears in Figure 2. The card provides for local control using a 16 key keypad (up to 64 keys are supported). The local display is four digits of 7 segment LEDs. The display can indicate the status of all major system parameters and provide voltage readout for the analog signal inputs. The card can be populated with only the chips required for a given application. Fully populated, the card has two RS-232 serial ports for computer communications. It has a total of 48 TTL parallel lines that can define as either inputs or outputs in groups of four. A total of 32 analog inputs with a 0-5 volt range are supported. In addition, a real-time clock/calendar is available if required. A total of 16 k bytes of ROM and 16 k bytes of RAM is available for programming. This card can be the basis of virtually any monitor or control system with appropriate software.

  19. Optical Tunable-Based Transmitter for Multiple Radio Frequency Bands

    Science.gov (United States)

    Nguyen, Hung (Inventor); Simons, Rainee N. (Inventor); Wintucky, Edwin G. (Inventor); Freeman, Jon C. (Inventor)

    2016-01-01

    An optical tunable transmitter is used to transmit multiple radio frequency bands on a single beam. More specifically, a tunable laser is configured to generate a plurality of optical wavelengths, and an optical tunable transmitter is configured to modulate each of the plurality of optical wavelengths with a corresponding radio frequency band. The optical tunable transmitter is also configured to encode each of the plurality of modulated optical wavelengths onto a single laser beam for transmission of a plurality of radio frequency bands using the single laser beam.

  20. Experimental Characterization of Near-Infrared Laser Energy Absorption, Scattering, and Transmittance in Biological Tissue

    National Research Council Canada - National Science Library

    Laffitte, John; Roelant, David; Denton, Michael L; Thomas, Robert J

    2007-01-01

    .... Tissue samples varied in thickness from millimeters to microns. Readings from three IR detectors were used to calculate the diffuse reflectance, diffuse transmittance, and collimated transmittance...

  1. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  2. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  3. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  4. 47 CFR 95.628 - MedRadio transmitters.

    Science.gov (United States)

    2010-10-01

    ... measured on a test site equivalent to free space such as a fully anechoic test chamber. Compliance with the... anechoic test chamber. Compliance with the maximum transmitter power requirements set forth in § 95.639(f...

  5. High Temperature Telemetry Transmitter for Venus Exploration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed S-band telemetry transmitter will operate in the exterior Venusian corrosive, high pressure, 460oC ambient atmosphere without being contained in a...

  6. Surgical insertions of transmitters and telemetry methods in fisheries research

    Science.gov (United States)

    Wargo Rub, A. Michelle; Jepsen, Niels; Liedtke, Theresa L.; Moser, L; Weber III, E. P. Scott

    2015-01-01

    Use of electronic transmitter and monitoring systems to track movements of aquatic animals has increased continuously since the inception of these systems in the mid-1950s. The purpose of the present report is to provide information about veterinary principles and their incorporation into surgical implantation procedures for fish. We also intend to provide insight into the unique challenges of field-based aquatic surgical studies. Within this context, 4 aspects of the process for surgical implantation of transmitters in fish (ie, handling, aseptic technique, anesthesia, and implantation) will be described. Effects of surgical insertion of transmitters (ie, tagging) and aspects of the surgical implantation process where collaboration and professional exchanges among nonveterinarian researchers and veterinarians may be most fruitful will be discussed. Although this report focuses on surgical implantation, the principles and protocols described here (other than incision and suture placement) are also applicable to studies that involve injection of transmitters into fish.

  7. Determining Light Transmittance Characteristics of Wood and Bark Chips

    Science.gov (United States)

    Douglas B. Brumm; Robert C. Radcliffe; John A. Sturos

    1983-01-01

    Describes compter-assisted testing for measuring light transmittance of wood and bark chips. Electronic interface permitted the computer to collect physical data accurately and efficiently and to analyze and present the data in several tabular and grapical formats

  8. High Temperature Telemetry Transmitter for Venus Exploration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed S-band telemetry transmitter will operate in the exterior Venusian high pressure, 465?aC ambient atmosphere without being contained in a thermally...

  9. Streaming Transmitter over Block-Fading Channels with Delay Constraint

    CERN Document Server

    Cocco, Giuseppe; Ibars, Christian

    2012-01-01

    Data streaming transmission, in which the data arrives at the transmitter gradually over time is studied. It is assumed that the transmitter receives a new message at each channel block at a constant rate which is fixed by an underlying application, and tries to broadcast these messages to users within a certain deadline. The channels are assumed to be block fading and independent over blocks and users. The performance measure is the average total rate of received information at the users within the transmission deadline. Three different encoding schemes are proposed and compared with an informed transmitter upper bound in terms of the average total rate for a set of users with varying channel qualities. Analytical upper bounds on the average total rate are derived for all the proposed schemes. It is shown that no single transmission strategy dominates the others at all channel settings, and the best transmitter streaming scheme depends on the distribution of the average channel conditions over the users.

  10. Efficient and Compact Semiconductor Laser Transmitter Modules Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Continue development of a Compact Transmitter Module (CTM). Modules will be voltage controlled to adjust wavlength using temperature and drive current settings. The...

  11. Transmitter Architectures Based on Near-Field Direct Antenna Modulation

    OpenAIRE

    Babakhani, Aydin; Rutledge, David B.; Hajimiri, Ali

    2008-01-01

    A near-field direct antenna modulation (NFDAM) technique is introduced, where the radiated far-field signal is modulated by time-varying changes in the antenna near-field electromagnetic (EM) boundary conditions. This enables the transmitter to send data in a direction-dependent fashion producing a secure communication link. Near-field direct antenna modulation (NFDAM) can be performed by using either switches or varactors. Two fully-integrated proof-of-concept NFDAM transmitters operating at...

  12. An Ultra-Low Power Edge Combining BPSK Transmitter

    Science.gov (United States)

    2013-09-01

    TECHNICAL DOCUMENT 3271 September 2013 An Ultra-Low Power Edge Combining BPSK Transmitter A. Ryu J. Rowland S. Naik...Ultra-Low Power Edge Combining BPSK Transmitter Albert Ryu #1, Jason Rowland #2, Suketu Naik #3 #1, #2 55250, Advanced Integrated Circuit Technology...locked to a ring oscillator (RO), and then multiple phase outputs are combined at the last edge combining/power amplifier (EC/PA) stage. With the

  13. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  14. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  15. Design Parameters of a Miniaturized Piezoelectric Underwater Acoustic Transmitter

    Energy Technology Data Exchange (ETDEWEB)

    Li, Huidong; Deng, Zhiqun; Yuan, Yong; Carlson, Thomas J.

    2012-07-02

    The Juvenile Salmon Acoustic Telemetry System (JSATS) project supported by the U.S. Army Corps of Engineers, Portland District, has yielded the smallest acoustic fish tag transmitter commercially available to date. In order to study even smaller fish populations and make the transmitter injectable by needles, the JSATS acoustic micro transmitter needs to be further downsized. As part of the transmitter downsizing effort some of the design parameters of the lead zirconate titanate (PZT) ceramic tube transducer in the transmitter were studied, including the type of PZT, the backing material, the necessary drive voltage, the transmitting bandwidth and the length of the transducer. It was found that, to satisfy the 156-dB source level requirement of JSATS, a square wave with a 10-volt amplitude is required to drive 'soft' PZT transducers. PZT-5H demonstrated the best source level performance. For Navy types I and II, 16 volts or 18 volts were needed. Ethylene-propylene-diene monomer (EPDM) closed-cell foam was found to be the backing material providing the highest source level. The effect of tube length on the source level is also demonstrated in this paper, providing quantitative information for downsizing of small piezoelectric transmitters.

  16. Effects of radio transmitters on migrating wood thrushes

    Science.gov (United States)

    Powell, L.A.; Krementz, D.G.; Lang, J.D.; Conroy, M.J.

    1998-01-01

    We quantified the effects of radio transmitters on Wood Thrushes (Hylocichla mustelina) using 4 yr of banding and telemetry data from Piedmont National Wildlife Refuge, Georgia. Flight performance models suggest that the 1.6-g transmitter shortens the migratory range of Wood Thrushes by only 60 km, and the estimated migratory range is adequate to accomplish migration even with limited fat stores. We used two strengths of line, 5- and 9-kg test-strength braided Dacron, to attach the transmitters using the thigh-harness method. We recaptured 13 returning radio-marked Wood Thrushes, seven of which were still marked. Six of the seven birds marked with the 5-kg test harnesses lost their transmitters within 1 yr while all six of the 9-kg test harnesses were still attached up to 21 mo later. Radio-marking did not reduce the return rates of adults and immatures, and the transmitters did not cause radio-marked birds to lose more mass than banded-only birds. Wood Thrushes can successfully carry a transmitter during migration with no detectable negative effects. We recommend continued use of the thigh-harness method, but we encourage the use of 5-kg cotton line.

  17. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  18. 47 CFR 90.471 - Points of operation in internal transmitter control systems.

    Science.gov (United States)

    2010-10-01

    ...) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Transmitter Control Internal Transmitter Control Systems § 90.471 Points of operation in internal transmitter control systems. The... licensee for internal communications and transmitter control purposes. Operating positions in internal...

  19. 47 CFR 90.475 - Operation of internal transmitter control systems in specially equipped systems.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Operation of internal transmitter control... Control Internal Transmitter Control Systems § 90.475 Operation of internal transmitter control systems in specially equipped systems. (a) An internal transmitter control system need not be designed to meet the...

  20. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  1. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  2. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  3. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  4. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  5. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  6. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  7. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  8. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  9. An Energy Harvesting Underwater Acoustic Transmitter for Aquatic Animals.

    Science.gov (United States)

    Li, Huidong; Tian, Chuan; Lu, Jun; Myjak, Mitchell J; Martinez, Jayson J; Brown, Richard S; Deng, Zhiqun Daniel

    2016-09-20

    Acoustic telemetry is the primary method to actively track aquatic animals for behavioral studies. However, the small storage capacities of the batteries used in the transmitters limit the time that the implanted animals can be studied. In this research, we developed and implemented a battery-free acoustic transmitter that uses a flexible piezoelectric beam to harvest energy from fish swimming as the power source. The transmitter sends out a unique identification code with a sufficiently strong signal (150 dB, ref: 1 μPa at 1 meter) that has a detection range of up to 100 meters. Two prototypes, 100 mm and 77 mm long, respectively, weighing only about 1 gram or less in air, were sub-dermally implanted in two species of live fish. Transmissions were successfully detected as the fish swam in a natural manner. This represents the first known implanted energy-harvesting transmitter demonstrated in vivo. Successful development of this transmitter greatly expands the potential for long-term studies of the behaviors of aquatic animals and for subsequently developing strategies to mitigate the environmental impacts of renewable energy systems.

  10. Microminiature radio frequency transmitter for communication and tracking applications

    Science.gov (United States)

    Crutcher, Richard I.; Emery, Mike S.; Falter, Kelly G.; Nowlin, C. H.; Rochelle, Jim M.; Clonts, Lloyd G.

    1997-02-01

    A micro-miniature radio frequency (rf) transmitter has been developed and demonstrated by the Oak Ridge National Laboratory. The objective of the rf transmitter development was to maximize the transmission distance while drastically shrinking the overall transmitter size, including antenna. Based on analysis and testing, an application-specific integrated circuit (ASIC) with a 16-GHz gallium arsenide (GaAs) oscillator and integrated on-chip antenna was designed and fabricated using microwave monolithic integrated circuit (MMIC) technology. Details of the development and the results of various field tests are discussed. The rf transmitter is applicable to covert surveillance and tracking scenarios due to its small size of 2.2 multiplied by 2.2 mm, including the antenna. Additionally, the 16-GHz frequency is well above the operational range of consumer-grade radio scanners, providing a degree of protection from unauthorized interception. Variations of the transmitter design have been demonstrated for tracking and tagging beacons, transmission of digital data, and transmission of real-time analog video from a surveillance camera. Preliminary laboratory measurements indicate adaptability to direct-sequence spread-spectrum transmission, providing a low probability of intercept and/or detection. Concepts related to law enforcement applications are presented.

  11. An Energy Harvesting Underwater Acoustic Transmitter for Aquatic Animals

    Science.gov (United States)

    Li, Huidong; Tian, Chuan; Lu, Jun; Myjak, Mitchell J.; Martinez, Jayson J.; Brown, Richard S.; Deng, Zhiqun Daniel

    2016-09-01

    Acoustic telemetry is the primary method to actively track aquatic animals for behavioral studies. However, the small storage capacities of the batteries used in the transmitters limit the time that the implanted animals can be studied. In this research, we developed and implemented a battery-free acoustic transmitter that uses a flexible piezoelectric beam to harvest energy from fish swimming as the power source. The transmitter sends out a unique identification code with a sufficiently strong signal (150 dB, ref: 1 μPa at 1 meter) that has a detection range of up to 100 meters. Two prototypes, 100 mm and 77 mm long, respectively, weighing only about 1 gram or less in air, were sub-dermally implanted in two species of live fish. Transmissions were successfully detected as the fish swam in a natural manner. This represents the first known implanted energy-harvesting transmitter demonstrated in vivo. Successful development of this transmitter greatly expands the potential for long-term studies of the behaviors of aquatic animals and for subsequently developing strategies to mitigate the environmental impacts of renewable energy systems.

  12. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  13. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  14. Joint Transmitter-Receiver Optimization in the Downlink CDMA Systems

    Directory of Open Access Journals (Sweden)

    Mohammad Saquib

    2002-08-01

    Full Text Available To maximize the downlink code-division multiple access (CDMA system capacity, we propose to minimize the total transmitted power of the system subject to users′ signal-to-interference ratio (SIR requirements via designing optimum transmitter sequences and utilizing linear optimum receivers (minimum mean square error (MMSE receiver. In our work on joint transmitter-receiver design for the downlink CDMA systems with multiple antennas and multipath channels, we develop several optimization algorithms by considering various system constraints and prove their convergence. We empirically observed that under the optimization algorithm with no constraint on the system, the optimum receiver structure matches the received transmitter sequences. A simulation study is performed to see how the different practical system constraints penalize the system with respect to the optimum algorithm with no constraint on the system.

  15. Examination of an optical transmittance test for photovoltaic encapsulation materials

    Energy Technology Data Exchange (ETDEWEB)

    Miller, David C.; Bengoechea, Jaione; Bokria, Jayesh G.; Köhl, Michael; Powell, Nick E.; Smith, Michael E.; White, Michael D.; Wilson, Helen Rose; Wohlgemuth, John H.; Dhere, Neelkanth G.; Wohlgemuth, John H.; Lynn, Kevin W.

    2013-09-24

    The optical transmittance of encapsulation materials is a key characteristic for their use in photovoltaic (PV) modules. Changes in transmittance with time in the field affect module performance, which may impact product warranties. Transmittance is important in product development, module manufacturing, and field power production (both immediate and long-term). Therefore, an international standard (IEC 62788-1-4) has recently been proposed by the Encapsulation Task-Group within the Working Group 2 (WG2) of the International Electrotechnical Commission (IEC) Technical Committee 82 (TC82) for the quantification of the optical performance of PV encapsulation materials. Existing standards, such as ASTM E903, are general and more appropriately applied to concentrated solar power than to PV. Starting from the optical transmittance measurement, the solar-weighted transmittance of photon irradiance, yellowness index (which may be used in aging studies to assess durability), and ultraviolet (UV) cut-off wavelength may all be determined using the proposed standard. The details of the proposed test are described. The results of a round-robin experiment (for five materials) conducted at seven laboratories to validate the test procedure using representative materials are also presented. For example, the Encapsulation Group actively explored the measurement requirements (wavelength range and resolution), the requirements for the spectrophotometer (including the integrating sphere and instrument accessories, such as a depolarizer), specimen requirements (choice of glass-superstrate and -substrate), and data analysis (relative to the light that may be used in the PV application). The round-robin experiment identified both intra- and inter-laboratory instrument precision and bias for five encapsulation materials (encompassing a range of transmittance and haze-formation characteristics).

  16. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  17. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  18. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  19. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  20. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  1. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  2. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  3. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  4. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  5. Luminous transmittance and phase transition temperature of VO 2 ...

    African Journals Online (AJOL)

    The phase transition temperature (τc) of the films was obtained from both the transmittance and sheet resistance against temperature curves. A change in sheet resistance of 2 to 3 orders of magnitude was observed for both undoped and Ce-doped VO2 films. Comparison between undoped and doped VO2 films revealed ...

  6. Evaluation of acoustic transmitter implantation and determination of ...

    African Journals Online (AJOL)

    Largemouth bass Micropterus salmoides are an important angling species that are often displaced during catchand-release fishing tournaments. The impact of acoustic transmitter implantation on this species and the effect of displacement distance on their behaviour were tested. In April 2010, 10 fish with surgically ...

  7. Snake mortality associated with late season radio-transmitter implantation

    Science.gov (United States)

    D. Craig Rudolph; Shirley J. Burgdorf; Richard R. Schaefer; Richard N. Conner; Robert T. Zappalorth

    1998-01-01

    Radio-telemetry is an increasingly used procedure to obtain data on the biology of free-living snakes (Reinert 1992, 1994). In Texas and Louisiana we have been using the surgical technique of Weatherhead and Anderka (1984) to implant transmitters in timber rattlesnakes (Crotalus horridus) and Louisiana pine snakes (Pituophis melanoleucus...

  8. 47 CFR 73.1660 - Acceptability of broadcast transmitters.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Acceptability of broadcast transmitters. 73.1660 Section 73.1660 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES Rules Applicable to All Broadcast Stations § 73.1660 Acceptability of...

  9. Order-sorting filter transmittance measured with an array detector

    Science.gov (United States)

    Heaney, James B.; Bradley, Scott E.; Bly, Vincent T.; Ewin, Audrey J.; La, Anh T.

    1993-08-01

    The simultaneous measurement of the spectrally and spatially variant transmittance of a linear variable order-sorting filter in a manner that closely resembles its conditions of actual use is described. The transmittance of a prototype order-sorting filter was measured in the 400- to 880-nm wavelength region by illuminating it with the output beam of a spectrophotometer while the filter was attached to the front of a 30 x 32 pixel silicon array detector. The filter was designed to be used in the output beam of a grating spectrometer to prevent the dispersal of higher diffracted orders onto an array detector. Areas of the filter that were spatially matched to the corresponding detector pixel column had measured peak transmittances of about 90 percent that were uniform to within +/- 1.5 percent along a given column. Transmittances for incident wavelengths shorter than the desired bandpass, corresponding to the order overlap region, were measured in the 0.003 range. Line spread function measurements made with the array detector indicated no significant beam spreading caused by inserting the filter into the beam.

  10. 47 CFR 73.685 - Transmitter location and antenna system.

    Science.gov (United States)

    2010-10-01

    ... antenna system. In the case of a composite antenna composed of two or more individual antennas, this means that the patterns for the composite antenna, not the patterns for each of the individual antennas, must... 47 Telecommunication 4 2010-10-01 2010-10-01 false Transmitter location and antenna system. 73.685...

  11. Ozone transmittance in a model atmosphere at Ikeja, Lagos state ...

    African Journals Online (AJOL)

    Variation of ozone transmittance with height in the atmosphere for radiation in the 9.6m absorption band was studied using Goody's model atmosphere, with cubic spline interpolation technique to improve the quality of the curve. The data comprising of pressure and temperature at different altitudes (0-22 km) for the month of ...

  12. Analysis of an Intelligent Temperature Transmitter for Process Control

    African Journals Online (AJOL)

    It also identifies low power microprocessor and analog to digital converters working with the basic sensor circuit as the key propellants in the advancement of transmitter technology. Despite several sensors available in the process control industry, the authors focus on temperature sensors and analyze a typical Rosemount ...

  13. Digital staining of pathological tissue specimens using spectral transmittance

    Science.gov (United States)

    Bautista, Pinky A.; Abe, Tokiya; Yamaguchi, Masahiro; Yagi, Yukako; Ohyama, Nagaaki

    2005-04-01

    Staining of tissue specimens is a classical procedure in pathological diagnosis to enhance the contrast between tissue components such that identification and classification of these components can be easily performed. In this paper, a framework for digital staining of pathological specimens using the information derived from the L-band spectral transmittance of various pathological tissue components is introduced, particularly the transformation of a Hematoxylin and Eosin (HE) stained specimen to its Masson-Trichrome (MT) stained counterpart. The digital staining framework involves the classification of tissue components, which are highlighted when the specimen is actually stained with MT stain, e.g. fibrosis, from the HE-stained image; and the linear mapping between specific sets of HE and MT stained transmittance spectra through pseudo-inverse procedure to produce the LxL transformation matrices that will be used to transform the HE stained transmittance to its equivalent MT stained transmittance configuration. To generate the digitally stained image, the decisions of multiple quadratic classifiers are pooled to form the weighting factors for the transformation matrices. Initial results of our experiments on liver specimens show the viability of multispectral imaging (MSI) for the implementation of digital staining in the pathological context.

  14. Spectral transmittance of the spectacle scale of snakes and geckos

    NARCIS (Netherlands)

    Doorn, van K.; Sivak, J.G.

    2015-01-01

    The spectral transmittance of the optical media of the eye plays a substantial role in tuning the spectrum of light available for capture by the retina. Certain squamate reptiles, including snakes and most geckos, shield their eyes beneath a layer of transparent, cornified skin called the

  15. Controlled crumpling of graphene oxide films for tunable optical transmittance.

    Science.gov (United States)

    Thomas, Abhay V; Andow, Brandon C; Suresh, Shravan; Eksik, Osman; Yin, Jie; Dyson, Anna H; Koratkar, Nikhil

    2015-06-03

    The delamination buckling approach provides a facile means to dynamically control the optical transmittance of extremely flexible and stretchable graphene oxide coatings with fast response time. Such graphene oxide coatings can be deposited by scalable solution-processing methods for potential applications in dynamic glazing. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. 47 CFR 97.313 - Transmitter power standards.

    Science.gov (United States)

    2010-10-01

    ....313 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES... must use the minimum transmitter power necessary to carry out the desired communications. (b) No... an effective radiated power (ERP) exceeding 50 W PEP on the 60 m band. For the purpose of computing...

  17. 47 CFR 95.855 - Transmitter effective radiated power limitation.

    Science.gov (United States)

    2010-10-01

    .... 95.855 Section 95.855 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Transmitter effective radiated power limitation. The effective radiated power (ERP) of each CTS and RTU shall be limited to the minimum necessary for successful communications. No CTS or fixed RTU may transmit...

  18. ALTERNATIVE METHOD FOR ON SITE EVALUATION OF THERMAL TRANSMITTANCE

    Directory of Open Access Journals (Sweden)

    Aleksandar Janković

    2017-08-01

    Full Text Available Thermal transmittance or U-value is an indicator of the building envelope thermal properties and a key parameter for evaluation of heat losses through the building elements due to heat transmission. It can be determined by calculation based on thermal characteristics of the building element layers. However, this value does not take into account the effects of irregularities and degradation of certain elements of the envelope caused by aging, which may lead to errors in calculation of the heat losses. An effective and simple method for determination of thermal transmittance is in situ measurement, which is governed by the ISO 9869-1:2014 that defines heat flow meter method. This relatively expensive method leaves marks and damages surface of the building element. Furthermore, the final result is not always reliable, in particular when the building element is light or when the weather conditions are not suitable. In order to avoid the above mentioned problems and to estimate the real thermal transmittance value an alternative experimental method, here referred as the natural convection and radiation method, is proposed in this paper. For determination of thermal transmittance, this method requires only temperatures of inside and outside air, as well as the inner wall surface temperature. A detailed statistical analysis, performed by the software package SPSS ver. 20, shows several more advantages of this method comparing to the standard heat flow meter one, besides economic and non-destructive benefits.

  19. A method for predicting the direct transmittance of atmospheric ...

    African Journals Online (AJOL)

    The trends in the variations of the two models are identical but the disparity in the magnitudes of the transmittances tends to widen with increasing value of air mass under the specified conditions, particularly for air masses 20. Appropriate reasons have been given for the observed differences. It is proposed that the ...

  20. Efficient and Compact Semiconductor Laser Transmitter Modules Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Develop a Compact Transmitter Module (CTM) capable of operating at 1.26 5m, 1.57 5m and at 2 5m complete with all drive and control electronics for the TEC and the...

  1. analysis of an analysis of an intelligent temperature transmitter

    African Journals Online (AJOL)

    eobe

    analog to digital converters working with the basic sensor circuit as the key propellants in the advancement of transmitter technology. Despite several .... which include constrains in energy supply, storage capacity and bandwidth not to ... sine wave of digital signals which make up 1.2 KHz and 2.2 KHz, representing bits 1 ...

  2. Surgical insertion of transmitters and telemetry methods in fisheries research

    DEFF Research Database (Denmark)

    Rub, A. Michelle Wargo; Jepsen, Niels; Liedtke, Theresa L.

    2014-01-01

    ) will be described. Effects of surgical insertion of transmitters (ie, tagging) and aspects of the surgical implantation process where collaboration and professional exchanges among nonveterinarian researchers and veterinarians may be most fruitful will be discussed. Although this report focuses on surgical...

  3. Optimisation of radio transmitter locations in mobile telecommunications networks

    Directory of Open Access Journals (Sweden)

    Schmidt-Dumont, Thorsten

    2016-08-01

    Full Text Available Multiple factors have to be taken into account when mobile telecommunication network providers make decisions about radio transmitter placement. Generally, area coverage and the average signal level provided are of prime importance in these decisions. These criteria give rise to a bi-objective problem of facility location, with the goal of achieving an acceptable trade-off between maximising the total area coverage and maximising the average signal level provided to the demand region by a network of radio transmitters. This paper establishes a mathematical modelling framework, based on these two placement criteria, for evaluating the effectiveness of a given set of radio transmitter locations. In the framework, coverage is measured according to the degree of obstruction of the so-called ‘Fresnel zone’ that is formed between handset and base station, while signal strength is modelled taking radio wave propagation loss into account. This framework is used to formulate a novel bi-objective facility location model that may form the basis for decision support aimed at identifying high-quality transmitter location trade-off solutions for mobile telecommunication network providers. But it may also find application in various other contexts (such as radar, watchtower, or surveillance camera placement optimisation.

  4. 22 CFR 181.7 - Transmittal to the Congress.

    Science.gov (United States)

    2010-04-01

    ... Assistant Legal Adviser for Treaty Affairs to the Senate Committee on Foreign Affairs. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Transmittal to the Congress. 181.7 Section 181.7 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL AGREEMENTS COORDINATION, REPORTING AND...

  5. 48 CFR 5.207 - Preparation and transmittal of synopses.

    Science.gov (United States)

    2010-10-01

    ... Preparation and transmittal of synopses. (a) Content. Each synopsis transmitted to the GPE must address the... of manufacture. (6) Quantity, including any options for additional quantities. (7) Unit of issue. (8...) If the technical data required to respond to the solicitation will not be furnished as part of such...

  6. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  7. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  8. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  9. Digital controller for the Wave Propagation Laboratory's VHF and UHF wind-profiling radars

    Science.gov (United States)

    Moran, K.

    1984-09-01

    Principles are described for operation of a digital system that is used to control the operations of a multiple beam stratospheric-tropospheric (ST) radar system. The digital system, referred to as the radar controller, contains the digital logic for generating the necessary pulse sequences for modulation of the radar transmitter, gating the radar's receiver channels, and sequencing the antenna beams. The radar controller also performs digital-to-analog conversion and coherent averaging of the receiver necessary for signal detection in ST radars. The radar controller is controlled internally by a Z80 microprocessor, and the entire system functions as a peripheral device to a host minicomputer. Block diagrams and detailed circuit schematics for all the custom designed electronics are included.

  10. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  11. 77 FR 28668 - Technical Standard Order (TSO)-C91a, Emergency Locator Transmitters (ELTs)

    Science.gov (United States)

    2012-05-15

    ... Technical Standard Order (TSO)-C91a, Emergency Locator Transmitter (ELT) Equipment. SUMMARY: This notice announces the FAA's cancellation of TSO-C91a, Emergency Locator Transmitter (ELT) Equipment. The effect of... December 1, 2012, must seek authorization for TSO-C126a, 406 MHz Emergency Locator Transmitter (ELT), or...

  12. All polymer chip for amperometric studies of transmitter release from large groups of neuronal cells

    DEFF Research Database (Denmark)

    Larsen, Simon T.; Taboryski, Rafael

    2012-01-01

    -induced release of transmitter molecules. The nature of the resulting current peaks is discussed, and the time for restoring transmitter reservoirs is studied. The relationship between released transmitters and potassium concentration was found to fit to a sigmoidal dose–response curve. Finally, we demonstrate...

  13. Effects of radio transmitters on the behavior of Red-headed Woodpeckers

    Science.gov (United States)

    Mark Vukovich; John C. Kilgo

    2009-01-01

    Previous studies have revealed that radio-transmitters may affect bird behaviors, including feeding rates, foraging behavior, vigilance, and preening behavior. In addition, depending on the method of attachment, transmitters can potentially affect the ability of cavity-nesting birds to use cavities. Our objective was to evaluate effects of transmitters on the behavior...

  14. High-transmittance all-dielectric Huygens' metasurfaces (presentation video)

    Science.gov (United States)

    Staude, Isabelle; Decker, Manuel; Falkner, Matthias; Dominguez, Jason; Neshev, Dragomir N.; Brener, Igal; Pertsch, Thomas; Kivshar, Yuri S.

    2014-09-01

    We demonstrate a metamaterial Huygens' surfaces for near-infrared frequencies using high-permittivity all-dielectric nanoparticles with tailored Mie-type resonances as meta-atoms. We experimentally measure 360 degrees phase variation of the transmitted light in combination with high transmittance values for light passing through a fabricated metasurface exhibiting spectrally overlapping electric and magnetic dipole-type modes in the near-infrared spectral range. Our experimental measurements are in excellent agreement with numerical simulations and analytical calculations. High transmittance in combination with the simultaneously observed complete phase coverage is key for the realization of a wide range of applications including efficient wavefront shaping, dispersion control devices, and holograms.

  15. LOT-G3: Plasma Lamp, Ozonator and CW transmitter

    CERN Document Server

    Gobato, Ricardo; Gobato, Alekssander

    2015-01-01

    The LOT-G3 is designed to be a versatile equipment that perform several simple experiments for use in helping the physics classes for high school. Easy construction, low cost, using easily accessible materials. Its construction involves simple practices and knowledge of electromagnetism. It has the function of a plasma globe to demonstrate the ionization of a low pressure gas, as well as the formation of magnetic field. Can be used as sanitizer closed environments such as automotive vehicles in ozonator function, demonstrating the ionization of oxygen in the atmosphere, producing ozone, essential to life on earth. And as a sparks transmitter, low power, low frequency modulated continuous wave in (CW), for signals in Morse code. Therefore the equipment here called LOT-G3, has three functions: a plasma lamp, ozonator and CW transmitter.

  16. Cylindrical PVDF film transmitters and receivers for air ultrasound.

    Science.gov (United States)

    Toda, Minoru

    2002-05-01

    Cylindrical polyvinylidene fluoride (PVDF) film transducers for transmission and reception of 40-kHz ultrasonic waves in air have been investigated. A key feature of such transducers is their omni-directional polar response. An optimized structure comprises a cylindrical PVDF film element resting on a spool without a mechanical bond to it. Various key design equations to obtain the required ultrasonic performance both as transmitter and receiver are shown, which include resonance frequency, acoustic pressure, angle performance, back air cavity effect, and receiver sensitivity. Measurements of actual frequency response of transmitter output and receiver sensitivity, angular performance, back air space effect, and temperature effect are presented. The results agree well with the theoretical predictions. It has been shown that this device is well-suited for practical application as an ultrasonic ranging device.

  17. System for Isolation Testing of RF Transmitters and Receivers

    Science.gov (United States)

    2012-08-03

    memory 30B. [0018] Programmable device 30 can be based on a software defined radio ( SDR ) configured to operate as described herein. By way of example...one such software defined radio is the open source GNU radio platform utilizing the Universal Software Radio Peripheral. [0019] The advantages of...to a system that can perform isolation testing of a radio frequency (RF) transmitter or an RF receiver. (2) Description of the Prior Art [0004

  18. Laser Transmitters for the optical link systems used in CMS

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    In the CMS experiment of the now new flagship LHC optical links will be used for the tracker readout system. One part of this components will be semiconductor laser (~50.000 !!!), named correctly: 1310 nm InGaAsP (DCPBH-MQW) edge-emitting laser. They are foreseen as transmitter in the Tx Hybrid part of the optical link system.

  19. Secure Broadcasting with Imperfect Channel State Information at the Transmitter

    KAUST Repository

    Hyadi, Amal

    2015-11-13

    We investigate the problem of secure broadcasting over fast fading channels with imperfect main channel state information (CSI) at the transmitter. In particular, we analyze the effect of the noisy estimation of the main CSI on the throughput of a broadcast channel where the transmission is intended for multiple legitimate receivers in the presence of an eavesdropper. Besides, we consider the realistic case where the transmitter is only aware of the statistics of the eavesdropper’s CSI and not of its channel’s realizations. First, we discuss the common message transmission case where the source broadcasts the same information to all the receivers, and we provide an upper and a lower bounds on the ergodic secrecy capacity. For this case, we show that the secrecy rate is limited by the legitimate receiver having, on average, the worst main channel link and we prove that a non-zero secrecy rate can still be achieved even when the CSI at the transmitter is noisy. Then, we look at the independent messages case where the transmitter broadcasts multiple messages to the receivers, and each intended user is interested in an independent message. For this case, we present an expression for the achievable secrecy sum-rate and an upper bound on the secrecy sum-capacity and we show that, in the limit of large number of legitimate receivers K, our achievable secrecy sum-rate follows the scaling law log((1−) log(K)), where is the estimation error variance of the main CSI. The special cases of high SNR, perfect and no-main CSI are also analyzed. Analytical derivations and numerical results are presented to illustrate the obtained expressions for the case of independent and identically distributed Rayleigh fading channels.

  20. Temperature Dependence of Light Transmittance in Polymer Dispersed Liquid Crystals

    OpenAIRE

    Bloisi, F.; Ruocchio, C.; Vicari, L

    1997-01-01

    Polymer Dispersed Liquid Crystals (PDLC) axe composite materials made of a dispersion of liquid crystal droplets in a polymeric matrix. When the liquid crystal is in the nematic phase, droplets appeax as optically anisotropic spheres and the material is opaque white. Sample transmittance is a function of the temperature. If the liquid crystal refractive index in the isotropic phase is equal to the one of the polymer, after the nematic-isotropic transition the material is transparent. We prese...

  1. Effects of satellite transmitters on captive and wild mallards

    Science.gov (United States)

    Kesler, Dylan C.; Raedeke, Andrew H.; Foggia, Jennifer R.; Beatty, William S.; Webb, Elisabeth B.; Humburg, Dale D.; Naylor, Luke W.

    2014-01-01

    Satellite telemetry has become a leading method for studying large-scale movements and survival in birds, yet few have addressed potential effects of the larger and heavier tracking equipment on study subjects. We simultaneously evaluated effects of satellite telemetry equipment on captive and wild mallards (Anas platyrhynchos) to assess impacts on behavior, body mass, and movement. We randomly assigned 55 captive ducks to one of 3 treatment groups, including a standard body harness group, a modified harness group, and a control group. Ducks in the control group were not fitted with equipment, whereas individuals in the other 2 groups were fitted with dummy transmitters attached with a Teflon ribbon harness or with a similar harness constructed of nylon cord. At the conclusion of the 14-week captive study, mean body mass of birds in the control group was 40–105 g (95% CI) greater than birds with standard harnesses, and 28–99 g (95% CI) greater than birds with modified harnesses. Further, results of focal behavior observations indicated ducks with transmitters were less likely to be in water than control birds. We also tested whether movements of wild birds marked with a similar Teflon harness satellite transmitter aligned with population movements reported by on-the-ground observers who indexed local abundances of mid-continent mallards throughout the non-breeding period. Results indicated birds marked with satellite transmitters moved concurrently with the larger unmarked population. Our results have broad implications for field research and suggest that investigators should consider potential for physiological and behavioral effects brought about by tracking equipment. Nonetheless, results from wild ducks indicate satellite telemetry has the potential to provide useful movement data.

  2. Intraperitoneal implantation of life-long telemetry transmitters in otariids

    Directory of Open Access Journals (Sweden)

    Haulena Martin

    2008-12-01

    Full Text Available Abstract Background Pinnipeds, including many endangered and declining species, are inaccessible and difficult to monitor for extended periods using externally attached telemetry devices that are shed during the annual molt. Archival satellite transmitters were implanted intraperitoneally into four rehabilitated California sea lions (Zalophus californianus and 15 wild juvenile Steller sea lions (Eumetopias jubatus to determine the viability of this surgical technique for the deployment of long-term telemetry devices in otariids. The life history transmitters record information throughout the life of the host and transmit data to orbiting satellites after extrusion following death of the host. Results Surgeries were performed under isoflurane anesthesia and single (n = 4 or dual (n = 15 transmitters were inserted into the ventrocaudal abdominal cavity via an 8.5 to 12 cm incision along the ventral midline between the umbilicus and pubic symphysis or preputial opening. Surgeries lasted 90 minutes (SD = 8 for the 19 sea lions. All animals recovered well and were released into the wild after extended monitoring periods from 27 to 69 days at two captive animal facilities. Minimum post-implant survival was determined via post-release tracking using externally attached satellite transmitters or via opportunistic re-sighting for mean durations of 73.7 days (SE = 9.0, Z. californianus and 223.6 days (SE = 71.5, E. jubatus. Conclusion The low morbidity and zero mortality encountered during captive observation and post-release tracking periods confirm the viability of this surgical technique for the implantation of long-term telemetry devices in otariids.

  3. Fast Turn-off Mine Transient Electromagnetic Transmitter System

    Directory of Open Access Journals (Sweden)

    ZHENG Xiao-Liang

    2014-05-01

    Full Text Available For solving problems such as short turn-off time, high linear degree of falling edge, measurement of turn-off time and influence of primary signals for transient electromagnetic transmitter, and restrictions because of the environmental conditions of underground coal mine, this thesis aims at designing a new transient electromagnetic transmitter system suitable for coal mine. Supported by damping absorption circuit, such system applies small volume, sectional transmitting coil, with features of short turn-off time, high linear degree of current falling edge. It uses the transmitter monitoring circuit, which accurately measures turn-off time and simultaneously records the current value changes after turn-off, thus to eliminate the influence of primary field as well as to restore earlier secondary field signals for reference and finally to improve the ability to detect the shallow structure. It turns out that the new system has a shorter turn-off time, a higher linear degree of current falling and more accurate data record of turn-off current.

  4. Analisis interferensi T-DAB dan TV Analog pada pita Very High Frequency (VHF

    Directory of Open Access Journals (Sweden)

    Kasmad Ariansyah

    2014-09-01

    Full Text Available Kehadiran teknologi digital telah membawa perubahan di dalam berbagai aspek kehidupan, tak terkecuali di dunia penyiaran. Digitalisasi dibidang penyiaran diyakini dapat memberikan manfaat dalam hal efisiensi spektrum frekuensi radio. Berkaitan dengan penyiaran radio, Menteri  Komunikasi  dan  Informatika telah menetapkan DAB family sebagai standard penyiaran radio digital di Indonesia. Kajian dilakukan untuk mendapatkan jarak minimum yang diperlukan  antara sistem T-DAB dan TV analog sebagai solusi terhadap kemungkinan interferensi. Analisis dilakukan dengan bantuan SEAMCAT. Berdasarkan hasil analisis disimpulkan bahwa  kanal  A  T-DAB  merupakan  kanal yang paling rentan terhadap interferensi; Untuk mencapai probabilitas interferensi maksimum 5%, separasi geograpis minimum antara cakupan terluar TV analog kanal n dan transmitter terluar pada jaringan SFN T-DAB untuk kanal (n- 1D, nA, nB, nC berturut-turut adalah 220 Km, 290 Km, 145 Km dan  40  Km.  Sedangkan  untuk  kanal  nD  dan  (n+1A  dapat dioperasikan tanpa separasi geograpis dengan TV analog.

  5. Retention and effects of miniature transmitters in juvenile American eels

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Robert P.; Janak, Jill; Liss, Stephanie A.; Brown, Richard S.; Deng, Zhiqun; Harnish, Ryan A.

    2017-11-01

    This study was conducted to assess the effects of a non-functional acoustic micro transmitter (tag) on survival, tag loss, and swimming ability of juvenile American eels (Anguilla rostrata). The transmitter was designed for implantation through a < 3 mm opening into the body cavity of anguilliform fishes without the need for sutures. American eels used for the swimming performance study were 113–175 mm (N = 120). There were two treatment groups (tagged and non-tagged), each treatment was split into six size groups of 10 mm for testing. Potential transmitter effects on swimming performance were examined by comparing critical swimming speeds (Ucrit an index of prolonged swimming performance) for tagged and non-tagged eels. There was no significant difference in Ucrit between tagged and non-tagged eels for all of the size groups tested. Median Ucrits for tagged eels ranged from 50.2 cm/s for the smallest group tested (113–119 mm) to 63.9 cm/s for fish 141–150 mm in length. Non-tagged group median Ucrits ranged from 47.2 cm/s for the smallest group to 66.9 cm/s for the 141–150 mm group. An additional 26 eels (115–208 mm) were tagged and held for 38 d (without undergoing swimming performance tests) to determine the effects on survival and tag loss. There was no mortality during the holding period and the majority of the tag loss occurred after 20 days post-tagging, which is the current projected life of the tag. Our results indicate that micro acoustic tags can be successfully implanted in juvenile American eels with no apparent impacts to swimming ability, and would be a viable option for examining eel movement patterns in river systems and near hydroelectric facilities.

  6. Behavioral modelling and predistortion of wideband wireless transmitters

    CERN Document Server

    Ghannouchi, Fadhel M; Helaoui, Mohamed

    2015-01-01

    Covers theoretical and practical aspects related to the behavioral modelling and predistortion of wireless transmitters and power amplifiers. It includes simulation software that enables the users to apply the theory presented in the book. In the first section, the reader is given the general background of nonlinear dynamic systems along with their behavioral modelling from all its aspects. In the second part, a comprehensive compilation of behavioral models formulations and structures is provided including memory polynomial based models, box oriented models such as Hammerstein-based and Wiene

  7. Atmospheric transmittance and radiance - The LOWTRAN 5 code

    Science.gov (United States)

    Kneizys, F. X.; Shettle, E. P.; Gallery, W. O.

    1981-01-01

    A computer code, LOWTRAN 5, has been developed for calculating the transmission and background radiance of the earth's atmosphere at moderate spectral resolution 20 per cm. The code was derived using a single parameter band model for molecular absorption and includes the effects of continuum absorption, molecular scattering, and aerosol extinction. A choice of atmospheric models and aerosol models is provided to the user for any atmospheric slant path. The LOWTRAN model is described and application of the code is given by examples of atmospheric transmittance and radiance spectra. Comments on the validity of the code are presented.

  8. Cost-effective tunable 1310nm DWDM transmitter

    Science.gov (United States)

    Chorchos, Łukasz; Turkiewicz, Jarosław P.

    2015-09-01

    The growing demand for higher data rate transmissions in local and metropolitan area networks is main reason of developing effective and inexpensive transmission systems. In this paper, study about the possibility to realize 1310 nm tunable DWDM transmitter using commercially available low-cost DFB lasers is presented. Extensive DFB lasers characterization has been performed which led to establish relationships between laser current, operational temperature, emitted wavelength and power. An algorithm to find the laser settings for a desired wavelength grid has been proposed and tested. Generation of the 1310nm DWDM channels with frequency spacing between 120 and 240GHz has been demonstrated.

  9. Suomi NPP VIIRS solar diffuser screen transmittance model and its applications.

    Science.gov (United States)

    Lei, Ning; Xiong, Xiaoxiong; Mcintire, Jeff

    2017-11-01

    The visible infrared imaging radiometer suite on the Suomi National Polar-orbiting Partnership satellite calibrates its reflective solar bands through observations of a sunlit solar diffuser (SD) panel. Sunlight passes through a perforated plate, referred to as the SD screen, before reaching the SD. It is critical to know whether the SD screen transmittance measured prelaunch is accurate. Several factors such as misalignments of the SD panel and the measurement apparatus could lead to errors in the measured transmittance and thus adversely impact on-orbit calibration quality through the SD. We develop a mathematical model to describe the transmittance as a function of the angles that incident light makes with the SD screen, and apply the model to fit the prelaunch measured transmittance. The results reveal that the model does not reproduce the measured transmittance unless the size of the apertures in the SD screen is quite different from the design value. We attribute the difference to the orientation alignment errors for the SD panel and the measurement apparatus. We model the alignment errors and apply our transmittance model to fit the prelaunch transmittance to retrieve the "true" transmittance. To use this model correctly, we also examine the finite source size effect on the transmittance. Furthermore, we compare the product of the retrieved "true" transmittance and the prelaunch SD bidirectional reflectance distribution function (BRDF) value to the value derived from on-orbit data to determine whether the prelaunch SD BRDF value is relatively accurate. The model is significant in that it can evaluate whether the SD screen transmittance measured prelaunch is accurate and help retrieve the true transmittance from the transmittance with measurement errors, consequently resulting in a more accurate sensor data product by the same amount.

  10. Thermal transmittance of a cellulose loose-fill insulation material

    Energy Technology Data Exchange (ETDEWEB)

    Nicolajsen, A. [Danish Building and Urban Research, Hoersholm (Denmark). Department of Building Technology and Productivity

    2005-07-15

    The thermal performance of cellulose insulation material was investigated and compared with the thermal performance of stone wool batts. The moisture content in selected facade elements insulated with cellulose loose-fill insulation material and stone wool, was investigated as well as the influence of the moisture content on thermal transmittance. The investigation was carried out as a full-scale test under normal climate conditions in a moisture test house facility. Facade elements were built as timber frame constructions. Heat flow through the facade elements was measured with built-in heat flowmeters and the moisture content in the thermal insulation behind the wind barrier was measured with moisture measuring dowels. The test showed that the thermal performance of the tested type of cellulose loose-fill insulation material was significantly lower than the thermal performance of stone wool batts. The maximum moisture content of the insulation material was below, what in Denmark is considered critical for the onset of rot and growth of wood decaying fungi. The thermal transmittance did not change with changes in the moisture content within the investigated hygroscopic range. (author)

  11. Modified Polar Sigma-Delta Transmitter for Multiradio Applications

    Directory of Open Access Journals (Sweden)

    Maršálek Roman

    2010-01-01

    Full Text Available Radio transmitters capable of transforming variable envelope signals into constant envelope signals can be associated with high-efficiency switched mode power amplifiers. One of the techniques providing this conversion is Polar Sigma-Delta ( architecture. This approach provides efficient solution for high-dynamic signals, and, moreover, it offers flexibility in a multiradio environment. The overall concept of the polar transmitter is presented here along with novel modifications and improvements. Namely, when recombining the envelope and the phase signals, it is suggested to replace the analog mixing by a digital mixing. The impact of a frequency synthesizer with a switched loop bandwidth and its imperfections on the overall polar architecture is investigated as well. The Mobile WiMAX standard has been chosen for validation due to very high requirements in terms of power dynamics and the variable channel bandwidth. Simulation results are presented in this paper, and advantages and drawbacks of this novel approach are pointed here as well.

  12. Assessment of the calibration curve for transmittance pulse-oximetry

    Science.gov (United States)

    Doronin, A.; Fine, I.; Meglinski, I.

    2011-11-01

    Optical/laser modalities provide a broad variety of practical solutions for clinical diagnostics and therapy in a range from imaging of single cells and molecules to non-invasive biopsy of specific biological tissues and organs tomography. Near-infrared transmittance pulse oximetry with laser diodes is the accepted standard in current clinical practice and widely used for noninvasive monitoring of oxygen saturation in arterial blood hemoglobin. Conceptual design of practical pulse oximetry systems requires careful selection of various technical parameters, including intensity, wavelength, beam size and profile of incident laser radiation, size, numerical aperture of the detector, as well as a clear understanding of how the spatial and temporal structural alterations in biological tissues can be linked with and can be distinguished by variations of these parameters. In current letter utilizing state-of-the-art NVIDEA CUDA technology, a new object oriented programming paradigm and on-line solutions we introduce a computational tool applied for human finger transmittance spectra simulation and assessment of calibration curve for near-infrared transmitted pulseoximetry.

  13. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  14. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  15. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  16. Leaf Relative Water Content Estimated from Leaf Reflectance and Transmittance

    Science.gov (United States)

    Vanderbilt, Vern; Daughtry, Craig; Dahlgren, Robert

    2016-01-01

    Remotely sensing the water status of plants and the water content of canopies remain long term goals of remote sensing research. In the research we report here, we used optical polarization techniques to monitor the light reflected from the leaf interior, R, as well as the leaf transmittance, T, as the relative water content (RWC) of corn (Zea mays) leaves decreased. Our results show that R and T both change nonlinearly. The result show that the nonlinearities cancel in the ratio R/T, which appears linearly related to RWC for RWC less than 90%. The results suggest that potentially leaf water status and perhaps even canopy water status could be monitored starting from leaf and canopy optical measurements.

  17. Design Parameters of a Miniaturized Piezoelectric Underwater Acoustic Transmitter

    Directory of Open Access Journals (Sweden)

    Thomas J. Carlson

    2012-07-01

    Full Text Available PZT ceramics have been widely used in underwater acoustic transducers. However, literature available discussing the design parameters of a miniaturized PZT-based low-duty-cycle transmitter is very limited. This paper discusses some of the design parameters—the backing material, driving voltage, PZT material type, power consumption and the transducer length of a miniaturized acoustic fish tag using a PZT tube. Four different types of PZT were evaluated with respect to the source level, energy consumption and bandwidth of the transducer. The effect of the tube length on the source level is discussed. The results demonstrate that ultralow-density closed-cell foam is the best backing material for the PZT tube. The Navy Type VI PZTs provide the best source level with relatively low energy consumption and that a low transducer capacitance is preferred for high efficiency. A 35% reduction in the transducer length results in 2 dB decrease in source level.

  18. Dopamine neurons release transmitter via a flickering fusion pore.

    Science.gov (United States)

    Staal, Roland G W; Mosharov, Eugene V; Sulzer, David

    2004-04-01

    A key question in understanding mechanisms of neurotransmitter release is whether the fusion pore of a synaptic vesicle regulates the amount of transmitter released during exocytosis. We measured dopamine release from small synaptic vesicles of rat cultured ventral midbrain neurons using carbon fiber amperometry. Our data indicate that small synaptic vesicle fusion pores flicker either once or multiple times in rapid succession, with each flicker releasing approximately 25-30% of vesicular dopamine. The incidence of events with multiple flickers was reciprocally regulated by phorbol esters and staurosporine. Thus, dopamine neurons regulate the amount of neurotransmitter released by small synaptic vesicles by controlling the number of fusion pore flickers per exocytotic event. This mode of exocytosis is a potential mechanism whereby neurons can rapidly reuse vesicles without undergoing the comparatively slow process of recycling.

  19. High power optical transmitter package for free space optical communication

    Science.gov (United States)

    Hildebrand, U.; Menke, B.; Wiesmann, Th.; Ohm, G.

    1990-07-01

    This paper discusses the characteristics of a new concept involving high-power laser diode (HPLD) arrays which are able to emit up to 1000 mW of optical output power but which suffer from poor far-field pattern and poor optical quality, related to the gain guiding mechanism used in such devices. Methods are proposed for improving the optical quality of HPLDs. These include the use of apertured AM scheme for HPLDs and the use of a graded-index lens and a stripe mirror to stabilize the HPLD. A HPLD optical transmitter is designed which will have the capability of operating the HPLD in the 180 deg phase alternating mode under modulation.

  20. Comparison between ASHRAE and ISO thermal transmittance calculation methods

    DEFF Research Database (Denmark)

    Blanusa, Petar; Goss, William P.; Roth, Hartwig

    2007-01-01

    the Heat Transfer and Total Optical Properties of Fenestration Products, Public Review Draft of Standard 142P, American Society of Heating, Refrigerating and Air Conditioning Engineers, Atlanta, 1998]) and in Europe [ISO 10077-2. Thermal Performance of Windows, Doors and Shutters-Calculation of Thermal...... Transmittance-Part 2: Numerical Method for Frames, International Standards Organization, Geneva, 2003]. The two approaches, called the ASHRAE and ISO methods, are different in the way they treat the effect of the glazing spacer on the heat transfer through the frame and the glazing unit near the frame....... The ASHRAE method assumes that the spacer effects both the heat transfer through the frame and the heat transfer through the glazing in an "edge-of glass" region 63.5mm (2.5in.) from the glazing/frame sight line. The ISO method assumes that the additional heat transfer due to the existence of the spacer...

  1. Electromagnetic Cavity Effects from Transmitters Inside a Launch Vehicle Fairing

    Science.gov (United States)

    Trout, Dawn H.; Wahid, Parveen F.; Stanley, James E.

    2009-01-01

    This paper provides insight into the difficult analytical issue for launch vehicles and spacecraft that has applicability outside of the launch industry. Radiation from spacecraft or launch vehicle antennas located within enclosures in the launch vehicle generates an electromagnetic environment that is difficult to accurately predict. This paper discusses the test results of power levels produced by a transmitter within a representative scaled vehicle fairing model and provides preliminary modeling results at the low end of the frequency test range using a commercial tool. Initially, the walls of the fairing are aluminum and later, layered with materials to simulate acoustic blanketing structures that are typical in payload fairings. The effects of these blanketing materials on the power levels within the fairing are examined.

  2. Effect of transmitter turn-off time on transient soundings

    Science.gov (United States)

    Fitterman, D.V.; Anderson, W.L.

    1987-01-01

    A general procedure for computing the effect of non-zero turn-off time on the transient electromagnetic response is presented which can be applied to forward and inverse calculation methods for any transmitter-receiver configuration. We consider in detail the case of a large transmitter loop which has a receiver coil located at the center of the loop (central induction or in-loop array). For a linear turn-off ramp of width t0, the voltage response is shown to be the voltage due to an ideal step turn-off averaged over windows of width t0. Thus the effect is similar to that obtained by using averaging windows in the receiver. In general when time zero is taken to be the end of the ramp, the apparent resistivity increases for a homogeneous half-space over a limited time range. For time zero taken to be the start of the ramp the apparent resistivity is affected in the opposite direction. The effect of the ramp increases with increasing t0 and first-layer resistivity, is largest during the intermediate stage, and decreases with increasing time. It is shown that for a ramp turn-off, there is no effect in the early and late stages. For two-layered models with a resistive first layer (??1>??2), the apparent resistivity is increased in the intermediate stage. When the first layer is more conductive than the second layer (??1geoelectrical section on the turn-off effect. Neglecting the turn-off ramp will affect data interpretation as shown by field examples; the influence is the greatest on near-surface layer parameters. ?? 1987.

  3. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  4. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  5. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  6. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  7. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  8. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  9. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  10. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  11. Effect of package light transmittance on vitamin content of milk. Part 2: UHT whole milk

    NARCIS (Netherlands)

    Saffert, A.; Pieper, G.; Jetten, J.

    2008-01-01

    This work is the second part of a milk study evaluating the effect of package light transmittance on the vitamin content of milk, in this case on UHT whole milk. The milk was stored at three different light intensities in polyethylene terephthalate (PET) bottles with varying light transmittance as

  12. Radio Transmitter Implantation and Movement in the Wild Timber Rattlesnake ( Crotalus horridus ).

    Science.gov (United States)

    Hale, Vanessa L; MacGowan, Brian; Corriveau, Lorraine; Huse, David C; Currylow, Andrea F T; Thompson, Steve

    2017-07-01

    Radiotelemetry transmitters have become critical to studies of wildlife ecology. However, little is known about how transmitter implantation surgery affects the mobility of some species, including the timber rattlesnake, Crotalus horridus . Tracking snake movement can provide insights into the effects of transmitter implantation. During 2007-11, 71 radio transmitters were surgically implanted intracoelomically in 47 timber rattlesnakes. Over 20 of these snakes underwent surgery at least twice in 5 yr to replace old transmitters. Surgeries were performed under general anesthesia with a local nerve block at the site of implantation, 20 cm cranial to the cloaca. Snakes were also administered postsurgical meloxicam and enrofloxacin every 24 h for three doses. Two to five days after surgery, snakes were released at their original locations and radiotracked regularly during the active seasons (April-October 2007-11). Average daily movement data (distance traveled) were compiled for each snake. Snakes undergoing transmitter surgery in a given year did not differ significantly in distance traveled compared to snakes that had transmitters but did not have surgery in that year. Distance traveled for each snake did not differ before or after surgery or between weeks 1 and 2 postsurgery, indicating that the transmitter implantation did not alter snake movement.

  13. Integrated S-band transmitter with on-chip DC-DC converter and control loop

    NARCIS (Netherlands)

    Brouzes, H.; Geurts, S.; Besselink, M.; Telli, A.; Hek, A.P. de; Bent, G. van der; Vliet, F.E. van

    2012-01-01

    A highly integrated high-power transmitter has been designed in a high breakdown GaAs MMIC technology. The transmitter includes, on top of an S-Band 10 W class-F HPA, a DC/DC converter and its associated gate driver, the full voltage regulation control loop, which provides a significant step for

  14. 31 CFR 538.319 - U.S. registered money transmitter.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. registered money transmitter. 538.319 Section 538.319 Money and Finance: Treasury Regulations Relating to Money and Finance... General Definitions § 538.319 U.S. registered money transmitter. The term U.S. registered money...

  15. 31 CFR 537.323 - U.S. registered money transmitter.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. registered money transmitter. 537.323 Section 537.323 Money and Finance: Treasury Regulations Relating to Money and Finance... General Definitions § 537.323 U.S. registered money transmitter. The term U.S. registered money...

  16. A 100 – 800MHz 8-Path polyphase transmitter with mixer duty-cycle control achieving

    NARCIS (Netherlands)

    Subhan, S.; Klumperink, Eric A.M.; Ghaffari, A.; Wienk, Gerhardus J.M.; Nauta, Bram

    2014-01-01

    Radio transceivers capable of dynamic spectrum access require frequency agile transmitters with a clean output spectrum. High-Q filters are difficult to implement on chip and have limited tuning range. Transmitters with high linearity and broadband harmonic rejection can be more flexible and require

  17. 47 CFR 2.813 - Transmitters operated in the Instructional Television Fixed Service.

    Science.gov (United States)

    2010-10-01

    ... Television Fixed Service. 2.813 Section 2.813 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL... Devices § 2.813 Transmitters operated in the Instructional Television Fixed Service. Section 2.803 (a) through (d) shall not be applicable to a transmitter operated in the Instructional Television Fixed...

  18. Influence of Distance Between Metal Squares in Checkerboard Patterns on Transmittance Characteristics in the Infrared Region

    Science.gov (United States)

    Higashira, Takaya; Kageyama, Tomoaki; Kashiwagi, Kouhei; Miyashita, Hidetoshi; Takano, Keisuke; Nakajima, Makoto; Lee, Sang-Seok

    2017-09-01

    In this study, we investigated the influence of the distance between metal squares in self-complementary metal checkerboard patterns (CPs) on the transmittance characteristics in the infrared (IR) region. Transmittance characteristics of CPs in the IR region are rarely studied. Here, to clarify experimentally the influence of reactance variation in CPs on the transmittance in the IR region, we fabricated self-complementary metallic CPs with differing distances between the metal squares, and their transmittances were measured. Initially, two types of capacitive CPs (C-CPs) and three types of inductive CPs (I-CPs) were fabricated, and their IR transmittances were measured. The CPs were configured to have different gaps or overlapping distances between the metal squares for the C-CPs and I-CPs, respectively. Furthermore, we investigated the influence of the distance configuration of CPs consisting of both C-CPs and I-CPs, on the transmittances of x- and y-polarized incident IR electromagnetic waves. The evaluated hybrid CPs, referred to as anisotropic CPs (A-CPs), were fabricated with horizontal metal patterns in contact with each other and separated vertical components. The results demonstrated that the transmittance depends on sensitively to the gap or the overlapping distance between the metal squares of the self-complementary metallic CPs. Moreover, we observed remarkable changes in the transmittance associated with the A-CPs, resulting from the polarization of the incident IR electromagnetic waves.

  19. Negative control in two-component signal transduction by transmitter phosphatase activity

    Science.gov (United States)

    Huynh, TuAnh Ngoc; Stewart, Valley

    2011-01-01

    Bifunctional sensor transmitter modules of two-component systems exert both positive and negative control on the receiver domain of the cognate response regulator. In negative control, the transmitter module accelerates the rate of phospho-receiver dephosphorylation. This transmitter phosphatase reaction serves the important physiological functions of resetting response regulator phosphorylation level and suppressing cross talk. Although the biochemical reactions underlying positive control are reasonably well-understood, the mechanism for transmitter phosphatase activity has been unknown. A recent hypothesis is that the transmitter phosphatase reaction is catalyzed by a conserved Gln, Asn or Thr residue, via a hydrogen bond between the amide or hydroxyl group and the nucleophilic water molecule in acyl-phosphate hydrolysis. This hypothetical mechanism closely resembles the established mechanisms of auxiliary phosphatases such as CheZ and CheX, and may be widely conserved in two-component signal transduction. In addition to the proposed catalytic residues, transmitter phosphatase activity also requires the correct transmitter conformation and appropriate interactions with the receiver. Evidence suggests that the phosphatase-competent and autokinase-competent states are mutually exclusive, and the corresponding negative and positive activities are likely to be reciprocally regulated through dynamic control of transmitter conformations. PMID:21895797

  20. Wireless heterogeneous transmitter placement using multiobjective variable-length genetic algorithm.

    Science.gov (United States)

    Ting, Chuan-Kang; Lee, Chung-Nan; Chang, Hui-Chun; Wu, Jain-Shing

    2009-08-01

    The problem of placing wireless transmitters to meet particular objectives, such as coverage and cost, has proven to be NP-hard. Furthermore, the heterogeneity of wireless networks makes the problem more intractable to deal with. This paper presents a novel multiobjective variable-length genetic algorithm to solve this problem. One does not need to determine the number of transmitters beforehand; the proposed algorithm simultaneously searches for the optimal number, types, and positions of heterogeneous transmitters by considering coverage, cost, capacity, and overlap. The proposed algorithm can achieve the optimal number of transmitters with coverage exceeding 98% on average for six benchmarks. These preferable experimental results demonstrate the high capability of the proposed algorithm for the wireless heterogeneous transmitter placement problem.

  1. 2-Micron Laser Transmitter for Coherent CO2 DIAL Measurement

    Science.gov (United States)

    Singh, Upendra N.; Bai, Yingxin; Yu, Jirong

    2009-01-01

    Carbon dioxide (CO2) has been recognized as one of the most important greenhouse gases. It is essential for the study of global warming to accurately measure the CO2 concentration in the atmosphere and continuously record its variation. A high repetition rate, highly efficient, Q-switched 2-micron laser system as the transmitter of a coherent differential absorption lidar for CO2 measurement has been developed in NASA Langley Research Center. This laser system is capable of making a vertical profiling of CO2 from ground and column measurement of CO2 from air and space-borne platform. The transmitter is a master-slave laser system. The master laser operates in a single frequency, either on-line or off-line of a selected CO2 absorption line. The slave laser is a Q-switched ring-cavity Ho:YLF laser which is pumped by a Tm:fiber laser. The repetition rate can be adjusted from a few hundred Hz to 10 kHz. The injection seeding success rate is from 99.4% to 99.95%. For 1 kHz operation, the output pulse energy is 5.5mJ with the pulse length of 50 ns. The optical-to-optical efficiency is 39% when the pump power is 14.5W. A Ho:YLF laser operating in the range of 2.05 micrometers can be tuned over several characteristic lines of CO2 absorption. Experimentally, a diode pumped Ho:Tm:YLF laser has been successfully used as the transmitter of coherent differential absorption lidar for the measurement of CO2 with a repetition rate of 5 Hz and pulse energy of 75 mJ. For coherent detection, high repetition rate is required for speckle averaging to obtain highly precise measurements. However, a diode pumped Ho:Tm:YLF laser can not operate in high repetition rate due to the large heat loading and up-conversion. A Tm:fiber laser pumped Ho:YLF laser with low heat loading can operate in high repetition rate. A theoretical model has been established to simulate the performance of Tm:fiber laser pumped Ho:YLF lasers. For continuous wave (CW) operation, high pump intensity with small beam

  2. Quantitative Chemical Measurements of Vesicular Transmitters with Electrochemical Cytometry.

    Science.gov (United States)

    Li, Xianchan; Dunevall, Johan; Ewing, Andrew G

    2016-10-18

    Electrochemical cytometry adds a new dimension to our ability to study the chemistry and chemical storage of transmitter molecules stored in nanometer vesicles. The approach involves the adsorption and subsequent rupture of vesicles on an electrode surface during which the electroactive contents are quantitatively oxidized (or reduced). The measured current allows us to count the number of molecules in the vesicles using Faraday's law and to correlate this to the amount of molecules released when single exocytosis events take place at communicating cells. The original format for this method involved a capillary electrophoresis separation step to singly address each vesicle, but we have more recently discovered that cellular vesicles tend to adsorb to carbon electrodes and spontaneously as well as stochastically rupture to give mostly single vesicle events. This approach, called impact electrochemical cytometry, even though the impact is perhaps not the important part of this process, has been studied and the vesicle rupture appears to be at the interface between the vesicle and the electrode and is probably driven by electroporation. The pore size and rate of content electrolysis are a function of the pore diameter and the presence of a protein core in the vesicles. In model liposomes with no protein, events appear extremely rapidly as the soft nanoparticles impact the electrode and the contents are oxidized. It appears that the proteins decorating the surface of the vesicle are important in maintaining a gap from the electrode and when this gap is closed electroporation takes place. Models of the event response times suggest the pores formed are small enough so we can carry out these measurements at nanotip electrodes and we have used this to quantify the vesicle content in living cells in a mode we call intracellular impact electrochemical cytometry. The development of electrochemical cytometry allows comparison between vesicle content and vesicular release and

  3. Solar active envelope module with an adjustable transmittance/absorptance

    Directory of Open Access Journals (Sweden)

    C. Villasante Villasante

    2015-06-01

    Full Text Available A solar active envelope module with a high flexibility degree is proposed in this paper. The transparent module controls the day-lighting of the room, improving the indoor environment, while absorbing the superfluous solar energy inside. That energy is used to increase the efficiency of heating, ventilation, and the air-conditioning (HVAC system of the building. This is carried out through a fine control of the absorptance of the envelope module. The active envelope module consists of three glazed chambers with advanced coatings and frames to assure a minimum thermal transmittance while allowing transparency. A fluid containing heat-absorbing nanoparticles flows inside the central chamber and is heated up due to the impinging solar energy. Unlike other systems proposed in the past, which included transparency control systems based on complex filters and chemical processes, the absorption of the module is controlled by the variation of the thickness of the central chamber with a mechanical device. That is, varying the thickness of the central chamber, it allows controlling the absorptance of the whole system and, as a result, indoor day-lighting and thermal loads. Therefore, a new system is proposed that enables to:  

  4. Computational Investigations of THz Transmittance in the Atmosphere

    Science.gov (United States)

    Yang, Xingyu; Calhoun, Casey; Calhoun, Ronald

    2016-06-01

    With the recent scientific advancements in Terahertz (THz) wave propagation and reception technology, there has been significant development in new possibilities for using THz waves - offering new possibilities in THz detection and ranging. A first foundational step toward this goal is to better understand THz transmittance in the turbulent atmosphere. In this project, a frequency modulation pattern of THz waves was created by utilizing a system of shifting frequency based on temperature, air humidity, and distance of transmission. The total path loss of the wave in air, based on the wave spread and molecular absorption, was then modeled using radiative transfer theory, onto a set of JavaHAWK filtered-HITRAN data representative of an air sample. This data was used to generate a path loss matrix, which was then used to optimize frequency of transmission for the specific conditions. The concept to be evaluated is whether adaptive frequency modulated THz might usefully decrease transmission losses by adjusting to atmospheric conditions (such as local variations in temperature and humidity).

  5. Development and Testing of a Radio Transmitter for Englacial Trilateration

    Science.gov (United States)

    Kintner, P., III; Winebrenner, D. P.; Elam, T.; Carpenter, M.

    2014-12-01

    Recent need for englacial radiolocation of instrumentation has motivated the construction of a compact radio for GPS style trilateration. The summer of 2014 offered an opportunity to test the radio across the surface of the Greenland ice sheet. A compact crystal oscillator transmitter was developed to operate on the 10 meter amateur band, to put a watt across the transmit antenna. The transmitting antenna used was a coiled dipole antenna, which was tuned in a laboratory ice block. Multiple receive antennas were constructed, a Moxon beam, and two dipole antennas one tuned for air and another tuned for ice. Transmission was tested with a constant tone while positioning the radio above and below the glacier surface. The received signal was well defined at distances of 727m along ice surface despite the complexity and water content. The performance of each receive antenna was judged on a calculated signal to noise ratio. It was theorized the gain from the Moxon beam, reported to be 10dB, would be equal to the loss of signal in the reflection on the ice-air boundary, and thus performance for the Moxon beam and the dipole in ice would be equivalent. Preliminary results suggest this to be true. Previous modeling suggested that a signal to noise ratio above ten would give satisfactory results for trilateration. Here calculated signal to noise was greater at 730m, suggesting that developing a capable receiver would be the next step towards completing englacial trilateration.

  6. Gas detection by using transmittance estimation and segmentation approaches

    Science.gov (United States)

    Özısık Baskurt, Didem; Gür, Yusuf; Ömrüuzun, Fatih; ćetin, Yasemin Yardımcı

    2016-10-01

    Hyperspectral imaging for gas detection applications is an under-researched topic. The same gas model is used in most of the gas detection studies in the literature. This model aims to formulate the scene covering the gas emission as well as the background and the atmosphere. Therefore, the model requires prior knowledge on transmittance, emissivity, and temperature values of the components in the scene. The commonly used approaches to estimate these parameters include atmospheric modeling and statistical inference. However, accessing such information is costly in remote detection applications. Some studies avoid background characterization by decomposing the scene using spectral-spatial information. There are several studies in the literature using this model. They aim to detect various types of gases on different parts of electromagnetic spectrum. Most of these studies use hyperspectral radiance information regarding the scene. However, using brightness temperature map of the data instead of radiance data is more suitable for direct analysis. For this reason, we used brightness temperature spectrum in this study. On the other hand, the detection algorithms are generally based on pixel based investigation. Since the emission of the gas is sourced by a pipe or a chimney, investigating the emission region at the segment level increases detection accuracy. In this study, we used an iterative spectral feature based pixel clustering algorithm followed by spatial segmentation.

  7. Computational Investigations of THz Transmittance in the Atmosphere

    Directory of Open Access Journals (Sweden)

    Yang Xingyu

    2016-01-01

    Full Text Available With the recent scientific advancements in Terahertz (THz wave propagation and reception technology, there has been significant development in new possibilities for using THz waves – offering new possibilities in THz detection and ranging. A first foundational step toward this goal is to better understand THz transmittance in the turbulent atmosphere. In this project, a frequency modulation pattern of THz waves was created by utilizing a system of shifting frequency based on temperature, air humidity, and distance of transmission. The total path loss of the wave in air, based on the wave spread and molecular absorption, was then modeled using radiative transfer theory, onto a set of JavaHAWK filtered-HITRAN data representative of an air sample. This data was used to generate a path loss matrix, which was then used to optimize frequency of transmission for the specific conditions. The concept to be evaluated is whether adaptive frequency modulated THz might usefully decrease transmission losses by adjusting to atmospheric conditions (such as local variations in temperature and humidity.

  8. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  9. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  10. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  11. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  12. On the Optimality of Opportunistic Interference Alignment in 3-Transmitter MIMO Interference Channels

    CERN Document Server

    Lee, Jung Hoon; Love, David J

    2011-01-01

    In this paper, we propose opportunistic interference alignment (OIA) for three-transmitter multiple-input multiple-output (MIMO) interference channels (ICs). In the proposed OIA scheme, each transmitter has its own user group that consists of $K$ users, and each transmitter opportunistically selects the user whose received interference signals are most aligned. Thus, three-transmitter MIMO IC is opportunistically constructed by three transmitters and their selected users. Contrary to conventional IA, perfect channel information for all of the interference links is not required at the transmitter. Each user just needs to feed back one scalar value in the proposed OIA scheme. When the number of receive antennas is $N_R$ (with $N_R=2M$) and the number of transmit antennas is $N_T$ (with $N_T\\ge M$), we prove that each transmitter can achieve $M$ degrees of freedom (DoF) as the number of users in each group goes to infinity ($K\\to\\infty$), in comparison with the $\\frac{2M}{3}$ DoF known to be achievable in the th...

  13. Joint Time-Frequency Signal Processing Scheme in Forward Scattering Radar with a Rotational Transmitter

    Directory of Open Access Journals (Sweden)

    Raja Syamsul Azmir Raja Abdullah

    2016-12-01

    Full Text Available This paper explores the concept of a Forward Scattering Radar (FSR system with a rotational transmitter for target detection and localization. Most of the research and development in FSR used a fixed dedicated transmitter; therefore, the detection of stationary and slow moving target is very difficult. By rotating the transmitter, the received signals at the receiver contain extra information carried by the Doppler due to the relative movement of the transmitter-target-receiver. Hence, rotating the transmitter enhances the detection capability especially for a stationary and slow-moving target. In addition, it increases the flexibility of the transmitter to control the signal direction, which broadens the coverage of FSR networks. In this paper, a novel signal processing for the new mode of FSR system based on the signal’s joint time-frequency is proposed and discussed. Additionally, the concept of the FSR system with the rotational transmitter is analyzed experimentally for the detection and localization of a stationary target, at very low speed and a low profile target crossing the FSR baseline. The system acts as a virtual fencing of a remote sensor for area monitoring. The experimental results show that the proposed mode with the new signal processing scheme can detect a human intruder. The potential applications for this system could be used for security and border surveillance, debris detection on an airport runway, ground aerial monitoring, intruder detection, etc.

  14. Proportional Fair Power Allocation for Secondary Transmitters in the TV White Space

    Directory of Open Access Journals (Sweden)

    Konstantinos Koufos

    2013-01-01

    Full Text Available The key bottleneck for secondary spectrum usage is the aggregate interference to the primary system receivers due to simultaneous secondary transmissions. Existing power allocation algorithms for multiple secondary transmitters in the TV white space either fail to protect the TV service in all cases or they allocate extremely low power levels to some of the transmitters. In this paper, we propose a power allocation algorithm that favors equally the secondary transmitters and it is able to protect the TV service in all cases. When the number of secondary transmitters is high, the computational complexity of the proposed algorithm becomes high too. We show how the algorithm could be modified to reduce its computational complexity at the cost of negligible performance loss. The modified algorithm could permit a spectrum allocation database to allocate near optimal transmit power levels to tens of thousands of secondary transmitters in real time. In addition, we describe how the modified algorithm could be applied to allow decentralized power allocation for mobile secondary transmitters. In that case, the proposed algorithm outperforms the existing algorithms because it allows reducing the communication signalling overhead between mobile secondary transmitters and the spectrum allocation database.

  15. The Use of a Solid State Analog Television Transmitter as a Superconducting Electron Gun Power Amplifier

    Energy Technology Data Exchange (ETDEWEB)

    J.G. Kulpin, K.J. Kleman, R.A. Legg

    2012-07-01

    A solid state analog television transmitter designed for 200 MHz operation is being commissioned as a radio frequency power amplifier on the Wisconsin superconducting electron gun cavity. The amplifier consists of three separate radio frequency power combiner cabinets and one monitor and control cabinet. The transmitter employs rugged field effect transistors built into one kilowatt drawers that are individually hot swappable at maximum continuous power output. The total combined power of the transmitter system is 33 kW at 200 MHz, output through a standard coaxial transmission line. A low level radio frequency system is employed to digitally synthesize the 200 MHz signal and precisely control amplitude and phase.

  16. Use of a novel acoustic dissolved oxygen transmitter for fish telemetry

    DEFF Research Database (Denmark)

    Svendsen, Jon Christian; Aarestrup, Kim; Steffensen, J.F.

    2006-01-01

    The multiple responses of fishes to changes in dissolved oxygen saturations have been studied widely in the laboratory. In contrast only few studies have included field observations. The objective of the present study was to evaluate the performance of a novel acoustic dissolved oxygen transmitter...... for field biotelemetry. The results demonstrated that the output of the transmitter was unaffected by three different temperatures (10 to 30 degrees C) and described the dissolved oxygen saturation with high accuracy (r(2) > 0.99) over the entire range of 0 to 191% saturation. The response time (>= 90......% of end value) of the transmitter was 12 s both in terms of decreasing (100 to 0%) and increasing (0 to 100%) oxygen saturations. When externally attached to fishes the present findings support the use of the transmitter for reliable dissolved oxygen measurements on individuals living in environments...

  17. High-efficiency resonantly pumped 1550-nm fiber-based laser transmitter Project

    Data.gov (United States)

    National Aeronautics and Space Administration — nLight proposes the development of high efficiency, high average power 1550-nm laser transmitter system that is based on Er-doped fiber amplifier resonantly pumped...

  18. Solid State Transmitters for Water Vapor and Ozone DIAL Systems Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We have developed a common architecture for laser transmitters that address requirements for water vapor as well as ground and airborne ozone lidar systems. Our...

  19. Identification of neurotransmitters and co-localization of transmitters in brainstem respiratory neurons

    Science.gov (United States)

    R.L., Stornetta

    2008-01-01

    Identifying the major ionotropic neurotransmitter in a respiratory neuron is of critical importance in determining how the neuron fits into the respiratory system, whether in producing or modifying respiratory drive and rhythm. There are now several groups of respiratory neurons whose major neurotransmitters have been identified and in some of these cases, more than one transmitter have been identified in particular neurons. This review will describe the physiologically identified neurons in major respiratory areas that have been phenotyped for major ionotropic transmitters as well as those where more than one transmitter has been identified. Although the purpose of the additional transmitter has not been elucidated for any of the respiratory neurons, some examples from other systems will be discussed. PMID:18722563

  20. DESIGN AND IMPLEMENTATION OF A CDMA TRANSMITTER FOR MOBILE CELLULAR COMMUNICATIONS

    Directory of Open Access Journals (Sweden)

    R. Muraoka

    2003-07-01

    Full Text Available In this work we describe the design and implementation of a CDMA transmitter with application on thirdgeneration mobile and personal communication systems. We present several experimental results.

  1. Compact, Rugged and Low-Cost Atmospheric Ozone DIAL Transmitter Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Bridger Photonics Inc. (Bridger) proposes to develop the most compact, efficient and low-cost ultra-violet ozone differential absorption lidar (DIAL) transmitter...

  2. A passively aligned VCSEL transmitter operating at fixed current over a wide temperature range.

    Science.gov (United States)

    Park, Jonghyun; Kim, Taeyong; Kim, Sung-Han; Kim, Sang-Bae

    2009-03-30

    We have investigated low-current operation characteristics of a passively aligned VCSEL transmitter driven at fixed "on" and "off" current over a wide temperature range. GaAs/AlGaAs-based 850-nm oxide VCSELs with the minimum threshold current of 0.79 mA at 50 masculineC and small temperature dependence of the threshold current, d(2)I(th)/dT(2), as low as 0.114 muA/ masculineC(2) have been fabricated and used for the transmitter module. The superior temperature characteristics enable fixed-current operation of the VCSEL transmitter that complies with Gigabit Ethernet standard over a wide temperature range from -20 to 120 masculineC. This result paves the way to a VCSEL transmitter featured by low-power consumption, low-cost with a simple driving circuit and passive alignment, and a wide operation temperature range.

  3. Flexible High Energy Lidar Transmitter for Remote Gas and Wind Sensing Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Fibertek proposes a high energy and flexible operation 1570 nm pulsed lidar transmitter for airborne and space-based remote CO2 gas and doppler wind sensing. The...

  4. Space-Qualifiable 1064 nm Fiber Based Transmitter for Long Range Optical Communications Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Fibertek has developed transmitters for Lidar and 3D imaging applications based on fiber optics architectures both at 1064nm. We have demonstrated an all fiber...

  5. Perancangan Prototipe Transmitter Beacon Black Box Locator Acoustic 37.5 kHz Pingers

    Directory of Open Access Journals (Sweden)

    RUSTAMAJI RUSTAMAJI

    2016-08-01

    Full Text Available ABSTRAK Pingers transmitter berfungsi untuk memancarkan sinyal atau getaran pulsa akustik pada black box. Frekuensi sinyal yang dipancarkan sebesar 37,5 kHz yang dimodulasikan oleh pulsa dengan durasi 10 ms setiap interval 1 second. Modulasi yang digunakan adalah modulasi on off keying. Dalam penelitian ini dibuat perancangan pingers transmitter yang tersusun atas rangkaian osilator, timer, inverter, switch dan rangkaian amplifier. Frekuensi 37,5 kHz tersebut dibangkitkan oleh rangkaian osilator colpitts, sedangkan lebar pulsa dengan durasi 10 ms dan pengulangan pulsa setiap interval 1 second dibangkitkan oleh rangkaian timer. Berdasarkan perancangan yang telah dibuat, output sinyal yang dihasilkan oleh prototipe pingers transmitter tersebut sebesar 37,69 kHz dengan lebar pulsa 9,8 ms setiap interval 1 second. Kata kunci: Black box, pingers transmitter, on off keying. ABSTRACT Pingers transmitter is used to emits a signal or pulse of acoustic vibrations  in black box. The frequency of the transmitted signal is 37.5 kHz which is modulated by pulses with a duration of 10 ms every interval 1 second. The modulation that used this research is on off keying modulation. In this research, made the design of pingers transmitter which arrange of the oscillator circuit,timer, inverter, switch, and amplifier circuit. The 37.5 kHz frequency is generated by the colpitts oscillator circuit, while the pulse width with a duration of 10 ms,and each pulse repetition interval of 1 second generated by timer circuit. Based on the design that have made, signal output from the pingers transmitter prototype is 37.69 kHz, with the pulse width 9.8 ms every 1 second interval. Keywords: Black box, pingers transmitter, on off keying.

  6. Widely Linear Blind Adaptive Equalization for Transmitter IQ-Imbalance/Skew Compensation in Multicarrier Systems

    DEFF Research Database (Denmark)

    Porto da Silva, Edson; Zibar, Darko

    2016-01-01

    Simple analytical widely linear complex-valued models for IQ-imbalance and IQ-skew effects in multicarrier transmitters are presented. To compensate for such effects, a 4×4 MIMO widely linear adaptive equalizer is proposed and experimentally validated.......Simple analytical widely linear complex-valued models for IQ-imbalance and IQ-skew effects in multicarrier transmitters are presented. To compensate for such effects, a 4×4 MIMO widely linear adaptive equalizer is proposed and experimentally validated....

  7. Effects of satellite transmitters on survival in Snowy Owls Bubo scandiacus

    OpenAIRE

    Heggøy, Oddvar; Aarvak, Tomas; Øien, Ingar Jostein; Jacobsen, Karl-Otto; Solheim, Roar; Zazelenchuk, Dan; Stoffel, Marten; Kleven, Oddmund

    2017-01-01

    The use of tracking devices to monitor birds is extensive, but the effects of such instruments on equipped individuals are still insufficiently taken into account. Here we evaluate potential effects of backpack-mounted satellite transmitters (platform terminal transmitters; PTTs) on survival of 28 Snowy Owls Bubo scandiacus. Six confirmed deaths were all probably related to natural and human-induced causes. Although PTT operational time was significantly shorter than expected lifetime of Snow...

  8. A comb laser-driven DWDM silicon photonic transmitter based on microring modulators.

    Science.gov (United States)

    Chen, Chin-Hui; Ashkan Seyedi, M; Fiorentino, Marco; Livshits, Daniil; Gubenko, Alexey; Mikhrin, Sergey; Mikhrin, Vladimir; Beausoleil, Raymond G

    2015-08-10

    We demonstrate concurrent multi-channel transmission at 10 Gbps per channel of a DWDM silicon photonic transmitter. The DWDM transmitter is based on a single quantum dot comb laser and an array of microring resonator-based modulators. The resonant wavelengths of microrings are thermally tuned to align with the wavelengths provided by the comb laser. No obvious crosstalk is observed at 240 GHz channel spacing.

  9. Electromagnetic coupling between transmitters and electro-explosive devices located within an enclosure.

    Energy Technology Data Exchange (ETDEWEB)

    Warne, Larry Kevin; Jorgenson, Roy Eberhardt; Coats, Rebecca Sue

    2010-04-01

    This report documents calculations conducted to determine if 42 low-power transmitters located within a metallic enclosure can initiate electro-explosive devices (EED) located within the same enclosure. This analysis was performed for a generic EED no-fire power level of 250 mW. The calculations show that if the transmitters are incoherent, the power available is 32 mW - approximately one-eighth of the assumed level even with several worst-case assumptions in place.

  10. Comparative Evaluation of Spectral Transmittance of Some Welding Glasses with ANSI Z87.1

    OpenAIRE

    saeed Rahmani; Alireza Akbarzadeh Baghban; Mohammadreza Nazari; Mohammad Ghassemi-Broumand

    2016-01-01

    Background: Welding emits harmful rays to the eyes. We evaluate and compare the UV, blue light and IR transmittance characteristics of some currently available welding safety protectors with ANSI Z87.1 criteria.Materials and Methods: Three type of welding safety protectors (three of each type) have been evaluated for spectral transmittance. One-sample T-test was performed to establish is there a statistically significant difference between the standard criteria and UV, blue and IR regions for...

  11. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  12. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  13. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  14. Total canopy transmittance estimated from small-footprint, full-waveform airborne LiDAR

    Science.gov (United States)

    Milenković, Milutin; Wagner, Wolfgang; Quast, Raphael; Hollaus, Markus; Ressl, Camillo; Pfeifer, Norbert

    2017-06-01

    Canopy transmittance is a directional and wavelength-specific physical parameter that quantifies the amount of radiation attenuated when passing through a vegetation layer. The parameter has been estimated from LiDAR data in many different ways over the years. While early LiDAR methods treated each returned echo equally or weighted the echoes according to their return order, recent methods have focused more on the echo energy. In this study, we suggest a new method of estimating the total canopy transmittance considering only the energy of ground echoes. Therefore, this method does not require assumptions for the reflectance or absorption behavior of vegetation. As the oblique looking geometry of LiDAR is explicitly considered, canopy transmittance can be derived for individual laser beams and can be mapped spatially. The method was applied on a contemporary full-waveform LiDAR data set collected under leaf-off conditions and over a study site that contains two sub regions: one with a mixed (coniferous and deciduous) forest and another that is predominantly a deciduous forest in an alluvial plain. The resulting canopy transmittance map was analyzed for both sub regions and compared to aerial photos and the well-known fractional cover method. A visual comparison with aerial photos showed that even single trees and small canopy openings are visible in the canopy transmittance map. In comparison with the fractional cover method, the canopy transmittance map showed no saturation, i.e., there was better separability between patches with different vegetation structure.

  15. Prediction of transmittance spectra for transparent composite electrodes with ultra-thin metal layers

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Zhao; Alford, T. L., E-mail: TA@asu.edu [School for Engineering of Matter, Transport, and Energy, Arizona State University, Tempe, Arizona 85287 (United States); Khorasani, Arash Elhami [ON Semiconductor Corp., Phoenix, Arizona 85005 (United States); Theodore, N. D. [CHD-Fab, Freescale Semiconductor Inc., Tempe, Arizona 85224 (United States); Dhar, A. [Intel Corp., 2501 NW 229th Ave, Hillsboro, Oregon 97124 (United States)

    2015-11-28

    Recent interest in indium-free transparent composite-electrodes (TCEs) has motivated theoretical and experimental efforts to better understand and enhance their electrical and optical properties. Various tools have been developed to calculate the optical transmittance of multilayer thin-film structures based on the transfer-matrix method. However, the factors that affect the accuracy of these calculations have not been investigated very much. In this study, two sets of TCEs, TiO{sub 2}/Au/TiO{sub 2} and TiO{sub 2}/Ag/TiO{sub 2}, were fabricated to study the factors that affect the accuracy of transmittance predictions. We found that the predicted transmittance can deviate significantly from measured transmittance for TCEs that have ultra-thin plasmonic metal layers. The ultrathin metal layer in the TCE is typically discontinuous. When light interacts with the metallic islands in this discontinuous layer, localized surface plasmons are generated. This causes extra light absorption, which then leads to the actual transmittance being lower than the predicted transmittance.

  16. Efficient Compensation of Transmitter and Receiver IQ Imbalance in OFDM Systems

    Directory of Open Access Journals (Sweden)

    Tandur Deepaknath

    2010-01-01

    Full Text Available Radio frequency impairments such as in-phase/quadrature-phase (IQ imbalances can result in a severe performance degradation in direct-conversion architecture-based communication systems. In this paper, we consider the case of transmitter and receiver IQ imbalance together with frequency selective channel distortion. The proposed training-based schemes can decouple the compensation of transmitter and receiver IQ imbalance from the compensation of channel distortion in an orthogonal frequency division multiplexing (OFDM systems. The presence of frequency selective channel fading is a requirement for the estimation of IQ imbalance parameters when both transmitter/receiver IQ imbalance are present. However, the proposed schemes are equally applicable over a frequency flat/frequency selective channel when either transmitter or only receiver IQ imbalance is present. Once the transmitter and receiver IQ imbalance parameters are estimated, a standard channel equalizer can be applied to estimate/compensate for the channel distortion. The proposed schemes result in an overall lower training overhead and a lower computational requirement, compared to the joint compensation of transmitter/receiver IQ imbalance and channel distortion. Simulation results demonstrate that the proposed schemes provide a very efficient compensation with performance close to the ideal case without any IQ imbalance.

  17. Effects of radio transmitters on the behavior of Red-headed Woodpeckers.

    Energy Technology Data Exchange (ETDEWEB)

    Vukovich, Mark; Kilgo, John, C.

    2009-05-01

    ABSTRACT. Previous studies have revealed that radio-transmitters may affect bird behaviors, including feeding rates, foraging behavior, vigilance, and preening behavior. In addition, depending on the method of attachment, transmitters can potentially affect the ability of cavity-nesting birds to use cavities. Our objective was to evaluate effects of transmitters on the behavior of and use of cavities byRed-headedWoodpeckers (Melanerpes erythrocephalus). Using backpack harnesses, we attached 2.1-g transmitter packages that averaged 3.1% of body weight (range = 2.5–3.6%) to Red-headed Woodpeckers. We observed both radio-tagged (N = 23) and nonradio-tagged (N = 28) woodpeckers and determined the percentage of time spent engaged in each of five behaviors: flight, foraging, perching, preening, and territorial behavior. We found no difference between the two groups in the percentage of time engaged in each behavior. In addition, we found that transmitters had no apparent effect on use of cavities for roosting by radio-tagged woodpeckers (N = 25).We conclude that backpack transmitters weighing less than 3.6% of body weight had no impact on either their behavior or their ability to use cavities.

  18. A 4 Gbps current-mode transmitter for 12-bit 250 MSPS ADC

    Science.gov (United States)

    Chen, Zhenhai; Yu, Zongguang; Wei, Jinghe; Zhou, Dejin; Su, Xiaobo; Zou, Jiaxuan

    2017-08-01

    A 4 Gbps transmitter for a 12-bit 250 MSPS pipelined ADCs is presented. A low power current mode (CM) output driver with reverse scaling technique is proposed. A high speed, low power combined serializer is implemented to convert 12 bit parallel data into a seria1 data stream. The whole transmitter is used in a 12-bit 250 MSPS pipelined ADC for the digital output buffer and fabricated in 180 nm 1. 8 V 1P5M CMOS technology. Test results show that the transmitter provides an eye height greater than 800 mV for data rates of both 2 Gbps and 4 Gbps, the 12-bit 250 MSPS ADC achieves the SNR of 69.92 dBFS and SFDR of 81.17 dB with 20.1 MHz input at full sampling speed. The ADC with the 4 Gbps transmitter consumes the power consumption of 395 mW, where the power consumption of transmitter is 75 mW. The ADC occupies an area of 2.5× 3.2 {{mm}}2, where the active area of the transmitter block is 0.5× 1.2 {{mm}}2. Project supported by the National Science Foundation of China (No. 61474092) and Key Project of Natural Science of Anhui Provincial Department of Education (No. KJ2017A396).

  19. Transmitter-receiver system for time average fourier telescopy

    Science.gov (United States)

    Pava, Diego Fernando

    Time Average Fourier Telescopy (TAFT) has been proposed as a means for obtaining high-resolution, diffraction-limited images over large distances through ground-level horizontal-path atmospheric turbulence. Image data is collected in the spatial-frequency, or Fourier, domain by means of Fourier Telescopy; an inverse twodimensional Fourier transform yields the actual image. TAFT requires active illumination of the distant object by moving interference fringe patterns. Light reflected from the object is collected by a "light-buckt" detector, and the resulting electrical signal is digitized and subjected to a series of signal processing operations, including an all-critical averaging of the amplitude and phase of a number of narrow-band signals. This dissertation reports on the formulation and analysis of a transmitter-receiver system appropriate for the illumination, signal detection, and signal processing required for successful application of the TAFT concept. The analysis assumes a Kolmogorov model for the atmospheric turbulence, that the object is rough on the scale of the optical wavelength of the illumination pattern, and that the object is not changing with time during the image-formation interval. An important original contribution of this work is the development of design principles for spatio-temporal non-redundant arrays of active sources for object illumination. Spatial non-redundancy has received considerable attention in connection with the arrays of antennas used in radio astronomy. The work reported here explores different alternatives and suggests the use of two-dimensional cyclic difference sets, which favor low frequencies in the spatial frequency domain. The temporal nonredundancy condition requires that all active sources oscillate at a different optical frequency and that the frequency difference between any two sources be unique. A novel algorithm for generating the array, based on optimized perfect cyclic difference sets, is described

  20. An uncovered risk factor of sonothrombolysis: Substantial fluctuation of ultrasound transmittance through the human skull.

    Science.gov (United States)

    Wang, Zuojun; Komatsu, Teppei; Mitsumura, Hidetaka; Nakata, Norio; Ogawa, Takeki; Iguchi, Yasuyuki; Yokoyama, Masayuki

    2017-05-01

    Sonothrombolysis is one of the most feasible methods for enhancing clot lysis with a recombinant tissue plasminogen activator (rt-PA) in cases of acute ischemic strokes. For safe and efficient clinical practices of sonothrombolysis, accurate estimation of ultrasound transmittance through the human skull is critical. Previously, we reported substantial and periodic fluctuation of ultrasound transmittance through a bone-phantom plate following changes to ultrasound frequency, the thickness of the bone-phantom plate, and the distance between a transducer and the bone-phantom plate. In the present study, we clarify the transmittance behavior of medium-frequency ultrasound (from 400kHz to 600kHz) through the human skull, and examine reduction of the transmittance fluctuation. For the study, we measured transmittance of sinusoidal ultrasound waves at 400kHz, 500kHz, and 600kHz at 13 temple spots on 3 human skulls by changing the distance between a transducer and the skull bone, and found substantial and periodic fluctuation in the transmittance behaviors for these sinusoidal voltage excitations. Degrees of the fluctuation varied depending on the measurement spots. A fluctuation ratio between the maximum transmittance and the minimum transmittance reached 3 in some spots. This large transmittance fluctuation is considered to be a risk factor for sonothrombolysis therapies. We examined a modulated ultrasound wave to reduce the fluctuation, and succeeded in obtaining considerable reduction. The average fluctuation ratios for 400-kHz, 500-kHz, and 600-kHz waves were 2.38, 2.38, and 2.07, respectively. We successfully reduced the ratio to 1.72 by using a periodic selection of random frequency (PSRF)-type of modulation wave. The thus obtained results indicate that attention to the fluctuation in ultrasound transmittance through the skull is necessary for safe and effective sonothrombolysis therapies, and that modulated ultrasound waves constitute a powerful method for reducing

  1. Micro-miniature radio frequency transmitter for communication and tracking applications

    Energy Technology Data Exchange (ETDEWEB)

    Crutcher, R.I.; Emery, M.S.; Falter, K.G.; Nowlin, C.H. [Oak Ridge National Lab., TN (United States); Rochelle, J.M.; Clonts, L.G. [Univ. of Tennessee, Knoxville, TN (United States). Electrical Engineering Dept.

    1996-12-31

    A micro-miniature radio frequency (rf) transmitter has been developed and demonstrated by the Oak Ridge National Laboratory. The objective of the rf transmitter development was to maximize the transmission distance while drastically shrinking the overall transmitter size, including antenna. Based on analysis and testing, an application-specific integrated circuit (ASIC) with a 16-GHz gallium arsenide (GaAs) oscillator and integrated on-chip antenna was designed and fabricated using microwave monolithic integrated circuit (MMIC) technology. Details of the development and the results of various field tests will be discussed. The rf transmitter is applicable to covert surveillance and tracking scenarios due to its small size of 2.2 x 2.2 mm, including the antenna. Additionally, the 16-GHz frequency is well above the operational range of consumer-grade radio scanners, providing a degree of protection from unauthorized interception. Variations of the transmitter design have been demonstrated for tracking and tagging beacons, transmission of digital data, and transmission of real-time analog video from a surveillance camera. Preliminary laboratory measurements indicate adaptability to direct-sequence spread-spectrum transmission, providing a low probability of intercept and/or detection. Concepts related to law enforcement applications will be presented.

  2. Glutamate may be an efferent transmitter that elicits inhibition in mouse taste buds.

    Directory of Open Access Journals (Sweden)

    Yijen A Huang

    Full Text Available Recent studies suggest that l-glutamate may be an efferent transmitter released from axons innervating taste buds. In this report, we determined the types of ionotropic synaptic glutamate receptors present on taste cells and that underlie this postulated efferent transmission. We also studied what effect glutamate exerts on taste bud function. We isolated mouse taste buds and taste cells, conducted functional imaging using Fura 2, and used cellular biosensors to monitor taste-evoked transmitter release. The findings show that a large fraction of Presynaptic (Type III taste bud cells (∼50% respond to 100 µM glutamate, NMDA, or kainic acid (KA with an increase in intracellular Ca(2+. In contrast, Receptor (Type II taste cells rarely (4% responded to 100 µM glutamate. At this concentration and with these compounds, these agonists activate glutamatergic synaptic receptors, not glutamate taste (umami receptors. Moreover, applying glutamate, NMDA, or KA caused taste buds to secrete 5-HT, a Presynaptic taste cell transmitter, but not ATP, a Receptor cell transmitter. Indeed, glutamate-evoked 5-HT release inhibited taste-evoked ATP secretion. The findings are consistent with a role for glutamate in taste buds as an inhibitory efferent transmitter that acts via ionotropic synaptic glutamate receptors.

  3. The Effect of an Externally Attached Neutrally Buoyant Transmitter on Mortal Injury during Simulated Hydroturbine Passage

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Richard S.; Pflugrath, Brett D.; Carlson, Thomas J.; Deng, Zhiqun

    2012-02-03

    On their seaward migration, juvenile salmonids commonly pass hydroelectric dams. Fish passing through hydroturbines experience a rapid decrease in pressure as they pass by the turbine blade and the severity of this decompression can be highly variable. This rapid decrease in pressure can result in injuries such as swim bladder rupture, exophthalmia, and emboli and hemorrhaging in the fins and tissues. However, recent research indicates that the presence of a telemetry tag (acoustic, radio, inductive) implanted inside the coelom of a juvenile salmon increases the likelihood that the fish will be injured or die during turbine passage. Thus, previous research conducted using telemetry tags implanted into the coelom of fish may have been inaccurate. Thus, a new technique is needed to provide unbiased estimates of survival through turbines. This research provides an evaluation of the effectiveness of a neutrally buoyant externally attached acoustic transmitter. Both nontagged fish and fish tagged with a neutrally buoyant external transmitter were exposed to a range of rapid decompressions simulating turbine passage. Juvenile Chinook salmon tagged with a neutrally buoyant externally attached acoustic transmitter did not receive a higher degree of barotrauma than their nontagged counterparts. We suggest that future research include field-based comparisons of survival and behavior among fish tagged with a neutrally buoyant external transmitter and those internally implanted with transmitters.

  4. Preparation and characterization of high-transmittance AZO films using RF magnetron sputtering at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Jian [College of Materials and Chemical Engineering, Collaborative Innovation Center for Energy Equipment of Three Gorges Region, China Three Gorges University, Yichang 443002 (China); Sun, Yihua, E-mail: sunyihua316181@163.com [College of Materials and Chemical Engineering, Collaborative Innovation Center for Energy Equipment of Three Gorges Region, China Three Gorges University, Yichang 443002 (China); Lv, Xin; Li, Derong [Glass Industry Engineering Research Center of Hubei Province, Hubei Sanxia New Building Materials Co., Ltd., Dangyang 444105 (China); Fang, Liang; Wang, Hailin; Sun, Xiaohua; Huang, Caihua; Yu, Haizhou; Feng, Ping [College of Materials and Chemical Engineering, Collaborative Innovation Center for Energy Equipment of Three Gorges Region, China Three Gorges University, Yichang 443002 (China)

    2014-10-30

    Highlights: • We prepared the AZO thin films on soda-lime glass without the substrate heated. • High-transmittance AZO films had been obtained by RF magnetron sputtering using a ceramic target. • The minimum resistivity of 2.55 × 10{sup −3} Ω cm combined with highest transmittance of 91% was obtained at a sputtering power of 400 W. • The resistivity decreased and transmittance improved with the sputtering power increase. - Abstract: Aluminum-doped zinc oxide (AZO) thin films with 250 nm thickness had been prepared on soda-lime glass substrate without heated by RF magnetron sputtering using a ceramic target. The microstructure, surface morphology, electrical and optical properties of AZO thin films had been investigated by X-ray diffraction, scanning electron microscope, four-point probe method and optical transmission spectroscopy. The results indicated that all of the films obtained were polycrystalline with a hexagonal structure and oriented with the c-axis perpendicular to the substrate. The resistivity decreased and transmittance improved with the sputtering power increase. The minimum resistivity of 2.55 × 10{sup −3} Ω cm combined with highest transmittance of 91% was obtained at a sputtering power of 400 W. The optical bandgap at different sputtering power varied among 3.81–4.04 eV.

  5. Integration and test of high-speed transmitter electronics for free-space laser communications

    Science.gov (United States)

    Soni, Nitin J.; Lizanich, Paul J.

    1994-01-01

    The NASA Lewis Research Center in Cleveland, Ohio, has developed the electronics for a free-space, direct-detection laser communications system demonstration. Under the High-Speed Laser Integrated Terminal Electronics (Hi-LITE) Project, NASA Lewis has built a prototype full-duplex, dual-channel electronics transmitter and receiver operating at 325 megabit S per second (Mbps) per channel and using quaternary pulse-position modulation (QPPM). This paper describes the integration and testing of the transmitter portion for future application in free-space, direct-detection laser communications. A companion paper reviews the receiver portion of the prototype electronics. Minor modifications to the transmitter were made since the initial report on the entire system, and this paper addresses them. The digital electronics are implemented in gallium arsenide integrated circuits mounted on prototype boards. The fabrication and implementation issues related to these high-speed devices are discussed. The transmitter's test results are documented, and its functionality is verified by exercising all modes of operation. Various testing issues pertaining to high-speed circuits are addressed. A description of the transmitter electronics packaging concludes the paper.

  6. Capacitor-Shunted Transmitter for Power Reduction in Inductive-Coupling Clock Link

    Science.gov (United States)

    Kumar, Amit; Miura, Noriyuki; Kuroda, Tadahiro

    2008-04-01

    The importance of low-power and high-speed chip-to-chip communication between stacked chips is increasing in system in a package (SiP) systems. Wireless chip-to-chip communication is a promising technology that can increase the speed of inter-chip data transfer with very little area and power overhead. The wireless clock link in this scheme consumes more power than wireless data circuits. To reduce the overall power consumption we need to reduce the power consumed in the clock link of the circuit. In this paper we present a simple yet effective transmitter circuit, namely a capacitor-shunted transmitter, to reduce the power consumed in the clock transmitter. The simulation is carried out in spectre, and, to confirm the simulation result, a test chip is fabricated using Taiwan Semiconductor Manufacturing Company (TSMC) 0.18 µm complementary metal-oxide-semiconductor (CMOS). The simulation results and the test chip measurement results show that the power consumption of the clock transmitter circuit is reduced by 50% because of the capacitor-shunted transmitter circuit.

  7. Radio-transmitters have no impact on survival of pre-fledged American Woodcocks

    Science.gov (United States)

    Daly, Kyle O.; Andersen, David E.; Brininger, Wayne L.; Cooper, Thomas R.

    2015-01-01

    American Woodcocks (Scolopax minor) are a high priority species of conservation need across most of their breeding range due to long-term population declines. Survival of juveniles may be key to understanding these population declines, but there have been few direct estimates of juvenile woodcock survival rates, and no recent assessment of the possible effect of radio-tagging on juvenile survival. In 2011 and 2012, we radio-tagged 73 juvenile American Woodcocks in west-central Minnesota and compared survival rates of radio-tagged (N = 58) and non-radio-tagged (N = 82) juveniles during the period from hatching to fledging. We compared survival rates of juveniles with known fates and used logistic-exposure models to assess the potential impact of radio-transmitters on survival. We evaluated variables related to juvenile survival including age, hatch date, maximum and minimum temperature, precipitation, and year to assess the possible effects of radio-transmitters. The best-supported model of survival rate of juvenile American Woodcocks included the interaction of age and year and a negative effect of precipitation (β = −0.76, 85% CI: −1.08 to −0.43), but did not include a negative effect of transmitters. Our results suggest that radio-transmitters did not impact survival of juvenile American Woodcocks and that transmitters are a reliable tool for studying survival of juvenile American Woodcocks, and perhaps other precocial shorebirds.

  8. Fiber-Based, Trace-Gas, Laser Transmitter Technology Development for Space

    Science.gov (United States)

    Stephen, Mark; Yu, Anthony; Chen, Jeffrey; Nicholson, Jeffrey; Engin, Doruk; Mathason, Brian; Wu, Stewart; Allan, Graham; Hasselbrack, William; Gonzalez, Brayler; hide

    2015-01-01

    NASA’s Goddard Space Flight Center (GSFC) is working on maturing the technology readiness of a laser transmitter designed for use in atmospheric CO2 remote-sensing. GSFC has been developing an airplane-based CO2 lidar instrument over several years to demonstrate the efficacy of the instrumentation and measurement technique and to link the science models to the instrument performance. The ultimate goal is to make space-based satellite measurements with global coverage. In order to accomplish this, we must demonstrate the technology readiness and performance of the components as well as demonstrate the required power-scaling to make the link with the required signal-to-noise-ratio (SNR). To date, all the instrument components have been shown to have the required performance with the exception of the laser transmitter.In this program we are working on a fiber-based master oscillator power amplifier (MOPA) laser transmitter architecture where we will develop a ruggedized package and perform the relevant environmental tests to demonstrate TRL-6. In this paper we will review our transmitter architecture and progress on the performance and packaging of the laser transmitter.

  9. Solar energy transmittance of translucent samples. A comparison between large and small integrating sphere measurements

    Energy Technology Data Exchange (ETDEWEB)

    Chevalier, B.; Olive, F. [CSTB, Grenoble (France); Hutchins, M.G.; Squire, T. [School of Engineering, Oxford Brookes University, Headington, Gipsy Lane Campus, Oxford OX3 0BP (United Kingdom); Maccari, A. [ENEA, Rome (Italy); Oversloot, H. [TNO, Delft (Netherlands); Platzer, W. [ISES, Freiburg (Germany); Polato, P. [SSV, Murano (Italy); Roos, A. [Uppsala University, Uppsala (Sweden); Rosenfeld, J.L.J. [University of Wales, Cardiff (United Kingdom); Yoshimura, K. [NIRIN, Nagoya (Japan)

    1998-07-13

    Optical transmittance and reflectance of a translucent plastic PTFE film have been measured over the solar wavelength range using different integrating spheres. The same sample has been measured with small and large spheres and the total solar transmittance has been obtained from both broad band measurements and from integration of spectral data. The fact that the sum of reflectance and transmittance often exceeds 100% shows that all types of spheres tend to overestimate the transmittance of this highly scattering sample. This error can be attributed to the sphere geometry in combination with the light scattering properties of the sample, and unless proper correction of recorded data is carried out the error may be as large as 5-10%. Some specific errors are presented and an approximate correction procedure is suggested.These results show that there is a need for a transmittance standard which can be used to calibrate integrating spheres. Such a standard with negligible thickness would be especially useful for measurements with large, broadband integrating spheres, but would also be helpful for the correct handling of data from small spectral instruments

  10. Heat treatment effect on erosion behavior of poly(methylmethacrylate) for optical transmittance efficiency

    Science.gov (United States)

    Çoban, Onur

    2014-10-01

    Influence of heat treatment on optical transmittance of poly(methyl methacrylate) (PMMA) samples was investigated under solid particle erosion. Heat treatment was employed at 85 °C for 1, 2 and 3 h. Effect of heat treatment on physical, chemical, mechanical and thermal properties of PMMA samples was investigated by differential scanning calorimeter (DSC), thermogravimetric analysis (TGA), Fourier transform infrared (FTIR) spectroscopy, Vickers microhardness measurement methods. After these analysis, both pristine and heat treated PMMA samples were eroded at 15°, 30°, 45°, 60°, 75° and 90° impingement angles. Then, optical transmittance of all eroded PMMA samples was inspected by a UV-Vis spectrometer. Scanning electron microscopy (SEM) was used to explain the erosion mechanisms and to compare the roughness and optical transmittance of eroded PMMA surfaces. Heat treatment under glass transition temperature of PMMA increased the Tg and hardness values. According to erosion test results, both pristine and heat treated PMMA samples were showed ductile erosion behavior. However; maximum and minimum optical transmittance values of eroded pristine PMMA samples were obtained for the angles of 15° and 90°, respectively. A positive effect of heat treatment on optical transmittance of PMMA was obtained for all impingement angles, but most pronounced effect was seen for 15°.

  11. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  12. High-resolution observation of field-aligned irregularities in the ionosphere using multi-frequency range imaging of VHF atmospheric radar

    Science.gov (United States)

    Chen, Jenn-Shyong; Furumoto, Jun-ichi; Su, Ching-Lun; Chu, Yen-Hsyang

    Field-aligned irregularity (FAI) in the ionosphere is a topic of interest to atmospheric radar community. In addition to the field-aligned characteristic, quasi-periodic (QP) appearance of FAI echoes has been observed frequently by very-high-frequency (VHF) atmospheric radar. The occurrence range of QP FAI echoes changes with time, and the slope of range versus time can be positive or negative, depending on occurrence time of the echoes. Several mechanisms responsible for the QP FAI echoes have been proposed, e.g., modulation in altitude by a passing atmospheric gravity wave, semidiurnal neutral-wind variation, and so on. Owing to the finite pulse length of radar in observation, the range resolution of measurement is limited within hundreds of meters. In view of this, the range imaging (RIM) using multiple frequencies has been employed to improve the range resolution of measurement. The multi-frequency technique transmits a set of slightly different frequencies sequentially during each radar pulse, and the radar returns at different transmitting frequencies are received, respectively. With adaptive retrieval algorithms for these radar returns, it is capable of resolving the echo structures at meter scale in the range direction. RIM has been employed in the lower atmosphere successfully. In this study, the performance of RIM for FAI was first carried out with the Middle and Upper atmosphere Radar (46 MHz; 34.85(°) N, 136.10(°) N; Japan) and the Chung-Li VHF radar (52 MHz; 24.9(°) N, 121.1(°) E; Taiwan). Some initial results of high-resolution FAI echoes within the range gate will be shown.

  13. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  14. Marine spawning sites of perch Perca fluviatilis revealed by oviduct-inserted acoustic transmitters

    DEFF Research Database (Denmark)

    Skovrind, Mikkel; Christensen, Emil A.F.; Carl, Henrik

    2013-01-01

    In the 1970s, a flood-protection system dramatically changed a large part of the coastal environment of Køge Bugt, a bay in the western Baltic Sea, from open coast to a brackish lagoon habitat. An anadromous stock of European perch Perca fluviatilis seems to have benefitted from this change...... a strong proof of concept of oviduct-inserted acoustic transmitters in brackish and marine fish spawning studies. The transmitter expulsions were validated using an egg map, which was based on visual observations of perch egg-strands, and 11 of the 12 expulsed transmitters (92%) were located in areas...... with eggs. Many fish spawned in the brackish water with salinities up to 9.6 PSU. These salinities are higher than those previously observed for European perch spawning in the wild, and call for further investigations of salinity tolerance in perch eggs...

  15. In Situ Thermal Transmittance Measurements for Investigating Differences between Wall Models and Actual Building Performance

    Directory of Open Access Journals (Sweden)

    Luca Evangelisti

    2015-08-01

    Full Text Available An accurate assessment of a building’s wall performance, defined through the thermal transmittance, is essential to compute the annual energy consumption. Analyzing opaque surfaces, the heat transfer across walls can be modeled by an electro-thermal analogy, based on resistors series, crossed by a one-dimensional heat flow. This analogy is well established and it refers to stratigraphy composed of homogeneous materials. When dealing with inhomogeneous materials, possibly including hollow bricks, the wall’s thermal transmittance is evaluated by means of an effective conductance. However, in order to verify the theoretical models effectiveness, a comparison with in situ measurements is needed. In this paper, three building walls characterized by different stratigraphy have been analyzed; by employing a heat flow meter investigation. Measurements results and estimated thermal transmittance values—calculated applying the standard UNI EN ISO 6946—have been compared.

  16. Transmitter and Translating Receiver Design For 64-ary Pulse Position Modulation (PPM)

    Energy Technology Data Exchange (ETDEWEB)

    Mendez, A J; Hernandez, V J; Gagliardi, R M; Bennett, C V

    2010-01-20

    This paper explores the architecture and design of an optically-implemented 64-ary PPM transmitter and direct-translating receiver that effectively translates incoming electrically-generated bit streams into optical PPM symbols (and vice-versa) at > 1 Gb/s data rates. The PPM transmitter is a cascade of optical switches operating at the frame rate. A corresponding receiver design is more difficult to architect and implement, since increasing data rates lead to correspondingly shorter decision times (slot times and frame times). We describe a solution in the form of a time-to-space mapping arrayed receiver that performs a translating algorithm represented as a code map. The technique for generating the code map is described, and the implementation of the receiver as a planar lightwave circuit is given. The techniques for implementing the transmitter and receiver can be generalized for any case of M-ary PPM.

  17. Optimal position of the transmitter coil for wireless power transfer to the implantable device.

    Science.gov (United States)

    Jinghui Jian; Stanaćević, Milutin

    2014-01-01

    The maximum deliverable power through inductive link to the implantable device is limited by the tissue exposure to the electromagnetic field radiation. By moving away the transmitter coil from the body, the maximum deliverable power is increased as the magnitude of the electrical field at the interface with the body is kept constant. We demonstrate that the optimal distance between the transmitter coil and the body is on the order of 1 cm when the current of the transmitter coil is limited to 1 A. We also confirm that the conditions on the optimal frequency of the power transmission and the topology of the transmission coil remain the same as if the coil was directly adjacent to the body.

  18. A self-oscillating detuning-insensitive class-E transmitter for implantable microsystems.

    Science.gov (United States)

    Ziaie, B; Rose, S C; Nardin, M D; Najafi, K

    2001-03-01

    This paper describes a low-cost, self-oscillating, detuning-in-sensitive, class-E driver for transcutaneous power and data transmission to implantable microsystems. A voltage feedback scheme using a fast comparator for zero-crossing detection and a CMOS start-up circuit were used to stabilize the class-E operation for various transmitter coil inductance values. This technique solves the common problem of mismatch between the switching frequency of the driving device and the resonant frequency of the load network, which can cause excessive power loss and damage to the active device. Data is transmitted by AM modulation of the carrier through switching the power supply between two levels. The transmitter uses a 9-V supply, consumes 212 mA, operates at 3.9 MHz, and has an efficiency of 71%. The efficiency is stable (Biomedical microsystems, class-E transmitter, implantable electronics, inductive powering, transcutaneous links.

  19. Determination of Aluminium Content in Aluminium Hydroxide Formulation by FT-NIR Transmittance Spectroscopy

    DEFF Research Database (Denmark)

    Lai, Xuxin; Zheng, Yiwu; Søndergaard, Ib

    2007-01-01

    A method for determining the aluminium content of an aluminium hydroxide suspension using near infrared (NIR) transmittance spectroscopy has been developed. Inductively coupled plasma-atomic emission spectroscopy (ICP-AES) was used as reference method. The factors influencing the NIR analysis...... by NIR transmission each on five different days, with total of 175 spectra used for the calibration set. The multivariate data analysis technique partial least square regression (PLSR) was applied to build the calibration model. Six batches of aluminium hydroxide samples were used for the test set. ICP......-AES and NIR transmittance spectroscopy exhibit comparable precision and accuracy. The NIR method provides several advantages: no complicated sample preparation; easy to operate; fast and non-destructive. In conclusion, NIR transmittance spectroscopy can be an alternative analytical method for determining...

  20. Standard Test Method for Solar Photometric Transmittance of Sheet Materials Using Sunlight

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    1996-01-01

    1.1 This test method covers the measurement of solar photometric transmittance of materials in sheet form. Solar photometric transmittance is measured using a photometer (illuminance meter) in an enclosure with the sun and sky as the source of radiation. The enclosure and method of test is specified in Test Method E 1175 (or Test Method E 1084). 1.2 The purpose of this test method is to specify a photometric sensor to be used with the procedure for measuring the solar photometric transmittance of sheet materials containing inhomogeneities in their optical properties. This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  1. Design of ultrasonic transmitters with defined frequency characteristics for wireless pressure sensing in injection molding.

    Science.gov (United States)

    Zhang, Li; Theurer, Charles B; Gao, Robert X; Kazmer, David O

    2005-08-01

    This paper describes a new mechanical wireless data transmission technique using ultrasonic waves as the information carrier for on-line injection mold cavity pressure measurement. Ultrasonic transmitters with specific frequency characteristics were designed, modeled, simulated, and prototyped for pressure data retrieval from an enclosed machine environment, as well as for sensor identification in a sensor matrix configuration. The effects of the front layer and bonding layer of the transmitter on the overall sensor frequency characteristics were investigated, using an equivalent circuit model. The optimal layer thickness was determined for the design of transmitters with specific dominant resonant frequency and narrow bandwidth. Experimental results were in good agreement with the analysis, thus confirming the design approach.

  2. Standard Test Methods for Solar Energy Transmittance and Reflectance (Terrestrial) of Sheet Materials

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    1971-01-01

    1.1 These test methods cover the measurement of solar energy transmittance and reflectance (terrestrial) of materials in sheet form. Method A, using a spectrophotometer, is applicable for both transmittance and reflectance and is the referee method. Method B is applicable only for measurement of transmittance using a pyranometer in an enclosure and the sun as the energy source. Specimens for Method A are limited in size by the geometry of the spectrophotometer while Method B requires a specimen 0.61 m2 (2 ft2). For the materials studied by the drafting task group, both test methods give essentially equivalent results. 1.2 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  3. Microscopically crumpled indium-tin-oxide thin films as compliant electrodes with tunable transmittance

    Energy Technology Data Exchange (ETDEWEB)

    Ong, Hui-Yng [School of Mechanical and Aerospace Engineering, Nanyang Technological University, Singapore 639798 (Singapore); School of Engineering, Nanyang Polytechnic, Singapore 569830 (Singapore); Shrestha, Milan; Lau, Gih-Keong, E-mail: mgklau@ntu.edu.sg [School of Mechanical and Aerospace Engineering, Nanyang Technological University, Singapore 639798 (Singapore)

    2015-09-28

    Indium-tin-oxide (ITO) thin films are perceived to be stiff and brittle. This letter reports that crumpled ITO thin films on adhesive poly-acrylate dielectric elastomer can make compliant electrodes, sustaining compression of up to 25% × 25% equi-biaxial strain and unfolding. Its optical transmittance reduces with crumpling, but restored with unfolding. A dielectric elastomer actuator (DEA) using the 14.2% × 14.2% initially crumpled ITO thin-film electrodes is electrically activated to produce a 37% areal strain. Such electric unfolding turns the translucent DEA to be transparent, with transmittance increased from 39.14% to 52.08%. This transmittance tunability promises to make a low-cost smart privacy window.

  4. Methods of Phase and Power Control in Magnetron Transmitters for Superconducting Accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Kazadevich, G. [MUONS Inc., Batavia; Johnson, R. [MUONS Inc., Batavia; Neubauer, M. [MUONS Inc., Batavia; Lebedev, V. [Fermilab; Schappert, W. [Fermilab; Yakovlev, V. [Fermilab

    2017-05-01

    Various methods of phase and power control in magnetron RF sources of superconducting accelerators intended for ADS-class projects were recently developed and studied with conventional 2.45 GHz, 1 kW, CW magnetrons operating in pulsed and CW regimes. Magnetron transmitters excited by a resonant (injection-locking) phasemodulated signal can provide phase and power control with the rates required for precise stabilization of phase and amplitude of the accelerating field in Superconducting RF (SRF) cavities of the intensity-frontier accelerators. An innovative technique that can significantly increase the magnetron transmitter efficiency at the widerange power control required for superconducting accelerators was developed and verified with the 2.45 GHz magnetrons operating in CW and pulsed regimes. High efficiency magnetron transmitters of this type can significantly reduce the capital and operation costs of the ADSclass accelerator projects.

  5. Light transmittance of fiber posts following various surface treatments: A preliminary study.

    Science.gov (United States)

    Cekic-Nagas, Isil; Ergun, Gulfem; Egilmez, Ferhan

    2016-01-01

    The objective of this study was to compare the light transmittance of fiber posts following application of various surface treatments. Fiber post specimens (Snowpost red size #14) were tested (n = 7). The fiber posts were divided into five groups according to the application of surface treatments: Group 1: No surface treatment; Group 2: Etched with hydrofluoric acid (HF) + silane application; Group 3: Airborne-particle abraded with 110 μm Al2O3; Group 4: Irradiated with erbium: Yttrium-aluminum-garnet laser; Group 5: Airborne-particle abraded with 110 μm Al2O3 + silane application. The light transmittance of the specimens was compared using a spectrophotometer. Statistical significance was determined using one-way analysis of variance (ANOVA) (α = 0.05). One-way ANOVA revealed that surface treatment had significant effects on light transmittance of posts (P fiber posts.

  6. Linear thermal transmittance of the assembly of the glazing and the frame in windows

    DEFF Research Database (Denmark)

    Svendsen, Svend; Laustsen, Jacob Birck; Kragh, Jesper

    2005-01-01

    The thermal transmittance or U-value of windows can be found by calculation according to the standards EN ISO 10077-1/2 (CEN,2000). The window U-value is calculated from the U-value of the glazing and the frame as well as the linear thermal transmittance of the assembly of the glazing and the frame....... The U-value of the glazing and the frame can be calculated separately while the calculation of the linear thermal transmittance includes the design of the edge construction of the glazing unit but also the design of the frame and the glazing unit. The edge construction of glazing units is made up...... of a spacer profile and a sealing. The spacer profile is typically made of metal and acts as a significant thermal bridge. Spacer profiles with improved thermal characteristics have been developed and are being introduced as ‘warm edge’. They are typically based on thin layers of stainless steel...

  7. High-energy, 2µm laser transmitter for coherent wind LIDAR

    Science.gov (United States)

    Singh, Upendra N.; Yu, Jirong; Kavaya, Michael J.; Koch, Grady J.

    2017-11-01

    A coherent Doppler lidar at 2μm wavelength has been built with higher output energy (300 mJ) than previously available. The laser transmitter is based on the solid-state Ho:Tm:LuLiF, a NASA Langley Research Center invented laser material for higher extraction efficiency. This diode pumped injection seeded MOPA has a transform limited line width and diffraction limited beam quality. NASA Langley Research Center is developing coherent wind lidar transmitter technology at eye-safe wavelength for satellite-based observation of wind on a global scale. The ability to profile wind is a key measurement for understanding and predicting atmospheric dynamics and is a critical measurement for improving weather forecasting and climate modeling. We would describe the development and performance of an engineering hardened 2μm laser transmitter for coherent Doppler wind measurement from ground/aircraft/space platform.

  8. NOVEL TECHNIQUE OF POWER CONTROL IN MAGNETRON TRANSMITTERS FOR INTENSE ACCELERATORS

    Energy Technology Data Exchange (ETDEWEB)

    Kazakevich, G. [MUONS Inc., Batavia; Johnson, R. [MUONS Inc., Batavia; Neubauer, M.; Lebedev, V. [Fermilab; Schappert, W. [Fermilab; Yakovlev, V. [Fermilab

    2016-10-21

    A novel concept of a high-power magnetron transmitter allowing dynamic phase and power control at the frequency of locking signal is proposed. The transmitter compensating parasitic phase and amplitude modulations inherent in Superconducting RF (SRF) cavities within closed feedback loops is intended for powering of the intensity-frontier superconducting accelerators. The con- cept uses magnetrons driven by a sufficient resonant (in- jection-locking) signal and fed by the voltage which can be below the threshold of self-excitation. This provides an extended range of power control in a single magnetron at highest efficiency minimizing the cost of RF power unit and the operation cost. Proof-of-principle of the proposed concept demonstrated in pulsed and CW regimes with 2.45 GHz, 1kW magnetrons is discussed here. A conceptual scheme of the high-power transmitter allowing the dynamic wide-band phase and y power controls is presented and discussed.

  9. Transmittance of semitransparent windows with absorbing cap-shaped droplets condensed on their backside

    Science.gov (United States)

    Zhu, Keyong; Pilon, Laurent

    2017-11-01

    This study aims to investigate systematically light transfer through semitransparent windows with absorbing cap-shaped droplets condensed on their backside as encountered in greenhouses, solar desalination plants, photobioreactors and covered raceway ponds. The Monte Carlo ray-tracing method was used to predict the normal-hemispherical transmittance, reflectance, and normal absorptance accounting for reflection and refraction at the air/droplet, droplet/window, and window/air interfaces and absorption in both the droplets and the window. The droplets were monodisperse or polydisperse and arranged either in an ordered hexagonal pattern or randomly distributed on the backside with droplet contact angle θc ranging between 0 and 180° The normal-hemispherical transmittance was found to be independent of the spatial distribution of droplets. However, it decreased with increasing droplet diameter and polydispersity. The normal-hemispherical transmittance featured four distinct optical regimes for semitransparent window supporting nonabsorbing droplets. These optical regimes were defined based on contact angle and critical angle for internal reflection at the droplet/air interface. However, for strongly absorbing droplets, the normal-hemispherical transmittance (i) decreased monotonously with increasing contact angle for θc absorption index kd, droplet mean diameter dm, and contact angle θc for θc ≥ 90° Analytical expressions for the normal-hemispherical transmittance were provided in the asymptotic cases when (1) the window was absorbing but the droplets were nonabsorbing with any contact angles θc, and (2) the droplets were strongly absorbing with contact angle θc >90° Finally, the spectral normal-hemispherical transmittance of a 3 mm-thick glass window supporting condensed water droplets for wavelength between 0.4 and 5 μm was predicted and discussed in light of the earlier parametric study and asymptotic behavior.

  10. Examination of an Optical Transmittance Test for Photovoltaic Encapsulation Materials (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Miller, D.; Bengoechea, J.; Bokria, J.; Kohl, M.; Powell, N. E.; Smith, M. E.; White, M. D.; Wilson, H. R.; Wohlgemuth, J. H.

    2013-09-01

    The optical transmittance of encapsulation materials is a key characteristic for their use in photovoltaic (PV) modules. Changes in transmittance with time in the field affect module performance, which may impact product warranties. Transmittance is important in product development, module manufacturing, and field power production (both immediate and long-term). Therefore, an international standard (IEC 62788-1-4) has recently been proposed by the Encapsulation Task-Group within the Working Group 2 (WG2) of the International Electrotechnical Commission (IEC) Technical Committee 82 (TC82) for the quantification of the optical performance of PV encapsulation materials. Existing standards, such as ASTM E903, are general and more appropriately applied to concentrated solar power than to PV. Starting from the optical transmittance measurement, the solar-weighted transmittance of photon irradiance, yellowness index (which may be used in aging studies to assess durability), and ultraviolet (UV) cut-off wavelength may all be determined using the proposed standard. The details of the proposed test are described. The results of a round-robin experiment (for five materials) conducted at seven laboratories to validate the test procedure using representative materials are also presented. For example, the Encapsulation Group actively explored the measurement requirements (wavelength range and resolution), the requirements for the spectrophotometer (including the integrating sphere and instrument accessories, such as a depolarizer), specimen requirements (choice of glass-superstrate and -substrate), and data analysis (relative to the light that may be used in the PV application). The round-robin experiment identified both intra- and inter-laboratory instrument precision and bias for five encapsulation materials (encompassing a range of transmittance and haze-formation characteristics).

  11. Research on control technology of hardware parallelism for marine controlled source electromagnetic transmitter

    Science.gov (United States)

    Wang, Meng; Deng, Ming; Luo, Xianhu; Zhao, Qingxian; Chen, Kai; Jing, Jianen

    2018-02-01

    The marine controlled source electromagnetic (CSEM) method has been recognized as an effective exploration method of shallow hydrocarbons around the world. We developed our own underwater marine CSEM transmitter that consisted of many functional modules with various response times. We previously adopted a centralized software-control technology to design the transmitter circuit topological structure. That structure probably generated a control disorder or malfunction. These undesirable conditions could lead to repeated recovery and deployment of the transmitter, which not only consumed time but also affected data continuity and establishment of stable and continuous CSEM field. We developed an instrument design concept named ‘control technology of hardware parallelism’. In this design, a noteworthy innovation of our new technology is to solve the above-mentioned problems at the physical and fundamental levels. We used several self-contained control-units to simultaneously accomplish the predetermined functions of the transmitter. The new solution relies on two technologies: multi-core embedded technology and multi-channel parallel optical-fiber data transmission technology. The first technology depends on many independent microcontrollers. Every microcontroller is only used to achieve a customized function. The second one relies on several multiple optical-fiber transmission channels realized by a complex programmable logic device and two optical-fiber conversion devices, which are used to establish a communication link between the shipboard monitoring and control-unit and underwater transmitter. We have conducted some marine experiments to verify the reliability and stability of the new method. In particular, the new technology used in the transmitter system could help us obtain more useful measured data in a limited time, improve real-time efficiency, and support the establishment of a stable CSEM field.

  12. The spatial distribution features of three Alpha transmitter signals at the topside ionosphere

    Science.gov (United States)

    Zhang, X.; Zhao, S. F.; Ruzhin, Y.; Liu, Jing; Song, R.

    2017-05-01

    The spatial distribution features of electric field over three Alpha transmitters in Russia were analyzed based on the Demeter satellite records at local nighttime during the solar minimum in December of 2008, where the three transmitters are with the same emitted power of 500 kW and the same radio waves at 11.9 kHz, 12.6 kHz, and 14.9 kHz. The results of observations showed that the maximal electric field reached -80 to -70 dB (hereafter referred as to V/m) at 660 km altitude, and the horizontal covered area even exceeded 80° in longitude with electric field above -100 dB at 14.9 kHz. The lowest electric field and the smallest longitude scale were detected over Krasnodar (KRA), which is demonstrated that the lower ionosphere plays an important role in attenuating the energy as suggested by the simulation results from the full-wave propagation model. Another feature over KRA was the significant decrease in electromagnetic field strength at 11.9 kHz and 12.6 kHz, being one order of magnitude lower than the other two transmitters, where the lower hybrid resonance waves affected severely the whistler mode wave mode propagation. Compared with the ground very low frequency observations at Tonghai and Ya'an in China, the most complex variations were observed from KRA, while the east transmitter Khabarovsk maintained high strength of electromagnetic power in a longer distance than the middle transmitter Novosibirsk in local nighttime, which is consistent with the large covering scale in the topside ionosphere due to the enhancement by wave-particle interaction from the other transmitter.

  13. Development of a passive VHF radar system using software-defined radio for equatorial plasma instability studies

    Science.gov (United States)

    Tuysuz, B.; Urbina, J.; Lind, F. D.

    2013-07-01

    In this paper, a bistatic passive radar receiver system named "Coherent-scatter Atmospheric Passive Radar Imager (CAPRI)" is described. It is primarily designed to study the dynamics of the upper atmosphere by utilizing "transmitters of opportunity" as the RF target illuminators. CAPRI is constructed using the open source software-defined radio toolkit, GNU Radio, to meet the signal processing requirements in combination with the open source hardware, Universal Software Radio Peripheral 2, for data acquisition. The resultant system is highly flexible, and we present the details of the design as well as a performance analysis. CAPRI will be deployed in Peru, near the magnetic equator, for long-term operations in the area. FM stations near Lima, Peru, will be utilized with the targets of interest being the equatorial electrojet and the spread F. The results will then be compared to the Jicamarca Unattended Long-term investigations of the Ionosphere and Atmosphere (JULIA) radar data, and CAPRI will be used to improve the simultaneous time and spatial coverage in the region in a more cost-effective manner.

  14. Evaluating in situ thermal transmittance of green buildings masonries—A case study

    Directory of Open Access Journals (Sweden)

    Francesco Asdrubali

    2014-01-01

    The paper presents the results of a measurement campaign of in situ thermal transmittance, performed in some buildings in the Umbria Region (Italy, designed implementing bio-architecture solutions. The analyzed walls were previously monitored with thermographic surveys in order to assess the correct application of the sensors. Results of the investigation show that in situ thermal transmittance measurements and theoretical calculated U-value are not in perfect agreement. The mismatch becomes important for monolithic structures such as walls made of thermal blocks without insulating layers.

  15. Transmittance of transparent windows with non-absorbing cap-shaped droplets condensed on their backside

    Science.gov (United States)

    Zhu, Keyong; Huang, Yong; Pruvost, Jeremy; Legrand, Jack; Pilon, Laurent

    2017-06-01

    This study aims to quantify systematically the effect of non-absorbing cap-shaped droplets condensed on the backside of transparent windows on their directional-hemispherical transmittance and reflectance. Condensed water droplets have been blamed to reduce light transfer through windows in greenhouses, solar desalination plants, and photobioreactors. Here, the directional-hemispherical transmittance was predicted by Monte Carlo ray-tracing method. For the first time, both monodisperse and polydisperse droplets were considered, with contact angle between 0 and 180°, arranged either in an ordered hexagonal pattern or randomly distributed on the window backside with projected surface area coverage between 0 and 90%. The directional-hemispherical transmittance was found to be independent of the size and spatial distributions of the droplets. Instead, it depended on (i) the incident angle, (ii) the optical properties of the window and droplets, and on (iii) the droplet contact angle and (iv) projected surface area coverage. In fact, the directional-hemispherical transmittance decreased with increasing incident angle. Four optical regimes were identified in the normal-hemispherical transmittance. It was nearly constant for droplet contact angles either smaller than the critical angle θcr (predicted by Snell's law) for total internal reflection at the droplet/air interface or larger than 180°-θcr. However, between these critical contact angles, the normal-hemispherical transmittance decreased rapidly to reach a minimum at 90° and increased rapidly with increasing contact angles up to 180°-θcr. This was attributed to total internal reflection at the droplet/air interface which led to increasing reflectance. In addition, the normal-hemispherical transmittance increased slightly with increasing projected surface area coverage for contact angle was smaller than θcr. However, it decreased monotonously with increasing droplet projected surface area coverage for contact

  16. High transmittance optical films based on quantum dot doped nanoscale polymer dispersed liquid crystals

    Science.gov (United States)

    Gandhi, Sahil Sandesh; Chien, Liang-Chy

    2016-04-01

    We propose a simple way to fabricate highly transparent nanoscale polymer dispersed liquid crystal (nano-PDLC) films between glass substrates and investigate their incident angle dependent optical transmittance properties with both collimated and Lambertian intensity distribution light sources. We also demonstrate that doping nano-PDLC films with 0.1% InP/ZnS core/shell quantum dots (QD) results in a higher optical transmittance. This work lays the foundation for such nanostructured composites to potentially serve as roll-to-roll coatable light extraction or brightness enhancement films in emissive display applications, superior to complex nanocorrugation techniques proposed in the past.

  17. A COMPARISON OF OBSERVATION WITH MODELING FOR ALBEDO AND TRANSMITTANCE OF SNOW

    OpenAIRE

    アオキ, テルオ; セコ, カツモト; アオキ, タダオ; フカボリ, マサシ; Teruo, AOKI; Katsumoto, SEKO; Tadao, AOKI; Masashi, FUKABORI

    1994-01-01

    Snow surface albedo and transmittance inside the snow have been investigated by observation and modeling. Observations were taken by a grating type spectrometer at Tokamachi in March 1993. The observed snow was old and very wet. Microscope photo-graphs of snow grains taken at this time indicate that snow grain is spherical particles with size of about 1.0μm. Surface albedo and transmittance of snow by a multiple scattering model for the atmosphere-snow system with pure snow grain size of 1.0μ...

  18. Design and Implementation of Double-Transmitter-Coil Antenna Used for the Tag Test System

    Directory of Open Access Journals (Sweden)

    Bin You

    2013-01-01

    Full Text Available At present, more and more electronic tags are used in Antitheft system; it is important to examine the performance of electronic tags. The traditional single-transmitter-coil antenna (STC antenna of the electronic tags tester has some serious drawbacks. So a novel double-transmitter-coil antenna (DTC antenna is presented in this paper. Compared to the traditional STC antenna, this new antenna has a more excellent performance in the tag test systems, especially when it is used for testing the quality factor of tags.

  19. Investigating Feasibility Of Multiple UHF Passive RFID Transmitters Using Backscatter Modulation Scheme In BCI Applications

    DEFF Research Database (Denmark)

    Al Ajrawi, Shams; Sarkar, Mahasweta; Rao, Ramesh

    simulatedbrain matter to a receiver located on the surface of a simulatedskull. These analyses are essential for building a brain computerinterface application. We showcase theoretical and experimentalresults based on a phantom model of the human brain usingpassive RFID as the implantable transmitter operating...... in UHFrange. Furthermore, we use backscatter modulation as a powertransfer mechanism. Investigation on the feasibility and appli-cability of implantable UHF Passive RFID transmitters insidethe brain is done for capturing multi-channel ECoG signals at ahigh data transfer rate. Detailed analysis have been done...

  20. Robustness of the universal optical transmittance in monolayer and multilayer graphene flakes under Coulomb interactions

    Science.gov (United States)

    Yadav, Premlata; Srivastava, Pawan Kumar; Ray, Nirat; Ghosh, Subhasis

    2016-09-01

    We present an experimental investigation on the universality of the optical transmittance of mono- and multilayer chemically exfoliated graphene flakes. By varying the exfoliating solvent, and thereby modulating the strength of electron-electron interactions, we find that the universality is not impacted over the visible region. The impact of modulating the interaction strength is clearly seen as shifts in the M-point exciton spectra. These shifts can then lead to a reduction in the wavelength regime over which universal wavelength independent optical transmittance is observed. At the level of first-order perturbation theory, our results are consistent with existing theoretical predictions for interaction corrections in optical properties of monolayer graphene.

  1. Remote Determination of Cloud Temperature and Transmittance from Spectral Radiance Measurements: Method and Results

    Science.gov (United States)

    1996-10-01

    CONTROL DATA 2. SECURITY CLASSIFICATION 1...atmospherics temperatura and humidity profiles. Validation tests performed on experimental spectra demonstrate the occuracy of the method with typical...indicated as with the title.) Passive Remota Sensing Infrared Spectra Cloud Temperatura Cloud Transmittance FTIR Spectrometer Icing Hazard Detection (DCD03E.IFO - 95.02.22) UNCLASSIFIED SECURITY CLASSIFICATION OF FORM

  2. Abdominally implanted satellite transmitters affect reproduction and survival rather than migration of large shorebirds

    NARCIS (Netherlands)

    Hooijmeijer, J.C.E.W.; Gill, Robert E.; Mulcahy, D.M.; Tibbitts, T. Lee; Kentie, Rosemarie; Gerritsen, Gerrit J.; Bruinzeel, Leo W.; Tijssen, David C.; Harwood, Christopher M.; Piersma, Theunis

    Satellite telemetry has become a common technique to investigate avian life-histories, but whether such tagging will affect fitness is a critical unknown. In this study, we evaluate multi-year effects of implanted transmitters on migratory timing and reproductive performance in shorebirds.

  3. Design of an Omnidirectional Multibeam Transmitter for High-Speed Indoor Wireless Communications

    Directory of Open Access Journals (Sweden)

    Jaw-Luen Tang

    2010-01-01

    Full Text Available For future high speed indoor wireless communication, diffuse wireless optical communications offer more robust optical links against shadowing than line-of-sight links. However, their performance may be degraded by multipath dispersion arising from surface reflections. We have developed a multipath diffusive propagation model capable of providing channel impulse responses data. It is aimed to design and simulate any multibeam transmitter under a variety of indoor environments. In this paper, a multi-beam transmitter system associated with hemisphere structure is proposed to fight against the diverse effects of multipath distortion albeit, at the cost of increased laser power and cost. Simulation results of multiple impulse responses showed that this type of multi-beam transmitter can significantly improve the performance of BER suitable for high bit rate application. We present the performance and simulation results for both line-of-sight and diffuse link configurations. We propose a design of power radiation pattern for a transmitter in achieving uniform and full coverage of power distributions for diffuse indoor optical wireless systems.

  4. Conductive Polymer Microelectrodes for on-chip measurement of transmitter release from living cells

    DEFF Research Database (Denmark)

    Larsen, Simon Tylsgaard; Matteucci, Marco; Taboryski, Rafael J.

    2012-01-01

    In this paper, we present techniques to trap a group of neuronal cells (PC 12) close to band microelectrodes and quantitatively measure cellular transmitter release. Different trapping approaches were investigated including coating of electrodes by layers enhancing cell attachment and by pressure...

  5. Estimation of thermal transmittance based on temperature measurements with the application of perturbation numbers

    Science.gov (United States)

    Nowoświat, Artur; Skrzypczyk, Jerzy; Krause, Paweł; Steidl, Tomasz; Winkler-Skalna, Agnieszka

    2017-12-01

    Fast estimation of thermal transmittance based on temperature measurements is uncertain, and the obtained results can be burdened with a large error. Nevertheless, such attempts should be undertaken merely due to the fact that a precise measurement by means of heat flux measurements is not always possible in field conditions (resentment of the residents during the measurements carried out inside their living quarters), and the calculation methods do not allow for the nonlinearity of thermal insulation, heat bridges or other fragments of building envelope of diversified thermal conductivity. The present paper offers the estimation of thermal transmittance and internal surface resistance with the use of temperature measurements (in particular with the use of thermovision). The proposed method has been verified through tests carried out on a laboratory test stand built in the open space, subjected to the influence of real meteorological conditions. The present elaboration involves the estimation of thermal transmittance by means of temperature measurements. Basing on the mentioned estimation, the authors present correction coefficients which have impact on the estimation accuracy. Furthermore, in the final part of the paper, various types of disturbance were allowed for using perturbation numbers, and the introduced by the authors "credibility area of thermal transmittance estimation" was determined.

  6. Photonic chip based 1.28 Tbaud transmitter optimization and receiver OTDM demultiplexing

    DEFF Research Database (Denmark)

    Vo, T.D.; Hu, Hao; Galili, Michael

    2010-01-01

    We propose chip-based Tbaud processing for all-optical performance monitoring, switching and demultiplexing. We demonstrate the first transmitter optimization and receiver-end demultiplexing of 1.28 Tbit/s OOK signals. Both exploited Kerr nonlinearity in dispersion-engineered As$_2$S$_3$ planar...

  7. Low power wide spectrum optical transmitter using avalanche mode LEDs in SOI CMOS technology

    NARCIS (Netherlands)

    Agarwal, Vishal Vishal; Dutta, Satadal; Annema, Anne J.; Hueting, Raymond Josephus Engelbart; Steeneken, P.G.; Nauta, Bram

    2017-01-01

    This paper presents a low power monolithically integrated optical transmitter with avalanche mode light emitting diodes in a 140 nm silicon-on-insulator CMOS technology. Avalanche mode LEDs in silicon exhibit wide-spectrum electroluminescence (400 nm < λ < 850 nm), which has a significant overlap

  8. High-power multi-beam diode laser transmitter for a flash imaging lidar

    Science.gov (United States)

    Holmlund, Christer; Aitta, Petteri; Kivi, Sini; Mitikka, Risto; Tyni, Lauri; Heikkinen, Veli

    2013-10-01

    VTT Technical Research Centre of Finland is developing the transmitter for the "Flash Optical Sensor for TErrain Relative NAVigation" (FOSTERNAV) multi-beam flash imaging lidar. FOSTERNAV is a concept demonstrator for new guidance, navigation and control (GNC) technologies to fulfil the requirements for landing and docking of spacecraft as well as for navigation of rovers. This paper presents the design, realisation and testing of the multi-beam continuous-wave (CW) laser transmitter to be used in a 256x256 pixel flash imaging lidar. Depending on the target distance, the lidar has three operation modes using either several beams with low divergence or one single beam with a large divergence. This paper describes the transmitter part of the flash imaging lidar with focus on the electronics and especially the laser diode drivers. The transmitter contains eight fibre coupled commercial diode laser modules with a total peak optical power of 32 W at 808 nm. The main requirement for the laser diode drivers was linear modulation up to a frequency of 20 MHz allowing, for example, low distortion chirps or pseudorandom binary sequences. The laser modules contain the laser diode, a monitoring photodiode, a thermo-electric cooler, and a thermistor. The modules, designed for non-modulated and low-frequency operation, set challenging demands on the design of the drivers. Measurement results are presented on frequency response, and eye diagrams for pseudo-random binary sequences.

  9. Development of two transmitter release components during the critical period for imprinting in the chick IMHV.

    Science.gov (United States)

    Kiyosue, Kazuyuki; Shimabayashi, Eiko; Taguchi, Takahisa

    2002-10-01

    Transmitter release at an excitatory synapse has two components, fast synchronous and slow asynchronous transmitter release. Using the whole cell recording technique, we investigated the developmental properties of neurotransmitter release, which is composed of the two components in the intermediate and medial part of the hyperstriatum ventral (IMHV) of chicks during the critical period for imprinting. Analysis of the paired-pulse responses revealed that the depression of the excitatory postsynaptic currents (EPSCs), driven mainly by fast synchronous release, was frequently observed in P0-1 chicks but not in those at P5-8. The spontaneous excitatory postsynaptic currents (sEPSCs) after the paired-pulse stimulation, which were thought to be driven by asynchronous transmitter releases, were observed more frequently in P0-1 chicks than P5-8 chicks. Furthermore, examination of Ca2+ dependency in the evoked EPSCs showed that the amplitudes in P5-8 chicks were more sensitive to reduction of the extracellular Ca2+ concentration than younger chicks. Considering that the Ca2+ dependency of EPSCs is defined by both Ca2+ sensitivity and the proportion of each type of release machineries at the release site, these results indicate that the ratio of fast synchronous to slow asynchronous transmitter release machinery changed during the critical period. These changes may play critical roles in the capacity of the avian brain to consolidate novel experience in the immediate period after hatching.

  10. New Treatments for Drug-Resistant Epilepsy that Target Presynaptic Transmitter Release

    Science.gov (United States)

    2013-05-01

    Live cell imaging of mossy fiber boutons in acute hippocampal slices was done by bulk loading a group of granule cells and their axons with Alexa...whether post- SE leads to functional differences in transmitter release from excitatory mossy fiber boutons we utilized two-photon live cell imaging in

  11. Surface morphology of pre-stressed bilayer shells for tunable optical transmittance

    Science.gov (United States)

    Al-Rashed, Rashed; López Jiménez, Francisco; Marthelot, Joel; Lee, Anna; Reis, Pedro

    We introduce a new class of pre-stressed bilayer shells, whose surface morphology can be used to smoothly tune their optical transmittance by pneumatic actuation. Each sample is fabricated by pressurizing a disk made out of an optically clear silicone-based rubber to bulge it into a nearly hemispherical pre-strained shell. The surface of this shell is then taken as a substrate and coated with a thin layer of a polymer suspension with black micron-sized dye particles, which, upon curing, can make the samples opaque. The sample becomes planar when it is depressurized to remove the pre-strain, and its surface develops a complex topography that significantly affects its optical transmittance (i.e. the amount of light that passes through the sample). Re-pressurization of the samples allow for their transmittance to be smoothly tuned in a reversible manner. We explore the parameter space of the system by systematically varying its geometric and material properties. A phase diagram is then constructed where we characterize the transmittance of each of the surface patterns at varying levels of pre-strain.

  12. Breaking the Transmitter-Receiver Isolation Barrier in Mobile Handsets with Spatial Duplexing

    DEFF Research Database (Denmark)

    Alrabadi, Osama; Tatomirescu, Alexandru; Knudsen, Mikael

    2013-01-01

    In full-duplex radio communication systems like eUTRAN, CDMA-2000, the radio transmitter (Tx) is active at the same time as the radio receiver (Rx). The Tx and the Rx will be using separate dedicated frequency bands and the Tx-Rx isolation is ensured by duplex filters. However, agile duplexers...

  13. Reading Rooms of Russian Province in 1920s as Transmitters of Soviet Values

    Directory of Open Access Journals (Sweden)

    Vadim P. Nikolashin

    2014-12-01

    Full Text Available The article features regional aspects of reading room activities in the 1920s as transmitters of Soviet values. Authors analyze forms and methods of work of this type of socio-cultural institutions, study specifics of relationship of countrymen. The conducted analysis allows speaking about positive impact by reading rooms on evolution of a country life.

  14. An Embedded Web based Real Time Application for Remote Monitoring & Controlling of MST RADAR Transmitters

    Directory of Open Access Journals (Sweden)

    Nagabhushan Raju KONDURU

    2012-01-01

    Full Text Available An embedded web based radar transmitters control & interlock system is developed in the present work. This research activity facilitates controlling and monitoring 53-MHz, 2.5 Mega-watt peak power MST radar triode based transmitters via internet. This radar is a prime instrument for atmospheric science research with 32 transmitters powering 1024-element antenna array. A comprehensive safety interlock is built in to protect expensive devices; by sensing anode voltages, heater currents and airflow etc. It automatically prevents fatal damages by switching transmitter / RF off. The system is designed and developed using RISC microcontroller ARM LPC 2148 based on a 32- bit ARM7 TDMI-S CPU with real-time emulation and embedded trace support and 512 kB high speed flash memory. The microcontroller is a blend of serial communication interface, dual 10-bit ADC’s and fast GPIO. Ethernet controller LM3S6432 is used to send sensors’ digitalized data over internet.

  15. Effect of package light transmittance on the vitamin content of pasteurized whole milk

    NARCIS (Netherlands)

    Soffert, A.; Pieper, G.; Jetten, J.

    2006-01-01

    Pasteurized whole milk (3% fat) was stored under fluorescent light at 8°C in clear 1 litre polyethylene terephthalate (PET) bottles and three variants of pigmented PET bottles with different light transmittance. Changes in the vitamin content were monitored over a period of 10 days. Milk packed in

  16. Abdominally implanted satellite transmitters affect reproduction and survival rather than migration of large shorebirds

    NARCIS (Netherlands)

    Hooijmeijer, J.C.E.W.; Gill, R.E.; Mulcahy, D.M.; Tibbitts, T.L.; Kentie, R.; Gerritsen, G.J.; Bruinzeel, L.W.; Tijssen, D.C.; Harwood, C.M.; Piersma, T.

    2014-01-01

    Satellite telemetry has become a common technique to investigate avian life-histories, but whether such tagging will affect fitness is a critical unknown. In this study, we evaluate multi-year effects of implanted transmitters on migratory timing and reproductive performance in shorebirds.

  17. Development and testing of attachment methods for pop-up satellite archival transmitters in European eel

    DEFF Research Database (Denmark)

    Økland, Finn; Thorstad, Eva B.; Westerberg, Håkan

    2013-01-01

    Background Four methods for attaching pop-up satellite transmitters to European eel were tested in the laboratory by recording long-term tag retention, growth and survival; short-term behavioral responses; and physical damage from attachments. Results All eels survived until they lost their tag...

  18. 47 CFR 80.169 - Operators required to adjust transmitters or radar.

    Science.gov (United States)

    2010-10-01

    ... radar. 80.169 Section 80.169 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Requirements § 80.169 Operators required to adjust transmitters or radar. (a) All adjustments of radio... such equipment which may affect the proper operation of the station, must be performed by or under the...

  19. Topology optimised photonic crystal waveguide intersections with high-transmittance and low crosstalk

    DEFF Research Database (Denmark)

    Ikeda, N; Sugimoto, Y; Watanabe, Y

    2006-01-01

    Numerical and experimental studies on the photonic crystal waveguide intersection based on the topology optimisation design method are reported and the effectiveness of this technique is shown by achieving high transmittance spectra with low crosstalk for the straightforward beam-propagation line...

  20. 22 CFR 1423.26 - Transmittal of the Administrative Law Judge's decision to the Board; exceptions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Transmittal of the Administrative Law Judge's decision to the Board; exceptions. 1423.26 Section 1423.26 Foreign Relations FOREIGN SERVICE LABOR...; AND THE FOREIGN SERVICE IMPASSE DISPUTES PANEL FOREIGN SERVICE LABOR RELATIONS BOARD AND GENERAL...

  1. Spatial integration of local transmitter responses in motoneurones of the turtle spinal cord in vitro

    DEFF Research Database (Denmark)

    Skydsgaard, Morten Arnika; Hounsgaard, J

    1994-01-01

    1. Integration of responses to local activation of transmitter receptors in the dendrites of motoneurones was investigated in a slice preparation of the turtle spinal cord. Membrane-active substances were applied from up to three independent iontophoresis electrodes during intracellular recording...

  2. Measurement of the total solar energy transmittance (g-value) for conventional glazings

    DEFF Research Database (Denmark)

    Duer, Karsten

    1998-01-01

    Three different glazings have been investigated in the Danish experimental setup METSET. (A device for calorimetric measurement of total solar energy transmittance - g-value).The purpose of the measurements is to increase the confidence in the calorimetric measurements. This is done by comparison...

  3. Polarization-, carrier-, and format-selectable optical flow generation based on a multi-flow transmitter using passive polymers

    DEFF Research Database (Denmark)

    Katopodis, V.; Spyropoulou, M.; Tsokos, C.

    2016-01-01

    generation is feasible with appropriate distribution of the client data in the digital domain and encapsulation into OTN containers. Configuration of the electrical and optical transmitter resources is performed via a developed software defined optics (SDO) platform residing on top of the transmitter...

  4. 47 CFR 95.420 - (CB Rule 20) May I connect my CB station transmitter to a telephone?

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false (CB Rule 20) May I connect my CB station... Operate A Cb Station § 95.420 (CB Rule 20) May I connect my CB station transmitter to a telephone? (a) You may connect your CB station transmitter to a telephone if you comply with all of the following: (1...

  5. Comparing the survival rate of juvenile Chinook salmon migrating through hydropower systems using injectable and surgical acoustic transmitters

    Science.gov (United States)

    Deng, Z. D.; Martinez, J. J.; Li, H.; Harnish, R. A.; Woodley, C. M.; Hughes, J. A.; Li, X.; Fu, T.; Lu, J.; McMichael, G. A.; Weiland, M. A.; Eppard, M. B.; Skalski, J. R.; Townsend, R. L.

    2017-02-01

    Acoustic telemetry is one of the primary technologies for studying the behavior and survival of fishes throughout the world. The size and performance of the transmitter are key limiting factors. The newly developed injectable transmitter is the first acoustic transmitter that can be implanted via injection instead of surgery. A two-part field study was conducted to evaluate the performance of the injectable transmitter and its effect on the survival of implanted fish. The injectable transmitter performed well and similarly to the proceeding generation of commercially-available JSATS transmitters tested concurrently. Snake River subyearling Chinook salmon smolts implanted with the injectable transmitter had a higher survival probability from release to each of eleven downstream detection arrays, because reach-specific survival estimates were significantly higher for the injectable group in three of the eleven reaches examined. Overall, the injectable group had a 0.263 (SE = 0.017) survival probability over the entire 500 km study area compared to 0.199 (0.012) for the surgically implanted group. The reduction in size and ability to implant the new transmitter via injection has reduced the tag or tagging effect bias associated with studying small fishes. The information gathered with this new technology is helping to evaluate the impacts of dams on fishes.

  6. A new topology and control method for electromagnetic transmitter power supplies

    Science.gov (United States)

    Zhang, Yiming; Zhang, Jialin; Yuan, Dakang

    2017-04-01

    As essential equipment for electromagnetic exploration, electromagnetic transmitter reverse the steady power supply with desired frequency and transmit the power through grounding electrodes. To obtain effective geophysical data during deep exploration, the transmitter needs to be high-voltage, high-current, with high-accuracy output, and yet compact and light. The researches on the power supply technologies for high-voltage high-power electromagnetic transmitter is of significant importance to the deep geophysical explorations. Therefore, the performance of electromagnetic transmitter is mainly subject to the following two aspects: the performance of emission current and voltage, and the power density. These requirements bring technical difficulties to the development of power supplies. Conventionally, high-frequency switching power supplies are applied in the design of a high-power transmitter power supply. However, the structure of the topology is complicate, which may reduce the controllability of the output voltage and the reliability of the system. Without power factor control, the power factor of the structure is relatively low. Moreover high switching frequency causes high loss. With the development of the PWM (pulse width modulation) technique, its merits of simple structure, low loss, convenient control and unit power factor have made it popular in electrical energy feedback, active filter, and power factor compensation. Studies have shown that using PWM converters and space vector modulation have become the trend in designing transmitter power supply. However, the earth load exhibits different impedances at different frequencies. Thus ensuing high-accuracy and a stable output from a transmitter power supply in harsh environment has become a key topic in the design of geophysical exploration instruments. Based on SVPWM technology, an electromagnetic transmitter power supply has been designed and its control strategy has been studied. The transmitting

  7. Transmittance and reflectance of crystalline quartz and highand low-water content fused silica from 2 microns to 1 mm

    Science.gov (United States)

    Heaney, J. B.; Stewart, K. P.; Hass, G.

    1983-01-01

    The transmittances and reflectances of cultured crystalline quartz, Suprasil, Suprasil W, and Infrasil were compared over the wavelength region from 2 to 1000 microns. The high-water content of Suprasil and the low-water content of cultured crystalline quartz, Suprasil W, and Infrasil were determined by their transmittances measured at 2.73 microns where water content causes high absorption in optical materials. The fact that the fused silicas, both with high- and low-water content, had identical far-IR transmittances and that their transmittances were greatly inferior to that of crystalline quartz led to the conclusion that their inferior transmittance is due to their amorphous structure and not to their water content.

  8. Changes in ultraviolet transmittance of hydrogel and silicone-hydrogel contact lenses induced by wear.

    Science.gov (United States)

    Osuagwu, Uchechukwu L; Ogbuehi, Kelechi C; Almubrad, Turki M

    2014-01-01

    To evaluate the ultraviolet (UV) transmittance spectra of different contact lenses and assess the effect of wear on UV transmittance values and ocular protection factor (PF). Transmittance in the UV range (200-400 nm) of 216 contact lenses was measured before and after wear, using a spectrophotometer. The contact lenses used were ACUVUE TruEye, ACUVUE MOIST, ACUVUE OASYS, ACUVUE 2, ACUVUE DEFINE, DAILIES AquaComfort Plus, AIR OPTIX for astigmatism, FreshLook ONE-DAY lens, and Neo Cosmo. This study indicates that the following contact lenses transmitted less than the American National Standards Institute (ANSI) of 5% or less of UVB: ACUVUE DEFINE, ACUVUE MOIST, ACUVUE 2, ACUVUE TruEye, and ACUVUE OASYS. All lenses also met the ANSI standard of less than 30% transmittance of UVA except for AquaComfort Plus, AIR OPTIX for astigmatism, and Neo Cosmo. FreshLook meets the UVA transmission standard but fell short of the UVB transmission standard by 3%. FreshLook and ACUVUE MOIST had the highest calculated PF (3.9) of the hydrogel group and were unaffected after wear. Of the silicone-hydrogels (SiHs), the PF for AIR OPTIX for astigmatism was the highest (10.6) before wear and increased after wear to a PF of 13.3. The results also show that, for the UVC region, significant differences exist in transmittance values before and after wear of all SiH lenses and all hydrogel lenses, except for Neo Cosmo. FreshLook and Neo Cosmo were the only lenses that showed no statistically significant differences in the UVA transmittance after wear. Ultraviolet-blocking contact lenses were effective in blocking ultraviolet radiation to safe levels recommended by ANSI, whereas non-UV blockers such as AquaComfort Plus and AIR OPTIX for astigmatism also showed UV-attenuation capabilities greater than the values previously reported. The Neo Cosmo contact lens transmitted greater than 86% UVB and 89% UVA, making it unsuitable for UV protection seekers. Transmission is modified after contact lens

  9. 47 CFR 95.217 - (R/C Rule 17) May I operate my R/C station transmitter by remote control?

    Science.gov (United States)

    2010-10-01

    ... records. See R/C Rule 24, § 95.224. (c) Remote control means operation of an R/C transmitter from any place other than the location of the R/C transmitter. Direct mechanical control or direct electrical control by wire from some point on the same premises, craft or vehicles as the R/C transmitter is not...

  10. Acoustic characterization of high intensity focused ultrasound field generated from a transmitter with large aperture

    Science.gov (United States)

    Fan, Tingbo; Chen, Tao; Zhang, Wei; Hu, Jimin; Zhang, Yichuan; Zhang, Dong

    2017-03-01

    A combined experiment and simulation method was utilized to characterize the acoustic field generated from a strong focused HIFU transmitter. The nonlinear sound propagation was described by the spheroidal beam equation (SBE). The relationship between the source pressure amplitude and excitation voltage was determined by fitting the measured ratio of the second harmonic to the fundamental component of the focal waveform to the simulation result; then the acoustic pressure field generated by the strong focused transducer was predicted by using the SBE model. A commercial fiber optic probe hydrophone (FOPH) was utilized to measure the acoustic pressure field generated from a 1.1 MHz HIFU transmitter with a half aperture angle of 30°. The validity of this combined approach was confirmed by the comparison between the measured results and the calculated ones. The results show that the current approach might be useful to describe the HIFU field.

  11. CMOS highly linear direct-conversion transmitter for WCDMA with fine gain accuracy

    Energy Technology Data Exchange (ETDEWEB)

    Li Xin; Fu Jian; Huang Yumei; Hong Zhiliang, E-mail: yumeihuang@fudan.edu.cn [State Key Laboratory of ASIC and System, Fudan University, Shanghai 201203 (China)

    2011-08-15

    A highly linear, high output power, 0.13 {mu}m CMOS direct conversion transmitter for wideband code division multiple access (WCDMA) is described. The transmitter delivers 6.8 dBm output power with 38 mA current consumption. With careful design on the resistor bank in the IQ-modulator, the gain step accuracy is within 0.1 dB, hence the image rejection ratio can be kept below -47 dBc for the entire output range. The adjacent channel leakage ratio and the LO leakage at 6.8 dBm output power are -44 dBc - 5 MHz and -37 dBc, respectively, and the corresponding EVM is 3.6%. The overall gain can be programmed in 6 dB steps in a 66-dB range.

  12. CMOS highly linear direct-conversion transmitter for WCDMA with fine gain accuracy

    Science.gov (United States)

    Xin, Li; Jian, Fu; Yumei, Huang; Zhiliang, Hong

    2011-08-01

    A highly linear, high output power, 0.13 μm CMOS direct conversion transmitter for wideband code division multiple access (WCDMA) is described. The transmitter delivers 6.8 dBm output power with 38 mA current consumption. With careful design on the resistor bank in the IQ-modulator, the gain step accuracy is within 0.1 dB, hence the image rejection ratio can be kept below -47 dBc for the entire output range. The adjacent channel leakage ratio and the LO leakage at 6.8 dBm output power are -44 dBc @ 5 MHz and -37 dBc, respectively, and the corresponding EVM is 3.6%. The overall gain can be programmed in 6 dB steps in a 66-dB range.

  13. Transmittance and Reflectance Spectra of Doped-Polyanisidine-Derived Film in the Visible Light Region

    Energy Technology Data Exchange (ETDEWEB)

    Tapia, A K G [Physics Divisio, Institute of Mathematical Sciences and Physics and University of the Philippines Los Banos, College, Laguna, Philippines, 4031 (Philippines); Catedral, M D [Physics Divisio, Institute of Mathematical Sciences and Physics and University of the Philippines Los Banos, College, Laguna, Philippines, 4031 (Philippines); Herrera, M U [Physics Divisio, Institute of Mathematical Sciences and Physics and University of the Philippines Los Banos, College, Laguna, Philippines, 4031 (Philippines); Tamayo, J P [Institute of Chemistry, University of the Philippines Los Banos, College, Laguna, Philippines, 4031 (Philippines); Rosario, E J R del [Institute of Chemistry, University of the Philippines Los Banos, College, Laguna, Philippines, 4031 (Philippines)

    2006-01-01

    Polyanisidine (PAnis) powder was synthesized using a standard procedure. It was doped with Hydrochloric (HCl) and Perchloric (HClO{sub 4}) Acids. The air-dried PAnis powder was then diluted using Dimethyl Formamide (DMF) as solvent and was spread out in a SiOx transparent glass substrate. An amorphous and semi-transparent film was fabricated seen in a polarizing microscope. The spectral analysis was carried out in the visible region from 400 nm to 700 nm. For HCl-doped sample, the high intensity region in the transmittance spectra occurred at the green portion while the high intensity region for the reflectance spectra was seen at the violet portion. Lastly, for the HClO4-doped sample, the peak intensities are at 536 nm and 516 nm for the transmittance and the reflectance spectra, respectively.

  14. Colourless adaptively modulated optical OFDM transmitters using SOAs as intensity modulators.

    Science.gov (United States)

    Wei, J L; Yang, X L; Giddings, R P; Tang, J M

    2009-05-25

    The wavelength dependent transmission performance of adaptively modulated optical OFDM (AMOOFDM) signals is investigated, for the first time, over optical amplification- and chromatic dispersion compensation-free IMDD SMF systems using semiconductor optical amplifiers (SOAs) as intensity modulators. A theoretical SOA model describing both optical gain saturation and gain spectral dynamics is developed, based on which optimum SOA operating conditions are identified for various wavelengths varying in a broad range of 1510 nm- 1590 nm. Results show that, SOA intensity modulators operating at the identified optimum conditions enable the realization of colourless AMOOFDM transmitters within the aforementioned wavelength window. Such transmitters are capable of supporting >30 Gb/s signal transmission over 60 km SMFs.

  15. Biomonitoring of estrogen and melatonin metabolites among women residing near radio and television broadcasting transmitters.

    Science.gov (United States)

    Clark, Maggie L; Burch, James B; Yost, Michael G; Zhai, Yusheng; Bachand, Annette M; Fitzpatrick, Cole T E; Ramaprasad, Jaya; Cragin, Lori A; Reif, John S

    2007-10-01

    Metabolites of estrogen (estrone-3-glucuronide [E1G]) and melatonin (6-hydroxymelatonin sulfate [6-OHMS]) were characterized among women living in a community with increased radiofrequency (RF) exposure from radio and television transmitters. RF spot measurements, and personal 60-Hz magnetic field and residential parameters were collected. Overnight urine samples were assayed for E1G and 6-OHMS excretion. Among premenopausal women, there were no associations between RF or 60-Hz nonionizing radiation and E1G or 6-OHMS excretion. Among postmenopausal women, increased residential RF exposures, transmitter proximity and visibility, and temporally stable 60-Hz exposures were significantly associated with increased E1G excretion. This association was strongest among postmenopausal women with low overnight 6-OHMS levels. RF and temporally stable 60-Hz exposures were associated with increased E1G excretion among postmenopausal women. Women with reduced nocturnal 6-OHMS excretion may represent a sensitive subgroup.

  16. FDTD simulation of transmittance characteristics of one-dimensional conducting electrodes.

    Science.gov (United States)

    Lee, Kilbock; Song, Seok Ho; Ahn, Jinho

    2014-03-24

    We investigated transparent conducting electrodes consisting of periodic one-dimensional Ag or Al grids with widths from 25 nm to 5 μm via the finite-difference time-domain method. To retain high transmittance, two grid configurations with opening ratios of 90% and 95% were simulated. Polarization-dependent characteristics of the transmission spectra revealed that the overall transmittance of micron-scale grid electrodes may be estimated by the sum of light power passing through the uncovered area and the light power penetrating the covered metal layer. However, several dominant physical phenomena significantly affect the transmission spectra of the nanoscale grids: Rayleigh anomaly, transmission decay in TE polarized mode, and localized surface plasmon resonance. We conclude that, for applications of transparent electrodes, the critical feature sizes of conducting 1D grids should not be less than the wavelength scale in order to maintain uniform and predictable transmission spectra and low electrical resistivity.

  17. Effect of wet etching process on the morphology and transmittance of fluorine doped tin oxide (FTO)

    Science.gov (United States)

    Triana, S. L.; Kusumandari; Suryana, R.

    2016-11-01

    Wet etching process was performed on the surface of FTO. The FTO coated glasses subtrates with size of 2×2 cm covered by screen were patterned using zinc powder and concentrated hydrochloric acid (1 M). The substrates were then cleaned in ultrasonic baths of special detergent(helmanex) diluted in deionized water and isopropanol in sequence. The screens with various of hole size denotes by T32, T49 and T55 were used in order to create a pattern of surface textured. The atomic force microscopy (AFM) image revealed that wet etching process changes the morphology of FTO. It indicates that texturization occured. Moreover, from the UV-Vis Spectrophotometer measurement, the transmittance of FTO increase after wet etching process. The time of etching and pattern of screen were affect to the morphology and the transmittance of FTO.

  18. High Performance Design of 100Gb/s DPSK Optical Transmitter

    DEFF Research Database (Denmark)

    Das, Bhagwan; Abdullah, M.F.L; Shah, Nor Shahihda Mohd

    2016-01-01

    High performance communication systems require high performance devices for exchanging information at a faster rate. These devices are experiencing several challenges e.g. bandwidth limitations, power limitations, design limitations and etc. The existing techniques are lacking in providing high...... performance output simultaneously by maintaining actual parameters of device. In this work, high performance 100Gb/s optical DPSK transmitter design is realized in Field Programming Gate (FPGA) using time constraint technique. Before applying the proposed technique actual FPGA’s frequency was 0.2 GHz....... This high performance design of optical transmitter has zero timing error, low timing score and high slack time due to synchronization between input data and clock frequency. It is also determined that 99% timing score is reduced in comparison with 1 GHz frequency that has high jitters, high timing error...

  19. The exploratory development of a high power S-band solid state radar transmitter

    Science.gov (United States)

    Hay, J. D.; Kerstenbeck, E. A.; Rahn, D. G.; Halayko, D. W.; Painchaud, G. R.

    A solid-state power amplifier has been developed using 100-W S-band silicon bipolar transistors. The amplifier produces a nominal 400-W peak output power from 2.7 GHz to 3.0 GHz, at pulse widths up to 50 microsec, at a 10 percent maximum duty cycle and 30 percent efficiency. A high-power planar hybrid combiner was also designed to combine 16 amplifiers to provide a nominal 5-kW RF output power. The isolation between combining ports ensures graceful degradation of output power should individual amplifier modules fail, and allows replacement of the modules during transmitter operation. Higher output powers can be achieved by adding more combining ports to the design or by incorporating a second stage of combining to sum the outputs from several 16-way combiners. The feasibility of solid-state radar transmitter technology at S-band is confirmed.

  20. Determination and application of location and angular orientation of a pill transmitter within a body

    Science.gov (United States)

    Schipper, John F. (Inventor)

    2009-01-01

    A mobile pill transmitter system that moves through or adjacent to one or more organs in an animal's body and that provides signals from which the pill's present location and/or present angular orientation can be determined. The system also provides signals from which the present roll angle of the pill, about a selected axis, can be determined. When the location coordinates and the roll angle of the pill are within selected ranges, an aperture on the pill container releases a selected chemical into or onto the body. Optionally, the pill as it moves also provides a sequence of visually perceptible images; the times for image formation may correspond to times at which the pill transmitter system location or image satisfies one or at least four different criteria.

  1. A Low-Noise Delta-Sigma Phase Modulator for Polar Transmitters

    Directory of Open Access Journals (Sweden)

    Bo Zhou

    2014-01-01

    Full Text Available A low-noise phase modulator, using finite-impulse-response (FIR filtering embedded delta-sigma (ΔΣ fractional-N phase-locked loop (PLL, is fabricated in 0.18 μm CMOS for GSM/EDGE polar transmitters. A simplified digital compensation filter with inverse-FIR and -PLL features is proposed to trade off the transmitter noise and linearity. Experimental results show that the presented architecture performs RF phase modulation well with 20 mW power dissipation from 1.6 V supply and achieves the root-mean-square (rms and peak phase errors of 4° and 8.5°, respectively. The measured and simulated phase noises of −104 dBc/Hz and −120 dBc/Hz at 400-kHz offset from 1.8-GHz carrier frequency are observed, respectively.

  2. A low-noise delta-sigma phase modulator for polar transmitters.

    Science.gov (United States)

    Zhou, Bo

    2014-01-01

    A low-noise phase modulator, using finite-impulse-response (FIR) filtering embedded delta-sigma (ΔΣ) fractional-N phase-locked loop (PLL), is fabricated in 0.18 μ m CMOS for GSM/EDGE polar transmitters. A simplified digital compensation filter with inverse-FIR and -PLL features is proposed to trade off the transmitter noise and linearity. Experimental results show that the presented architecture performs RF phase modulation well with 20 mW power dissipation from 1.6 V supply and achieves the root-mean-square (rms) and peak phase errors of 4° and 8.5°, respectively. The measured and simulated phase noises of -104 dBc/Hz and -120 dBc/Hz at 400-kHz offset from 1.8-GHz carrier frequency are observed, respectively.

  3. A method of reconstructing the spatial measurement network by mobile measurement transmitter for shipbuilding

    Science.gov (United States)

    Guo, Siyang; Lin, Jiarui; Yang, Linghui; Ren, Yongjie; Guo, Yin

    2017-07-01

    The workshop Measurement Position System (wMPS) is a distributed measurement system which is suitable for the large-scale metrology. However, there are some inevitable measurement problems in the shipbuilding industry, such as the restriction by obstacles and limited measurement range. To deal with these factors, this paper presents a method of reconstructing the spatial measurement network by mobile transmitter. A high-precision coordinate control network with more than six target points is established. The mobile measuring transmitter can be added into the measurement network using this coordinate control network with the spatial resection method. This method reconstructs the measurement network and broadens the measurement scope efficiently. To verify this method, two comparison experiments are designed with the laser tracker as the reference. The results demonstrate that the accuracy of point-to-point length is better than 0.4mm and the accuracy of coordinate measurement is better than 0.6mm.

  4. A standard operating procedure for the surgical implantation of transmitters in juvenile salmonids

    Science.gov (United States)

    Liedtke, T.L.; Beeman, J.W.; Gee, L.P.

    2012-01-01

    Biotelemetry is a useful tool to monitor the movements of animals and is widely applied in fisheries research. Radio or acoustic technology can be used, depending on the study design and the environmental conditions in the study area. A broad definition of telemetry also includes the use of Passive Integrated Transponder (PIT) tags, either separately or with a radio or acoustic transmitter. To use telemetry, fish must be equipped with a transmitter. Although there are several attachment procedures available, surgical implantation of transmitters in the abdominal cavity is recognized as the best technique for long-term telemetry studies in general (Stasko and Pincock, 1977; Winter, 1996; Jepsen, 2003), and specifically for juvenile salmonids, Oncorhynchus spp. (Adams and others, 1998a, 1998b; Martinelli and others, 1998; Hall and others, 2009). Studies that use telemetry assume that the processes by which the animals are captured, handled, and tagged, as well as the act of carrying the transmitter, will have minimal effect on their behavior and performance. This assumption, commonly stated as a lack of transmitter effects, must be valid if telemetry studies are to describe accurately the movements and behavior of an entire population of interest, rather than the subset of that population that carries transmitters. This document describes a standard operating procedure (SOP) for surgical implantation of radio or acoustic transmitters in juvenile salmonids. The procedures were developed from a broad base of published information, laboratory experiments, and practical experience in tagging thousands of fish for numerous studies of juvenile salmon movements near Columbia River and Snake River hydroelectric dams. Staff from the Western Fisheries Research Center's Columbia River Research Laboratory (CRRL) frequently have used telemetry studies to evaluate new structures or operations at hydroelectric dams in the Columbia River Basin, and these evaluations typically

  5. Reception of ELF transmitter signals at Moshiri, Japan, and their propagation characteristics

    Science.gov (United States)

    Yano, M.; Ida, Y.; Hobara, Y.; Hayakawa, M.; Nickolaenko, A. P.

    2010-02-01

    Measurements are described of 82 Hz radio signals arriving from the Russian ELF transmitter located on the Kola Peninsula, Russia. We used two orthogonal calibrated horizontal magnetic field sensors and a vertical electric antenna at the Moshiri observatory, Hokkaido (geographic coordinates; 44.4°N, 142.2°E). Several propagation characteristics were studied: (1) signal amplitude and its variations on diurnal and seasonal scales, (2) phase difference between the two horizontal magnetic field components (wave polarization), and (3) wave arrival angle. The amplitude detected was compared with early published data, showing a good agreement. We estimated the source current moment of the transmitter by comparing our experimental amplitude with theoretical computations. This 82 Hz signal field is found to be linearly polarized, which allowed for the goniometric finding of source bearing. The arrival azimuth is consistent with the geometry of the experiment.

  6. Development of Instrument Transmitter Protecting Device against High-Temperature Condition during Severe Accidents

    Directory of Open Access Journals (Sweden)

    Min Yoo

    2014-01-01

    Full Text Available Reliable information through instrumentation systems is essential in mitigating severe accidents such as the one that occurred at the Fukushima Daiichi nuclear power plant. There are five elements which might pose a potential threat to the reliability of parameter detection at nuclear power plants during a severe accident: high temperature, high pressure, high humidity, high radiation, and missiles generated during the evolution of a severe accident. Of these, high temperature apparently poses the most serious threat, since thin shielding can get rid of pressure, humidity, radiation (specifically, alpha and beta radiations, and missile effects. In view of this fact, our study focused on designing an instrument transmitter protecting device that can eliminate the high-temperature effect on transmitters to maintain their functional integrity. We present herein a novel concept for designing such a device in terms of heat transfer model that takes into account various heat transfer mechanisms associated with the device.

  7. Optimal Analytical Solution for a Capacitive Wireless Power Transfer System with One Transmitter and Two Receivers

    Directory of Open Access Journals (Sweden)

    Ben Minnaert

    2017-09-01

    Full Text Available Wireless power transfer from one transmitter to multiple receivers through inductive coupling is slowly entering the market. However, for certain applications, capacitive wireless power transfer (CWPT using electric coupling might be preferable. In this work, we determine closed-form expressions for a CWPT system with one transmitter and two receivers. We determine the optimal solution for two design requirements: (i maximum power transfer, and (ii maximum system efficiency. We derive the optimal loads and provide the analytical expressions for the efficiency and power. We show that the optimal load conductances for the maximum power configuration are always larger than for the maximum efficiency configuration. Furthermore, it is demonstrated that if the receivers are coupled, this can be compensated for by introducing susceptances that have the same value for both configurations. Finally, we numerically verify our results. We illustrate the similarities to the inductive wireless power transfer (IWPT solution and find that the same, but dual, expressions apply.

  8. CMOS 60-GHz and E-band power amplifiers and transmitters

    CERN Document Server

    Zhao, Dixian

    2015-01-01

    This book focuses on the development of design techniques and methodologies for 60-GHz and E-band power amplifiers and transmitters at device, circuit and layout levels. The authors show the recent development of millimeter-wave design techniques, especially of power amplifiers and transmitters, and presents novel design concepts, such as “power transistor layout” and “4-way parallel-series power combiner”, that can enhance the output power and efficiency of power amplifiers in a compact silicon area. Five state-of-the-art 60-GHz and E-band designs with measured results are demonstrated to prove the effectiveness of the design concepts and hands-on methodologies presented. This book serves as a valuable reference for circuit designers to develop millimeter-wave building blocks for future 5G applications.

  9. The variability of the occurrence of the Field Aligned Irregularities in the middle-latitude F region using the VHF radar observation at Daejon, South Korea.

    Science.gov (United States)

    Oh, S. J.; Kil, H.; Tae-yong, Y.; Kwak, Y. S.; Lee, W. K.

    2016-12-01

    The VHF radar observations at Daejeon in South Korea reveal the highly variable nature of the field-aligned irregularities (FAIs) in the middle-latitude F-region. Medium-scale travelling ionospheric disturbances (MSTIDs) are suggested as the source of FAIs, however, the occurrence climatology of the FAIs cannot be fully explained by the existence of the MSTIDs. Moreover, the occurrence climatology of the FAIs with respect to local time (pre-midnight and post-midnight) likely to have separate onset mechanisms. We investigate the role of the ionospheric disturbances(MSTIDs, Equatorial Plasma Bubbles(EPBs)) in the creation of the FAIs using the radar data at Daejon , the total electron content maps over Japan acquired during 2010-2015. and the measurements of the ion density by Swarm (2014,2015). We assess the causal linkage of the occurrence of the FAIs by examining the correlative occurrence of MSTIDs in middle latitude F-region and EPB in low latitude F-region.

  10. Observations of VHF emissions from 50-mA electron beam injections in the ionosphere that are associated with beam-induced discharges

    Science.gov (United States)

    Goerke, R. T.; Kellogg, P. J.; Monson, S. J.; Franz, R. C.; Nemzek, R. J.; Anderson, H. R.; Potter, D. W.; Denig, W. F.; Szuszczewicz, E. P.; Earle, G. D.

    1992-01-01

    Results are presented of observations of strong VHF plasma waves with amplitudes in excess of 0.1 mV/m (Hz)1/2 associated with 50 mA electron beam injections in the ionosphere. Data from three swept-frequency receivers carried on two daughter payloads are analyzed to determine the emission spectra of the electron beam for various energies and currents. These results were obtained from the rocket-borne experiment SCEX 3, NASA flight 39.002 UE, launched February 1, 1990. The accelerator payload also carried photometers, which measured luminosity at wavelengths of 391.4 and 380.5 nm. Several times during electron gun activity the measured luminosity increased much faster than proportional to the beam current. This nonlinear increase is evidence that a discharge is occurring in the vicinity of the accelerator payload. It is inferred from the uniform distribution of the luminosity around the accelerator payload that the observed discharge extends significantly outside the beam cylinder.

  11. Impact of light transmittance mode on polymerisation kinetics in bulk-fill resin-based composites.

    Science.gov (United States)

    Ilie, Nicoleta

    2017-08-01

    to determine the mode of light transmission and its impact on the polymerisation kinetic in modern bulk-fill resin-based composites (B-RBC). Four low-viscosity methacrylate-based and one high-viscosity ormocer-based B-RBCs were considered. One material was available in three different shades that were all analyzed. Polymerization kinetic and light transmittance were assessed in 2 and 4mm specimen depths. Incident and transmitted irradiance and radiant exposure were measured in real-time on a laboratory-grade spectrometer. A progressive enhanced light transmittance during polymerisation was identified in all materials except for TetricEvoFlow BulkFill, which became progressively opaque in all shades. One-way ANOVA and multivariate analysis (α=0.05) were performed. The parameter material has a significant (p0.95), differentiating between the gel- and the glass-phase and revealing a faster initiation of polymerization and a slower transition into the glass-phase by lowering the filler volume. Depth retarded the transition into the glass-phase, but did not alter DC measured 300s post-irradiation. Moderate inverse correlation was identified among DC and filler volume% (-0.646) or filler weight% (-0.403), while no correlation among DC and light transmittance (p=0.141; 0.125). The maximal rate of carbon-carbon double bond conversion varied within the analyzed materials but was independent from specimen's depths. Light transmission changes during polymerization do not alter polymerization kinetics in modern B-RBCs. DC 300s post-irradiation was maintained with depth, while light was attenuated, the faster the more translucent the material was. DC and quality of curing cannot be related to light transmittance in B-RBCs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Self-similar optical transmittance for a deterministic aperiodic multilayer structure

    Science.gov (United States)

    Saldaña, X. I.; López-Cruz, E.; Contreras-Solorio, D. A.

    2009-04-01

    We study theoretically the spectral transmission properties of a multilayer structure in which the refractive index of the layers follows a self-similar arithmetical sequence named 'The 1s-counting sequence', which is related to the Pascal's triangle. The transmittance spectrum is intermediate between that of a periodic structure and that of a random structure, and shows clearly properties of scaling and self-similarity for all incident angles and TE and TM polarizations.

  13. High optical transmittance of aluminum ultrathin film with hexagonal nanohole arrays as transparent electrode

    KAUST Repository

    Du, Qing Guo

    2016-02-24

    We fabricate samples of aluminum ultrathin films with hexagonal nanohole arrays and characterize the transmission performance. High optical transmittance larger than 60% over a broad wavelength range from 430 nm to 750 nm is attained experimentally. The Fano-type resonance of the excited surface plasmon plaritons and the directly transmitted light attribute to both of the broadband transmission enhancement and the transmission suppression dips. © 2016 Optical Society of America.

  14. Evaluation of Emergency-Locator-Transmitter performance in real and simulated crash tests

    Science.gov (United States)

    Carden, H. D.

    1981-01-01

    Emergency locator transmitter (ELT) activation problems were investigated by testing a sampling of ELT units in actual crashes and in a special test apparatus which simulated longitudinal crash pulses with superimposed local structural resonances. The probable causes of excessive false alarms and nonactivation of ELT's during crash situations were determined. Solutions to operational and technical problems were also examined as well as the sensitivity of ELT impact switches to orientation and to local structural vibrations.

  15. Evidence that dorsally mounted satellite transmitters affect migration chronology of Northern Pintails

    Science.gov (United States)

    Hupp, Jerry; Kharitonov, Sergei; Yamaguchi, Noriyuki M.; Ozaki, K.; Flint, Paul L.; Pearce, John M.; Tokita, Ken-ichi; Shimada, Tetsuo; Higuchi, Hiroyoshi

    2015-01-01

    We compared migration movements and chronology between Northern Pintails (Anas acuta) marked with dorsally mounted satellite transmitters and pintails marked only with tarsus rings. During weekly intervals of spring and autumn migration between their wintering area in Japan and nesting areas in Russia, the mean distance that ringed pintails had migrated was up to 1000 km farther than the mean distance radiomarked pintails migrated. Radiomarked pintails were detected at spring migration sites on average 9.9 days (90 % CI 8.0, 11.8) later than ringed pintails that were recovered within 50 km. Although ringed and radiomarked pintails departed from Japan on similar dates, the disparity in detection of radiomarked versus ringed pintails at shared sites increased 7.7 days (90 % CI 5.2, 10.2) for each 1000 km increase in distance from Japan. Thus, pintails marked with satellite transmitters arrived at nesting areas that were 2500 km from Japan on average 19 days later than ringed birds. Radiomarked pintails were detected at autumn migration stopovers on average 13.1 days (90 % CI 9.8, 16.4) later than ringed birds that were recovered within 50 km. We hypothesize that dorsal attachment of 12–20 g satellite transmitters to Northern Pintails increased the energetic cost of flight, which resulted in more rapid depletion of energetic reserves and shortened the distance pintails could fly without refueling. Radiomarked pintails may have used more stopovers or spent longer periods at stopovers. causing their migration schedule to diverge from ringed pintails. We urge further evaluation of the effects of dorsally mounted transmitters on migration chronology of waterfowl.

  16. Wavelength locking of silicon photonics multiplexer for DML-based WDM transmitter

    OpenAIRE

    Grillanda, Stefano; Ji, Ruiqiang; Morichetti, Francesco; Carminati, Marco; Ferrari, Giorgio; Guglielmi, Emanuele; Peserico, Nicola; Annoni, Andrea; Dede, Alberto; Nicolato, Danilo; Vannucci, Antonello; Klitis, Charalambos; Holmes, Barry; Sorel, Marc; Fu, Shengmeng

    2017-01-01

    We present a wavelength locking platform enabling the feedback control of silicon (Si) microring resonators (MRRs) for the realization of a 4 × 10 Gb/s wavelength-division-multiplexing (WDM) transmitter. Four thermally tunable Si MRRs are employed to multiplex the signals generated by four directly modulated lasers (DMLs) operating in the L-band, as well as to improve the quality of the DMLs signals. Feedback control is achieved through a field-programmable gate array controller by monitoring...

  17. A Preliminary Study on Light Transmittance Properties of Translucent Concrete Panels with Coarse Waste Glass Inclusions

    OpenAIRE

    Lo Verso, Valerio Roberto Maria; Torta, Annalisa; Pagliolico, Simonetta Lucia

    2015-01-01

    This paper investigates the potential reuse of coarse glass wastes as insert in a high performance cement matrix to produce translucent concrete panels for architectural applications such as interior walls. The effects of the addition of glass scraps on chemical and optical properties of concrete were studied. Alkali-silica reactivity resistance tests were carried out to evaluate the reactivity between amorphous waste glass and alkaline concrete pore solution. Light transmittance LT was evalu...

  18. Simultaneous Localization and Mapping in Multipath Environments: Mapping and Reusing of Virtual Transmitters

    OpenAIRE

    Gentner, Christian; Ma, Boxiao; Pöhlmann, Robert; Jost, Thomas; Dammann, Armin

    2016-01-01

    Channel-SLAM is an algorithm which uses multipath propagation for positioning and treats multipath components (MPCs) as line-of-sight (LoS) signals originated from virtual transmitters (VTs). To use the information of the MPCs, Channel-SLAM estimates the receiver position and the position of the VTs simultaneously using simultaneous localization and mapping (SLAM) and does not require any prior information such as room-layout or a database for fingerprinting. This paper investigates mapping, ...

  19. Optical fiber ultrasound transmitter with electrospun carbon nanotube-polymer composite

    Science.gov (United States)

    Poduval, Radhika K.; Noimark, Sacha; Colchester, Richard J.; Macdonald, Thomas J.; Parkin, Ivan P.; Desjardins, Adrien E.; Papakonstantinou, Ioannis

    2017-05-01

    All-optical ultrasound transducers are promising for imaging applications in minimally invasive surgery. In these devices, ultrasound is transmitted and received through laser modulation, and they can be readily miniaturized using optical fibers for light delivery. Here, we report optical ultrasound transmitters fabricated by electrospinning an absorbing polymer composite directly onto the end-face of optical fibers. The composite coating consisting of an aqueous dispersion of multi-walled carbon nanotubes (MWCNTs) in polyvinyl alcohol was directly electrospun onto the cleaved surface of a multimode optical fiber and subsequently dip-coated with polydimethylsiloxane (PDMS). This formed a uniform nanofibrous absorbing mesh over the optical fiber end-face wherein the constituent MWCNTs were aligned preferentially along individual nanofibers. Infiltration of the PDMS through this nanofibrous mesh onto the underlying substrate was observed and the resulting composites exhibited high optical absorption (>97%). Thickness control from 2.3 μm to 41.4 μm was obtained by varying the electrospinning time. Under laser excitation with 11 μJ pulse energy, ultrasound pressures of 1.59 MPa were achieved at 1.5 mm from the coatings. On comparing the electrospun ultrasound transmitters with a dip-coated reference fabricated using the same constituent materials and possessing identical optical absorption, a five-fold increase in the generated pressure and wider bandwidth was observed. The electrospun transmitters exhibited high optical absorption, good elastomer infiltration, and ultrasound generation capability in the range of pressures used for clinical pulse-echo imaging. All-optical ultrasound probes with such transmitters fabricated by electrospinning could be well-suited for incorporation into catheters and needles for diagnostics and therapeutic applications.

  20. Robust Short-Pulse, High-Peak-Power Laser Transmitter for Optical Communications

    Science.gov (United States)

    Wright, Malcolm W.

    2009-01-01

    We report on a pulsed fiber based master oscillator power amplifier laser at 1550 nm to support moderate data rates with high peak powers in a compact package suitable for interplanetary optical communications. To accommodate pulse position modulation, the polarization maintaining laser transmitter generates pulses from 0.1 to 1 ns with variable duty cycle over a pulse repetition frequency range of 10 to 100 MHz.

  1. Optimal power allocation of a single transmitter-multiple receivers channel in a cognitive sensor network

    KAUST Repository

    Ayala Solares, Jose Roberto

    2012-08-01

    The optimal transmit power of a wireless sensor network with one transmitter and multiple receivers in a cognitive radio environment while satisfying independent peak, independent average, sum of peak and sum of average transmission rate constraints is derived. A suboptimal scheme is proposed to overcome the frequency of outages for the independent peak transmission rate constraint. In all cases, numerical results are provided for Rayleigh fading channels. © 2012 IEEE.

  2. Micro-V covering materials with high light transmittance for solar collectors

    Energy Technology Data Exchange (ETDEWEB)

    Sonneveld, P.J.; Swinkels, G.L.A.M. [Wageningen UR, A and F (Netherlands)

    2004-07-01

    Maximal light transmittance of the covering material is important for solar collectors maximising yield of the system. Furthermore a second sheet of covering material can be applied with low light loss to increase thermal insulation. Therefore research is aimed at improving light transmission. Ray tracing method has been applied to design the optimal geometry of the material. Light transmission, thermal insulation, structural performance and yield aspects of solar collectors are combined in this research with glass as basic covering material. (orig.)

  3. The evidence informing the surgeon's selection of intraocular lens on the basis of light transmittance properties

    OpenAIRE

    Li, X; Kelly, D; Nolan, J M; Dennison, J L; Beatty, S.

    2016-01-01

    In recent years, manufacturers and distributors have promoted commercially available intraocular lenses (IOLs) with transmittance properties that filter visible short-wavelength (blue) light on the basis of a putative photoprotective effect. Systematic literature review. Out of 21 studies reporting on outcomes following implantation of blue-light-filtering IOLs (involving 8914 patients and 12?919 study eyes undergoing cataract surgery), the primary outcome was vision, sleep pattern, and photo...

  4. Acoustic characterization of high intensity focused ultrasound fields generated from a transmitter with a large aperture

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Tao; Fan, Tingbo [Institute of Acoustics, Key Laboratory of Modern Acoustics, MOE, Nanjing University, Nanjing 210093 (China); Jiangsu Province Institute for Medical Equipment Testing, Nanjing 210012 (China); Zhang, Wei [Jiangsu Province Institute for Medical Equipment Testing, Nanjing 210012 (China); Qiu, Yuanyuan [Department of electronic information, Nantong University, Nantong 226019 (China); Tu, Juan, E-mail: juantu@nju.edu.cn, E-mail: dzhang@nju.edu.cn; Guo, Xiasheng [Institute of Acoustics, Key Laboratory of Modern Acoustics, MOE, Nanjing University, Nanjing 210093 (China); Zhang, Dong, E-mail: juantu@nju.edu.cn, E-mail: dzhang@nju.edu.cn [Institute of Acoustics, Key Laboratory of Modern Acoustics, MOE, Nanjing University, Nanjing 210093 (China); Institute of Acoustics, State Key Laboratory of Acoustics, Chinese Academy of Sciences, Beijing 100190 (China)

    2014-03-21

    Prediction and measurement of the acoustic field emitted from a high intensity focused ultrasound (HIFU) is essential for the accurate ultrasonic treatment. In this study, the acoustic field generated from a strongly focused HIFU transmitter was characterized by a combined experiment and simulation method. The spheroidal beam equation (SBE) was utilized to describe the nonlinear sound propagation. The curve of the source pressure amplitude versus voltage excitation was determined by fitting the measured ratio of the second harmonic to the fundamental component of the focal waveform to the simulation result; finally, the acoustic pressure field generated by the strongly focused HIFU transmitter was predicted by using the SBE model. A commercial fiber optic probe hydrophone was utilized to measure the acoustic pressure field generated from a 1.1 MHz HIFU transmitter with a large half aperture angle of 30°. The maximum measured peak-to-peak pressure was up to 72 MPa. The validity of this combined approach was confirmed by the comparison between the measured results and the calculated ones. The results indicate that the current approach might be useful to describe the HIFU field. The results also suggest that this method is not valid for low excitations owing to low sensitivity of the second harmonic.

  5. Use of electricity to sedate Lake Trout for intracoelomic implantation of electronic transmitters

    Science.gov (United States)

    Faust, Matthew D.; Vandergoot, Christopher; Hostnik, Eric T.; Binder, Thomas R.; Mida Hinderer, Julia L.; Ives, Jessica T.; Krueger, Charles C.

    2017-01-01

    Use of telemetry data to inform fisheries conservation and management is becoming increasingly common; as such, fish typically must be sedated before surgical implantation of transmitters into the coelom. Given that no widely available, immediate-release chemical sedative currently exists in North America, we investigated the feasibility of using electricity to sedate Lake Trout Salvelinus namaycush long enough for an experienced surgeon to implant an electronic transmitter (i.e., 180 s). Specifically, our study objectives were to determine (1) whether some combination of electrical waveform characteristics (i.e., duty cycle, frequency, voltage, and pulse type) could sedate Lake Trout for at least 180 s; and (2) whether Lake Trout that were sequentially exposed to continuous DC and pulsed DC had greater rates of spinal injury and short-term mortality than control fish. A Portable Electrosedation System unit was used to sedate hatchery and wild Lake Trout. Dual-frequency pulsed-DC and two-stage approaches successfully sedated Lake Trout and had similar induction and recovery times. Lake Trout sedated using the two-stage approach did not have survival rates or spinal abnormalities that were significantly different from those of control fish. We concluded that electricity was a viable alternative to chemical sedatives for sedating Lake Trout before surgical implantation of an electronic transmitter, but we suggest that Lake Trout and other closely related species (e.g., Arctic Char Salvelinus alpinus) may require morphotype-specific electrical waveforms due to their morphological diversity.

  6. Ultra-efficient 10 Gb/s hybrid integrated silicon photonic transmitter and receiver.

    Science.gov (United States)

    Zheng, Xuezhe; Patil, Dinesh; Lexau, Jon; Liu, Frankie; Li, Guoliang; Thacker, Hiren; Luo, Ying; Shubin, Ivan; Li, Jieda; Yao, Jin; Dong, Po; Feng, Dazeng; Asghari, Mehdi; Pinguet, Thierry; Mekis, Attila; Amberg, Philip; Dayringer, Michael; Gainsley, Jon; Moghadam, Hesam Fathi; Alon, Elad; Raj, Kannan; Ho, Ron; Cunningham, John E; Krishnamoorthy, Ashok V

    2011-03-14

    Using low parasitic microsolder bumping, we hybrid integrated efficient photonic devices from different platforms with advanced 40 nm CMOS VLSI circuits to build ultra-low power silicon photonic transmitters and receivers for potential applications in high performance inter/intra-chip interconnects. We used a depletion racetrack ring modulator with improved electro-optic efficiency to allow stepper optical photo lithography for reduced fabrication complexity. Integrated with a low power cascode 2 V CMOS driver, the hybrid silicon photonic transmitter achieved better than 7 dB extinction ratio for 10 Gbps operation with a record low power consumption of 1.35 mW. A received power penalty of about 1 dB was measured for a BER of 10(-12) compared to an off-the-shelf lightwave LiNOb3 transmitter, which comes mostly from the non-perfect extinction ratio. Similarly, a Ge waveguide detector fabricated using 130 nm SOI CMOS process was integrated with low power VLSI circuits using hybrid bonding. The all CMOS hybrid silicon photonic receiver achieved sensitivity of -17 dBm for a BER of 10(-12) at 10 Gbps, consuming an ultra-low power of 3.95 mW (or 395 fJ/bit in energy efficiency). The scalable hybrid integration enables continued photonic device improvements by leveraging advanced CMOS technologies with maximum flexibility, which is critical for developing ultra-low power high performance photonic interconnects for future computing systems.

  7. Optimization of an acoustic telemetry array for detecting transmitter-implanted fish

    Science.gov (United States)

    Clements, S.; Jepsen, D.; Karnowski, M.; Schreck, C.B.

    2005-01-01

    The development of miniature acoustic transmitters and economical, robust automated receivers has enabled researchers to study the movement patterns and survival of teleosts in estuarine and ocean environments, including many species and age-classes that were previously considered too small for implantation. During 2001-2003, we optimized a receiver mooring system to minimize gear and data loss in areas where current action or wave action and acoustic noise are high. In addition, we conducted extensive tests to determine (1) the performance of a transmitter and receiver (Vemco, Ltd.) that are widely used, particularly in North America and Europe and (2) the optimal placement of receivers for recording the passage of fish past a point in a linear-flow environment. Our results suggest that in most locations the mooring system performs well with little loss of data; however, boat traffic remains a concern due to entanglement with the mooring system. We also found that the reception efficiency of the receivers depends largely on the method and location of deployment. In many cases, we observed a range of 0-100% reception efficiency (the percentage of known transmissions that are detected while the receiver is within range of the transmitter) when using a conventional method of mooring. The efficiency was improved by removal of the mounting bar and obstructions from the mooring line. ?? Copyright by the American Fisheries Society 2005.

  8. Improvement of optical transmittance and electrical conductivity of silver nanowires by Cu ion beam irradiation

    Science.gov (United States)

    Ishaq, Ahmad; Shehla, H.; Zafar Ali, Naveed; Akram, Waheed; Shakil, Khan; Diallo, A.; Shahzad, N.; Maaza, Malik

    2017-07-01

    Concatenation of Silver nanowires (Ag-NWs) networks upon ion-beam irradiation is a novel annealing process with various opto-electronics and nano-electronics applications. In the present study, the Ag-NWs have been irradiated with copper (Cu) ion having MeV energy. The effect of ion fluencies on optical (ultraviolet and visible ranges) and electrical properties of Cu ion irradiated Ag NWs are investigated. It has been observed that electrical conductivity and optical transmittance rises with the increase of Cu ion fluences i.e. at 1  ×  1015 ions cm-2, optical transmittance of Ag-NWs thin film increased up to 34% in the visible and 19% in the ultraviolet ranges with reference to un-irradiated Ag-NWs thin film. At the equivalent dose, the electrical conductivity raised twice to the pristine value. The increase in optical transmittance has been attributed to the ion beam induced localized heating source causing slicing of Ag-NWs, whereas ion beam induced fusion of Ag-NWs at contact position is the main reason to increase the electrical conductivity. This study offers a base for the future design of transparent metal NWs thin films in various photovoltaic applications, specifically in harsh irradiation environment.

  9. Degradation in PV Encapsulation Transmittance: An Interlaboratory Study Toward a Climate-Specific Test

    Energy Technology Data Exchange (ETDEWEB)

    Miller, David C.; Hacke, Peter L.; Kempe, Michael D.; Wohlgemuth, John H.; Annigoni, Eleonora; Sculati-Meillaud, Fanny; Ballion, Amal; Kohl, Michael; Bokria, Jayesh G.; Bruckman, Laura S.; French, Roger H.; Burns, David; Phillips, Nancy H.; Feng; Jiangtao; Elliott, Lamont; Scott, Kurt P.; Fowler, Sean; Gu, Xiaohong; Honeker, Christian C.; Khonkar, Hussam; Perret-Aebi, Laure-Emmanuelle; Shioda, Tsy

    2015-06-14

    Reduced optical transmittance of encapsulation resulting from ultraviolet (UV) degradation has frequently been identified as a cause of decreased PV module performance through the life of installations in the field. The present module safety and qualification standards, however, apply short UV doses only capable of examining design robustness or 'infant mortality' failures. Essential information that might be used to screen encapsulation through product lifetime remains unknown. For example, the relative efficacy of xenon-arc and UVA-340 fluorescent sources or the typical range of activation energy for degradation is not quantified. We have conducted an interlaboratory experiment to provide the understanding that will be used towards developing a climate- and configuration-specific (UV) weathering test. Five representative, known formulations of EVA were studied in addition to one TPU material. Replicate laminated silica/polymer/silica specimens are being examined at 14 institutions using a variety of indoor chambers (including Xe, UVA-340, and metal-halide light sources) or field aging. The solar-weighted transmittance, yellowness index, and the UV cut-off wavelength, determined from the measured hemispherical transmittance, are examined to provide understanding and guidance for the UV light source (lamp type) and temperature used in accelerated UV aging tests. Index Terms -- reliability, durability, thermal activation.

  10. Degradation in PV Encapsulation Transmittance: An Interlaboratory Study Towards a Climate-Specific Test: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Miller, David C.; Annigoni, Eleonora; Ballion, Amal; Bokria, Jayesh G.; Bruckman, Laura S.; Burns, David M.; Chen, Xinxin; Elliott, Lamont; Feng, Jiangtao; French, Roger H.; Fowler, Sean; Gu, Xiaohong; Hacke, Peter L.; Honeker, Christian C.; Kempe, Michael D.; Khonkar, Hussam; Kohl, Michael; Perret-Aebi, Laure-Emmanuelle; Phillips, Nancy H.; Scott, Kurt P.; Sculati-Meillaud, Fanny; Shioda, Tsuyos

    2015-08-12

    Reduced optical transmittance of encapsulants resulting from ultraviolet (UV) degradation has frequently been identified as a cause of decreased PV module performance through the life of service in the field. The present module safety and qualification standards, however, apply short UV doses only capable of examining design robustness or 'infant mortality' failures. Essential information that might be used to screen encapsulation through product lifetime remains unknown. For example, the relative efficacy of xenon-arc and UVA-340 fluorescent sources or the typical range of activation energy for degradation is not quantified. We have conducted an interlaboratory experiment to provide the understanding that will be used towards developing a climate- and configuration-specific (UV) weathering test. Five representative, known formulations of EVA were studied in addition to one TPU material. Replicate laminated silica/polymer/silica specimens are being examined at 14 institutions using a variety of indoor chambers (including Xenon, UVA-340, and metal-halide light sources) or field aging. The solar-weighted transmittance, yellowness index, and the UV cut-off wavelength, determined from the measured hemispherical transmittance, are examined to provide understanding and guidance for the UV light source (lamp type) and temperature used in accelerated UV aging tests.

  11. A dual-mode 6-9 GHz transmitter for OFDM-UWB

    Energy Technology Data Exchange (ETDEWEB)

    Chen Yunfeng; Gao Ting; Li Wei; Li Ning; Ren Junyan, E-mail: jyren@fudan.edu.cn, E-mail: w-li@fudan.edu.cn [State Key Laboratory of ASIC and System, Fudan University, Shanghai 201203 (China)

    2011-05-15

    This paper presents a fully integrated dual-mode 6 to 9 GHz transmitter for both WiMedia and China MB-OFDM UWB applications. The proposed transmitter consists of a dual-mode I/QLPF, an up-conversion mixer, a two-stage power driver amplifier and a broadband high-speed frequency divider with LO buffers for I/Q LO carrier generation. The measurement results show that the gain ripple of the transmitter is within {+-}1.5/{+-}2.8 dB from 6 to 8.7/9 GHz. The output IP3 is about +13.2 dBm, the output 1dBCP is around +2.8 dBm, and the LO leakage/sideband rejection ratio is about -35/-38 dBc. The ESD protected chip is fabricated with a TSMC 0.13 {mu}m RFCMOS process with a die size of 1.6 x 1.3 mm{sup 2} and the core circuit consumes only 46 mA under a 1.2 V supply. (semiconductor integrated circuits)

  12. Simultaneous determination of monoamine transmitters, precursors and metabolites in a single mouse brain.

    Science.gov (United States)

    Ishikawa, K; McGaugh, J L

    1982-04-16

    A simple and sensitive procedure for simultaneous determination of monoamine transmitters and related substances including precursors and metabolites has been developed for a single mouse brain. The proposed procedure involves (1) primary butanol extraction, (2) separation of the substances into either acid or alkaline aqueous layers according to their physicochemical properties, and (3) determination by means of high-performance liquid chromatography with electrochemical detection. Three transmitters (noradrenaline, dopamine and 5-hydroxytryptamine) and their precursors (tyrosine, 3,4-dihydroxyphenylalanine and tryptophan) and major metabolites (normethanephrine, 3-methoxy-4-hydroxyphenylethylene glycol, 3-methoxytyramine, 3,4-dihydroxyphenylacetic acid, 3-methoxy-4-hydroxyphenylacetic acid and 5-hydroxyindoleacetic acid) were selectively separated and sensitively detected in mouse whole brain sample. Although 3-methoxy-4-hydroxymandelic acid was also separated from other substances by authentic chromatography, the substance was not detected in mouse brain. Changes in levels of these substances were examined for drugs whose effects had been previously confirmed. These changes reflected putative effects of the drugs and confirmed that the procedure is effective for neurochemical research into the transmitter system.

  13. Configurable Transmitter and Systolic Channel Estimator Architectures for Data-Dependent Superimposed Training Communications Systems

    Directory of Open Access Journals (Sweden)

    E. Romero-Aguirre

    2012-01-01

    Full Text Available In this paper, a configurable superimposed training (ST/data-dependent ST (DDST transmitter and architecture based on array processors (APs for DDST channel estimation are presented. Both architectures, designed under full-hardware paradigm, were described using Verilog HDL, targeted in Xilinx Virtex-5 and they were compared with existent approaches. The synthesis results showed a FPGA slice consumption of 1% for the transmitter and 3% for the estimator with 160 and 115 MHz operating frequencies, respectively. The signal-to-quantization-noise ratio (SQNR performance of the transmitter is about 82 dB to support 4/16/64-QAM modulation. A Monte Carlo simulation demonstrates that the mean square error (MSE of the channel estimator implemented in hardware is practically the same as the one obtained with the floating-point golden model. The high performance and reduced hardware of the proposed architectures lead to the conclusion that the DDST concept can be applied in current communications standards.

  14. Effects of harness transmitters on behavior and reproduction of wild mallards

    Science.gov (United States)

    Pietz, Pamela J.; Krapu, Gary L.; Greenwood, Raymond J.; Lokemoen, John T.

    1993-01-01

    Radio telemetry has been an important research tool in waterfowl studies for >20 years, yet little effort has been made to evaluate potential effects of transmitters on the birds that carry them. As part of a 4-year mallard (Anas platyrhynchos) study in the prairie pothole region of North Dakota and Minnesota, we compared radio-marked and unmarked female mallards in terms of percent time observed feeding, resting, and preening; nest initiation date; and clutch size and egg volume. Radio-marked females carried a 23-g back-mounted transmitter attached with a 2-loop harness (Dwyer 1972). On average, radio-marked females tended to feed less, rest and preen more, initiate nests later, and lay smaller clutches and eggs than unmarked females. Thus, behavioral and reproductive data from ducks marked with back-mounted harness-attached transmitters may be biased. We recommend that new designs of radio packages be field tested and caution that effects may be masked under extreme environmental conditions.

  15. A New Position Location System Using DTV Transmitter Identification Watermark Signals

    Directory of Open Access Journals (Sweden)

    Chouinard Jean-Yves

    2006-01-01

    Full Text Available A new position location technique using the transmitter identification (TxID RF watermark in the digital TV (DTV signals is proposed in this paper. Conventional global positioning system (GPS usually does not work well inside buildings due to the high frequency and weak field strength of the signal. In contrast to the GPS, the DTV signals are received from transmitters at relatively short distance, while the broadcast transmitters operate at levels up to the megawatts effective radiated power (ERP. Also the RF frequency of the DTV signal is much lower than the GPS, which makes it easier for the signal to penetrate buildings and other objects. The proposed position location system based on DTV TxID signal is presented in this paper. Practical receiver implementation issues including nonideal correlation and synchronization are analyzed and discussed. Performance of the proposed technique is evaluated through Monte Carlo simulations and compared with other existing position location systems. Possible ways to improve the accuracy of the new position location system is discussed.

  16. Spectral transmittance of UV-blocking soft contact lenses: a comparative study.

    Science.gov (United States)

    Rahmani, Saeed; Mohammadi Nia, Mohadeseh; Akbarzadeh Baghban, Alireza; Nazari, Mohammad Reza; Ghassemi-Broumand, Mohammad

    2014-12-01

    Three major parts of sunlight consist of visible, ultraviolet and infrared radiation. Exposure to ultraviolet radiation (UVR) can result in a spectrum of skin and ocular diseases. UV-blocking contact lenses help provide protection against harmful UV radiation. We studied the ultraviolet and visible light rays transmission in some soft UV-blocking contact lenses. Four available tinted soft lenses (Acuvue Moist, Zeiss CONTACT Day 30 Air spheric, Pretty Eyes and Sauflon 56 UV) have been evaluated for UV and visible transmission. One-way ANOVA testing was performed to establish is there a statistically significant difference between the UV regions and visible spectra means for the contact lenses (α=0.05). Pretty Eyes, Zeiss CONTACT, Acuvue Moist and Sauflon 56 UV showed UV-B transmittance value of 0.65%, 10.69%, 1.22%, and 5.78%, respectively. Pretty Eyes and Acuvue Moist had UV-A transmittance values of 32% and 34%, Sauflon 56 UV and Zeiss CONTACT had transmittance values of 48% and 43%, respectively. All of the studied lenses transmitted at least 94.6% on the visible spectrum. The results of the one-way ANOVA statistical analysis show that a statistically significant difference exists within the group of contact lenses tested for the visible (pcontact lenses in this study. Copyright © 2014 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

  17. Algorithms for detecting cherry pits on the basis of transmittance mode hyperspectral data

    Science.gov (United States)

    Siedliska, Anna; Zubik, Monika; Baranowski, Piotr; Mazurek, Wojciech

    2017-10-01

    The suitability of the hyperspectral transmittance imaging technique was assessed in terms of detecting the internal intrusions (pits and their fragments) in cherries. Herein, hyperspectral transmission images were acquired in the visible and near-infrared range (450-1000 nm) from pitted and intact cherries of three popular cultivars: `Łutówka', `Pandy 103', and `Groniasta', differing by soluble solid content. The hyperspectral transmittance data of fresh cherries were used to determine the influence of differing soluble solid content in fruit tissues on pit detection effectiveness. Models for predicting the soluble solid content of cherries were also developed. The principal component analysis and the second derivative pre-treatment of the hyperspectral data were used to construct the supervised classification models. In this study, five classifiers were tested for pit detection. From all the classifiers studied, the best prediction accuracies for the whole pit or pit fragment detection were obtained via the backpropagation neural networks model (87.6% of correctly classified instances for the training/test set and 81.4% for the validation set). The accuracy of distinguishing between drilled and intact cherries was close to 96%. These results showed that the hyperspectral transmittance imaging technique is feasible and useful for the non-destructive detection of pits in cherries.

  18. A small long-life acoustic transmitter for studying the behavior of aquatic animals

    Science.gov (United States)

    Lu, J.; Deng, Z. D.; Li, H.; Myjak, M. J.; Martinez, J. J.; Xiao, J.; Brown, R. S.; Cartmell, S. S.

    2016-11-01

    Acoustic telemetry is an important tool for studying the behavior of aquatic animals and assessing the environmental impact of structures such as hydropower facilities. However, the physical size, signal intensity, and service life of off-the-shelf transmitters are presently insufficient for monitoring certain species. In this study, we developed a small, long-life acoustic transmitter with an approximate length of 24.2 mm, diameter of 5.0 mm, and dry weight of 0.72 g. The transmitter generates a coded acoustic signal at 416.7 kHz with a selectable source level between 159 and 163 dB relative to 1 μPa at 1 m, allowing a theoretical detection range of up to 500 m. The expected operational lifetime is 1 yr at a pulse rate interval of 15 s. The new technology makes long-term acoustic telemetry studies of small fish possible, and is being deployed for a long-term tracking of juvenile sturgeon.

  19. Comparative Evaluation of Spectral Transmittance of Some Welding Glasses with ANSI Z87.1

    Directory of Open Access Journals (Sweden)

    saeed Rahmani

    2016-04-01

    Full Text Available Background: Welding emits harmful rays to the eyes. We evaluate and compare the UV, blue light and IR transmittance characteristics of some currently available welding safety protectors with ANSI Z87.1 criteria.Materials and Methods: Three type of welding safety protectors (three of each type have been evaluated for spectral transmittance. One-sample T-test was performed to establish is there a statistically significant difference between the standard criteria and UV, blue and IR regions for the welding protectors (α=0.05.Results: In ultraviolet (UV (far and near region, two types of the tested protectors (P1, P2 transmitted lower than the maximum allowable value specified in the standard (P<0.001. In infrared (IR spectrum only one type (P3 transmitted lower than the maximum allowable value specified in the standard (P<0.001. In blue light region, all of the tested protectors transmitted lower than the maximum allowable value specified in the standard (P<0.001.Conclusion: Although all of the tested glasses could meet some parts of the criteria, but none of them could meet the complete spectral transmittance requirements of ANSI Z87.1.

  20. Attaching transmitters to waterbirds using one versus two subcutaneous anchors: Retention and survival trade-offs

    Science.gov (United States)

    Lewis, Tyler; Esler, Daniel N.; Uher-Koch, Brian D.; Dickson, Rian D.; Anderson, Eric M.; Evenson, Joseph R.; Hupp, Jerry; Flint, Paul L.

    2017-01-01

    A major challenge of wildlife telemetry is choosing an attachment technique that maximizes transmitter retention while minimizing negative side effects. For waterbirds, attachment of transmitters with subcutaneous anchors has been an effective and well-established technique, having been used on >40 species. This method was recently modified to include a second subcutaneous anchor, presumably increasing transmitter retention beyond that of single-anchor attachments. This putative benefit may be offset, however, by increased health risks related to additional incisions and subcutaneous protrusions. To test this potential trade-off, we attached radiotransmitters to molting and wintering surf (Melanitta perspicillata) and white-winged scoters (M. fusca) during 2008 and 2009 in Washington State and southeast Alaska, USA, using single- (121 scoters) and double-anchor (128 scoters) attachment techniques. We estimated daily probabilities of survival and radio retention for each group, this being apparent retention for wintering scoters because we could not differentiate shed transmitters from flighted emigration. For scoters during the flightless remigial molt, we found that addition of a second anchor increased cumulative retention probability (±SE) over a 49-day period from 0.69 ± 0.11 for single-anchor to 0.88 ± 0.07 for double-anchor attachments, while having no effect on survival. However, during winter, scoters with double-anchor attachments experienced no improvement in apparent retention, while having significantly lower survival during their first 14 days following transmitter attachment; of 15 mortalities during this period, 11 had 2 subcutaneous anchors. From day 15 onward, winter survival rates were nearly identical for single- versus double-anchor attachments, indicating that adverse effects of subcutaneous anchors were mainly limited to the 14-day postattachment period. Overall, given that the survival cost of adding a second subcutaneous anchor

  1. Effect of grain size on optical transmittance of birefringent polycrystalline ceramics

    Science.gov (United States)

    Wen, Tzu-Chien

    Polycrystalline ceramics are increasingly used for fabricating windows and domes for the mid infra-red regime (3-5 mum) due to their superior durability as compared to glass and the lower cost of their fabrication and finishing relative to single crystals without significant compromise in optical properties. Due to the noncubic structure, MgF2 and Al2O3 are birefringent ceramics. Birefringence causes scatter of light at the grain boundaries and diminishes in-line transmittance and optical performance. This dissertation presents experimental results and analyses of the grain-size and wavelength dependence of the in-line transmittance of polycrystalline MgF2 and Al2O3. Chapter 2 presents experimental results and analyses of light transmission in polycrystalline MgF2 as a function of the mean grain size at different wavelengths. The scattering coefficient of polycrystalline MgF 2 increased linearly with the mean grain size and inversely with the square of the wavelength of light. These trends are consistent with theoretical models based on both a limiting form of the Raleigh-Gans-Debye theory of particle scattering and light retardation theories that take refractive-index variations along the light path. Chapter 3 investigates the applicability of particle light scattering theories to light attenuation in birefringent polycrystalline ceramics by measuring light transmittance in a model two-phase system. The system consisted of microspheres of silica dispersed in a solution of glycerol in water. It was found that RGD theory showed the systematic deviation for higher particle volume fraction (φ > 0.2) and larger particle size (d p > 1 mum). This result suggested that light scattering models based on single particle scattering are unlikely to provide viable physical explanation for the effect of grain size on light transmittance in birefringent polycrystalline ceramics due to the high volume fraction in dense polycrystalline ceramics. Chapter 4 analyses light

  2. A New Metre for Cheap, Quick, Reliable and Simple Thermal Transmittance (U-Value) Measurements in Buildings

    National Research Council Canada - National Science Library

    Jose Manuel Andújar Marquez; Miguel angel Martínez Bohórquez; Sergio Gómez Melgar

    2017-01-01

    .... Today, if many thermal transmittance measurements in a short time are needed, the current devices, based on the measurement of the heat flow through the wall, cannot carry out them, except if a great...

  3. Calculations of the Total Number of Electrons Along a Ray Path Extending from the Transmitter to the Receiver

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ionospheric Total Electron Content (TEC) is the total number of electrons in a column of unit cross section extending from the transmitter to the receiver. TEC is...

  4. Single-Chip Fully Integrated Direct-Modulation CMOS RF Transmitters for Short-Range Wireless Applications

    Directory of Open Access Journals (Sweden)

    M. Jamal Deen

    2013-08-01

    Full Text Available Ultra-low power radio frequency (RF transceivers used in short-range application such as wireless sensor networks (WSNs require efficient, reliable and fully integrated transmitter architectures with minimal building blocks. This paper presents the design, implementation and performance evaluation of single-chip, fully integrated 2.4 GHz and 433 MHz RF transmitters using direct-modulation power voltage-controlled oscillators (PVCOs in addition to a 2.0 GHz phase-locked loop (PLL based transmitter. All three RF transmitters have been fabricated in a standard mixed-signal CMOS 0.18 µm technology. Measurement results of the 2.4 GHz transmitter show an improvement in drain efficiency from 27% to 36%. The 2.4 GHz and 433 MHz transmitters deliver an output power of 8 dBm with a phase noise of −122 dBc/Hz at 1 MHz offset, while drawing 15.4 mA of current and an output power of 6.5 dBm with a phase noise of −120 dBc/Hz at 1 MHz offset, while drawing 20.8 mA of current from 1.5 V power supplies, respectively. The PLL transmitter delivers an output power of 9 mW with a locking range of 128 MHz and consumes 26 mA from 1.8 V power supply. The experimental results demonstrate that the RF transmitters can be efficiently used in low power WSN applications.

  5. Small-signal transmittances of DC-DC step-down PWM converter in various operation modes

    Directory of Open Access Journals (Sweden)

    Janke Włodzimierz

    2015-09-01

    Full Text Available Small-signal transmittances: input-to-output and control-to-output of BUCK converter power stage working in CCM or DCM mode are discussed. Ideal converter case and converter with parasitic resistances are considered separately. Derivations of small-signal transmittances, based on different approaches to finding the converter averaged models, are presented and the results are compared. Apart from theoretical considerations, some results of numerical calculations are presented.

  6. Small-signal transmittances of DC-DC step-down PWM converter in various operation modes

    OpenAIRE

    Janke Włodzimierz

    2015-01-01

    Small-signal transmittances: input-to-output and control-to-output of BUCK converter power stage working in CCM or DCM mode are discussed. Ideal converter case and converter with parasitic resistances are considered separately. Derivations of small-signal transmittances, based on different approaches to finding the converter averaged models, are presented and the results are compared. Apart from theoretical considerations, some results of numerical calculations are presented.

  7. Presynaptic membrane potential affects transmitter release in an identified neuron in Aplysia by modulating the Ca2+ and K+ currents

    Science.gov (United States)

    Shapiro, Eli; Castellucci, Vincent F.; Kandel, Eric R.

    1980-01-01

    We have examined the relationships between the modulation of transmitter release and of specific ionic currents by membrane potential in the cholinergic interneuron L10 of the abdominal ganglion of Aplysia californica. The presynaptic cell body was voltage-clamped under various pharmacological conditions and transmitter release from the terminals was assayed simultaneously by recording the synaptic potentials in the postsynaptic cell. When cell L10 was voltage-clamped from a holding potential of -60 mV in the presence of tetrodotoxin, graded transmitter release was evoked by depolarizing command pulses in the membrane voltage range (-35 mV to + 10 mV) in which the Ca2+ current was also increasing. Depolarizing the holding potential of L10 results in increased transmitter output. Two ionic mechanisms contribute to this form of plasticity. First, depolarization inactivates some K+ channels so that depolarizing command pulses recruit a smaller K+ current. In unclamped cells the decreased K+ conductance causes spike-broadening and increased influx of Ca2+ during each spike. Second, small depolarizations around resting potential (-55 mV to -35 mV) activate a steady-state Ca2+ current that also contributes to the modulation of transmitter release, because, even with most presynaptic K+ currents blocked pharmacologically, depolarizing the holding potential still increases transmitter release. In contrast to the steady-state Ca2+ current, the transient inward Ca2+ current evoked by depolarizing clamp steps is relatively unchanged from various holding potentials. PMID:6244571

  8. Influence of Incision Location on Transmitter Loss, Healing, Survival, Growth, and Suture Retention of Juvenile Chinook Salmon

    Energy Technology Data Exchange (ETDEWEB)

    Panther, Jennifer L.; Brown, Richard S.; Gaulke, Greg L.; Deters, Katherine A.; Woodley, Christa M.; Eppard, M. Brad

    2011-11-01

    Fisheries research involving surgical implantation of transmitters necessitates the use of methods that minimize transmitter loss and fish mortality and optimize healing of the incision. We evaluated the effects of three incision locations on transmitter loss, healing, survival, growth, and suture retention in juvenile Chinook salmon Oncorhynchus tshawytscha. The three incision locations were (1) on the linea alba (LA incision), (2) adjacent and parallel to the LA (muscle-cutting [MC] incision), and (3) extending from the LA towards the dorsum at a 45° angle, between the parallel lines of myomeres (muscle-sparing [MS] incision). A Juvenile Salmon Acoustic Telemetry System acoustic transmitter (0.44 g in air) and a passive integrated transponder tag (0.10 g in air) were implanted into each fish (total N = 936 fish). The fish were held at 12°C or 20°C and were examined weekly for 98 d. The progression of healing among incision locations and the variability in transmitter loss made it difficult to identify one incision location as the best choice. The LA incisions had a much smaller wound extent (area of visible subepidermal tissue) than MC and MS incisions during the first 28 d of the study. In both temperature treatments, apposition of incisions through day 14 was better for LA incisions than for MC and MS incisions. However, MC and MS incisions were less likely than LA incisions to reopen over time and thus were less likely to allow transmitter loss through the incision.

  9. vhfRNAi: a web-platform for analysis of host genes involved in viral infections discovered by genome wide RNAi screens.

    Science.gov (United States)

    Thakur, Anamika; Qureshi, Abid; Kumar, Manoj

    2017-06-27

    Knockdown of host genes using high-throughput genome-wide RNA interference screens has identified numerous host factors that affect viral infections, which would be helpful in understanding host-virus interactions. We have developed a vhfRNAi web resource based on genome-wide RNAi experiments for viruses. It contains experimental details of 12 249 entries (host factors + restriction factors) for 18 viruses. Simultaneously, this resource encompasses analysis of overlapping genes, genome wide association studies, gene ontology (GO), pathogen interacting proteins, interaction networks and pathway enrichment. Using overlap analysis, it was found that Influenza A virus shared overlapping host genes with the majority of viruses including Hepatitis C virus and Dengue virus 2. In the genome wide association studies analysis, 429 diseases/traits were mapped, of which obesity-related traits were the most common. GO analysis revealed that the major categories belonged to metabolic processes, molecule transport, signal transduction, proteolysis, etc. In the pathogen interacting protein analysis, protein interaction data from different resources can be explored for further understanding of host-virus biology. By pathway enrichment analysis, a total of 8955 genes were mapped on 303 pathways with most of the hits coming from metabolic pathways. We have found 491 genes that are not essential for the host but essential for the virus and can be targeted to inhibit the virus. These may be explored as potential candidates for drug targets. The resource is freely accessible at and will be useful in understanding host-virus biology as well as identification of targets for the development of antiviral therapeutics.

  10. WHU VHF radar observations of the diurnal tide and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N, China

    Directory of Open Access Journals (Sweden)

    C. Huang

    2015-07-01

    Full Text Available The diurnal tide (DT and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N were studied based on the newly established Wuhan University (WHU VHF radar observations with the height intervals of 0.145 km (below 9 km and 0.58 km (above 9 km in the whole year of 2012. We find that the DT was the dominant tidal component and showed remarkable height and season variations. A prominent seasonally dependent height variability characteristic is that maximum DT amplitude usually occurs around 6 km in the winter and spring months, which might be due to the tidal wave energy concentration arising from the reflections from the strong eastward tropospheric jet around 13 km and the ground surface. Our results suggest that the background wind is a crucial cause for height variability and seasonal variability of DT. In April 2012, a notable strengthening of DT is observed. Meanwhile, the significant higher harmonics of tides, i.e., the semidiurnal, terdiurnal, and even quarterdiurnal tides, can also be observed, which has seldom been reported. Interestingly, these four tidal components displayed consistent short-term variability, implying that they were excited by the same dramatically varying tidal source. In addition, we identified two symptoms of the coupling of DT and planetary waves (PWs, which can also lead to the short-term DT variability. One is the sum and difference interactions between DT and PWs, causing the tidal amplitude short-term variability as a consequence of the energy exchange among the interacting waves. The other one is the modulation of DT by PWs, leading to that the amplitude of DT varies with the periods of the PWs.

  11. Heat flux and thermal conduction in O+ and H+ ion flows deduced from EISCAT-VHF radar observations in the high-latitude topside ionosphere

    Science.gov (United States)

    Wu, Jian; Taieb, Charley

    1994-06-01

    With two periods of EISCAT-VHF radar observations, magnetically quiet and moderately disturbed, we have calculated the H+ and O+ heat fluxes in using formulae of Wu and Taieb (1993), accounting not only for temperature gradients but also for pressure gradients, velocity gradients, and diffusion-thermal effects. They correspond to different physical processes that are calculated and compared between them. Then, the general features of the H+ and O+ ion thermal conductions are studied during the two periods of observation in the high-latitude topside ionosphere. The analysis of the two periods of measurements revealed the following trends, to be confirmed by further observations: (1) During the two periods the H+ heat flux Q2 is always upward in the altitude range from 600 km up to about 1000 km. It is larger during the quiet period than during the disturbed period. (2) The most important dominant mechanism for H+ heat flux is the diffusion-thermal effect due to the H+-O+ collision, with a correcting term due to the H+ temperature gradient. (3) The O+ heat flux is always downward in the same altitude range during the two periods of observations. The absolute value during the disturbed period is slightly larger than that during the quiet period. (4) The dominant mechanism for O+ heat flux is its temperature gradient, corrected by the coupling with the H+ ion. (5) The O+ thermal conduction is less important during the quiet period than during the disturbed period, while for the H+ thermal conduction it is the contrary. (6) The H+ thermal conduction increases with altitude below about 1000 km.

  12. Evidence for a role of glutamate as an efferent transmitter in taste buds

    Directory of Open Access Journals (Sweden)

    Anderson Catherine B

    2010-06-01

    Full Text Available Abstract Background Glutamate has been proposed as a transmitter in the peripheral taste system in addition to its well-documented role as an umami taste stimulus. Evidence for a role as a transmitter includes the presence of ionotropic glutamate receptors in nerve fibers and taste cells, as well as the expression of the glutamate transporter GLAST in Type I taste cells. However, the source and targets of glutamate in lingual tissue are unclear. In the present study, we used molecular, physiological and immunohistochemical methods to investigate the origin of glutamate as well as the targeted receptors in taste buds. Results Using molecular and immunohistochemical techniques, we show that the vesicular transporters for glutamate, VGLUT 1 and 2, but not VGLUT3, are expressed in the nerve fibers surrounding taste buds but likely not in taste cells themselves. Further, we show that P2X2, a specific marker for gustatory but not trigeminal fibers, co-localizes with VGLUT2, suggesting the VGLUT-expressing nerve fibers are of gustatory origin. Calcium imaging indicates that GAD67-GFP Type III taste cells, but not T1R3-GFP Type II cells, respond to glutamate at concentrations expected for a glutamate transmitter, and further, that these responses are partially blocked by NBQX, a specific AMPA/Kainate receptor antagonist. RT-PCR and immunohistochemistry confirm the presence of the Kainate receptor GluR7 in Type III taste cells, suggesting it may be a target of glutamate released from gustatory nerve fibers. Conclusions Taken together, the results suggest that glutamate may be released from gustatory nerve fibers using a vesicular mechanism to modulate Type III taste cells via GluR7.

  13. Narrow linewidth UV laser transmitter for ozone DIAL remote sensing application

    Science.gov (United States)

    Chuang, Ti; Hansell, Joe; Shuman, Tim; Schum, Tom; Puffenberger, Kent; Burnham, Ralph

    2016-03-01

    Fibertek has demonstrated a dual-wavelength narrow linewidth UV laser transmitter for NASA airborne ozone DIAL remote sensing application. The application requires two narrow linewidth lasers in the UV region between 300 nm and 320 nm with at least 12 nm separation between the two wavelengths. Each UV laser was based on a novel ring structure incorporating an optical parametric oscillator (OPO) and a sum frequency generator (SFG). The fundamental pump source of the UV laser was a single frequency 532 nm laser, which was frequency-doubled from a diode-pumped, injection-seeded single frequency Nd:YAG laser operating at 1064 nm and 50 Hz repetition rate. The ring frequency converters generated UV wavelengths at 304 nm and 316 nm respectively. The demonstrated output energies were 2.6 mJ for 304 nm and 2.3 mJ for 316 nm UV lines, with room to potentially achieve more energy for each laser. Linewidth narrowing was achieved using a volume Bragg grating as the output coupler of the OPO in each ring oscillator. We obtained spectral linewidths (FWHM) of 0.12 nm for the 304 nm line and 0.1 nm for the 316 nm line, and the UV energy conversion efficiencies of 12.2% and 9.1%. Fibertek built an airborne DIAL transmitter based on the reported demonstration, which was a single optical module with dual-wavelength output at the demonstrated wavelengths. NASA plans to field the UV laser transmitter as a key component of the High Spectral Resolution Lidar-II (HSRL-II) high altitude airborne instrument to perform autonomous global ozone DIAL remote sensing field campaigns.

  14. Evaluation of Accuracy and Practical Applicability of Methods for Measuring Leaf Reflectance and Transmittance Spectra

    Directory of Open Access Journals (Sweden)

    Aarne Hovi

    2017-12-01

    Full Text Available Leaf reflectance and transmittance spectra are urgently needed in interpretation of remote sensing data and modeling energy budgets of vegetation. The measurement methods should be fast to operate and preferably portable to enable quick collection of spectral databases and in situ measurements. At the same time, the collected spectra must be comparable across measurement campaigns. We compared three different methods for acquiring leaf reflectance and transmittance spectra. These were a single integrating sphere (ASD RTS-3ZC, a small double integrating sphere (Ocean Optics SpectroClip-TR, and a leaf clip (PP Systems UNI501 Mini Leaf Clip. With all methods, an ASD FieldSpec 4 spectrometer was used to measure white paper and tree leaves. Single and double integrating spheres showed comparable within-method variability in the measurements. Variability with leaf clip was slightly higher. The systematic difference in mean reflectance spectra between single and double integrating spheres was only minor (average relative difference of 1%, whereas a large difference (14% was observed in transmittance. Reflectance measured with leaf clip was on average 14% higher compared to single integrating sphere. The differences between methods influenced also spectral vegetation indices calculated from the spectra, particularly those that were designed to track small changes in spectra. Measurements with double integrating sphere were four, and with leaf clip six times as fast as with single integrating sphere, if slightly reduced signal level (integration time reduced from optimum was allowed for the double integrating sphere. Thus, these methods are fast alternatives to a conventional single integrating sphere. However, because the differences between methods depended on the measured target and wavelength, care must be taken when comparing the leaf spectra acquired with different methods.

  15. Energy-Efficient Power Allocation of Cognitive Radio Systems without CSI at the Transmitter

    KAUST Repository

    Sboui, Lokman

    2015-01-07

    Two major issues are facing today’s wireless communications evolution: -Spectrum scarcity: Need for more bandwidth. As a solution, the Cognitive Radio (CR) paradigm, where secondary users (unlicensed) share the spectrum with licensed users, was introduced. -Energy consumption and CO2 emission: The ICT produce 2% of global CO2 emission (equivalent to the aviation industry emission). The cellular networks produces 0.2%. As solution energy efficient systems should be designed rather than traditional spectral efficient systems. In this work, we aim to determine the optimal energy efficient power allocation of CR when the channel state information at the transmitter CSI-T is not available.

  16. Carbon-nanotube-templated deposition of amorphous aluminum oxide with linear photo transmittance

    Science.gov (United States)

    Lan, Zhuyao; Zhang, Xin; Zhang, Haiyan; Ye, Xiang; Zhang, Xiaohua

    2017-11-01

    Atomic layer deposition on free-standing carbon nanotube (CNT) sheets produced highly amorphous Al2O3 nanostructures. The hybrid sheets maintained amorphousness for Al2O3 at 700 °C and robustness as well by thermally decomposing the CNTs. Higher temperatures (above 1000 °C) induced crystalline transformations into γ- and α Al2O3 phases. As each amorphous structure could contribute an absorption peak, the hybrid sheets with a mixture of amorphousness interestingly showed a linear photo-transmittance/absorbance when increasing the wavelength from 200 to 800 nm.

  17. The infrared spectral transmittance of Aspergillus niger spore aggregated particle swarm

    Science.gov (United States)

    Zhao, Xinying; Hu, Yihua; Gu, Youlin; Li, Le

    2015-10-01

    Microorganism aggregated particle swarm, which is quite an important composition of complex media environment, can be developed as a new kind of infrared functional materials. Current researches mainly focus on the optical properties of single microorganism particle. As for the swarm, especially the microorganism aggregated particle swarm, a more accurate simulation model should be proposed to calculate its extinction effect. At the same time, certain parameters deserve to be discussed, which helps to better develop the microorganism aggregated particle swarm as a new kind of infrared functional materials. In this paper, take Aspergillus Niger spore as an example. On the one hand, a new calculation model is established. Firstly, the cluster-cluster aggregation (CCA) model is used to simulate the structure of Aspergillus Niger spore aggregated particle. Secondly, the single scattering extinction parameters for Aspergillus Niger spore aggregated particle are calculated by using the discrete dipole approximation (DDA) method. Thirdly, the transmittance of Aspergillus Niger spore aggregated particle swarm is simulated by using Monte Carlo method. On the other hand, based on the model proposed above, what influences can wavelength causes has been studied, including the spectral distribution of scattering intensity of Aspergillus Niger spore aggregated particle and the infrared spectral transmittance of the aggregated particle swarm within the range of 8~14μm incident infrared wavelengths. Numerical results indicate that the scattering intensity of Aspergillus Niger spore aggregated particle reduces with the increase of incident wavelengths at each scattering angle. Scattering energy mainly concentrates on the scattering angle between 0~40°, forward scattering has an obvious effect. In addition, the infrared transmittance of Aspergillus Niger spore aggregated particle swarm goes up with the increase of incident wavelengths. However, some turning points of the trend

  18. Determination of adsorbed protein concentration in aluminum hydroxide suspensions by near-infrared transmittance Spectroscopy

    DEFF Research Database (Denmark)

    Lai, Xuxin; Zheng, Yiwu; Jacobsen, Susanne

    2008-01-01

    Analysis of aluminum hydroxide based vaccines is difficult after antigen adsorption. Adsorbed protein is often assessed by measuring residual unadsorbed protein for quality control. A new method for the direct determination of adsorbed protein concentration in suspension using near-infrared (NIR...... in vaccine production as a method for quality control and quality assurance.......) transmittance spectroscopy is proposed here. A simple adsorption system using albumin from bovine serum (BSA) and aluminum hydroxide as a model system is employed. The results show that the NIR absorbance at 700-1300 nm is correlated to the adsorbed BSA concentration, measured by the ultraviolet (UV) method...

  19. Estimating Leaf Water Status from Vis-Nir Reflectance and Transmittance

    Science.gov (United States)

    Vanderbilt, Vern; Daughtry, Craig; Dahlgren, Robert

    2017-01-01

    Remotely sensing the water status of plant canopies remains a long term goal of remote sensing research. Established approaches involve measurements in the thermal infrared and the 900-2000nm reflective infrared. Less popular UV-visible-NIR techniques presumably deserve research attention, because photochemical changes linked to plant water status manifest spectral light scattering and absorption changes. Here we monitored the visible and NIR light reflected from the leaf interior as well as the leaf transmittance as the relative water content of corn (Zeamays L.) leaves decreased. Our results highlight the importance of both scattering effects and effects due to absorption by leaf pigments.

  20. The testing techniques of the automatics fire detection monitoring systems (A receiver and A transmitter)

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Yon Woo; Soong, Woong Sup; Kim, Kee Ha [Korea Atomic Energy Research Institute, Taejon (Korea)

    1999-04-01

    The major function of the automatic fire detection system is to use effectively the fire-fighting equipments and the shelter apparatus detecting immediately the fire and notifying the fire to a person in charge. To perform these functions, the automatic fire detection system is composed of a receiver and a transmitter which indicate the origin of a fire, sound facility, wiring and power supply. And the main purpose using this system is to stop the spread of the fire and minimize the damage of human life and properties of the facility. 12 refs., 17 figs., 11 tabs. (Author)

  1. Transient transmittance and scattering changes during nanosecond laser-induced damage in fused silica

    Science.gov (United States)

    Cao, Zhen; Hu, Guohang; He, Hongbo; Zhao, Yuanan; Yang, Liujiang; Luo, Yang; Peng, Xiaocong; Shan, Yao

    2017-08-01

    Transient transmission and scattering changes was observed to study the dynamics during the laser-induced bulk damage in fused silica at the wavelength of 532 and 355 nm. Within the nanosecond high power laser irradiation, the transmittance decreased dramatically, indicating an intense absorption. With fluence increasing, the time required to form the intense absorption was shortened, and at similar fluence, this time interval at the wavelength of 355 nm is shorter than that at 532 nm. At times, the intense absorption did not cause the macroscopic damage because no variation in scattering was observed. While the macroscopic damage occurred, the scattering kept on increasing until the end of pulse.

  2. Study of light transmittance from layers of Fricke-xylenol-orange-gel dosimeters

    Science.gov (United States)

    Gambarini, G.; Birattari, C.; Mariani, M.; Marchesini, R.; Pirola, L.; Prestini, P.; Sella, M.; Tomatis, S.

    2004-01-01

    In-phantom absorbed dose is imaged by measuring the optical transmittance through ferrous-sulphate and xylenol-orange infused gel, in form of layers. Images are acquired with a CCD camera provided with a suitable optical filter. The dependence of dosimeter sensitivity and of linearity range on the amount of xylenol orange and on parameters of optical analysis has been inspected. In order to check the capability of the method, dose profiles in the central axis of a phantom irradiated with a collimated γ-beam have been compared with the results obtained with a ionisation chamber.

  3. Study of light transmittance from layers of Fricke-xylenol-orange-gel dosimeters

    Energy Technology Data Exchange (ETDEWEB)

    Gambarini, G. E-mail: grazia.gambarini@mi.infn.it; Birattari, C.; Mariani, M.; Marchesini, R.; Pirola, L.; Prestini, P.; Sella, M.; Tomatis, S

    2004-01-01

    In-phantom absorbed dose is imaged by measuring the optical transmittance through ferrous-sulphate and xylenol-orange infused gel, in form of layers. Images are acquired with a CCD camera provided with a suitable optical filter. The dependence of dosimeter sensitivity and of linearity range on the amount of xylenol orange and on parameters of optical analysis has been inspected. In order to check the capability of the method, dose profiles in the central axis of a phantom irradiated with a collimated {gamma}-beam have been compared with the results obtained with a ionisation chamber.

  4. All-VCSEL Transmitters With Remote Optical Injection for WDM-OFDM-PON

    DEFF Research Database (Denmark)

    Deng, Lei; Zhao, Ying; Pang, Xiaodan

    2014-01-01

    We report on a novel scheme that uses vertical cavity surface emitting lasers (VCSELs) and remote optical injection technique in the hybrid wavelength division multiplexing orthogonal frequency division multiplexing (OFDM) passive optical network. In the proposed scheme, 1.55-$\\mu{\\rm m}$ VCSELs...... are used as low-cost, directly modulated upstream and downstream transmitters. The slave VCSEL at the optical network unit is remotely injection-locked by modulated downstream signals, and no need for additional injection-locking optical sources and external modulators. In our experiment, bidirectional...

  5. Abdominally implanted satellite transmitters affect reproduction and survival rather than migration of large shorebirds

    Science.gov (United States)

    Hooijmeijer, Jos C. E. W.; Gill, Robert E.; Mulcahy, Daniel M.; Tibbitts, T. Lee; Kentie, Rosemarie; Gerritsen, Gerrit J.; Bruinzeel, Leo W.; Tijssen, David C.; Harwood, Christopher M.; Piersma, Theunis

    2014-01-01

    Satellite telemetry has become a common technique to investigate avian life-histories, but whether such tagging will affect fitness is a critical unknown. In this study, we evaluate multi-year effects of implanted transmitters on migratory timing and reproductive performance in shorebirds. Shorebirds increasingly are recognized as good models in ecology and evolution. That many of them are of conservation concern adds to the research responsibilities. In May 2009, we captured 56 female Black-tailed Godwits Limosa limosa limosa during late incubation in The Netherlands. Of these, 15 birds were equipped with 26-g satellite transmitters with a percutaneous antenna (7.8 % ± 0.2 SD of body mass), surgically implanted in the coelom. We compared immediate nest survival, timing of migration, subsequent nest site fidelity and reproductive behaviour including egg laying with those of the remaining birds, a comparison group of 41 females. We found no effects on immediate nest survival. Fledging success and subsequent southward and northward migration patterns of the implanted birds conformed to the expectations, and arrival time on the breeding grounds in 2010–2012 did not differ from the comparison group. Compared with the comparison group, in the year after implantation, implanted birds were equally faithful to the nest site and showed equal territorial behaviour, but a paucity of behaviours indicating nests or clutches. In the 3 years after implantation, the yearly apparent survival of implanted birds was 16 % points lower. Despite intense searching, we found only three eggs of two implanted birds; all were deformed. A similarly deformed egg was reported in a similarly implanted Whimbrel Numenius phaeopus returning to breed in central Alaska. The presence in the body cavity of an object slightly smaller than a normal egg may thus lead to egg malformation and, likely, reduced egg viability. That the use of implanted satellite transmitters in these large shorebirds

  6. City as a transmitter of urban messages: On some types of urban messages

    Directory of Open Access Journals (Sweden)

    Đorđević Radomir D.

    2007-01-01

    Full Text Available This work elaborates origin, significance and complexity of urban messages which emanates modern city. Modern city becomes unique transmitter of various urban messages with different connotation and subordinate of certain society passing through historical time. As most significant habitat of people, city becomes, more and more unavoidable factor of uniting different human needs. However, in most of the cases they cannot be manifested, whether they are positive or negative, various groups are being formed for pressure on city administration in order to realize accrued messages.

  7. Pyrolyzed Photoresist Electrodes for Integration in Microfluidic Chips for Transmitter Detection from Biological Cells

    DEFF Research Database (Denmark)

    Larsen, Simon Tylsgaard; Argyraki, Aikaterini; Amato, Letizia

    2013-01-01

    In this study, we show how pyrolyzed photoresist carbon electrodes can be used for amperometric detection of potassium-induced transmitter release from large groups of neuronal PC 12 cells. This opens the way for the use of carbon film electrodes in microfabricated devices for neurochemical drug...... screening applications. We also investigated the effect of using two different photoresists for fabrication of pyrolyzed photoresist electrodes. We observed a significant difference in the cross-sectional profile of band electrodes made of AZ 4562 and AZ 5214 photoresist. This difference can be explained...

  8. Improved algorithm for the transmittance estimation of spectra obtained with SOIR/Venus Express.

    Science.gov (United States)

    Trompet, Loic; Mahieux, Arnaud; Ristic, Bojan; Robert, Séverine; Wilquet, Valérie; Thomas, Ian R; Vandaele, Ann Carine; Bertaux, Jean-Loup

    2016-11-10

    The Solar Occultation in the InfraRed (SOIR) instrument onboard the ESA Venus Express spacecraft, an infrared spectrometer sensitive from 2.2 to 4.3 μm, probed the atmosphere of Venus from June 2006 until December 2014. During this time, it performed more than 750 solar occultations of the Venus mesosphere and lower thermosphere. A new procedure has been developed for the estimation of the transmittance in order to decrease the number of rejected spectra, to check that the treated spectra are well calibrated, and to improve the quality of the calibrated spectra by reducing the noise and accurately normalizing it to the solar spectrum.

  9. 47 CFR 22.913 - Effective radiated power limits.

    Science.gov (United States)

    2010-10-01

    ... radiated power (ERP) of transmitters in the Cellular Radiotelephone Service must not exceed the limits in this section. (a) Maximum ERP. In general, the effective radiated power (ERP) of base transmitters and... areas, as those areas are defined in § 22.949, the ERP of base transmitters and cellular repeaters of...

  10. HyperART: non-invasive quantification of leaf traits using hyperspectral absorption-reflectance-transmittance imaging.

    Science.gov (United States)

    Bergsträsser, Sergej; Fanourakis, Dimitrios; Schmittgen, Simone; Cendrero-Mateo, Maria Pilar; Jansen, Marcus; Scharr, Hanno; Rascher, Uwe

    2015-01-01

    Combined assessment of leaf reflectance and transmittance is currently limited to spot (point) measurements. This study introduces a tailor-made hyperspectral absorption-reflectance-transmittance imaging (HyperART) system, yielding a non-invasive determination of both reflectance and transmittance of the whole leaf. We addressed its applicability for analysing plant traits, i.e. assessing Cercospora beticola disease severity or leaf chlorophyll content. To test the accuracy of the obtained data, these were compared with reflectance and transmittance measurements of selected leaves acquired by the point spectroradiometer ASD FieldSpec, equipped with the FluoWat device. The working principle of the HyperART system relies on the upward redirection of transmitted and reflected light (range of 400 to 2500 nm) of a plant sample towards two line scanners. By using both the reflectance and transmittance image, an image of leaf absorption can be calculated. The comparison with the dynamically high-resolution ASD FieldSpec data showed good correlation, underlying the accuracy of the HyperART system. Our experiments showed that variation in both leaf chlorophyll content of four different crop species, due to different fertilization regimes during growth, and fungal symptoms on sugar beet leaves could be accurately estimated and monitored. The use of leaf reflectance and transmittance, as well as their sum (by which the non-absorbed radiation is calculated) obtained by the HyperART system gave considerably improved results in classification of Cercospora leaf spot disease and determination of chlorophyll content. The HyperART system offers the possibility for non-invasive and accurate mapping of leaf transmittance and absorption, significantly expanding the applicability of reflectance, based on mapping spectroscopy, in plant sciences. Therefore, the HyperART system may be readily employed for non-invasive determination of the spatio-temporal dynamics of various plant

  11. Performance Limits of Online Energy Harvesting Communications with Noisy Channel State Information at the Transmitter

    KAUST Repository

    Zenaidi, Mohamed Ridha

    2017-03-01

    In energy harvesting communications, the transceivers have to adjust the data transmission to the energy scavenged during the course of communication. The performance of the transmission depends on the channel conditions which vary randomly due to mobility and environmental changes. In this paper, we consider the problem of power allocation taking into account the energy arrivals over time and the quality of channel state information (CSI) measured at the transmitter, in order to maximize the throughput. Differently from previous work, we focus on energy harvesting communications where the CSI at the transmitter is not perfect and may include estimation errors. In the present paper, we introduce a Markov process that models the energy arrival process. Indeed, we solve the throughput maximization problem with respect to energy harvesting constraints. We show that the optimal online power policy can be found using dynamic programming. Furthermore, we study the asymptotic behavior of the communication system at low and high average recharge rate (ARR) regime. Selected numerical results are provided to support our analysis.

  12. Liquid crystal light shutters for simultaneous control of haze and transmittance

    Science.gov (United States)

    Yoon, Tae-Hoon; Heo, Joon; Yu, Byeong-Hun; Huh, Jae-Won

    2016-03-01

    Recently, see-through displays have been attracted much attention as next-generation displays. There are two basic technologies by which we can realize a see-through display: organic light-emitting diodes (OLEDs) and liquid crystal (LC) displays. The pixel structure of a see-through display includes a transparent window area through which the background image can be seen. Therefore, background images are always seen along with the displayed image. In addition, a see-through display using OLEDs cannot provide the black color. As a result, a see-thorough display exhibits poor visibility. This inevitable problem can be solved by placing a light shutter at the back of a see-through display. Light shutter technology can be divided into two types; light absorption and light scattering. Light shutter based on light absorption can be used to control the transmittance, but it cannot block the object behind the display panel completely. Light shutters based on light scattering can be used to control the haze, but it cannot provide black color. To realize a high-visibility see-through display, we need a light shutter by which we can control haze and transmittance simultaneously. In this talk we would like to introduce technologies for LC light shutters by which we can block the background image and provide black color by utilizing light scattering and absorption effects simultaneously.

  13. Release of chemical transmitters from cell bodies and dendrites of nerve cells.

    Science.gov (United States)

    De-Miguel, Francisco F; Nicholls, John G

    2015-07-05

    Papers in this issue concern extrasynaptic transmission, namely release of signalling molecules by exocytosis or diffusion from neuronal cell bodies, dendrites, axons and glia. Problems discussed concern the molecules, their secretion and importance for normal function and disease. Molecules secreted extrasynaptically include transmitters, peptides, hormones and nitric oxide. For extrasynaptic secretion, trains of action potentials are required, and the time course of release is slower than at synapses. Questions arise concerning the mechanism of extrasynaptic secretion: how does it differ from the release observed at synaptic terminals and gland cells? What kinds of vesicles take part? Is release accomplished through calcium entry, SNAP and SNARE proteins? A clear difference is in the role of molecules released synaptically and extrasynaptically. After extrasynaptic release, molecules reach distant as well as nearby cells, and thereby produce long-lasting changes over large volumes of brain. Such changes can affect circuits for motor performance and mood states. An example with clinical relevance is dyskinesia of patients treated with l-DOPA for Parkinson's disease. Extrasynaptically released transmitters also evoke responses in glial cells, which in turn release molecules that cause local vasodilatation and enhanced circulation in regions of the brain that are active. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  14. Axonal GABAA receptors depolarize presynaptic terminals and facilitate transmitter release in cerebellar Purkinje cells.

    Science.gov (United States)

    Zorrilla de San Martin, Javier; Trigo, Federico F; Kawaguchi, Shin-Ya

    2017-10-26

    In neurons of the adult brain, somatodendritic GABAA Rs mediate fast synaptic inhibition and play a crucial role in synaptic integration. GABAA Rs are not only present in the somatodendritic compartment, but also in the axonal compartment where they modulate action potential (AP) propagation and transmitter release. Although presynaptic GABAA Rs have been reported in various brain regions, their mechanisms of action and physiological roles remain obscure, particularly at GABAergic boutons. Here, using a combination of direct whole-bouton or perforated patch-clamp recordings and local GABA photolysis in single axonal varicosities of cerebellar Purkinje cells, we investigate the subcellular localization and functional role of axonal GABAA Rs both in primary cultures and acute slices. Our results indicate that presynaptic terminals of PCs carry GABAA Rs that behave as auto-receptors; their activation leads to a depolarization of the terminal membrane after an AP due to the relatively high cytoplasmic Cl(-) concentration in the axon, but do not modulate the AP itself. Paired recordings from different terminals of the same axon show that the GABAA R-mediated local depolarizations propagate substantially to neighboring varicosities. Finally, the depolarization mediated by presynaptic GABAA R activation augmented Ca(2+) influx and transmitter release, resulting in a marked effect on short-term plasticity. Altogether, our results reveal a mechanism by which presynaptic GABAA Rs influence neuronal computation. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  15. Silicon Photonics Transmitter with SOA and Semiconductor Mode-Locked Laser.

    Science.gov (United States)

    Moscoso-Mártir, Alvaro; Müller, Juliana; Hauck, Johannes; Chimot, Nicolas; Setter, Rony; Badihi, Avner; Rasmussen, Daniel E; Garreau, Alexandre; Nielsen, Mads; Islamova, Elmira; Romero-García, Sebastián; Shen, Bin; Sandomirsky, Anna; Rockman, Sylvie; Li, Chao; Sharif Azadeh, Saeed; Lo, Guo-Qiang; Mentovich, Elad; Merget, Florian; Lelarge, François; Witzens, Jeremy

    2017-10-24

    We experimentally investigate an optical link relying on silicon photonics transmitter and receiver components as well as a single section semiconductor mode-locked laser as a light source and a semiconductor optical amplifier for signal amplification. A transmitter based on a silicon photonics resonant ring modulator, an external single section mode-locked laser and an external semiconductor optical amplifier operated together with a standard receiver reliably supports 14 Gbps on-off keying signaling with a signal quality factor better than 7 for 8 consecutive comb lines, as well as 25 Gbps signaling with a signal quality factor better than 7 for one isolated comb line, both without forward error correction. Resonant ring modulators and Germanium waveguide photodetectors are further hybridly integrated with chip scale driver and receiver electronics, and their co-operability tested. These experiments will serve as the basis for assessing the feasibility of a silicon photonics wavelength division multiplexed link relying on a single section mode-locked laser as a multi-carrier light source.

  16. A scheme for a high-power, low-cost transmitter for deep space applications

    Science.gov (United States)

    Scheffer, L. K.

    2005-10-01

    Applications such as planetary radars and spacecraft communications require transmitters with extremely high effective isotropic radiated power. Until now, this has been done by combining a high-power microwave source with a large reflective antenna. However, this arrangement has a number of disadvantages. It is costly, since the steerable reflector alone is quite expensive, and for spacecraft communications, the need to transmit hurts the receive performance. For planetary radars, the utilization is very low since the antenna must be shared with other applications such as radio astronomy or spacecraft communications. This paper describes a potential new way of building such transmitters with lower cost, greater versatility, higher reliability, and potentially higher power. The basic idea is a phased array with a very large number of low-power elements, built with mass production techniques that have been optimized for consumer markets. The antennas are built en mass on printed circuit boards and are driven by chips, built with consumer complementary metal-oxide-semiconductor technology, that adjust the phase of each element. Assembly and maintenance should be comparatively inexpensive since the boards need only be attached to large, flat, unmoving, ground-level infrastructure. Applications to planetary radar and spacecraft communications are examined. Although we would be unlikely to use such a facility in this way, an implication for Search for Extraterrestrial Intelligence (SETI) is that high-power beacons are easier to build than had been thought.

  17. Determination of the solar transmittance for the translucent shutter with PCM in liquid and solid state

    Directory of Open Access Journals (Sweden)

    Komerska Anna

    2017-01-01

    Full Text Available This article presents results of the energy performance of an external translucent shading component integrated with a phase change material. A proposed technology is able to accumulate considerable amounts of energy in the latent heat by absorbing solar energy. Due to selective optical properties, much of the visible light is still transmitted through the facade. Experimental measurements were carried out in a laboratory set–up – testing thermal chamber, located in the Faculty of Building Services, Hydro and Environmental Engineering at Warsaw University of Technology. The main result of the experimental study was the evaluation of the average solar transmittance in the whole measured spectrum, as well as in the infrared and visible light. Since the shift in optical properties was observed when the material was undergoing a phase transition, the average spectral transmittances were measured for different states of matter of the PCM material. The tested shutter showed abilities to reduce and modulate daylight and solar heat gains in the indoor environment, which could contribute to considerable energy savings.

  18. Behavioral study and design of a digital interpolator filter for wireless reconfigurable transmitters

    Science.gov (United States)

    Ferragina, V.; Frassone, A.; Ghittori, N.; Malcovati, P.; Vigna, A.

    2005-06-01

    The behavioral analysis and the design in a 0.13 μm CMOS technology of a digital interpolator filter for wireless applications are presented. The proposed block is designed to be embedded in the baseband part of a reconfigurable transmitter (WLAN 802.11a, UMTS) to operate as a sampling frequency boost between the digital signal processor (DSP) and the digital-to-analog converter (DAC). In recent trends the DAC of such transmitters usually operates at high conversion frequencies (to allow a relaxed implementation of the following analog reconstruction filter), while the DSP output flows at low frequencies (typically Nyquist rate). Thus a block able to increase the digital data rate, like the one proposed, is needed before the DAC. For example, in the WLAN case, an interpolation factor of 4 has been used, allowing the digital data frequency to raise from 20 MHz to 80 MHz. Using a time-domain model of the TX chain, a behavioral analysis has been performed to determine the impact of the filter performance on the quality of the signal at the antenna. This study has led to the evaluation of the z-domain filter transfer function, together with the specifications concerning a finite precision implementation. A VHDL description has allowed an automatic synthesis of the circuit in a 0.13 μm CMOS technology (with a supply voltage of 1.2 V). Post-synthesis simulations have confirmed the effectiveness of the proposed study.

  19. Thermal transmittance of reed-insulated walls in a purpose-built test house

    Directory of Open Access Journals (Sweden)

    M. Miljan

    2014-03-01

    Full Text Available We studied the construction and thermal properties of walls insulated with reed, to enable comparisons with other wall structures that are widely used in building. In 2010 we built a test house insulated with reed adjacent to the Estonian University of Life Sciences in Tartu. The load-bearing structure of the house was a timber frame, and four different technologies were used to place reed insulation in its external walls. The thickness of the reed layer was 450 mm in all cases, and both sides (inside and outside of the walls were rendered with clay plaster. Records were kept of time spent and materials used in construction of the different types of walls, and these data were used to calculate unit (m-2 requirements of time and materials for each wall type to enable direct comparisons. From October 2010 to March 2012, heat flow plates were used to measure the thermal transmittance of the walls of the completed house and the results were compared with the thermal transmittance requirements set by Estonian legislation. Only one of the test walls met the Estonian standard. This was insulated with compressed loose reed, placed horizontally in the wall.

  20. INFLUENCE OF TRANSMITTER NONLINEARITIES ON DATA TRANSMISSION FROM REMOTELY PILOTED AIR SYSTEM

    Directory of Open Access Journals (Sweden)

    Andrii Grekhov

    2017-11-01

    Full Text Available Purpose: 1 to develop a model of a communication channel of an unmanned aerial vehicle "UAV-Ground station" with adaptive modulation and orthogonal frequency division of channels; 2 to calculate the channel parameters with different types of fading for different levels of satellite transponder nonlinearity. Method: MATLAB Simulink software was used to simulate the channel operation. Results: Based on the IEEE 802.16d standard, a realistic model of the communication channel of the unmanned aerial vehicle "UAV-Ground Station" was developed, which is used to estimate the channel parameters. The channel model with adaptive modulation consists of a source of information, a transmitter, a downlink channel with fading, and a terrestrial station receiver. Dependences of the signal-to-noise ratio of the terrestrial receiver on the signal-to-noise ratio in the channel down for different types of nonlinearity of the unmanned aerial transmitter, various modulations (BPSK, QPSK, 16QAM, 64QAM, various types of fading are obtained. The signal constellations of the received signals for different Doppler frequency shifts are compared. Conclusion: The developed model allows determining the conditions under which the channel is "open" for a given type of a modulation and a data rate. The proposed approach can be considered as a method for estimating the parameters of the satellite communication channel of an unmanned aerial vehicle with fading.

  1. [Research on the transmittance spectrum of wedge thin film filter with oblique incidence].

    Science.gov (United States)

    Yu, Kan; Huang, De-Xiu; Yin, Juan-Juan; Bao, Jia-Qi

    2013-08-01

    Angle-tuned thin film filter is widely used in the DWDM system for its broad tunable wavelength range and high rectangular degree. The transmissivity and the half bandwidth is greatly influenced not only by the incident angle, but also by the wedge angle of the non-paralleled thin film filter. In the present paper, the influences of the wedge angle on the transmissivity and the half bandwidth were detailedly analyzed. The proper wedge angle and the orientation can greatly improve the characteristics of the transmittance spectrum. The angle-tuned thin film filter with 0.8 degrees wedge angle was also fabricated. The experimental results show that keeping the wedge angle with the same orientation to the incident angle will worsen the transmissivity and the rectangular degree of the transmittance spectrum. However, keeping the wedge angle orientation reverse to the incident angle will greatly enhance the transmissivity and the rectangular degree of the filter and its tunable wavelength range will broaden by 10 nm.

  2. Three-dimensional mapping of light transmittance and foliage distribution using lidar

    Energy Technology Data Exchange (ETDEWEB)

    Todd, K.W.; Csillag, F. [Univ. of Toronto, Dept. of Geography and Inst. for Land Information Management, Mississauga, Ontario (Canada)]. E-mail: fcs@geog.utoronto.ca; Atkinson, P.M. [Univ. of Southhampton, School of Geography, Highfield, Southhampton (United Kingdom)

    2003-10-01

    The horizontal and vertical distributions of light transmittance were evaluated as a function of foliage distribution using lidar (light detection and ranging) observations for a sugar maple (Acer saccharum) stand in the Turkey Lakes Watershed. Along the vertical profile of vegetation, horizontal slices of probability of light transmittance were derived from an Optech ALTM 1225 instrument's return pulses (two discrete, 15-cm diameter returns) using indicator kriging. These predictions were compared with (i) below canopy (1-cm spatial resolution) transect measurements of the fraction of photosynthetically active radiation (FPAR) and (ii) measurements of tree height. A first-order trend was initially removed from the lidar returns. The vertical distribution of vegetation height was then sliced into nine percentiles and indicator variograms were fitted to them. Variogram parameters were found to vary as a function of foliage height above ground. In this paper, we show that the relationship between ground measurements of FPAR and kriged estimates of vegetation cover becomes stronger and tighter at coarser spatial resolutions. Three-dimensional maps of foliage distribution were computed as stacks of the percentile probability surfaces. These probability surfaces showed correspondence with individual tree-based observations and provided a much more detailed characterization of quasi-continuous foliage distribution. These results suggest that discrete-return lidar provides a promising technology to capture variations of foliage characteristics in forests to support the development of functional linkages between biophysical and ecological studies. (author)

  3. Determination of the solar transmittance for the translucent shutter with PCM in liquid and solid state

    Science.gov (United States)

    Komerska, Anna; Ksionek, Dariusz; Rosiński, Marian

    2017-11-01

    This article presents results of the energy performance of an external translucent shading component integrated with a phase change material. A proposed technology is able to accumulate considerable amounts of energy in the latent heat by absorbing solar energy. Due to selective optical properties, much of the visible light is still transmitted through the facade. Experimental measurements were carried out in a laboratory set-up - testing thermal chamber, located in the Faculty of Building Services, Hydro and Environmental Engineering at Warsaw University of Technology. The main result of the experimental study was the evaluation of the average solar transmittance in the whole measured spectrum, as well as in the infrared and visible light. Since the shift in optical properties was observed when the material was undergoing a phase transition, the average spectral transmittances were measured for different states of matter of the PCM material. The tested shutter showed abilities to reduce and modulate daylight and solar heat gains in the indoor environment, which could contribute to considerable energy savings.

  4. Adaptive Transmitter Precoding for Time Division Duplex CDMA in Fading Multipath Channels: Strategy and Analysis

    Directory of Open Access Journals (Sweden)

    Daryl Reynolds

    2003-01-01

    Full Text Available The recently developed blind adaptive techniques for multiuser detection in code division multiple access (CDMA systems offer an attractive compromise of performance and complexity. However, the desire to further reduce complexity at the mobile unit has led to the investigation of techniques that move signal processing from the mobile unit to the base station. In this paper, we investigate transmitter precoding for downlink time division duplex (TDD code division multiple access (CDMA communications. In particular, we develop a linear minimum mean square error precoding strategy using blind channel estimation for fading multipath channels that allows for simple matched filtering at the mobile unit and is easy to make adaptive. We also present a performance analysis using tools developed for the analysis of conventional (receiver-based linear blind multiuser detection in unknown channels. We compare the analytical and simulation results to traditional receiver-based blind multiuser detection. It is seen that transmitter precoding offers a reasonable alternative for TDD-mode CDMA when minimizing computational complexity at the mobile unit is a priority.

  5. Development of a full-waveform voltage and current recording device for multichannel transient electromagnetic transmitters

    Science.gov (United States)

    Zhang, Xinyue; Zhang, Qisheng; Wang, Meng; Kong, Qiang; Zhang, Shengquan; He, Ruihao; Liu, Shenghui; Li, Shuhan; Yuan, Zhenzhong

    2017-11-01

    Due to the pressing demand for metallic ore exploration technology in China, several new technologies are being employed in the relevant exploration instruments. In addition to possessing the high resolution of the traditional transient electromagnetic method, high-efficiency measurements, and a short measurement time, the multichannel transient electromagnetic method (MTEM) technology can also sensitively determine the characteristics of a low-resistivity geologic body, without being affected by the terrain. Besides, the MTEM technology also solves the critical, existing interference problem in electrical exploration technology. This study develops a full-waveform voltage and current recording device for MTEM transmitters. After continuous acquisition and storage of the large, pseudo-random current signals emitted by the MTEM transmitter, these signals are then convoluted with the signals collected by the receiver to obtain the earth's impulse response. In this paper, the overall design of the full-waveform recording apparatus, including the hardware and upper-computer software designs, the software interface display, and the results of field test, is discussed in detail.

  6. Improved theory for relativistic transmittance of circularly polarized laser pulses in non-ideal, realistic plasmas

    Science.gov (United States)

    Kang, Teyoun; Kim, Young-Kuk; Hur, Min Sup

    2016-10-01

    Owing to the rapid development of laser technologies, relativistically-induced transmittance (RT) of ultra-intense laser pulses in overdense plasmas is now a practically important matter. RT could give either deleterious or positive effects depending on the kinds of laser-plasma interactions. In radiation-pressure-acceleration (RPA), enhanced transmittance lowers the momentum transfer from the pulse to the ions. Meanwhile, in collisionless-electrostatic-shock, the acceleration efficiency can be increased owing to the effective heating of upstream electrons by transmitted laser fields. Previous theories mostly have handled RT in ideal plasmas, such as an infinitely long uniform plasma or a delta-function-like slab. In the actual applications, however, RT is generally combined with other dynamics, such as plasma density compression, leading to RT under a plasma in other cases. We developed one-dimensional RT theories for circularly polarized laser pulses, which would be used for such realistic plasma profiles. According to our theory, optimal thickness condition should be modified in RPA. Furthermore we developed our theory so that RT in the common two-step density plasma can be modeled. In this poster, we present the derivation and the comparison of the improved theory with PIC simulation results. This work was supported by the Basic Science Research Program (Grant Number NRF-2013R1A1A2006353).

  7. Radiofrequency Exposures of Workers on Low-Power FM Radio Transmitters.

    Science.gov (United States)

    Valic, Blaž; Kos, Bor; Gajšek, Peter

    2017-05-01

    Low-power radio transmitters are one of the most common radio frequency sources and the exposure limit values (ELVs) for occupational exposure may be exceeded close to them. Therefore, a detailed analysis and assessment of occupational exposure in their vicinity is presented in the paper. For 20 different exposure scenarios, electric field strength and specific absorption rate (SAR) values were computed to determine whether the action levels (ALs) and ELVs of the European directive 2013/35/EU are exceeded for different 500 W radio transmitters. The results show that the ALs are very conservative for such exposure situations. Even when the ALs are greatly exceeded, the SAR values are not necessarily above the limit. However, in some situations, the ELVs were also exceeded. The local 10 g averaged value of the SAR can be exceeded if the worker is grounded (in direct contact with the steel structure), while the whole body ELVs can be exceeded for exposures at distances of <1 m from the transmitting dipole array antennas. © The Author 2017. Published by Oxford University Press on behalf of the British Occupational Hygiene Society.

  8. Feasibility of long-distance heart rate monitoring using transmittance photoplethysmographic imaging (PPGI)

    Science.gov (United States)

    Amelard, Robert; Scharfenberger, Christian; Kazemzadeh, Farnoud; Pfisterer, Kaylen J.; Lin, Bill S.; Clausi, David A.; Wong, Alexander

    2015-10-01

    Photoplethysmography (PPG) devices are widely used for monitoring cardiovascular function. However, these devices require skin contact, which restricts their use to at-rest short-term monitoring. Photoplethysmographic imaging (PPGI) has been recently proposed as a non-contact monitoring alternative by measuring blood pulse signals across a spatial region of interest. Existing systems operate in reflectance mode, many of which are limited to short-distance monitoring and are prone to temporal changes in ambient illumination. This paper is the first study to investigate the feasibility of long-distance non-contact cardiovascular monitoring at the supermeter level using transmittance PPGI. For this purpose, a novel PPGI system was designed at the hardware and software level. Temporally coded illumination (TCI) is proposed for ambient correction, and a signal processing pipeline is proposed for PPGI signal extraction. Experimental results show that the processing steps yielded a substantially more pulsatile PPGI signal than the raw acquired signal, resulting in statistically significant increases in correlation to ground-truth PPG in both short- and long-distance monitoring. The results support the hypothesis that long-distance heart rate monitoring is feasible using transmittance PPGI, allowing for new possibilities of monitoring cardiovascular function in a non-contact manner.

  9. High Repetition Rate Pulsed 2-Micron Laser Transmitter for Coherent CO2 DIAL Measurement

    Science.gov (United States)

    Singh, Uprendra N.; Bai, Yingxin; Yu, Jirong; Petros, Mulugeta; Petzar, Paul J.; Trieu, Bo C.; Lee, Hyung

    2009-01-01

    A high repetition rate, highly efficient, Q-switched 2-micron laser system as the transmitter of a coherent differential absorption lidar for CO2 measurement has been developed at NASA Langley Research Center. Such a laser transmitter is a master-slave laser system. The master laser operates in a single frequency, either on-line or off-line of a selected CO2 absorption line. The slave laser is a Q-switched ring-cavity Ho:YLF laser which is pumped by a Tm:fiber laser. The repetition rate can be adjusted from a few hundred Hz to 10 kHz. The injection seeding success rate is from 99.4% to 99.95%. For 1 kHz operation, the output pulse energy is 5.5mJ with the pulse length of approximately 50 ns. The optical-to-optical efficiency is 39% when the pump power is 14.5W. The measured standard deviation of the laser frequency jitter is about 3 MHz.

  10. Design of programmable logic controller auto power reset circuit for FM transmitter

    Directory of Open Access Journals (Sweden)

    Adisak Pattanajakr

    2016-06-01

    Full Text Available The mono-stereo controller using audio mute clock is used at the International Broadcasting Bureau (IBB FM 106.6 MHz transmitter in Ulaan Baatar, Mongolia since 2010. The major problem of the FM broadcast station was from the frozen Programmable Logic Controller, PLC, which must be manually reset and the report by the VOA listeners. Then, the PLC auto power reset circuit is proposed and built in mono-stereo controller to monitor the operation of the PLC. The circuit is also used to restart the PLC whenever, it is frozen. The cloud router and Transmission Control Protocol/Internet Protocol (TCP/IP to Recommended Standard number 232 (RS-232 converter are used to synchronize the PLC time. From the results, this circuit can improve the transmitter availability and quality of the 24 hours/day broadcast program without affection to the listeners. The reliability of the cloud router is acceptable with low delay of data transfer via the internet connection between Thailand to Mongolia. The cloud router which the IBB leases cloud service from the provider that offers high speed internet up to 1000 Mb/s, via the remote terminal is used for the schedule program and the time synchronization of the PLC correctly. The proposed system is very stable and there is no problem of the frozen PLC whether it connects to the internet or not. Hence, the designed PLC auto power reset circuit can be used to eliminate the frozen PLC problem.

  11. Design of CMOS RFIC ultra-wideband impulse transmitters and receivers

    CERN Document Server

    Nguyen, Cam

    2017-01-01

    This book presents the design of ultra-wideband (UWB) impulse-based transmitter and receiver frontends, operating within the 3.1-10.6 GHz frequency band, using CMOS radio-frequency integrated-circuits (RFICs). CMOS RFICs are small, cheap, low power devices, better suited for direct integration with digital ICs as compared to those using III-V compound semiconductor devices. CMOS RFICs are thus very attractive for RF systems and, in fact, the principal choice for commercial wireless markets.  The book comprises seven chapters. The first chapter gives an introduction to UWB technology and outlines its suitability for high resolution sensing and high-rate, short-range ad-hoc networking and communications. The second chapter provides the basics of CMOS RFICs needed for the design of the UWB RFIC transmitter and receiver presented in this book. It includes the design fundamentals, lumped and distributed elements for RFIC, layout, post-layout simulation, and measurement. The third chapter discusses the basics of U...

  12. Output Choice of a Chaotic Jerk Circuit Used as Transmitter in Data Secure Communications

    Directory of Open Access Journals (Sweden)

    DATCU, O.

    2015-11-01

    Full Text Available Usually, when analyzing a data series, dynamical systems theory is used to reconstruct the state space of the original system. This work aims to determine which of a chaotic system's states is best suited as output when transmitting secret messages. This is the first step prior to designing an actual communication scheme. As an example, the three states of Sprott's jerk circuit are analyzed in terms of the local observability they ensure for the original dynamics when transmitted as a scalar data series. Results show that its first two states enable accurate estimation of the transmitter's dynamics at the receiving end. However, its third state generates, in some regions of the state space, a non-invertible transformation between the original state space and the one the receiver sees. This is due to the exponential nonlinearities present in this state's derivatives. Given that these nonlinearities remain inaccessible to the receiver, they are neglected in order to allow the partial reconstruction of the dynamics of the transmitter. But, since these nonlinearities are essential for the chaotic behavior, this makes the third state unusable for cryptographic purposes. This analysis may be applied to any bipolar junction transistor or diode based chaotic circuit.

  13. Inflammatory reaction to fabric collars from percutaneous antennas attached to intracoelomic radio transmitters implanted in harlequin ducks (Histrionicus histrionicus)

    Science.gov (United States)

    Mulcahy, Daniel M.; Burek, K.A.; Esler, Daniel

    2007-01-01

    In wild birds implanted intracoelomically with radio transmitters, a synthetic fabric collar placed around the base of a percutaneous antenna is believed to function as a barrier to contamination of the coelom. We examined 13 fabric collars recovered from percutaneous antennas of radio transmitters implanted intracoelomically in harlequin ducks (Histrionicus histrionicus) 12 months earlier. Both the transmitters and antenna collars were encapsulated in fibrous connective tissue, with adhesions to internal organs. Histologically, bacteria were evident at the fabric-plastic interface in 8 of 10 collars examined in cross section and along the length of the collar in 3 collars examined longitudinally. Bacteria were confined within the fibrotic sheath surrounding the transmitter and the antenna collar in all birds. No evidence of chronic systemic effects secondary to implantation was present on hematologic or serum biochemical testing. These findings indicate that antenna collars do not prevent the entry of bacteria along the percutaneous antenna but may help stabilize the antenna and minimize coelomic contamination. We conclude that radio transmitters implanted into the coelom of harlequin ducks do not appear to cause significant health problems for at least 1 year after implantation.

  14. Long-range measurement system using ultrasonic range sensor with high-power transmitter array in air.

    Science.gov (United States)

    Kumar, Sahdev; Furuhashi, Hideo

    2017-02-01

    A long-range measurement system comprising an ultrasonic range sensor with a high-power ultrasonic transmitter array in air was investigated. The system is simple in construction and can be used under adverse conditions such as fog, rain, darkness, and smoke. However, due to ultrasonic waves are well absorbed by air molecules, the measurable range is limited to a few meters. Therefore, we developed a high-power ultrasonic transmitter array consisting of 144 transmitting elements. All elements are arranged in the form of a 12×12 array pattern. The sound pressure level at 5m from the transmitter array was >30dB higher than that of a single element. A measuring range of over 25m was achieved using this transmitter array in conjunction with a receiver array having 32 receiving elements. The characteristics of the transmitter array and range sensor system are discussed by comparing simulation and experimental results. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Influence of Incision Location on Transmitter Loss, Healing, Incision Lengths, Suture Retention, and Growth of Juvenile Chinook Salmon

    Energy Technology Data Exchange (ETDEWEB)

    Panther, Jennifer L.; Brown, Richard S.; Gaulke, Greggory L.; Woodley, Christa M.; Deters, Katherine A.

    2010-05-11

    In this study, conducted by Pacific Northwest National Laboratory for the U.S. Army Corps of Engineers, Portland District, we measured differences in survival and growth, incision openness, transmitter loss, wound healing, and erythema among abdominal incisions on the linea alba, lateral and parallel to the linea alba (muscle-cutting), and following the underlying muscle fibers (muscle-sparing). A total of 936 juvenile Chinook salmon were implanted with both Juvenile Salmon Acoustic Tracking System transmitters (0.43 g dry) and passive integrated transponder tags. Fish were held at 12°C (n = 468) or 20°C (n = 468) and examined once weekly over 98 days. We found survival and growth did not differ among incision groups or between temperature treatment groups. Incisions on the linea alba had less openness than muscle-cutting and muscle-sparing incisions during the first 14 days when fish were held at 12°C or 20°C. Transmitter loss was not different among incision locations by day 28 when fish were held at 12°C or 20°C. However, incisions on the linea alba had greater transmitter loss than muscle-cutting and muscle-sparing incisions by day 98 at 12°C. Results for wound closure and erythema differed among temperature groups. Results from our study will be used to improve fish-tagging procedures for future studies using acoustic or radio transmitters.

  16. Bit- and Power-Loading—A Comparative Study on Maximizing the Capacity of RSOA Based Colorless DMT Transmitters

    Directory of Open Access Journals (Sweden)

    Simon Arega Gebrewold

    2017-09-01

    Full Text Available We present a comparative study of the capacity increase brought by bit- and power-loading discrete multi-tone (DMT modulation for low-cost colorless transmitters. Three interesting reflective semiconductor optical amplifier (RSOA based colorless transmitter configurations are compared: First, an amplified spontaneous emission (ASE spectrum-sliced source; second, a self-seeded RSOA fiber cavity laser (FCL and third, an externally seeded RSOA. With bit- and power-loaded DMT, we report record high line rates of 6.25, 20.1 and 30.7 Gbit/s and line rates of 4.17, 10.1 and 24.5 Gbit/s in a back-to-back and in a 25 km nonzero dispersion shifted fiber (NZDSF transmission experiments for the three transmitter configurations, respectively. In all the experiments, BER (bit error ratios below an FEC (forward error correction limit of 7.5 × 10−3 were achieved.

  17. A spectral method for retrieving cloud optical thickness and effective radius from surface-based transmittance measurements

    Directory of Open Access Journals (Sweden)

    P. J. McBride

    2011-07-01

    Full Text Available We introduce a new spectral method for the retrieval of optical thickness and effective radius from cloud transmittance that relies on the spectral slope of the normalized transmittance between 1565 nm and 1634 nm, and on cloud transmittance at a visible wavelength. The standard dual-wavelength technique, which is traditionally used in reflectance-based retrievals, is ill-suited for transmittance because it lacks sensitivity to effective radius, especially for optically thin clouds. Using the spectral slope rather than the transmittance itself enhances the sensitivity of transmittance observations with respect to the effective radius. This is demonstrated by applying it to the moderate spectral resolution observations from the Solar Spectral Flux Radiometer (SSFR and Shortwave Spectroradiometer (SWS, and by examining the retrieval uncertainties of the standard and the spectral method for data from the DOE ARM Southern Great Plains (SGP site and a NOAA ship cruise (ICEALOT. The liquid water path (LWP is derived from the retrieved optical thickness and effective radius, based on two different assumptions about the cloud vertical profile, and compared to the simultaneous observations from a microwave radiometer. Optical thickness and effective radius is also compared to MODIS retrievals. In general, the effective radius uncertainties were much larger for the standard retrieval than for the spectral retrieval, particularly for thin clouds. When defining 2 μm as upper limit for the tolerable uncertainty of the effective radius, the standard method returned only very few valid retrievals for clouds with an optical thickness below 25. For the analyzed ICEALOT data (mean optical thickness 23, the spectral method provided valid retrievals for 84 % of the data (24 % for the standard method. For the SGP data (mean optical thickness 44, both methods provided a high return of 90 % for the spectral method and 78 % for the standard method.

  18. Gigascale Silicon Photonic Transmitters Integrating HBT-based Carrier-injection Electroabsorption Modulator Structures

    Science.gov (United States)

    Fu, Enjin

    Demand for more bandwidth is rapidly increasing, which is driven by data intensive applications such as high-definition (HD) video streaming, cloud storage, and terascale computing applications. Next-generation high-performance computing systems require power efficient chip-to-chip and intra-chip interconnect yielding densities on the order of 1Tbps/cm2. The performance requirements of such system are the driving force behind the development of silicon integrated optical interconnect, providing a cost-effective solution for fully integrated optical interconnect systems on a single substrate. Compared to conventional electrical interconnect, optical interconnects have several advantages, including frequency independent insertion loss resulting in ultra wide bandwidth and link latency reduction. For high-speed optical transmitter modules, the optical modulator is a key component of the optical I/O channel. This thesis presents a silicon integrated optical transmitter module design based on a novel silicon HBT-based carrier injection electroabsorption modulator (EAM), which has the merits of wide optical bandwidth, high speed, low power, low drive voltage, small footprint, and high modulation efficiency. The structure, mechanism, and fabrication of the modulator structure will be discussed which is followed by the electrical modeling of the post-processed modulator device. The design and realization of a 10Gbps monolithic optical transmitter module integrating the driver circuit architecture and the HBT-based EAM device in a 130nm BiCMOS process is discussed. For high power efficiency, a 6Gbps ultra-low power driver IC implemented in a 130nm BiCMOS process is presented. The driver IC incorporates an integrated 27-1 pseudo-random bit sequence (PRBS) generator for reliable high-speed testing, and a driver circuit featuring digitally-tuned pre-emphasis signal strength. With outstanding drive capability, the driver module can be applied to a wide range of carrier

  19. The 120Gbps VCSEL Array Based Optical Transmitter (ATx) development for the High-Luminosity LHC (HL-LHC) experiments

    Science.gov (United States)

    Guo, D.; Liu, C.; Chen, J.; Chramowicz, J.; Deng, B.; Gong, D.; Hou, S.; Jin, G.; Kwan, S.; Liang, F.; Li, X.; Liu, G.; Liu, T.; Prosser, A.; Su, D.-S.; Teng, P.-K.; Xu, T.; Ye, J.; Zhao, X.; Xiang, A. C.; Liang, H.

    2014-02-01

    The integration of a Verticle Cavity Surface-Emitting Laser (VCSEL) array and a driving Application-Specific Integrated Circuit (ASIC) in a custom optical array transmitter module (ATx) for operation in the detector front-end is constructed, assembled and tested. The ATx provides 12 parallel channels with each channel operating at 10 Gbps. The optical transmitter eye diagram passes the eye mask and the bit-error rate (BER) less than 10-12 transmission is achieved at 10 Gbps/ch. The overall insertion loss including the radiation induced attenuation is sufficiently low to meet the proposed link budget requirement.

  20. Calculations of atmospheric transmittance in the 11 micrometer window for estimating skin temperature from VISSR infrared brightness temperatures

    Science.gov (United States)

    Chesters, D.

    1984-01-01

    An algorithm for calculating the atmospheric transmittance in the 10 to 20 micro m spectral band from a known temperature and dewpoint profile, and then using this transmittance to estimate the surface (skin) temperature from a VISSR observation in the 11 micro m window is presented. Parameterizations are drawn from the literature for computing the molecular absorption due to the water vapor continuum, water vapor lines, and carbon dioxide lines. The FORTRAN code is documented for this application, and the sensitivity of the derived skin temperature to variations in the model's parameters is calculated. The VISSR calibration uncertainties are identified as the largest potential source of error.